F489950
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1095 | 393 | 1076 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10010368|Ga0070658_100103689 |
| Length | 243 |
| Sequence | VAKSFTVKQIYEIFPTKLVGCCTFAEIFKLKFTIMSLQLGDAAPDFTAETTIGKINLYEFLGDSWGVLFSHPADFTPVCTTELGRTAQLQKEFEKRDVKVLAVSVDPLDKHHSWTKDINETQNCTVEFPLIADEDKTVANLYGMLHPNASATATVRSLFIIGPDKKIKLIILYPASTGRNFNEVLRVIDSLQLTANQGLTTPADWVLGDDLIVSPSISTEDAIKKFPKGVKVVKPYLRYTPQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 4 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 5 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 6 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 7 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 8 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 9 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 10 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 11 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 12 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 13 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 14 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 15 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 16 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 17 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 18 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 19 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 20 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 21 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 22 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 25 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 26 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 27 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 28 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 29 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 32 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 33 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 38 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 95 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 96 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 206 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 208 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 209 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 210 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 211 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 214 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 215 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 216 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 217 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 218 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 226 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 227 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 230 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 231 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 232 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 233 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 234 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 235 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 237 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 238 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 239 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 240 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 241 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 242 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 243 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 244 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 245 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 246 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 247 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 248 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 249 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 250 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 251 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 252 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 253 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 254 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 255 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 256 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 257 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 258 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 259 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 260 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 261 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 262 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 263 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 299 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 302 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 307 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 308 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 327 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 328 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 329 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 330 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 331 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 332 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 334 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 335 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 336 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 337 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 338 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 339 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 340 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 341 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 342 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 343 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 344 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 345 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 346 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 347 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 348 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 350 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 351 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 352 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 355 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 356 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 361 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 362 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 363 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 364 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 365 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 366 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 367 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 368 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 369 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 370 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 371 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 372 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 373 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 374 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 375 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 377 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 378 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 379 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 380 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 381 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 382 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 383 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 385 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.89 |
| Metatranscriptomes | 3.38 |
| Isolates | 1.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.3 |
| Nodule | 0 |
| Rhizoplane | 1 |
| Rhizosphere | 88.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1762462 | 2162886007 | Bacteria | 256265 |
| 2 | JGI24740J21852_10003348 | 3300001979 | Bacteria | 7062 |
| 3 | JGI25154J39366_1000120 | 3300002738 | Bacteria | 63261 |
| 4 | JGI25154J39366_1012097 | 3300002738 | Bacteria | 964 |
| 5 | Ga0006759J45824_1076550 | 3300003163 | Bacteria | 699 |
| 6 | Ga0006758J48902_1015743 | 3300003300 | Bacteria | 692 |
| 7 | rootH1_10023748 | 3300003316 | Bacteria | 1337 |
| 8 | rootH1_10058428 | 3300003316 | Bacteria | 1537 |
| 9 | rootH2_10019577 | 3300003320 | Bacteria | 23076 |
| 10 | rootH2_10158917 | 3300003320 | Bacteria | 10317 |
| 11 | rootH2_10206522 | 3300003320 | Bacteria | 2947 |
| 12 | rootH2_10220086 | 3300003320 | Bacteria | 1834 |
| 13 | rootH2_10318247 | 3300003320 | Unclassified | 1267 |
| 14 | rootL2_10172417 | 3300003322 | Bacteria | 3438 |
| 15 | rootH1_10065386 | 3300003323 | Bacteria | 6032 |
| 16 | rootH1_10116971 | 3300003323 | Bacteria | 1465 |
| 17 | rootH1_10134083 | 3300003323 | Bacteria | 5871 |
| 18 | rootH1_10165589 | 3300003323 | Bacteria | 1726 |
| 19 | rootH1_10257422 | 3300003323 | Bacteria | 2319 |
| 20 | rootH1_10260058 | 3300003323 | Bacteria | 1304 |
| 21 | JGI25160J50197_1000701 | 3300003354 | Bacteria | 18447 |
| 22 | Ga0055526_1046463 | 3300003771 | Bacteria | 1028 |
| 23 | Ga0055528_1023293 | 3300003790 | Bacteria | 1895 |
| 24 | Ga0058863_11748294 | 3300004799 | Unclassified | 689 |
| 25 | Ga0058863_11905271 | 3300004799 | Bacteria | 816 |
| 26 | Ga0058861_11695319 | 3300004800 | Bacteria | 761 |
| 27 | Ga0058862_12529024 | 3300004803 | Bacteria | 754 |
| 28 | Ga0058862_12773387 | 3300004803 | Bacteria | 928 |
| 29 | Ga0065165_1000436 | 3300005262 | Bacteria | 65530 |
| 30 | Ga0065165_1010871 | 3300005262 | Bacteria | 3875 |
| 31 | Ga0065165_1027698 | 3300005262 | Bacteria | 1841 |
| 32 | Ga0065714_10264965 | 3300005288 | Bacteria | 749 |
| 33 | Ga0065704_10147972 | 3300005289 | Bacteria | 1454 |
| 34 | Ga0065712_10000661 | 3300005290 | Bacteria | 11127 |
| 35 | Ga0065712_10112451 | 3300005290 | Bacteria | 1800 |
| 36 | Ga0065712_10196712 | 3300005290 | Bacteria | 1125 |
| 37 | Ga0065707_10127771 | 3300005295 | Bacteria | 1974 |
| 38 | Ga0065707_10183691 | 3300005295 | Unclassified | 1402 |
| 39 | Ga0070658_10010368 | 3300005327 | Bacteria | 7475 |
| 40 | Ga0070658_10029344 | 3300005327 | Bacteria | 4418 |
| 41 | Ga0070658_10040039 | 3300005327 | Bacteria | 3781 |
| 42 | Ga0070658_10093407 | 3300005327 | Bacteria | 2481 |
| 43 | Ga0070658_10141091 | 3300005327 | Bacteria | 2013 |
| 44 | Ga0070658_10170037 | 3300005327 | Bacteria | 1831 |
| 45 | Ga0070658_10635909 | 3300005327 | Bacteria | 926 |
| 46 | Ga0070676_10007488 | 3300005328 | Bacteria | 5861 |
| 47 | Ga0070676_10007533 | 3300005328 | Bacteria | 5847 |
| 48 | Ga0070676_10012382 | 3300005328 | Bacteria | 4653 |
| 49 | Ga0070676_10072342 | 3300005328 | Unclassified | 2072 |
| 50 | Ga0070676_10536328 | 3300005328 | Bacteria | 836 |
| 51 | Ga0070683_100048151 | 3300005329 | Bacteria | 3941 |
| 52 | Ga0070683_100049320 | 3300005329 | Bacteria | 3894 |
| 53 | Ga0070683_100080317 | 3300005329 | Bacteria | 3053 |
| 54 | Ga0070683_100221886 | 3300005329 | Bacteria | 1797 |
| 55 | Ga0070683_100268473 | 3300005329 | Unclassified | 1623 |
| 56 | Ga0070683_100329379 | 3300005329 | Bacteria | 1454 |
| 57 | Ga0070683_100547939 | 3300005329 | Bacteria | 1106 |
| 58 | Ga0070683_100693185 | 3300005329 | Bacteria | 975 |
| 59 | Ga0070670_100021730 | 3300005331 | Bacteria | 5519 |
| 60 | Ga0070670_100026081 | 3300005331 | Bacteria | 5030 |
| 61 | Ga0070670_100048082 | 3300005331 | Bacteria | 3671 |
| 62 | Ga0070670_100062454 | 3300005331 | Bacteria | 3198 |
| 63 | Ga0070670_100133415 | 3300005331 | Bacteria | 2145 |
| 64 | Ga0070670_100230943 | 3300005331 | Bacteria | 1610 |
| 65 | Ga0070670_100242729 | 3300005331 | Bacteria | 1568 |
| 66 | Ga0070670_100632532 | 3300005331 | Bacteria | 959 |
| 67 | Ga0070670_100785560 | 3300005331 | Bacteria | 859 |
| 68 | Ga0070677_10049688 | 3300005333 | Bacteria | 1690 |
| 69 | Ga0068869_100001213 | 3300005334 | Bacteria | 15157 |
| 70 | Ga0068869_100008940 | 3300005334 | Bacteria | 6483 |
| 71 | Ga0068869_100027216 | 3300005334 | Bacteria | 3984 |
| 72 | Ga0068869_100059511 | 3300005334 | Bacteria | 2797 |
| 73 | Ga0068869_100119531 | 3300005334 | Bacteria | 2014 |
| 74 | Ga0068869_100161236 | 3300005334 | Unclassified | 1746 |
| 75 | Ga0070666_10000038 | 3300005335 | Bacteria | 115799 |
| 76 | Ga0070666_10035539 | 3300005335 | Bacteria | 3305 |
| 77 | Ga0070680_100029132 | 3300005336 | Bacteria | 4434 |
| 78 | Ga0070680_100033145 | 3300005336 | Bacteria | 4161 |
| 79 | Ga0070680_100092951 | 3300005336 | Unclassified | 2498 |
| 80 | Ga0070680_100096590 | 3300005336 | Bacteria | 2450 |
| 81 | Ga0070680_100332018 | 3300005336 | Unclassified | 1291 |
| 82 | Ga0070682_100000462 | 3300005337 | Bacteria | 25664 |
| 83 | Ga0070682_100051348 | 3300005337 | Bacteria | 2577 |
| 84 | Ga0070682_100327279 | 3300005337 | Unclassified | 1134 |
| 85 | Ga0068868_100002430 | 3300005338 | Bacteria | 12901 |
| 86 | Ga0068868_100031755 | 3300005338 | Bacteria | 4060 |
| 87 | Ga0068868_100044102 | 3300005338 | Bacteria | 3486 |
| 88 | Ga0068868_100185404 | 3300005338 | Bacteria | 1728 |
| 89 | Ga0068868_100192973 | 3300005338 | Bacteria | 1694 |
| 90 | Ga0068868_100265052 | 3300005338 | Bacteria | 1450 |
| 91 | Ga0068868_100374083 | 3300005338 | Bacteria | 1224 |
| 92 | Ga0068868_100409264 | 3300005338 | Bacteria | 1172 |
| 93 | Ga0068868_100624617 | 3300005338 | Bacteria | 957 |
| 94 | Ga0068868_100769593 | 3300005338 | Bacteria | 866 |
| 95 | Ga0070660_100049041 | 3300005339 | Bacteria | 3245 |
| 96 | Ga0070660_100617242 | 3300005339 | Bacteria | 907 |
| 97 | Ga0070660_100701463 | 3300005339 | Bacteria | 849 |
| 98 | Ga0070660_101114491 | 3300005339 | Bacteria | 668 |
| 99 | Ga0070689_100008276 | 3300005340 | Bacteria | 7318 |
| 100 | Ga0070689_100015958 | 3300005340 | Bacteria | 5490 |
| 101 | Ga0070689_100106396 | 3300005340 | Bacteria | 2225 |
| 102 | Ga0070689_100261644 | 3300005340 | Bacteria | 1430 |
| 103 | Ga0070691_10029945 | 3300005341 | Bacteria | 2548 |
| 104 | Ga0070687_100390997 | 3300005343 | Bacteria | 909 |
| 105 | Ga0070687_100443596 | 3300005343 | Bacteria | 861 |
| 106 | Ga0070668_100002232 | 3300005347 | Bacteria | 14240 |
| 107 | Ga0070668_100007815 | 3300005347 | Bacteria | 7941 |
| 108 | Ga0070668_100025917 | 3300005347 | Unclassified | 4446 |
| 109 | Ga0070668_100034818 | 3300005347 | Bacteria | 3838 |
| 110 | Ga0070668_100083647 | 3300005347 | Bacteria | 2505 |
| 111 | Ga0070668_100509255 | 3300005347 | Bacteria | 1043 |
| 112 | Ga0070669_100007640 | 3300005353 | Bacteria | 7728 |
| 113 | Ga0070669_100081326 | 3300005353 | Bacteria | 2413 |
| 114 | Ga0070669_100137440 | 3300005353 | Unclassified | 1881 |
| 115 | Ga0070675_100004112 | 3300005354 | Bacteria | 11049 |
| 116 | Ga0070675_100124675 | 3300005354 | Bacteria | 2191 |
| 117 | Ga0070675_100164429 | 3300005354 | Bacteria | 1910 |
| 118 | Ga0070675_100197256 | 3300005354 | Bacteria | 1746 |
| 119 | Ga0070675_100293294 | 3300005354 | Bacteria | 1432 |
| 120 | Ga0070671_100232720 | 3300005355 | Bacteria | 1564 |
| 121 | Ga0070674_100004279 | 3300005356 | Bacteria | 8121 |
| 122 | Ga0070674_100197328 | 3300005356 | Unclassified | 1552 |
| 123 | Ga0070673_100078528 | 3300005364 | Bacteria | 2670 |
| 124 | Ga0070673_100084595 | 3300005364 | Bacteria | 2580 |
| 125 | Ga0070673_100110964 | 3300005364 | Bacteria | 2274 |
| 126 | Ga0070673_100136004 | 3300005364 | Bacteria | 2068 |
| 127 | Ga0070688_100001613 | 3300005365 | Bacteria | 11291 |
| 128 | Ga0070688_100022499 | 3300005365 | Bacteria | 3695 |
| 129 | Ga0070688_100221604 | 3300005365 | Bacteria | 1333 |
| 130 | Ga0070659_100064593 | 3300005366 | Bacteria | 2897 |
| 131 | Ga0070659_100078815 | 3300005366 | Bacteria | 2629 |
| 132 | Ga0070659_100084648 | 3300005366 | Bacteria | 2536 |
| 133 | Ga0070667_100017912 | 3300005367 | Bacteria | 5871 |
| 134 | Ga0070667_100019084 | 3300005367 | Bacteria | 5686 |
| 135 | Ga0070667_100132615 | 3300005367 | Bacteria | 2175 |
| 136 | Ga0070667_100186935 | 3300005367 | Bacteria | 1834 |
| 137 | Ga0070667_100269813 | 3300005367 | Bacteria | 1525 |
| 138 | Ga0070667_100752589 | 3300005367 | Bacteria | 903 |
| 139 | Ga0070667_100934864 | 3300005367 | Bacteria | 808 |
| 140 | Ga0070714_100588286 | 3300005435 | Unclassified | 1068 |
| 141 | Ga0070713_100206609 | 3300005436 | Bacteria | 1776 |
| 142 | Ga0070700_100082410 | 3300005441 | Bacteria | 2080 |
| 143 | Ga0070700_100957526 | 3300005441 | Unclassified | 701 |
| 144 | Ga0070663_100187307 | 3300005455 | Bacteria | 1609 |
| 145 | Ga0070663_100222760 | 3300005455 | Bacteria | 1481 |
| 146 | Ga0070678_100237308 | 3300005456 | Bacteria | 1523 |
| 147 | Ga0070678_100599208 | 3300005456 | Bacteria | 983 |
| 148 | Ga0070678_101079450 | 3300005456 | Unclassified | 741 |
| 149 | Ga0070662_100581128 | 3300005457 | Bacteria | 941 |
| 150 | Ga0070681_10009082 | 3300005458 | Bacteria | 9771 |
| 151 | Ga0070681_10015101 | 3300005458 | Bacteria | 7681 |
| 152 | Ga0070681_10121009 | 3300005458 | Bacteria | 2552 |
| 153 | Ga0070681_10234554 | 3300005458 | Bacteria | 1749 |
| 154 | Ga0070681_10586944 | 3300005458 | Bacteria | 1028 |
| 155 | Ga0070681_10822982 | 3300005458 | Bacteria | 846 |
| 156 | Ga0068867_100011969 | 3300005459 | Bacteria | 6128 |
| 157 | Ga0068867_100017092 | 3300005459 | Bacteria | 5153 |
| 158 | Ga0068867_100070399 | 3300005459 | Bacteria | 2615 |
| 159 | Ga0068867_100076890 | 3300005459 | Bacteria | 2507 |
| 160 | Ga0068867_100313416 | 3300005459 | Bacteria | 1297 |
| 161 | Ga0068867_100598630 | 3300005459 | Bacteria | 961 |
| 162 | Ga0070685_10008312 | 3300005466 | Bacteria | 5327 |
| 163 | Ga0070698_100169759 | 3300005471 | Bacteria | 2123 |
| 164 | Ga0070679_100001442 | 3300005530 | Bacteria | 21032 |
| 165 | Ga0070679_100004485 | 3300005530 | Bacteria | 12895 |
| 166 | Ga0070679_100072510 | 3300005530 | Bacteria | 3435 |
| 167 | Ga0070679_100339490 | 3300005530 | Bacteria | 1450 |
| 168 | Ga0070684_100004834 | 3300005535 | Bacteria | 10293 |
| 169 | Ga0070684_100024212 | 3300005535 | Bacteria | 5090 |
| 170 | Ga0070684_100152960 | 3300005535 | Bacteria | 2091 |
| 171 | Ga0070684_100229730 | 3300005535 | Bacteria | 1694 |
| 172 | Ga0070684_100312971 | 3300005535 | Bacteria | 1442 |
| 173 | Ga0070684_100537503 | 3300005535 | Bacteria | 1084 |
| 174 | Ga0070697_100893625 | 3300005536 | Bacteria | 788 |
| 175 | Ga0068853_100001974 | 3300005539 | Bacteria | 15118 |
| 176 | Ga0068853_100005501 | 3300005539 | Bacteria | 9930 |
| 177 | Ga0068853_100069345 | 3300005539 | Bacteria | 3067 |
| 178 | Ga0068853_100336038 | 3300005539 | Bacteria | 1403 |
| 179 | Ga0068853_100373846 | 3300005539 | Bacteria | 1330 |
| 180 | Ga0068853_100375034 | 3300005539 | Bacteria | 1328 |
| 181 | Ga0068853_100425978 | 3300005539 | Bacteria | 1245 |
| 182 | Ga0070672_100004965 | 3300005543 | Bacteria | 8758 |
| 183 | Ga0070672_100070167 | 3300005543 | Bacteria | 2784 |
| 184 | Ga0070672_100075356 | 3300005543 | Unclassified | 2693 |
| 185 | Ga0070672_100577432 | 3300005543 | Unclassified | 978 |
| 186 | Ga0070672_100724560 | 3300005543 | Unclassified | 872 |
| 187 | Ga0070693_100007859 | 3300005547 | Bacteria | 5230 |
| 188 | Ga0070665_100001841 | 3300005548 | Bacteria | 24099 |
| 189 | Ga0070665_100023645 | 3300005548 | Bacteria | 6186 |
| 190 | Ga0070665_100413701 | 3300005548 | Bacteria | 1357 |
| 191 | Ga0068855_100001137 | 3300005563 | Bacteria | 32980 |
| 192 | Ga0068855_100008055 | 3300005563 | Bacteria | 12733 |
| 193 | Ga0068855_100080085 | 3300005563 | Bacteria | 3787 |
| 194 | Ga0068855_100097149 | 3300005563 | Unclassified | 3393 |
| 195 | Ga0068855_100232262 | 3300005563 | Bacteria | 2065 |
| 196 | Ga0068855_100363654 | 3300005563 | Bacteria | 1592 |
| 197 | Ga0068855_100382828 | 3300005563 | Bacteria | 1544 |
| 198 | Ga0068855_100394834 | 3300005563 | Bacteria | 1517 |
| 199 | Ga0070664_100006818 | 3300005564 | Bacteria | 9212 |
| 200 | Ga0070664_100044832 | 3300005564 | Bacteria | 3734 |
| 201 | Ga0070664_100048180 | 3300005564 | Bacteria | 3601 |
| 202 | Ga0070664_100177625 | 3300005564 | Bacteria | 1891 |
| 203 | Ga0070664_100667150 | 3300005564 | Unclassified | 967 |
| 204 | Ga0070664_100690732 | 3300005564 | Bacteria | 950 |
| 205 | Ga0068857_100035941 | 3300005577 | Bacteria | 4389 |
| 206 | Ga0068857_100104574 | 3300005577 | Bacteria | 2542 |
| 207 | Ga0068857_100140462 | 3300005577 | Bacteria | 2183 |
| 208 | Ga0068857_100243862 | 3300005577 | Bacteria | 1646 |
| 209 | Ga0068857_100246023 | 3300005577 | Bacteria | 1638 |
| 210 | Ga0068857_100348961 | 3300005577 | Bacteria | 1370 |
| 211 | Ga0068857_100364550 | 3300005577 | Unclassified | 1340 |
| 212 | Ga0068857_100461469 | 3300005577 | Bacteria | 1189 |
| 213 | Ga0068857_100613648 | 3300005577 | Bacteria | 1029 |
| 214 | Ga0068857_100980941 | 3300005577 | Bacteria | 813 |
| 215 | Ga0068854_100124333 | 3300005578 | Bacteria | 1963 |
| 216 | Ga0068854_100369306 | 3300005578 | Bacteria | 1179 |
| 217 | Ga0068856_100009166 | 3300005614 | Bacteria | 9621 |
| 218 | Ga0068856_100136052 | 3300005614 | Unclassified | 2462 |
| 219 | Ga0068856_100137317 | 3300005614 | Unclassified | 2451 |
| 220 | Ga0068852_100001659 | 3300005616 | Bacteria | 15178 |
| 221 | Ga0068852_100006054 | 3300005616 | Bacteria | 8715 |
| 222 | Ga0068852_100010785 | 3300005616 | Bacteria | 6845 |
| 223 | Ga0068852_100038053 | 3300005616 | Unclassified | 4040 |
| 224 | Ga0068852_100039117 | 3300005616 | Bacteria | 3991 |
| 225 | Ga0068852_100483536 | 3300005616 | Bacteria | 1231 |
| 226 | Ga0068852_100590414 | 3300005616 | Bacteria | 1114 |
| 227 | Ga0068852_100790408 | 3300005616 | Bacteria | 963 |
| 228 | Ga0068859_100000007 | 3300005617 | Bacteria | 390070 |
| 229 | Ga0068859_100005939 | 3300005617 | Bacteria | 12395 |
| 230 | Ga0068859_100007298 | 3300005617 | Bacteria | 11213 |
| 231 | Ga0068859_100053444 | 3300005617 | Bacteria | 4063 |
| 232 | Ga0068859_100085938 | 3300005617 | Bacteria | 3191 |
| 233 | Ga0068859_100211768 | 3300005617 | Bacteria | 2024 |
| 234 | Ga0068859_100315486 | 3300005617 | Unclassified | 1657 |
| 235 | Ga0068859_100373945 | 3300005617 | Unclassified | 1520 |
| 236 | Ga0068859_100861076 | 3300005617 | Bacteria | 992 |
| 237 | Ga0068864_100000685 | 3300005618 | Bacteria | 28427 |
| 238 | Ga0068864_100078167 | 3300005618 | Bacteria | 2895 |
| 239 | Ga0068864_100098112 | 3300005618 | Bacteria | 2594 |
| 240 | Ga0068864_100294136 | 3300005618 | Bacteria | 1519 |
| 241 | Ga0068864_100295740 | 3300005618 | Unclassified | 1515 |
| 242 | Ga0068861_100011956 | 3300005719 | Bacteria | 6045 |
| 243 | Ga0068861_100082382 | 3300005719 | Bacteria | 2521 |
| 244 | Ga0068861_100097495 | 3300005719 | Bacteria | 2332 |
| 245 | Ga0068861_100097774 | 3300005719 | Unclassified | 2329 |
| 246 | Ga0068861_100566855 | 3300005719 | Unclassified | 1037 |
| 247 | Ga0068861_100929290 | 3300005719 | Bacteria | 826 |
| 248 | Ga0068851_10056995 | 3300005834 | Bacteria | 1994 |
| 249 | Ga0068851_10083371 | 3300005834 | Bacteria | 1673 |
| 250 | Ga0068851_10196126 | 3300005834 | Unclassified | 1125 |
| 251 | Ga0068851_10293210 | 3300005834 | Bacteria | 933 |
| 252 | Ga0068870_10013221 | 3300005840 | Bacteria | 3875 |
| 253 | Ga0068870_10020019 | 3300005840 | Unclassified | 3252 |
| 254 | Ga0068870_10079494 | 3300005840 | Bacteria | 1809 |
| 255 | Ga0068863_100018440 | 3300005841 | Bacteria | 6679 |
| 256 | Ga0068863_100029101 | 3300005841 | Bacteria | 5274 |
| 257 | Ga0068863_100030116 | 3300005841 | Bacteria | 5184 |
| 258 | Ga0068863_100571603 | 3300005841 | Bacteria | 1117 |
| 259 | Ga0068863_100649717 | 3300005841 | Bacteria | 1046 |
| 260 | Ga0068863_100684508 | 3300005841 | Bacteria | 1019 |
| 261 | Ga0068858_100003163 | 3300005842 | Bacteria | 16480 |
| 262 | Ga0068858_100063023 | 3300005842 | Bacteria | 3429 |
| 263 | Ga0068858_100287788 | 3300005842 | Unclassified | 1566 |
| 264 | Ga0068858_100318255 | 3300005842 | Bacteria | 1486 |
| 265 | Ga0068858_100481076 | 3300005842 | Bacteria | 1198 |
| 266 | Ga0068858_100541347 | 3300005842 | Bacteria | 1127 |
| 267 | Ga0068860_100000052 | 3300005843 | Bacteria | 207351 |
| 268 | Ga0068860_100001511 | 3300005843 | Bacteria | 25059 |
| 269 | Ga0068860_100003681 | 3300005843 | Bacteria | 15776 |
| 270 | Ga0068860_100012160 | 3300005843 | Bacteria | 8479 |
| 271 | Ga0068860_100013747 | 3300005843 | Bacteria | 7937 |
| 272 | Ga0068860_100014258 | 3300005843 | Bacteria | 7794 |
| 273 | Ga0068860_100020337 | 3300005843 | Bacteria | 6429 |
| 274 | Ga0068860_100035248 | 3300005843 | Bacteria | 4801 |
| 275 | Ga0068860_100165723 | 3300005843 | Bacteria | 2133 |
| 276 | Ga0068860_100167208 | 3300005843 | Bacteria | 2123 |
| 277 | Ga0068860_100247929 | 3300005843 | Bacteria | 1733 |
| 278 | Ga0068860_100483985 | 3300005843 | Bacteria | 1234 |
| 279 | Ga0068860_100488768 | 3300005843 | Unclassified | 1227 |
| 280 | Ga0068860_100512583 | 3300005843 | Bacteria | 1199 |
| 281 | Ga0068862_100026484 | 3300005844 | Bacteria | 4874 |
| 282 | Ga0068862_100034043 | 3300005844 | Bacteria | 4308 |
| 283 | Ga0068862_100324559 | 3300005844 | Unclassified | 1422 |
| 284 | Ga0081539_10000120 | 3300005985 | Bacteria | 183566 |
| 285 | Ga0075367_10061073 | 3300006178 | Bacteria | 2249 |
| 286 | Ga0075366_10008398 | 3300006195 | Bacteria | 5740 |
| 287 | Ga0075366_10011185 | 3300006195 | Bacteria | 5060 |
| 288 | Ga0075366_10161526 | 3300006195 | Bacteria | 1358 |
| 289 | Ga0075366_10227556 | 3300006195 | Bacteria | 1136 |
| 290 | Ga0075366_10355010 | 3300006195 | Bacteria | 900 |
| 291 | Ga0097621_100000611 | 3300006237 | Bacteria | 25252 |
| 292 | Ga0097621_100014924 | 3300006237 | Bacteria | 5830 |
| 293 | Ga0097621_100023053 | 3300006237 | Bacteria | 4842 |
| 294 | Ga0097621_100070125 | 3300006237 | Bacteria | 2894 |
| 295 | Ga0097621_100133437 | 3300006237 | Unclassified | 2115 |
| 296 | Ga0068871_100008869 | 3300006358 | Bacteria | 7249 |
| 297 | Ga0068871_100010721 | 3300006358 | Bacteria | 6702 |
| 298 | Ga0068871_100012226 | 3300006358 | Bacteria | 6320 |
| 299 | Ga0068871_100022572 | 3300006358 | Bacteria | 4854 |
| 300 | Ga0068871_100248949 | 3300006358 | Unclassified | 1547 |
| 301 | Ga0068871_100339657 | 3300006358 | Bacteria | 1326 |
| 302 | Ga0068871_100543485 | 3300006358 | Bacteria | 1051 |
| 303 | Ga0068871_100771405 | 3300006358 | Bacteria | 885 |
| 304 | Ga0075428_101064068 | 3300006844 | Bacteria | 855 |
| 305 | Ga0075431_100005210 | 3300006847 | Bacteria | 12808 |
| 306 | Ga0075429_100004647 | 3300006880 | Bacteria | 11808 |
| 307 | Ga0068865_100002580 | 3300006881 | Bacteria | 10756 |
| 308 | Ga0068865_100015426 | 3300006881 | Bacteria | 4873 |
| 309 | Ga0068865_100128445 | 3300006881 | Unclassified | 1896 |
| 310 | Ga0068865_100141727 | 3300006881 | Bacteria | 1813 |
| 311 | Ga0068865_100177830 | 3300006881 | Bacteria | 1637 |
| 312 | Ga0097620_100000007 | 3300006931 | Bacteria | 390070 |
| 313 | Ga0097620_100005939 | 3300006931 | Bacteria | 12395 |
| 314 | Ga0097620_100007298 | 3300006931 | Bacteria | 11213 |
| 315 | Ga0097620_100053445 | 3300006931 | Bacteria | 4063 |
| 316 | Ga0097620_100085934 | 3300006931 | Bacteria | 3191 |
| 317 | Ga0097620_100211772 | 3300006931 | Bacteria | 2024 |
| 318 | Ga0097620_100315489 | 3300006931 | Unclassified | 1657 |
| 319 | Ga0097620_100373936 | 3300006931 | Unclassified | 1520 |
| 320 | Ga0097620_100861055 | 3300006931 | Bacteria | 992 |
| 321 | Ga0105240_10000728 | 3300009093 | Bacteria | 60140 |
| 322 | Ga0105240_10000822 | 3300009093 | Bacteria | 56372 |
| 323 | Ga0105240_10004785 | 3300009093 | Bacteria | 20422 |
| 324 | Ga0105240_10007855 | 3300009093 | Bacteria | 15393 |
| 325 | Ga0105240_10013063 | 3300009093 | Bacteria | 11429 |
| 326 | Ga0105240_10052936 | 3300009093 | Bacteria | 5100 |
| 327 | Ga0105240_10071237 | 3300009093 | Bacteria | 4299 |
| 328 | Ga0105240_10155272 | 3300009093 | Bacteria | 2723 |
| 329 | Ga0105240_10171975 | 3300009093 | Bacteria | 2565 |
| 330 | Ga0105240_10230685 | 3300009093 | Bacteria | 2152 |
| 331 | Ga0105240_10642565 | 3300009093 | Bacteria | 1164 |
| 332 | Ga0105240_11326747 | 3300009093 | Bacteria | 758 |
| 333 | Ga0111539_10004306 | 3300009094 | Bacteria | 18619 |
| 334 | Ga0111539_10319296 | 3300009094 | Unclassified | 1807 |
| 335 | Ga0105245_10414992 | 3300009098 | Bacteria | 1348 |
| 336 | Ga0105247_10007816 | 3300009101 | Bacteria | 6543 |
| 337 | Ga0105247_10008390 | 3300009101 | Bacteria | 6298 |
| 338 | Ga0114129_10000608 | 3300009147 | Bacteria | 44314 |
| 339 | Ga0114129_10097830 | 3300009147 | Unclassified | 4062 |
| 340 | Ga0105241_10000104 | 3300009174 | Bacteria | 60482 |
| 341 | Ga0105241_10001316 | 3300009174 | Bacteria | 18866 |
| 342 | Ga0105241_10004217 | 3300009174 | Bacteria | 10615 |
| 343 | Ga0105241_10052751 | 3300009174 | Bacteria | 3106 |
| 344 | Ga0105241_10341167 | 3300009174 | Bacteria | 1298 |
| 345 | Ga0105241_10465636 | 3300009174 | Unclassified | 1121 |
| 346 | Ga0105242_10049843 | 3300009176 | Bacteria | 3408 |
| 347 | Ga0105242_10204023 | 3300009176 | Unclassified | 1758 |
| 348 | Ga0105248_10443938 | 3300009177 | Bacteria | 1462 |
| 349 | Ga0105237_10000841 | 3300009545 | Bacteria | 41862 |
| 350 | Ga0105237_10002964 | 3300009545 | Bacteria | 20540 |
| 351 | Ga0105237_10006531 | 3300009545 | Bacteria | 12907 |
| 352 | Ga0105237_10009111 | 3300009545 | Bacteria | 10667 |
| 353 | Ga0105237_10018106 | 3300009545 | Bacteria | 7294 |
| 354 | Ga0105237_10020183 | 3300009545 | Bacteria | 6877 |
| 355 | Ga0105237_10055660 | 3300009545 | Bacteria | 3962 |
| 356 | Ga0105237_10057748 | 3300009545 | Bacteria | 3883 |
| 357 | Ga0105237_10132503 | 3300009545 | Unclassified | 2487 |
| 358 | Ga0105237_10192956 | 3300009545 | Unclassified | 2036 |
| 359 | Ga0105237_10497778 | 3300009545 | Bacteria | 1225 |
| 360 | Ga0105237_10551310 | 3300009545 | Bacteria | 1159 |
| 361 | Ga0105237_10578381 | 3300009545 | Bacteria | 1130 |
| 362 | Ga0105238_10008635 | 3300009551 | Bacteria | 10195 |
| 363 | Ga0105238_10016959 | 3300009551 | Bacteria | 7391 |
| 364 | Ga0105238_10056612 | 3300009551 | Bacteria | 3933 |
| 365 | Ga0105238_10118753 | 3300009551 | Bacteria | 2624 |
| 366 | Ga0105238_10563538 | 3300009551 | Bacteria | 1144 |
| 367 | Ga0105249_10000349 | 3300009553 | Bacteria | 46353 |
| 368 | Ga0105249_10009352 | 3300009553 | Bacteria | 8574 |
| 369 | Ga0105249_10016031 | 3300009553 | Bacteria | 6641 |
| 370 | Ga0105249_10056439 | 3300009553 | Unclassified | 3595 |
| 371 | Ga0105249_10081333 | 3300009553 | Bacteria | 3011 |
| 372 | Ga0105249_10094912 | 3300009553 | Bacteria | 2796 |
| 373 | Ga0105249_10100641 | 3300009553 | Unclassified | 2718 |
| 374 | Ga0105249_10187466 | 3300009553 | Bacteria | 2016 |
| 375 | Ga0105239_10000755 | 3300010375 | Bacteria | 45854 |
| 376 | Ga0105239_10000936 | 3300010375 | Bacteria | 41213 |
| 377 | Ga0105239_10003951 | 3300010375 | Bacteria | 17961 |
| 378 | Ga0105239_10006358 | 3300010375 | Bacteria | 13727 |
| 379 | Ga0105239_10016065 | 3300010375 | Bacteria | 8281 |
| 380 | Ga0105239_10057673 | 3300010375 | Bacteria | 4260 |
| 381 | Ga0105239_10136715 | 3300010375 | Bacteria | 2729 |
| 382 | Ga0105239_10140927 | 3300010375 | Bacteria | 2686 |
| 383 | Ga0105239_10245842 | 3300010375 | Bacteria | 2009 |
| 384 | Ga0105239_10252875 | 3300010375 | Bacteria | 1979 |
| 385 | Ga0105239_10257525 | 3300010375 | Bacteria | 1961 |
| 386 | Ga0105246_10001838 | 3300011119 | Bacteria | 12732 |
| 387 | Ga0105246_10207579 | 3300011119 | Unclassified | 1527 |
| 388 | Ga0105246_10527338 | 3300011119 | Bacteria | 1008 |
| 389 | Ga0157373_10000876 | 3300013100 | Bacteria | 23274 |
| 390 | Ga0157373_10056306 | 3300013100 | Bacteria | 2793 |
| 391 | Ga0157371_10001606 | 3300013102 | Bacteria | 23180 |
| 392 | Ga0157371_10002634 | 3300013102 | Bacteria | 17023 |
| 393 | Ga0157371_10003430 | 3300013102 | Bacteria | 14384 |
| 394 | Ga0157371_10003627 | 3300013102 | Bacteria | 13899 |
| 395 | Ga0157371_10011045 | 3300013102 | Bacteria | 6996 |
| 396 | Ga0157371_10016632 | 3300013102 | Bacteria | 5483 |
| 397 | Ga0157371_10030073 | 3300013102 | Bacteria | 3920 |
| 398 | Ga0157371_10057895 | 3300013102 | Bacteria | 2749 |
| 399 | Ga0157371_10099804 | 3300013102 | Bacteria | 2059 |
| 400 | Ga0157371_10108302 | 3300013102 | Bacteria | 1972 |
| 401 | Ga0157371_10133786 | 3300013102 | Bacteria | 1765 |
| 402 | Ga0157371_10169691 | 3300013102 | Bacteria | 1559 |
| 403 | Ga0157371_10352120 | 3300013102 | Bacteria | 1072 |
| 404 | Ga0157370_10000473 | 3300013104 | Bacteria | 50187 |
| 405 | Ga0157370_10000631 | 3300013104 | Bacteria | 43919 |
| 406 | Ga0157370_10001463 | 3300013104 | Bacteria | 29196 |
| 407 | Ga0157370_10001929 | 3300013104 | Bacteria | 25519 |
| 408 | Ga0157370_10003253 | 3300013104 | Bacteria | 19143 |
| 409 | Ga0157370_10081337 | 3300013104 | Bacteria | 3048 |
| 410 | Ga0157370_10088225 | 3300013104 | Bacteria | 2913 |
| 411 | Ga0157370_10192246 | 3300013104 | Bacteria | 1894 |
| 412 | Ga0157370_10206077 | 3300013104 | Bacteria | 1823 |
| 413 | Ga0157370_10540417 | 3300013104 | Bacteria | 1069 |
| 414 | Ga0157370_10575487 | 3300013104 | Bacteria | 1032 |
| 415 | Ga0157370_11211925 | 3300013104 | Bacteria | 681 |
| 416 | Ga0157369_10010202 | 3300013105 | Bacteria | 10718 |
| 417 | Ga0157369_10047443 | 3300013105 | Bacteria | 4664 |
| 418 | Ga0157369_10190553 | 3300013105 | Bacteria | 2155 |
| 419 | Ga0157369_10494325 | 3300013105 | Bacteria | 1266 |
| 420 | Ga0157369_10636179 | 3300013105 | Bacteria | 1100 |
| 421 | Ga0157369_10998971 | 3300013105 | Bacteria | 857 |
| 422 | Ga0157374_10000082 | 3300013296 | Bacteria | 95018 |
| 423 | Ga0157374_10000237 | 3300013296 | Bacteria | 51331 |
| 424 | Ga0157374_10071499 | 3300013296 | Bacteria | 3271 |
| 425 | Ga0157374_10116823 | 3300013296 | Bacteria | 2571 |
| 426 | Ga0157374_10159523 | 3300013296 | Bacteria | 2197 |
| 427 | Ga0157374_10196242 | 3300013296 | Bacteria | 1975 |
| 428 | Ga0157374_10205761 | 3300013296 | Bacteria | 1929 |
| 429 | Ga0157374_10362139 | 3300013296 | Bacteria | 1442 |
| 430 | Ga0157374_10364020 | 3300013296 | Bacteria | 1438 |
| 431 | Ga0157374_10392540 | 3300013296 | Bacteria | 1383 |
| 432 | Ga0157374_11259619 | 3300013296 | Bacteria | 761 |
| 433 | Ga0157378_10002819 | 3300013297 | Bacteria | 15501 |
| 434 | Ga0157378_10020773 | 3300013297 | Bacteria | 5774 |
| 435 | Ga0157378_10054652 | 3300013297 | Bacteria | 3555 |
| 436 | Ga0157378_10071369 | 3300013297 | Bacteria | 3119 |
| 437 | Ga0157378_10409947 | 3300013297 | Bacteria | 1337 |
| 438 | Ga0157378_10510695 | 3300013297 | Unclassified | 1202 |
| 439 | Ga0163162_10000086 | 3300013306 | Bacteria | 85949 |
| 440 | Ga0163162_10000226 | 3300013306 | Bacteria | 51615 |
| 441 | Ga0163162_10001051 | 3300013306 | Bacteria | 25638 |
| 442 | Ga0163162_10001766 | 3300013306 | Bacteria | 20260 |
| 443 | Ga0163162_10006217 | 3300013306 | Bacteria | 11572 |
| 444 | Ga0163162_10015360 | 3300013306 | Bacteria | 7482 |
| 445 | Ga0163162_10029801 | 3300013306 | Bacteria | 5402 |
| 446 | Ga0163162_10153084 | 3300013306 | Bacteria | 2424 |
| 447 | Ga0163162_10371562 | 3300013306 | Unclassified | 1563 |
| 448 | Ga0163162_10388005 | 3300013306 | Unclassified | 1529 |
| 449 | Ga0163162_10942027 | 3300013306 | Bacteria | 975 |
| 450 | Ga0157372_10005832 | 3300013307 | Bacteria | 13117 |
| 451 | Ga0157372_10006279 | 3300013307 | Bacteria | 12639 |
| 452 | Ga0157372_10033052 | 3300013307 | Bacteria | 5678 |
| 453 | Ga0157372_10054533 | 3300013307 | Bacteria | 4460 |
| 454 | Ga0157372_10057046 | 3300013307 | Bacteria | 4365 |
| 455 | Ga0157372_10084962 | 3300013307 | Bacteria | 3589 |
| 456 | Ga0157372_10102814 | 3300013307 | Bacteria | 3264 |
| 457 | Ga0157372_10105645 | 3300013307 | Bacteria | 3221 |
| 458 | Ga0157372_10195910 | 3300013307 | Bacteria | 2340 |
| 459 | Ga0157372_10211125 | 3300013307 | Bacteria | 2250 |
| 460 | Ga0157372_10288797 | 3300013307 | Bacteria | 1907 |
| 461 | Ga0157372_10407974 | 3300013307 | Bacteria | 1583 |
| 462 | Ga0157372_10433548 | 3300013307 | Unclassified | 1532 |
| 463 | Ga0157372_10466976 | 3300013307 | Bacteria | 1471 |
| 464 | Ga0157372_10503053 | 3300013307 | Bacteria | 1413 |
| 465 | Ga0157372_10847988 | 3300013307 | Bacteria | 1061 |
| 466 | Ga0157372_10954588 | 3300013307 | Bacteria | 994 |
| 467 | Ga0157372_10956967 | 3300013307 | Bacteria | 992 |
| 468 | Ga0157372_11961646 | 3300013307 | Bacteria | 673 |
| 469 | Ga0157375_10000115 | 3300013308 | Bacteria | 77964 |
| 470 | Ga0157375_10030276 | 3300013308 | Bacteria | 5102 |
| 471 | Ga0157375_10041963 | 3300013308 | Unclassified | 4423 |
| 472 | Ga0157375_10059422 | 3300013308 | Bacteria | 3788 |
| 473 | Ga0157375_10072306 | 3300013308 | Bacteria | 3465 |
| 474 | Ga0157375_10237762 | 3300013308 | Bacteria | 1981 |
| 475 | Ga0157375_10570108 | 3300013308 | Bacteria | 1293 |
| 476 | Ga0163163_10000088 | 3300014325 | Bacteria | 101126 |
| 477 | Ga0163163_10000244 | 3300014325 | Bacteria | 55634 |
| 478 | Ga0163163_10003449 | 3300014325 | Bacteria | 13434 |
| 479 | Ga0163163_10089730 | 3300014325 | Bacteria | 3086 |
| 480 | Ga0163163_10206453 | 3300014325 | Bacteria | 2013 |
| 481 | Ga0163163_10327720 | 3300014325 | Bacteria | 1585 |
| 482 | Ga0157380_10002932 | 3300014326 | Bacteria | 11595 |
| 483 | Ga0157380_10314685 | 3300014326 | Bacteria | 1448 |
| 484 | Ga0157377_10013206 | 3300014745 | Bacteria | 4175 |
| 485 | Ga0157377_10025801 | 3300014745 | Unclassified | 3138 |
| 486 | Ga0157377_10046580 | 3300014745 | Bacteria | 2426 |
| 487 | Ga0157377_10099087 | 3300014745 | Unclassified | 1733 |
| 488 | Ga0157379_10011834 | 3300014968 | Bacteria | 7621 |
| 489 | Ga0157379_10022878 | 3300014968 | Bacteria | 5540 |
| 490 | Ga0157379_10072415 | 3300014968 | Bacteria | 3083 |
| 491 | Ga0157379_10083102 | 3300014968 | Bacteria | 2870 |
| 492 | Ga0157379_10130716 | 3300014968 | Bacteria | 2260 |
| 493 | Ga0157379_10412908 | 3300014968 | Bacteria | 1242 |
| 494 | Ga0157379_10497234 | 3300014968 | Bacteria | 1130 |
| 495 | Ga0157379_10523746 | 3300014968 | Unclassified | 1101 |
| 496 | Ga0157379_10617162 | 3300014968 | Bacteria | 1013 |
| 497 | Ga0157376_10001060 | 3300014969 | Bacteria | 18012 |
| 498 | Ga0157376_10006708 | 3300014969 | Bacteria | 8149 |
| 499 | Ga0157376_10033319 | 3300014969 | Bacteria | 4147 |
| 500 | Ga0157376_10113753 | 3300014969 | Bacteria | 2387 |
| 501 | Ga0157376_10572390 | 3300014969 | Unclassified | 1121 |
| 502 | Ga0157376_10719768 | 3300014969 | Bacteria | 1005 |
| 503 | Ga0182005_1000100 | 3300015265 | Bacteria | 65235 |
| 504 | Ga0163161_10000968 | 3300017792 | Bacteria | 21949 |
| 505 | Ga0163161_10021573 | 3300017792 | Bacteria | 4525 |
| 506 | Ga0163161_10063543 | 3300017792 | Bacteria | 2691 |
| 507 | Ga0163161_10082782 | 3300017792 | Unclassified | 2365 |
| 508 | Ga0163161_10203377 | 3300017792 | Bacteria | 1527 |
| 509 | Ga0163161_10998847 | 3300017792 | Unclassified | 714 |
| 510 | Ga0206350_10720946 | 3300020080 | Eukaryota | 831 |
| 511 | Ga0206350_11190917 | 3300020080 | Unclassified | 1470 |
| 512 | Ga0213876_10010328 | 3300021384 | Bacteria | 5012 |
| 513 | Ga0209436_100776 | 3300025208 | Bacteria | 13217 |
| 514 | Ga0209436_110527 | 3300025208 | Bacteria | 1686 |
| 515 | Ga0209258_100032 | 3300025242 | Bacteria | 452764 |
| 516 | Ga0209646_1000050 | 3300025246 | Bacteria | 296599 |
| 517 | Ga0209646_1001058 | 3300025246 | Bacteria | 8271 |
| 518 | Ga0209026_1000452 | 3300025250 | Bacteria | 32703 |
| 519 | Ga0209148_1000223 | 3300025254 | Bacteria | 93490 |
| 520 | Ga0209673_1000042 | 3300025273 | Bacteria | 300704 |
| 521 | Ga0209130_1000921 | 3300025284 | Bacteria | 23640 |
| 522 | Ga0209564_1009094 | 3300025295 | Bacteria | 4784 |
| 523 | Ga0209758_1002389 | 3300025297 | Bacteria | 19314 |
| 524 | Ga0209758_1018818 | 3300025297 | Bacteria | 3365 |
| 525 | Ga0209050_1000295 | 3300025298 | Bacteria | 104889 |
| 526 | Ga0207426_1000059 | 3300025302 | Bacteria | 363842 |
| 527 | Ga0207426_1000250 | 3300025302 | Bacteria | 117492 |
| 528 | Ga0207426_1000549 | 3300025302 | Bacteria | 52206 |
| 529 | Ga0207426_1000732 | 3300025302 | Bacteria | 37561 |
| 530 | Ga0207426_1013618 | 3300025302 | Bacteria | 3007 |
| 531 | Ga0207426_1039810 | 3300025302 | Bacteria | 1469 |
| 532 | Ga0209051_1047707 | 3300025303 | Bacteria | 1460 |
| 533 | Ga0209257_1011800 | 3300025304 | Bacteria | 4144 |
| 534 | Ga0207697_10007749 | 3300025315 | Bacteria | 4760 |
| 535 | Ga0207656_10064949 | 3300025321 | Bacteria | 1610 |
| 536 | Ga0207656_10223176 | 3300025321 | Bacteria | 916 |
| 537 | Ga0207682_10035528 | 3300025893 | Bacteria | 2013 |
| 538 | Ga0207682_10061360 | 3300025893 | Bacteria | 1574 |
| 539 | Ga0207710_10066209 | 3300025900 | Bacteria | 1648 |
| 540 | Ga0207710_10138769 | 3300025900 | Bacteria | 1172 |
| 541 | Ga0207680_10000015 | 3300025903 | Bacteria | 138253 |
| 542 | Ga0207680_10103913 | 3300025903 | Bacteria | 1830 |
| 543 | Ga0207680_10425120 | 3300025903 | Bacteria | 941 |
| 544 | Ga0207647_10030149 | 3300025904 | Bacteria | 3502 |
| 545 | Ga0207647_10237685 | 3300025904 | Bacteria | 1047 |
| 546 | Ga0207645_10007658 | 3300025907 | Bacteria | 7609 |
| 547 | Ga0207645_10012916 | 3300025907 | Bacteria | 5652 |
| 548 | Ga0207645_10015110 | 3300025907 | Bacteria | 5143 |
| 549 | Ga0207643_10005965 | 3300025908 | Bacteria | 6510 |
| 550 | Ga0207643_10036187 | 3300025908 | Bacteria | 2768 |
| 551 | Ga0207705_10005519 | 3300025909 | Bacteria | 9459 |
| 552 | Ga0207705_10041346 | 3300025909 | Bacteria | 3307 |
| 553 | Ga0207705_10282138 | 3300025909 | Bacteria | 1272 |
| 554 | Ga0207705_10332821 | 3300025909 | Bacteria | 1168 |
| 555 | Ga0207654_10001648 | 3300025911 | Bacteria | 11678 |
| 556 | Ga0207654_10002787 | 3300025911 | Bacteria | 8879 |
| 557 | Ga0207654_10022864 | 3300025911 | Bacteria | 3341 |
| 558 | Ga0207654_10023652 | 3300025911 | Bacteria | 3294 |
| 559 | Ga0207654_10118760 | 3300025911 | Bacteria | 1657 |
| 560 | Ga0207654_10259889 | 3300025911 | Bacteria | 1167 |
| 561 | Ga0207707_10004161 | 3300025912 | Bacteria | 12820 |
| 562 | Ga0207707_10121149 | 3300025912 | Unclassified | 2287 |
| 563 | Ga0207707_10343707 | 3300025912 | Bacteria | 1286 |
| 564 | Ga0207707_10489650 | 3300025912 | Bacteria | 1050 |
| 565 | Ga0207707_10634642 | 3300025912 | Bacteria | 902 |
| 566 | Ga0207695_10000189 | 3300025913 | Bacteria | 177142 |
| 567 | Ga0207695_10000839 | 3300025913 | Bacteria | 56384 |
| 568 | Ga0207695_10001190 | 3300025913 | Bacteria | 44747 |
| 569 | Ga0207695_10024238 | 3300025913 | Bacteria | 6832 |
| 570 | Ga0207695_10044697 | 3300025913 | Bacteria | 4708 |
| 571 | Ga0207695_10067448 | 3300025913 | Unclassified | 3670 |
| 572 | Ga0207695_10213366 | 3300025913 | Bacteria | 1840 |
| 573 | Ga0207671_10001528 | 3300025914 | Bacteria | 26548 |
| 574 | Ga0207671_10002710 | 3300025914 | Bacteria | 18563 |
| 575 | Ga0207671_10005708 | 3300025914 | Bacteria | 11360 |
| 576 | Ga0207671_10009702 | 3300025914 | Bacteria | 8018 |
| 577 | Ga0207671_10020062 | 3300025914 | Bacteria | 5098 |
| 578 | Ga0207671_10022134 | 3300025914 | Bacteria | 4810 |
| 579 | Ga0207671_10023275 | 3300025914 | Bacteria | 4673 |
| 580 | Ga0207671_10075636 | 3300025914 | Unclassified | 2519 |
| 581 | Ga0207671_10121475 | 3300025914 | Bacteria | 1997 |
| 582 | Ga0207671_10231696 | 3300025914 | Bacteria | 1449 |
| 583 | Ga0207671_10288675 | 3300025914 | Bacteria | 1295 |
| 584 | Ga0207671_10369921 | 3300025914 | Bacteria | 1138 |
| 585 | Ga0207660_10014719 | 3300025917 | Bacteria | 5153 |
| 586 | Ga0207660_10078611 | 3300025917 | Bacteria | 2418 |
| 587 | Ga0207660_10081069 | 3300025917 | Unclassified | 2384 |
| 588 | Ga0207662_10224277 | 3300025918 | Bacteria | 1225 |
| 589 | Ga0207657_10023553 | 3300025919 | Bacteria | 5730 |
| 590 | Ga0207657_10030450 | 3300025919 | Bacteria | 4898 |
| 591 | Ga0207657_10055528 | 3300025919 | Bacteria | 3420 |
| 592 | Ga0207657_10114129 | 3300025919 | Bacteria | 2228 |
| 593 | Ga0207657_10370902 | 3300025919 | Bacteria | 1128 |
| 594 | Ga0207649_10108330 | 3300025920 | Bacteria | 1851 |
| 595 | Ga0207649_10384342 | 3300025920 | Unclassified | 1047 |
| 596 | Ga0207649_10703906 | 3300025920 | Unclassified | 784 |
| 597 | Ga0207652_10000055 | 3300025921 | Bacteria | 115420 |
| 598 | Ga0207652_10000121 | 3300025921 | Bacteria | 85376 |
| 599 | Ga0207652_10000397 | 3300025921 | Bacteria | 45365 |
| 600 | Ga0207652_10026359 | 3300025921 | Bacteria | 4840 |
| 601 | Ga0207652_10122844 | 3300025921 | Bacteria | 2311 |
| 602 | Ga0207681_10032161 | 3300025923 | Bacteria | 3433 |
| 603 | Ga0207681_10440740 | 3300025923 | Bacteria | 1058 |
| 604 | Ga0207694_10009052 | 3300025924 | Bacteria | 7514 |
| 605 | Ga0207694_10148385 | 3300025924 | Bacteria | 1888 |
| 606 | Ga0207694_10331225 | 3300025924 | Bacteria | 1258 |
| 607 | Ga0207650_10008566 | 3300025925 | Bacteria | 6982 |
| 608 | Ga0207650_10069036 | 3300025925 | Bacteria | 2655 |
| 609 | Ga0207650_10121053 | 3300025925 | Bacteria | 2038 |
| 610 | Ga0207650_10167017 | 3300025925 | Bacteria | 1747 |
| 611 | Ga0207650_10220158 | 3300025925 | Bacteria | 1527 |
| 612 | Ga0207650_10270520 | 3300025925 | Bacteria | 1381 |
| 613 | Ga0207650_10398018 | 3300025925 | Bacteria | 1139 |
| 614 | Ga0207650_10410229 | 3300025925 | Unclassified | 1123 |
| 615 | Ga0207650_10632788 | 3300025925 | Bacteria | 901 |
| 616 | Ga0207659_10012225 | 3300025926 | Bacteria | 5449 |
| 617 | Ga0207659_10028666 | 3300025926 | Unclassified | 3786 |
| 618 | Ga0207659_10078755 | 3300025926 | Bacteria | 2429 |
| 619 | Ga0207659_10080878 | 3300025926 | Bacteria | 2401 |
| 620 | Ga0207659_10461905 | 3300025926 | Bacteria | 1070 |
| 621 | Ga0207659_10548200 | 3300025926 | Bacteria | 983 |
| 622 | Ga0207664_10076429 | 3300025929 | Bacteria | 2711 |
| 623 | Ga0207644_10005946 | 3300025931 | Bacteria | 7955 |
| 624 | Ga0207644_10214342 | 3300025931 | Bacteria | 1524 |
| 625 | Ga0207644_10892485 | 3300025931 | Bacteria | 745 |
| 626 | Ga0207690_10226221 | 3300025932 | Bacteria | 1434 |
| 627 | Ga0207706_10010719 | 3300025933 | Bacteria | 8373 |
| 628 | Ga0207706_10018001 | 3300025933 | Bacteria | 6357 |
| 629 | Ga0207706_10522737 | 3300025933 | Bacteria | 1023 |
| 630 | Ga0207706_10529011 | 3300025933 | Bacteria | 1016 |
| 631 | Ga0207686_10126840 | 3300025934 | Bacteria | 1745 |
| 632 | Ga0207670_10003257 | 3300025936 | Bacteria | 8605 |
| 633 | Ga0207670_10037466 | 3300025936 | Bacteria | 3160 |
| 634 | Ga0207670_10067319 | 3300025936 | Bacteria | 2464 |
| 635 | Ga0207670_10709788 | 3300025936 | Bacteria | 833 |
| 636 | Ga0207669_10696976 | 3300025937 | Bacteria | 834 |
| 637 | Ga0207704_10007779 | 3300025938 | Bacteria | 5085 |
| 638 | Ga0207704_10052872 | 3300025938 | Bacteria | 2465 |
| 639 | Ga0207691_10002284 | 3300025940 | Bacteria | 18761 |
| 640 | Ga0207691_10011435 | 3300025940 | Bacteria | 8516 |
| 641 | Ga0207691_10092002 | 3300025940 | Bacteria | 2716 |
| 642 | Ga0207691_10175830 | 3300025940 | Unclassified | 1872 |
| 643 | Ga0207691_10179607 | 3300025940 | Bacteria | 1850 |
| 644 | Ga0207691_10245352 | 3300025940 | Bacteria | 1547 |
| 645 | Ga0207691_10260339 | 3300025940 | Unclassified | 1495 |
| 646 | Ga0207691_10433752 | 3300025940 | Unclassified | 1119 |
| 647 | Ga0207711_10372055 | 3300025941 | Bacteria | 1325 |
| 648 | Ga0207689_10001007 | 3300025942 | Bacteria | 27057 |
| 649 | Ga0207689_10003192 | 3300025942 | Bacteria | 15033 |
| 650 | Ga0207689_10004656 | 3300025942 | Bacteria | 12404 |
| 651 | Ga0207689_10015665 | 3300025942 | Bacteria | 6420 |
| 652 | Ga0207689_10089680 | 3300025942 | Bacteria | 2525 |
| 653 | Ga0207689_10142420 | 3300025942 | Bacteria | 1975 |
| 654 | Ga0207689_10326440 | 3300025942 | Bacteria | 1274 |
| 655 | Ga0207661_10008305 | 3300025944 | Bacteria | 7417 |
| 656 | Ga0207661_10052833 | 3300025944 | Bacteria | 3248 |
| 657 | Ga0207661_10134549 | 3300025944 | Bacteria | 2122 |
| 658 | Ga0207661_10179358 | 3300025944 | Unclassified | 1849 |
| 659 | Ga0207661_10183888 | 3300025944 | Bacteria | 1828 |
| 660 | Ga0207661_10343734 | 3300025944 | Unclassified | 1345 |
| 661 | Ga0207661_10873386 | 3300025944 | Bacteria | 828 |
| 662 | Ga0207679_10004170 | 3300025945 | Bacteria | 8982 |
| 663 | Ga0207679_10016760 | 3300025945 | Bacteria | 4869 |
| 664 | Ga0207679_10426057 | 3300025945 | Bacteria | 1172 |
| 665 | Ga0207679_10794637 | 3300025945 | Unclassified | 862 |
| 666 | Ga0207667_10001711 | 3300025949 | Bacteria | 27600 |
| 667 | Ga0207667_10002129 | 3300025949 | Bacteria | 24819 |
| 668 | Ga0207667_10079731 | 3300025949 | Unclassified | 3393 |
| 669 | Ga0207651_10021405 | 3300025960 | Bacteria | 3930 |
| 670 | Ga0207651_10096548 | 3300025960 | Bacteria | 2180 |
| 671 | Ga0207651_10700831 | 3300025960 | Unclassified | 892 |
| 672 | Ga0207651_10854347 | 3300025960 | Unclassified | 809 |
| 673 | Ga0207712_10003042 | 3300025961 | Bacteria | 10707 |
| 674 | Ga0207712_10044585 | 3300025961 | Unclassified | 3066 |
| 675 | Ga0207712_10100381 | 3300025961 | Unclassified | 2150 |
| 676 | Ga0207712_10395078 | 3300025961 | Bacteria | 1161 |
| 677 | Ga0207668_10074072 | 3300025972 | Bacteria | 2442 |
| 678 | Ga0207668_10292868 | 3300025972 | Bacteria | 1340 |
| 679 | Ga0207640_10016932 | 3300025981 | Bacteria | 4252 |
| 680 | Ga0207640_10062196 | 3300025981 | Bacteria | 2476 |
| 681 | Ga0207640_10499889 | 3300025981 | Bacteria | 1012 |
| 682 | Ga0207658_10019069 | 3300025986 | Bacteria | 4744 |
| 683 | Ga0207658_10083934 | 3300025986 | Bacteria | 2450 |
| 684 | Ga0207658_10119811 | 3300025986 | Bacteria | 2096 |
| 685 | Ga0207658_10269858 | 3300025986 | Bacteria | 1454 |
| 686 | Ga0207658_10396963 | 3300025986 | Bacteria | 1211 |
| 687 | Ga0207677_10005974 | 3300026023 | Bacteria | 6630 |
| 688 | Ga0207677_10043133 | 3300026023 | Bacteria | 2996 |
| 689 | Ga0207677_10285475 | 3300026023 | Unclassified | 1357 |
| 690 | Ga0207677_10437733 | 3300026023 | Bacteria | 1117 |
| 691 | Ga0207703_10004413 | 3300026035 | Bacteria | 11566 |
| 692 | Ga0207703_10011330 | 3300026035 | Bacteria | 6936 |
| 693 | Ga0207703_10240347 | 3300026035 | Bacteria | 1628 |
| 694 | Ga0207703_10387361 | 3300026035 | Bacteria | 1294 |
| 695 | Ga0207639_10035724 | 3300026041 | Bacteria | 3679 |
| 696 | Ga0207639_10125984 | 3300026041 | Bacteria | 2113 |
| 697 | Ga0207639_10129479 | 3300026041 | Bacteria | 2087 |
| 698 | Ga0207639_10130610 | 3300026041 | Bacteria | 2079 |
| 699 | Ga0207639_10197402 | 3300026041 | Bacteria | 1723 |
| 700 | Ga0207639_10401729 | 3300026041 | Bacteria | 1234 |
| 701 | Ga0207639_10589289 | 3300026041 | Bacteria | 1024 |
| 702 | Ga0207639_10636168 | 3300026041 | Bacteria | 986 |
| 703 | Ga0207639_10683019 | 3300026041 | Bacteria | 952 |
| 704 | Ga0207639_10906577 | 3300026041 | Bacteria | 824 |
| 705 | Ga0207639_10938750 | 3300026041 | Bacteria | 809 |
| 706 | Ga0207678_10029161 | 3300026067 | Bacteria | 4816 |
| 707 | Ga0207678_10600960 | 3300026067 | Bacteria | 964 |
| 708 | Ga0207702_10037726 | 3300026078 | Bacteria | 4045 |
| 709 | Ga0207702_10052219 | 3300026078 | Unclassified | 3458 |
| 710 | Ga0207702_10096912 | 3300026078 | Bacteria | 2595 |
| 711 | Ga0207702_10396300 | 3300026078 | Bacteria | 1330 |
| 712 | Ga0207641_10000056 | 3300026088 | Bacteria | 170719 |
| 713 | Ga0207641_10012112 | 3300026088 | Bacteria | 7075 |
| 714 | Ga0207641_10022803 | 3300026088 | Bacteria | 5154 |
| 715 | Ga0207641_10164057 | 3300026088 | Bacteria | 2022 |
| 716 | Ga0207641_10656294 | 3300026088 | Unclassified | 1031 |
| 717 | Ga0207641_10668496 | 3300026088 | Bacteria | 1021 |
| 718 | Ga0207641_11037785 | 3300026088 | Bacteria | 817 |
| 719 | Ga0207648_10004655 | 3300026089 | Bacteria | 14042 |
| 720 | Ga0207648_10012488 | 3300026089 | Bacteria | 7953 |
| 721 | Ga0207648_10016614 | 3300026089 | Bacteria | 6718 |
| 722 | Ga0207648_10037624 | 3300026089 | Bacteria | 4263 |
| 723 | Ga0207648_10131895 | 3300026089 | Bacteria | 2199 |
| 724 | Ga0207648_10147776 | 3300026089 | Bacteria | 2073 |
| 725 | Ga0207648_10212311 | 3300026089 | Bacteria | 1718 |
| 726 | Ga0207648_10386947 | 3300026089 | Bacteria | 1265 |
| 727 | Ga0207648_10716897 | 3300026089 | Bacteria | 928 |
| 728 | Ga0207676_10035035 | 3300026095 | Bacteria | 3805 |
| 729 | Ga0207676_10088827 | 3300026095 | Unclassified | 2531 |
| 730 | Ga0207676_10127225 | 3300026095 | Bacteria | 2160 |
| 731 | Ga0207676_10173626 | 3300026095 | Unclassified | 1880 |
| 732 | Ga0207676_10417933 | 3300026095 | Bacteria | 1257 |
| 733 | Ga0207674_10004751 | 3300026116 | Bacteria | 16286 |
| 734 | Ga0207674_10024112 | 3300026116 | Bacteria | 6506 |
| 735 | Ga0207674_10038653 | 3300026116 | Bacteria | 4950 |
| 736 | Ga0207674_10039029 | 3300026116 | Bacteria | 4925 |
| 737 | Ga0207674_10064267 | 3300026116 | Bacteria | 3702 |
| 738 | Ga0207674_10085033 | 3300026116 | Bacteria | 3160 |
| 739 | Ga0207674_10141956 | 3300026116 | Bacteria | 2361 |
| 740 | Ga0207674_10179815 | 3300026116 | Bacteria | 2067 |
| 741 | Ga0207674_10284796 | 3300026116 | Bacteria | 1601 |
| 742 | Ga0207674_10348523 | 3300026116 | Bacteria | 1432 |
| 743 | Ga0207675_100003813 | 3300026118 | Bacteria | 14671 |
| 744 | Ga0207675_100007383 | 3300026118 | Bacteria | 10388 |
| 745 | Ga0207675_100012540 | 3300026118 | Bacteria | 7918 |
| 746 | Ga0207675_100018489 | 3300026118 | Bacteria | 6500 |
| 747 | Ga0207675_100062310 | 3300026118 | Bacteria | 3483 |
| 748 | Ga0207675_100074291 | 3300026118 | Bacteria | 3181 |
| 749 | Ga0207675_100232223 | 3300026118 | Bacteria | 1780 |
| 750 | Ga0207683_10002007 | 3300026121 | Bacteria | 18003 |
| 751 | Ga0207683_10053052 | 3300026121 | Bacteria | 3554 |
| 752 | Ga0207683_10229948 | 3300026121 | Bacteria | 1691 |
| 753 | Ga0207683_10653236 | 3300026121 | Bacteria | 974 |
| 754 | Ga0207698_10010138 | 3300026142 | Bacteria | 6037 |
| 755 | Ga0207698_10018653 | 3300026142 | Bacteria | 4734 |
| 756 | Ga0207698_10051843 | 3300026142 | Bacteria | 3139 |
| 757 | Ga0207698_10056171 | 3300026142 | Bacteria | 3039 |
| 758 | Ga0207698_10056605 | 3300026142 | Bacteria | 3029 |
| 759 | Ga0207698_10225635 | 3300026142 | Bacteria | 1697 |
| 760 | Ga0207698_10320805 | 3300026142 | Unclassified | 1451 |
| 761 | Ga0207698_10356652 | 3300026142 | Unclassified | 1383 |
| 762 | Ga0209999_1038540 | 3300027543 | Bacteria | 894 |
| 763 | Ga0268266_10023889 | 3300028379 | Bacteria | 5202 |
| 764 | Ga0268266_10295083 | 3300028379 | Unclassified | 1511 |
| 765 | Ga0268266_10366162 | 3300028379 | Bacteria | 1357 |
| 766 | Ga0268265_10067420 | 3300028380 | Bacteria | 2770 |
| 767 | Ga0268265_10154331 | 3300028380 | Unclassified | 1941 |
| 768 | Ga0268265_10442058 | 3300028380 | Bacteria | 1212 |
| 769 | Ga0268264_10000143 | 3300028381 | Bacteria | 170031 |
| 770 | Ga0268264_10001196 | 3300028381 | Bacteria | 25064 |
| 771 | Ga0268264_10001996 | 3300028381 | Bacteria | 18331 |
| 772 | Ga0268264_10017622 | 3300028381 | Bacteria | 5848 |
| 773 | Ga0268264_10032895 | 3300028381 | Bacteria | 4256 |
| 774 | Ga0268264_10063577 | 3300028381 | Bacteria | 3103 |
| 775 | Ga0268264_10163267 | 3300028381 | Bacteria | 2009 |
| 776 | Ga0307515_10000078 | 3300028794 | Bacteria | 227988 |
| 777 | Ga0265327_10103988 | 3300031251 | Bacteria | 1366 |
| 778 | Ga0307513_10058922 | 3300031456 | Bacteria | 4078 |
| 779 | Ga0307513_10439506 | 3300031456 | Bacteria | 1031 |
| 780 | Ga0307509_10505643 | 3300031507 | Bacteria | 892 |
| 781 | Ga0307516_10000310 | 3300031730 | Bacteria | 63335 |
| 782 | Ga0307516_10105729 | 3300031730 | Unclassified | 2626 |
| 783 | Ga0307516_10556276 | 3300031730 | Bacteria | 801 |
| 784 | Ga0307413_10416392 | 3300031824 | Bacteria | 1057 |
| 785 | Ga0307410_10295184 | 3300031852 | Bacteria | 1277 |
| 786 | Ga0307412_10927157 | 3300031911 | Bacteria | 765 |
| 787 | Ga0307416_100469382 | 3300032002 | Bacteria | 1316 |
| 788 | Ga0307416_101688856 | 3300032002 | Bacteria | 738 |
| 789 | Ga0307414_10048812 | 3300032004 | Bacteria | 2923 |
| 790 | Ga0307414_10146317 | 3300032004 | Bacteria | 1857 |
| 791 | Ga0307414_10321574 | 3300032004 | Bacteria | 1317 |
| 792 | Ga0307411_10171240 | 3300032005 | Bacteria | 1638 |
| 793 | Ga0307415_100207344 | 3300032126 | Bacteria | 1561 |
| 794 | Ga0307510_10001062 | 3300033180 | Bacteria | 29213 |
| 795 | Ga0373923_0196712 | 3300035111 | Bacteria | 931 |
| 796 | Ga0373945_0045219 | 3300035116 | Bacteria | 1603 |
| 797 | Ga0373955_0101402 | 3300035172 | Unclassified | 1653 |
| 798 | Ga0373924_0103694 | 3300035410 | Unclassified | 1225 |
| 799 | Ga0373927_0011129 | 3300035695 | Bacteria | 5993 |
| 800 | Ga0373937_0002104 | 3300036401 | Bacteria | 16647 |
| 801 | Ga0265778_027271 | 3300036457 | Unclassified | 728 |
| 802 | Ga0395899_0014778 | 3300037312 | Bacteria | 5958 |
| 803 | Ga0395899_0018904 | 3300037312 | Bacteria | 5236 |
| 804 | Ga0395899_0420753 | 3300037312 | Bacteria | 880 |
| 805 | Ga0395899_0483603 | 3300037312 | Bacteria | 806 |
| 806 | Ga0395900_0003621 | 3300037418 | Bacteria | 16611 |
| 807 | Ga0395900_0025001 | 3300037418 | Bacteria | 6112 |
| 808 | Ga0395900_0025207 | 3300037418 | Bacteria | 6088 |
| 809 | Ga0395900_0154636 | 3300037418 | Bacteria | 2343 |
| 810 | Ga0395900_0273229 | 3300037418 | Unclassified | 1684 |
| 811 | Ga0395900_0450873 | 3300037418 | Unclassified | 1243 |
| 812 | Ga0395898_0054622 | 3300037466 | Bacteria | 3896 |
| 813 | Ga0395898_0068641 | 3300037466 | Bacteria | 3430 |
| 814 | Ga0395898_0277980 | 3300037466 | Bacteria | 1597 |
| 815 | Ga0395905_0005020 | 3300037471 | Bacteria | 13627 |
| 816 | Ga0395905_0036628 | 3300037471 | Bacteria | 4608 |
| 817 | Ga0395905_0068963 | 3300037471 | Bacteria | 3312 |
| 818 | Ga0395905_0378668 | 3300037471 | Bacteria | 1309 |
| 819 | Ga0395901_0012784 | 3300038443 | Bacteria | 8515 |
| 820 | Ga0395901_0063596 | 3300038443 | Bacteria | 3840 |
| 821 | Ga0395901_0305359 | 3300038443 | Bacteria | 1649 |
| 822 | Ga0395901_0474814 | 3300038443 | Bacteria | 1276 |
| 823 | Ga0395901_0561521 | 3300038443 | Bacteria | 1155 |
| 824 | Ga0395901_0599806 | 3300038443 | Bacteria | 1110 |
| 825 | Ga0436365_0262826 | 3300039437 | Bacteria | 23593 |
| 826 | Ga0439436_0007077 | 3300041404 | Bacteria | 3453 |
| 827 | Ga0439436_0075319 | 3300041404 | Bacteria | 940 |
| 828 | Ga0439439_0006329 | 3300041406 | Bacteria | 2737 |
| 829 | Ga0439439_0015516 | 3300041406 | Bacteria | 1862 |
| 830 | Ga0439466_0089903 | 3300041411 | Bacteria | 963 |
| 831 | Ga0439465_0010085 | 3300041413 | Bacteria | 2971 |
| 832 | Ga0451807_1400206 | 3300041486 | Unclassified | 1758 |
| 833 | Ga0451849_0783274 | 3300041505 | Bacteria | 1467 |
| 834 | Ga0451853_1183943 | 3300041512 | Bacteria | 730 |
| 835 | Ga0451853_3160169 | 3300041512 | Bacteria | 1086 |
| 836 | Ga0439431_0009061 | 3300041997 | Bacteria | 2243 |
| 837 | Ga0439431_0013467 | 3300041997 | Bacteria | 1887 |
| 838 | Ga0439431_0013552 | 3300041997 | Bacteria | 1882 |
| 839 | Ga0439441_076499 | 3300042001 | Bacteria | 724 |
| 840 | Ga0439442_010332 | 3300042002 | Bacteria | 1892 |
| 841 | Ga0439445_0011101 | 3300042004 | Bacteria | 2142 |
| 842 | Ga0439445_0113951 | 3300042004 | Unclassified | 773 |
| 843 | Ga0439445_0114136 | 3300042004 | Bacteria | 772 |
| 844 | Ga0439449_0001249 | 3300042007 | Bacteria | 9967 |
| 845 | Ga0439449_0025032 | 3300042007 | Bacteria | 2230 |
| 846 | Ga0439449_0025747 | 3300042007 | Bacteria | 2198 |
| 847 | Ga0439457_002994 | 3300042014 | Bacteria | 4694 |
| 848 | Ga0439457_003090 | 3300042014 | Bacteria | 4602 |
| 849 | Ga0439457_004882 | 3300042014 | Bacteria | 3444 |
| 850 | Ga0439457_024395 | 3300042014 | Bacteria | 1339 |
| 851 | Ga0439462_0001411 | 3300042015 | Bacteria | 5333 |
| 852 | Ga0450896_013997 | 3300042133 | Bacteria | 1144 |
| 853 | Ga0450898_004825 | 3300042134 | Bacteria | 2012 |
| 854 | Ga0450899_000898 | 3300042135 | Bacteria | 3392 |
| 855 | Ga0439434_0004572 | 3300042435 | Bacteria | 4049 |
| 856 | Ga0451577_0098047 | 3300042876 | Bacteria | 2618 |
| 857 | Ga0451577_0523880 | 3300042876 | Unclassified | 1076 |
| 858 | Ga0466969_0000382 | 3300044656 | Bacteria | 24366 |
| 859 | Ga0466972_0000010 | 3300044658 | Bacteria | 256339 |
| 860 | Ga0466972_0000143 | 3300044658 | Bacteria | 58694 |
| 861 | Ga0466972_0006101 | 3300044658 | Bacteria | 6054 |
| 862 | Ga0466972_0027460 | 3300044658 | Bacteria | 2815 |
| 863 | Ga0466972_0167925 | 3300044658 | Bacteria | 1030 |
| 864 | Ga0453683_0209423 | 3300044673 | Bacteria | 1238 |
| 865 | Ga0453683_0236351 | 3300044673 | Bacteria | 1163 |
| 866 | Ga0466965_0376654 | 3300044683 | Bacteria | 781 |
| 867 | Ga0466966_0000176 | 3300044684 | Bacteria | 42093 |
| 868 | Ga0466961_0099771 | 3300044693 | Unclassified | 1830 |
| 869 | Ga0466961_0167302 | 3300044693 | Unclassified | 1368 |
| 870 | Ga0466964_0018699 | 3300044706 | Bacteria | 2661 |
| 871 | Ga0453684_0082105 | 3300044712 | Bacteria | 4016 |
| 872 | Ga0453684_0389835 | 3300044712 | Bacteria | 1562 |
| 873 | Ga0453684_0633051 | 3300044712 | Bacteria | 1169 |
| 874 | Ga0453684_0717052 | 3300044712 | Bacteria | 1085 |
| 875 | Ga0466971_0063904 | 3300044719 | Unclassified | 1666 |
| 876 | Ga0466968_0007972 | 3300044735 | Bacteria | 4046 |
| 877 | Ga0466968_0219604 | 3300044735 | Bacteria | 895 |
| 878 | Ga0466970_0000921 | 3300044765 | Bacteria | 14222 |
| 879 | Ga0466970_0115434 | 3300044765 | Unclassified | 1468 |
| 880 | Ga0466970_0175637 | 3300044765 | Bacteria | 1188 |
| 881 | Ga0466970_0190026 | 3300044765 | Bacteria | 1141 |
| 882 | Ga0466970_0230620 | 3300044765 | Bacteria | 1035 |
| 883 | Ga0466957_0000577 | 3300044842 | Bacteria | 18517 |
| 884 | Ga0466957_0385784 | 3300044842 | Bacteria | 956 |
| 885 | Ga0466960_0030304 | 3300044901 | Bacteria | 2489 |
| 886 | Ga0466959_0000016 | 3300045049 | Bacteria | 144600 |
| 887 | Ga0466959_0014668 | 3300045049 | Bacteria | 5702 |
| 888 | Ga0466959_0035604 | 3300045049 | Bacteria | 3680 |
| 889 | Ga0466959_0059627 | 3300045049 | Bacteria | 2779 |
| 890 | Ga0495592_0182992 | 3300046454 | Unclassified | 1426 |
| 891 | Ga0495629_0214769 | 3300046459 | Bacteria | 1328 |
| 892 | Ga0495638_0165194 | 3300046460 | Bacteria | 1274 |
| 893 | Ga0495653_0199091 | 3300046463 | Bacteria | 1361 |
| 894 | Ga0495606_0002808 | 3300046507 | Bacteria | 19390 |
| 895 | Ga0495608_0264376 | 3300046511 | Unclassified | 1070 |
| 896 | Ga0495618_0480110 | 3300046514 | Bacteria | 751 |
| 897 | Ga0495628_0192773 | 3300046516 | Bacteria | 1538 |
| 898 | Ga0495630_0003153 | 3300046517 | Bacteria | 11441 |
| 899 | Ga0495648_0008648 | 3300046524 | Bacteria | 7982 |
| 900 | Ga0495648_0228485 | 3300046524 | Bacteria | 913 |
| 901 | Ga0495652_0526627 | 3300046529 | Unclassified | 816 |
| 902 | Ga0495640_0226365 | 3300046533 | Bacteria | 1178 |
| 903 | Ga0495622_0043460 | 3300046557 | Bacteria | 2089 |
| 904 | Ga0495667_0218117 | 3300046559 | Bacteria | 1218 |
| 905 | Ga0495634_0054328 | 3300046642 | Bacteria | 2682 |
| 906 | Ga0495611_0000231 | 3300046648 | Bacteria | 38409 |
| 907 | Ga0495611_0234725 | 3300046648 | Unclassified | 852 |
| 908 | Ga0495625_0101589 | 3300046660 | Bacteria | 1975 |
| 909 | Ga0495635_0236624 | 3300046663 | Unclassified | 1233 |
| 910 | Ga0495657_0269380 | 3300046675 | Bacteria | 1021 |
| 911 | Ga0495647_0180837 | 3300046681 | Bacteria | 917 |
| 912 | Ga0495658_0004169 | 3300046683 | Bacteria | 7120 |
| 913 | Ga0495604_0213874 | 3300047317 | Bacteria | 1331 |
| 914 | Ga0495674_0006177 | 3300047319 | Bacteria | 11493 |
| 915 | Ga0495674_0080161 | 3300047319 | Bacteria | 2802 |
| 916 | Ga0495672_0018917 | 3300047320 | Bacteria | 4559 |
| 917 | Ga0495680_0374124 | 3300047322 | Unclassified | 988 |
| 918 | Ga0495687_000111 | 3300047443 | Bacteria | 124789 |
| 919 | Ga0495684_0051254 | 3300047471 | Bacteria | 3150 |
| 920 | Ga0495686_0088327 | 3300047472 | Bacteria | 1885 |
| 921 | Ga0495602_0152944 | 3300048088 | Bacteria | 1811 |
| 922 | Ga0496101_0008686 | 3300048904 | Bacteria | 6643 |
| 923 | Ga0496104_0447940 | 3300048907 | Bacteria | 1203 |
| 924 | Ga0496105_0606482 | 3300048908 | Unclassified | 849 |
| 925 | Ga0496107_0605268 | 3300048910 | Bacteria | 810 |
| 926 | Ga0496110_0313645 | 3300048913 | Bacteria | 1428 |
| 927 | Ga0496114_0000397 | 3300048917 | Bacteria | 32141 |
| 928 | Ga0496114_0006425 | 3300048917 | Bacteria | 9254 |
| 929 | Ga0496114_0370946 | 3300048917 | Bacteria | 1267 |
| 930 | Ga0496114_0907236 | 3300048917 | Bacteria | 762 |
| 931 | Ga0496115_0331579 | 3300048918 | Bacteria | 1243 |
| 932 | Ga0496121_0000051 | 3300048924 | Bacteria | 315378 |
| 933 | Ga0496124_0112179 | 3300048927 | Bacteria | 2193 |
| 934 | Ga0501308_024175 | 3300049128 | Bacteria | 780 |
| 935 | Ga0501310_011220 | 3300049130 | Bacteria | 1011 |
| 936 | Ga0501310_023358 | 3300049130 | Bacteria | 786 |
| 937 | Ga0501343_009116 | 3300049132 | Bacteria | 799 |
| 938 | Ga0501304_014492 | 3300049160 | Bacteria | 731 |
| 939 | Ga0501292_005013 | 3300049515 | Bacteria | 1833 |
| 940 | Ga0501298_001144 | 3300049521 | Bacteria | 3837 |
| 941 | Ga0501312_022575 | 3300049528 | Bacteria | 943 |
| 942 | Ga0501312_051533 | 3300049528 | Bacteria | 695 |
| 943 | Ga0501313_020034 | 3300049529 | Unclassified | 821 |
| 944 | Ga0501313_025394 | 3300049529 | Bacteria | 750 |
| 945 | Ga0501314_005951 | 3300049530 | Bacteria | 1052 |
| 946 | Ga0501314_007552 | 3300049530 | Bacteria | 966 |
| 947 | Ga0501315_002390 | 3300049531 | Bacteria | 1757 |
| 948 | Ga0501316_012632 | 3300049532 | Bacteria | 989 |
| 949 | Ga0501319_003437 | 3300049535 | Bacteria | 1058 |
| 950 | Ga0501323_037544 | 3300049539 | Bacteria | 701 |
| 951 | Ga0501337_004936 | 3300049553 | Unclassified | 883 |
| 952 | Ga0501338_05278 | 3300049554 | Bacteria | 798 |
| 953 | Ga0501033_0019886 | 3300049570 | Bacteria | 5075 |
| 954 | Ga0501033_0224297 | 3300049570 | Bacteria | 1337 |
| 955 | Ga0501033_0238245 | 3300049570 | Bacteria | 1291 |
| 956 | Ga0501033_0305814 | 3300049570 | Bacteria | 1119 |
| 957 | Ga0501034_0022432 | 3300049571 | Bacteria | 6434 |
| 958 | Ga0501034_0046484 | 3300049571 | Bacteria | 4385 |
| 959 | Ga0501034_0099393 | 3300049571 | Bacteria | 2904 |
| 960 | Ga0501034_0405389 | 3300049571 | Bacteria | 1286 |
| 961 | Ga0501034_0792219 | 3300049571 | Bacteria | 841 |
| 962 | Ga0501036_0053937 | 3300049572 | Bacteria | 3404 |
| 963 | Ga0501037_0023146 | 3300049573 | Bacteria | 4595 |
| 964 | Ga0501037_0345966 | 3300049573 | Bacteria | 1026 |
| 965 | Ga0501038_0237267 | 3300049574 | Bacteria | 1449 |
| 966 | Ga0501043_0003586 | 3300049579 | Bacteria | 12742 |
| 967 | Ga0501043_0042539 | 3300049579 | Bacteria | 3570 |
| 968 | Ga0501043_0184099 | 3300049579 | Bacteria | 1627 |
| 969 | Ga0501047_0005137 | 3300049581 | Bacteria | 12283 |
| 970 | Ga0501047_0022222 | 3300049581 | Bacteria | 6095 |
| 971 | Ga0501047_0028692 | 3300049581 | Bacteria | 5367 |
| 972 | Ga0501069_0108360 | 3300049585 | Bacteria | 1580 |
| 973 | Ga0501070_0045242 | 3300049586 | Bacteria | 3661 |
| 974 | Ga0501070_0061556 | 3300049586 | Unclassified | 3109 |
| 975 | Ga0501070_0095944 | 3300049586 | Bacteria | 2453 |
| 976 | Ga0501198_002353 | 3300049649 | Bacteria | 2543 |
| 977 | Ga0501201_000015 | 3300049651 | Bacteria | 10456 |
| 978 | Ga0501202_001553 | 3300049652 | Bacteria | 3697 |
| 979 | Ga0501202_029338 | 3300049652 | Bacteria | 1140 |
| 980 | Ga0501207_007739 | 3300049654 | Bacteria | 1539 |
| 981 | Ga0501207_038145 | 3300049654 | Bacteria | 828 |
| 982 | Ga0501216_047605 | 3300049660 | Bacteria | 836 |
| 983 | Ga0501222_000903 | 3300049662 | Bacteria | 4259 |
| 984 | Ga0501227_012864 | 3300049665 | Bacteria | 1837 |
| 985 | Ga0501233_002623 | 3300049668 | Bacteria | 3180 |
| 986 | Ga0501233_074625 | 3300049668 | Bacteria | 864 |
| 987 | Ga0501235_000743 | 3300049669 | Bacteria | 6650 |
| 988 | Ga0501235_033463 | 3300049669 | Bacteria | 1164 |
| 989 | Ga0501238_019496 | 3300049671 | Bacteria | 953 |
| 990 | Ga0501240_000328 | 3300049673 | Bacteria | 3747 |
| 991 | Ga0501242_001195 | 3300049674 | Bacteria | 2556 |
| 992 | Ga0501243_000227 | 3300049675 | Bacteria | 6994 |
| 993 | Ga0501250_000666 | 3300049680 | Bacteria | 2464 |
| 994 | Ga0501252_000192 | 3300049682 | Bacteria | 4001 |
| 995 | Ga0501257_011575 | 3300049686 | Bacteria | 2015 |
| 996 | Ga0501257_017172 | 3300049686 | Bacteria | 1683 |
| 997 | Ga0501257_047767 | 3300049686 | Bacteria | 1062 |
| 998 | Ga0501259_000319 | 3300049688 | Bacteria | 7654 |
| 999 | Ga0501261_000658 | 3300049690 | Bacteria | 4339 |
| 1000 | Ga0501261_008731 | 3300049690 | Bacteria | 1312 |
| 1001 | Ga0501219_000650 | 3300049703 | Bacteria | 4948 |
| 1002 | Ga0501221_001008 | 3300049704 | Bacteria | 4632 |
| 1003 | Ga0501225_0000561 | 3300049705 | Bacteria | 11624 |
| 1004 | Ga0501225_0002441 | 3300049705 | Bacteria | 5743 |
| 1005 | Ga0501245_000123 | 3300049708 | Bacteria | 7876 |
| 1006 | Ga0501080_0278625 | 3300049742 | Bacteria | 1521 |
| 1007 | Ga0501080_0327808 | 3300049742 | Bacteria | 1385 |
| 1008 | Ga0501080_0386263 | 3300049742 | Unclassified | 1261 |
| 1009 | Ga0501241_001865 | 3300049758 | Bacteria | 4149 |
| 1010 | Ga0501266_001851 | 3300049763 | Bacteria | 2667 |
| 1011 | Ga0501268_072676 | 3300049765 | Bacteria | 698 |
| 1012 | Ga0501035_0016926 | 3300049822 | Bacteria | 6720 |
| 1013 | Ga0501035_0029491 | 3300049822 | Bacteria | 5003 |
| 1014 | Ga0501035_0106678 | 3300049822 | Bacteria | 2456 |
| 1015 | Ga0501035_0583474 | 3300049822 | Unclassified | 913 |
| 1016 | Ga0501035_0587796 | 3300049822 | Bacteria | 909 |
| 1017 | Ga0501044_0034967 | 3300049823 | Bacteria | 5264 |
| 1018 | Ga0501044_0300321 | 3300049823 | Unclassified | 1535 |
| 1019 | Ga0501044_0320531 | 3300049823 | Bacteria | 1474 |
| 1020 | Ga0501284_00005 | 3300050005 | Bacteria | 164758 |
| 1021 | nmdc:mga0k408_132857_c1 | 3300050493 | Bacteria | 1478 |
| 1022 | nmdc:mga0k408_1625_c3 | 3300050493 | Bacteria | 5649 |
| 1023 | nmdc:mga0k408_25436_c1 | 3300050493 | Bacteria | 3353 |
| 1024 | nmdc:mga0k408_395428_c1 | 3300050493 | Bacteria | 823 |
| 1025 | nmdc:mga0k408_7175_c1 | 3300050493 | Bacteria | 4771 |
| 1026 | nmdc:mga05p37_181524_c1 | 3300050507 | Unclassified | 2560 |
| 1027 | nmdc:mga05p37_914_c1 | 3300050507 | Bacteria | 33336 |
| 1028 | nmdc:mga09592_112309_c1 | 3300050508 | Unclassified | 2338 |
| 1029 | nmdc:mga06r32_20749_c1 | 3300050510 | Bacteria | 6052 |
| 1030 | nmdc:mga08y16_12509_c1 | 3300050511 | Bacteria | 8927 |
| 1031 | Ga0500578_0027483 | 3300053086 | Bacteria | 3654 |
| 1032 | Ga0500578_0117443 | 3300053086 | Bacteria | 1674 |
| 1033 | Ga0500644_0000032 | 3300053088 | Bacteria | 85851 |
| 1034 | Ga0500646_0004811 | 3300053090 | Bacteria | 3421 |
| 1035 | Ga0500646_0023054 | 3300053090 | Bacteria | 1668 |
| 1036 | Ga0500646_0031861 | 3300053090 | Bacteria | 1452 |
| 1037 | Ga0500583_0000037 | 3300053092 | Bacteria | 92466 |
| 1038 | Ga0500583_0001860 | 3300053092 | Bacteria | 6168 |
| 1039 | Ga0500583_0006441 | 3300053092 | Bacteria | 4041 |
| 1040 | Ga0500569_000056 | 3300053109 | Bacteria | 19932 |
| 1041 | Ga0500642_0068450 | 3300053130 | Bacteria | 1611 |
| 1042 | Ga0500652_015609 | 3300053131 | Bacteria | 2745 |
| 1043 | Ga0500658_0119642 | 3300053134 | Bacteria | 1166 |
| 1044 | Ga0500568_0001302 | 3300053139 | Bacteria | 16386 |
| 1045 | Ga0500568_0023320 | 3300053139 | Bacteria | 2633 |
| 1046 | Ga0500573_0133851 | 3300053140 | Bacteria | 1371 |
| 1047 | Ga0500577_0002744 | 3300053142 | Bacteria | 4522 |
| 1048 | Ga0500588_0010847 | 3300053146 | Bacteria | 2215 |
| 1049 | Ga0500589_059274 | 3300053147 | Bacteria | 1758 |
| 1050 | Ga0500590_028379 | 3300053148 | Bacteria | 2904 |
| 1051 | Ga0500604_0002834 | 3300053151 | Bacteria | 4707 |
| 1052 | Ga0500616_0006422 | 3300053153 | Bacteria | 7702 |
| 1053 | Ga0500616_0012198 | 3300053153 | Bacteria | 5036 |
| 1054 | Ga0500616_0069763 | 3300053153 | Bacteria | 1796 |
| 1055 | Ga0500616_0124652 | 3300053153 | Bacteria | 1225 |
| 1056 | Ga0500622_0006216 | 3300053156 | Bacteria | 6988 |
| 1057 | Ga0500622_0062897 | 3300053156 | Bacteria | 1890 |
| 1058 | Ga0500633_0005002 | 3300053160 | Bacteria | 3105 |
| 1059 | Ga0500634_0060050 | 3300053161 | Bacteria | 2020 |
| 1060 | Ga0500639_096414 | 3300053163 | Bacteria | 1464 |
| 1061 | Ga0500636_0080702 | 3300053177 | Bacteria | 1874 |
| 1062 | Ga0500637_0127480 | 3300053178 | Bacteria | 1476 |
| 1063 | Ga0500611_000004 | 3300053727 | Bacteria | 253326 |
| 1064 | Ga0501084_0129706 | 3300054114 | Bacteria | 2122 |
| 1065 | Ga0500661_014040 | 3300055283 | Bacteria | 1442 |
| 1066 | Ga0587073_0145722 | 3300059492 | Bacteria | 665 |
| 1067 | Ga0587077_017533 | 3300059493 | Bacteria | 1222 |
| 1068 | Ga0587077_094413 | 3300059493 | Bacteria | 709 |
| 1069 | Ga0587077_097345 | 3300059493 | Bacteria | 701 |
| 1070 | Ga0587080_071993 | 3300059503 | Bacteria | 693 |
| 1071 | Ga0587090_065552 | 3300059510 | Bacteria | 698 |
| 1072 | Ga0587090_072724 | 3300059510 | Bacteria | 675 |
| 1073 | Ga0587109_063764 | 3300059624 | Unclassified | 782 |
| 1074 | Ga0587128_060747 | 3300059630 | Bacteria | 713 |
| 1075 | Ga0587108_012644 | 3300059653 | Bacteria | 733 |
| 1076 | Ga0501082_0340214 | 3300060353 | Unclassified | 1307 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003320 | rootH2_10220086 | rootH2_102200862 | 195 |
| 2 | 3300046557 | Ga0495622_0043460 | Ga0495622_0043460_162_752 | 196 |
| 3 | 3300026118 | Ga0207675_100074291 | Ga0207675_1000742913 | 198 |
| 4 | 3300020080 | Ga0206350_10720946 | Ga0206350_107209461 | 207 |
| 5 | iso_pu_bacteria | 2738541278 | 2738726078 | 207 |
| 6 | iso_pu_bacteria | 2818991442 | 2819577285 | 207 |
| 7 | iso_pu_bacteria | 2818991444 | 2819590391 | 207 |
| 8 | iso_pu_bacteria | 2818991460 | 2819676432 | 207 |
| 9 | iso_pu_bacteria | 2821136567 | 2821140588 | 207 |
| 10 | iso_pu_bacteria | 2840677318 | 2840678273 | 207 |
| 11 | iso_pu_bacteria | 2852623160 | 2852625131 | 207 |
| 12 | iso_pu_bacteria | 2883068021 | 2883070534 | 207 |
| 13 | iso_pu_bacteria | 2884791551 | 2884796263 | 207 |
| 14 | iso_pu_bacteria | 2884933994 | 2884934149 | 207 |
| 15 | iso_pu_bacteria | 2896085136 | 2896086090 | 207 |
| 16 | iso_pu_bacteria | 2896109856 | 2896115342 | 207 |
| 17 | iso_pu_bacteria | 2904467357 | 2904473007 | 207 |
| 18 | iso_pu_bacteria | 2929177148 | 2929178219 | 207 |
| 19 | iso_pu_bacteria | 2929239360 | 2929240531 | 207 |
| 20 | iso_pu_bacteria | 2929921140 | 2929922367 | 207 |
| 21 | iso_pu_bacteria | 2945977869 | 2945980581 | 207 |
| 22 | iso_pu_bacteria | 2946013367 | 2946013556 | 207 |
| 23 | iso_pu_bacteria | 8003151029 | 8003156785 | 207 |
| 24 | 3300005327 | Ga0070658_10010368 | Ga0070658_100103689 | 209 |
| 25 | 3300005336 | Ga0070680_100096590 | Ga0070680_1000965902 | 209 |
| 26 | 3300005456 | Ga0070678_101079450 | Ga0070678_1010794501 | 209 |
| 27 | 3300005535 | Ga0070684_100152960 | Ga0070684_1001529601 | 209 |
| 28 | 3300005543 | Ga0070672_100577432 | Ga0070672_1005774321 | 209 |
| 29 | 3300005563 | Ga0068855_100394834 | Ga0068855_1003948343 | 209 |
| 30 | 3300005577 | Ga0068857_100348961 | Ga0068857_1003489611 | 209 |
| 31 | 3300005616 | Ga0068852_100006054 | Ga0068852_1000060548 | 209 |
| 32 | 3300009093 | Ga0105240_10071237 | Ga0105240_100712375 | 209 |
| 33 | 3300009093 | Ga0105240_11326747 | Ga0105240_113267471 | 209 |
| 34 | 3300009545 | Ga0105237_10055660 | Ga0105237_100556603 | 209 |
| 35 | 3300013104 | Ga0157370_10540417 | Ga0157370_105404171 | 209 |
| 36 | 3300013104 | Ga0157370_11211925 | Ga0157370_112119251 | 209 |
| 37 | 3300013105 | Ga0157369_10010202 | Ga0157369_100102029 | 209 |
| 38 | 3300013105 | Ga0157369_10998971 | Ga0157369_109989711 | 209 |
| 39 | 3300013307 | Ga0157372_10847988 | Ga0157372_108479882 | 209 |
| 40 | 3300013307 | Ga0157372_11961646 | Ga0157372_119616461 | 209 |
| 41 | 3300025909 | Ga0207705_10282138 | Ga0207705_102821382 | 209 |
| 42 | 3300025912 | Ga0207707_10343707 | Ga0207707_103437072 | 209 |
| 43 | 3300025914 | Ga0207671_10022134 | Ga0207671_100221346 | 209 |
| 44 | 3300026041 | Ga0207639_10636168 | Ga0207639_106361682 | 209 |
| 45 | 3300026142 | Ga0207698_10056171 | Ga0207698_100561713 | 209 |
| 46 | 3300005327 | Ga0070658_10141091 | Ga0070658_101410911 | 210 |
| 47 | 3300005366 | Ga0070659_100064593 | Ga0070659_1000645933 | 210 |
| 48 | 3300005458 | Ga0070681_10822982 | Ga0070681_108229821 | 210 |
| 49 | 3300005530 | Ga0070679_100072510 | Ga0070679_1000725102 | 210 |
| 50 | 3300005563 | Ga0068855_100001137 | Ga0068855_10000113723 | 210 |
| 51 | 3300013100 | Ga0157373_10000876 | Ga0157373_100008766 | 210 |
| 52 | 3300013102 | Ga0157371_10001606 | Ga0157371_1000160615 | 210 |
| 53 | 3300013102 | Ga0157371_10011045 | Ga0157371_100110455 | 210 |
| 54 | 3300013104 | Ga0157370_10000473 | Ga0157370_1000047319 | 210 |
| 55 | 3300013307 | Ga0157372_10033052 | Ga0157372_100330524 | 210 |
| 56 | 3300013307 | Ga0157372_10054533 | Ga0157372_100545334 | 210 |
| 57 | 3300025932 | Ga0207690_10226221 | Ga0207690_102262212 | 210 |
| 58 | 3300025949 | Ga0207667_10002129 | Ga0207667_1000212916 | 210 |
| 59 | 3300037312 | Ga0395899_0014778 | Ga0395899_0014778_2474_3106 | 210 |
| 60 | 3300037418 | Ga0395900_0025001 | Ga0395900_0025001_3497_4129 | 210 |
| 61 | 3300037418 | Ga0395900_0025207 | Ga0395900_0025207_2524_3156 | 210 |
| 62 | 3300037466 | Ga0395898_0054622 | Ga0395898_0054622_3184_3816 | 210 |
| 63 | 3300037466 | Ga0395898_0068641 | Ga0395898_0068641_325_957 | 210 |
| 64 | 3300037471 | Ga0395905_0036628 | Ga0395905_0036628_3935_4567 | 210 |
| 65 | 3300038443 | Ga0395901_0012784 | Ga0395901_0012784_3083_3715 | 210 |
| 66 | 3300038443 | Ga0395901_0063596 | Ga0395901_0063596_3103_3735 | 210 |
| 67 | 3300038443 | Ga0395901_0561521 | Ga0395901_0561521_28_660 | 210 |
| 68 | 3300038443 | Ga0395901_0599806 | Ga0395901_0599806_368_1000 | 210 |
| 69 | 3300049554 | Ga0501338_05278 | Ga0501338_05278_94_726 | 210 |
| 70 | 3300059493 | Ga0587077_017533 | Ga0587077_017533_353_985 | 210 |
| 71 | 3300001979 | JGI24740J21852_10003348 | JGI24740J21852_100033485 | 211 |
| 72 | 3300002738 | JGI25154J39366_1000120 | JGI25154J39366_100012010 | 211 |
| 73 | 3300002738 | JGI25154J39366_1012097 | JGI25154J39366_10120972 | 211 |
| 74 | 3300003163 | Ga0006759J45824_1076550 | Ga0006759J45824_10765501 | 211 |
| 75 | 3300003300 | Ga0006758J48902_1015743 | Ga0006758J48902_10157431 | 211 |
| 76 | 3300003316 | rootH1_10023748 | rootH1_100237482 | 211 |
| 77 | 3300003320 | rootH2_10019577 | rootH2_100195776 | 211 |
| 78 | 3300003320 | rootH2_10158917 | rootH2_101589175 | 211 |
| 79 | 3300003322 | rootL2_10172417 | rootL2_101724175 | 211 |
| 80 | 3300003323 | rootH1_10065386 | rootH1_100653865 | 211 |
| 81 | 3300003323 | rootH1_10134083 | rootH1_101340832 | 211 |
| 82 | 3300003323 | rootH1_10165589 | rootH1_101655892 | 211 |
| 83 | 3300003323 | rootH1_10257422 | rootH1_102574223 | 211 |
| 84 | 3300003323 | rootH1_10260058 | rootH1_102600582 | 211 |
| 85 | 3300003771 | Ga0055526_1046463 | Ga0055526_10464631 | 211 |
| 86 | 3300003790 | Ga0055528_1023293 | Ga0055528_10232931 | 211 |
| 87 | 3300004799 | Ga0058863_11748294 | Ga0058863_117482941 | 211 |
| 88 | 3300004799 | Ga0058863_11905271 | Ga0058863_119052711 | 211 |
| 89 | 3300004800 | Ga0058861_11695319 | Ga0058861_116953191 | 211 |
| 90 | 3300004803 | Ga0058862_12773387 | Ga0058862_127733871 | 211 |
| 91 | 3300005262 | Ga0065165_1000436 | Ga0065165_100043610 | 211 |
| 92 | 3300005262 | Ga0065165_1010871 | Ga0065165_10108712 | 211 |
| 93 | 3300005262 | Ga0065165_1027698 | Ga0065165_10276982 | 211 |
| 94 | 3300005288 | Ga0065714_10264965 | Ga0065714_102649651 | 211 |
| 95 | 3300005289 | Ga0065704_10147972 | Ga0065704_101479722 | 211 |
| 96 | 3300005290 | Ga0065712_10000661 | Ga0065712_100006614 | 211 |
| 97 | 3300005290 | Ga0065712_10112451 | Ga0065712_101124511 | 211 |
| 98 | 3300005295 | Ga0065707_10127771 | Ga0065707_101277712 | 211 |
| 99 | 3300005295 | Ga0065707_10183691 | Ga0065707_101836912 | 211 |
| 100 | 3300005327 | Ga0070658_10040039 | Ga0070658_100400393 | 211 |
| 101 | 3300005327 | Ga0070658_10170037 | Ga0070658_101700372 | 211 |
| 102 | 3300005328 | Ga0070676_10007488 | Ga0070676_100074884 | 211 |
| 103 | 3300005328 | Ga0070676_10007533 | Ga0070676_100075335 | 211 |
| 104 | 3300005328 | Ga0070676_10012382 | Ga0070676_100123823 | 211 |
| 105 | 3300005329 | Ga0070683_100049320 | Ga0070683_1000493203 | 211 |
| 106 | 3300005329 | Ga0070683_100080317 | Ga0070683_1000803175 | 211 |
| 107 | 3300005329 | Ga0070683_100329379 | Ga0070683_1003293792 | 211 |
| 108 | 3300005331 | Ga0070670_100021730 | Ga0070670_1000217305 | 211 |
| 109 | 3300005331 | Ga0070670_100026081 | Ga0070670_1000260814 | 211 |
| 110 | 3300005331 | Ga0070670_100242729 | Ga0070670_1002427292 | 211 |
| 111 | 3300005334 | Ga0068869_100001213 | Ga0068869_1000012135 | 211 |
| 112 | 3300005334 | Ga0068869_100008940 | Ga0068869_1000089406 | 211 |
| 113 | 3300005334 | Ga0068869_100059511 | Ga0068869_1000595112 | 211 |
| 114 | 3300005334 | Ga0068869_100119531 | Ga0068869_1001195313 | 211 |
| 115 | 3300005334 | Ga0068869_100161236 | Ga0068869_1001612362 | 211 |
| 116 | 3300005335 | Ga0070666_10035539 | Ga0070666_100355394 | 211 |
| 117 | 3300005336 | Ga0070680_100033145 | Ga0070680_1000331452 | 211 |
| 118 | 3300005336 | Ga0070680_100332018 | Ga0070680_1003320182 | 211 |
| 119 | 3300005337 | Ga0070682_100000462 | Ga0070682_10000046214 | 211 |
| 120 | 3300005337 | Ga0070682_100327279 | Ga0070682_1003272792 | 211 |
| 121 | 3300005338 | Ga0068868_100002430 | Ga0068868_1000024308 | 211 |
| 122 | 3300005338 | Ga0068868_100031755 | Ga0068868_1000317551 | 211 |
| 123 | 3300005338 | Ga0068868_100374083 | Ga0068868_1003740832 | 211 |
| 124 | 3300005338 | Ga0068868_100409264 | Ga0068868_1004092642 | 211 |
| 125 | 3300005339 | Ga0070660_100617242 | Ga0070660_1006172421 | 211 |
| 126 | 3300005339 | Ga0070660_101114491 | Ga0070660_1011144911 | 211 |
| 127 | 3300005340 | Ga0070689_100008276 | Ga0070689_1000082767 | 211 |
| 128 | 3300005340 | Ga0070689_100015958 | Ga0070689_1000159584 | 211 |
| 129 | 3300005340 | Ga0070689_100106396 | Ga0070689_1001063963 | 211 |
| 130 | 3300005340 | Ga0070689_100261644 | Ga0070689_1002616442 | 211 |
| 131 | 3300005341 | Ga0070691_10029945 | Ga0070691_100299452 | 211 |
| 132 | 3300005343 | Ga0070687_100443596 | Ga0070687_1004435961 | 211 |
| 133 | 3300005347 | Ga0070668_100002232 | Ga0070668_1000022324 | 211 |
| 134 | 3300005347 | Ga0070668_100007815 | Ga0070668_1000078155 | 211 |
| 135 | 3300005347 | Ga0070668_100034818 | Ga0070668_1000348182 | 211 |
| 136 | 3300005353 | Ga0070669_100007640 | Ga0070669_1000076402 | 211 |
| 137 | 3300005353 | Ga0070669_100081326 | Ga0070669_1000813263 | 211 |
| 138 | 3300005354 | Ga0070675_100004112 | Ga0070675_10000411211 | 211 |
| 139 | 3300005354 | Ga0070675_100164429 | Ga0070675_1001644293 | 211 |
| 140 | 3300005354 | Ga0070675_100293294 | Ga0070675_1002932942 | 211 |
| 141 | 3300005364 | Ga0070673_100084595 | Ga0070673_1000845953 | 211 |
| 142 | 3300005364 | Ga0070673_100110964 | Ga0070673_1001109643 | 211 |
| 143 | 3300005365 | Ga0070688_100001613 | Ga0070688_1000016138 | 211 |
| 144 | 3300005365 | Ga0070688_100022499 | Ga0070688_1000224993 | 211 |
| 145 | 3300005366 | Ga0070659_100084648 | Ga0070659_1000846483 | 211 |
| 146 | 3300005367 | Ga0070667_100019084 | Ga0070667_1000190845 | 211 |
| 147 | 3300005367 | Ga0070667_100132615 | Ga0070667_1001326153 | 211 |
| 148 | 3300005367 | Ga0070667_100752589 | Ga0070667_1007525891 | 211 |
| 149 | 3300005441 | Ga0070700_100082410 | Ga0070700_1000824101 | 211 |
| 150 | 3300005441 | Ga0070700_100957526 | Ga0070700_1009575261 | 211 |
| 151 | 3300005455 | Ga0070663_100187307 | Ga0070663_1001873071 | 211 |
| 152 | 3300005455 | Ga0070663_100222760 | Ga0070663_1002227601 | 211 |
| 153 | 3300005456 | Ga0070678_100237308 | Ga0070678_1002373082 | 211 |
| 154 | 3300005457 | Ga0070662_100581128 | Ga0070662_1005811281 | 211 |
| 155 | 3300005458 | Ga0070681_10015101 | Ga0070681_100151013 | 211 |
| 156 | 3300005458 | Ga0070681_10121009 | Ga0070681_101210093 | 211 |
| 157 | 3300005458 | Ga0070681_10234554 | Ga0070681_102345542 | 211 |
| 158 | 3300005459 | Ga0068867_100011969 | Ga0068867_1000119696 | 211 |
| 159 | 3300005459 | Ga0068867_100017092 | Ga0068867_1000170922 | 211 |
| 160 | 3300005459 | Ga0068867_100070399 | Ga0068867_1000703993 | 211 |
| 161 | 3300005459 | Ga0068867_100076890 | Ga0068867_1000768901 | 211 |
| 162 | 3300005471 | Ga0070698_100169759 | Ga0070698_1001697594 | 211 |
| 163 | 3300005535 | Ga0070684_100004834 | Ga0070684_1000048342 | 211 |
| 164 | 3300005535 | Ga0070684_100229730 | Ga0070684_1002297301 | 211 |
| 165 | 3300005535 | Ga0070684_100312971 | Ga0070684_1003129712 | 211 |
| 166 | 3300005536 | Ga0070697_100893625 | Ga0070697_1008936251 | 211 |
| 167 | 3300005539 | Ga0068853_100001974 | Ga0068853_10000197411 | 211 |
| 168 | 3300005539 | Ga0068853_100005501 | Ga0068853_1000055014 | 211 |
| 169 | 3300005539 | Ga0068853_100069345 | Ga0068853_1000693454 | 211 |
| 170 | 3300005539 | Ga0068853_100336038 | Ga0068853_1003360382 | 211 |
| 171 | 3300005539 | Ga0068853_100373846 | Ga0068853_1003738462 | 211 |
| 172 | 3300005539 | Ga0068853_100375034 | Ga0068853_1003750341 | 211 |
| 173 | 3300005543 | Ga0070672_100004965 | Ga0070672_1000049658 | 211 |
| 174 | 3300005543 | Ga0070672_100724560 | Ga0070672_1007245602 | 211 |
| 175 | 3300005547 | Ga0070693_100007859 | Ga0070693_1000078593 | 211 |
| 176 | 3300005548 | Ga0070665_100001841 | Ga0070665_10000184117 | 211 |
| 177 | 3300005548 | Ga0070665_100413701 | Ga0070665_1004137012 | 211 |
| 178 | 3300005563 | Ga0068855_100008055 | Ga0068855_10000805514 | 211 |
| 179 | 3300005563 | Ga0068855_100097149 | Ga0068855_1000971492 | 211 |
| 180 | 3300005563 | Ga0068855_100232262 | Ga0068855_1002322622 | 211 |
| 181 | 3300005563 | Ga0068855_100382828 | Ga0068855_1003828281 | 211 |
| 182 | 3300005564 | Ga0070664_100048180 | Ga0070664_1000481803 | 211 |
| 183 | 3300005564 | Ga0070664_100690732 | Ga0070664_1006907321 | 211 |
| 184 | 3300005577 | Ga0068857_100035941 | Ga0068857_1000359414 | 211 |
| 185 | 3300005577 | Ga0068857_100104574 | Ga0068857_1001045743 | 211 |
| 186 | 3300005577 | Ga0068857_100140462 | Ga0068857_1001404622 | 211 |
| 187 | 3300005577 | Ga0068857_100243862 | Ga0068857_1002438621 | 211 |
| 188 | 3300005577 | Ga0068857_100246023 | Ga0068857_1002460232 | 211 |
| 189 | 3300005577 | Ga0068857_100461469 | Ga0068857_1004614691 | 211 |
| 190 | 3300005577 | Ga0068857_100613648 | Ga0068857_1006136482 | 211 |
| 191 | 3300005578 | Ga0068854_100124333 | Ga0068854_1001243332 | 211 |
| 192 | 3300005578 | Ga0068854_100369306 | Ga0068854_1003693062 | 211 |
| 193 | 3300005614 | Ga0068856_100009166 | Ga0068856_1000091662 | 211 |
| 194 | 3300005614 | Ga0068856_100137317 | Ga0068856_1001373172 | 211 |
| 195 | 3300005616 | Ga0068852_100001659 | Ga0068852_1000016594 | 211 |
| 196 | 3300005616 | Ga0068852_100038053 | Ga0068852_1000380532 | 211 |
| 197 | 3300005616 | Ga0068852_100039117 | Ga0068852_1000391172 | 211 |
| 198 | 3300005616 | Ga0068852_100790408 | Ga0068852_1007904082 | 211 |
| 199 | 3300005617 | Ga0068859_100005939 | Ga0068859_1000059394 | 211 |
| 200 | 3300005617 | Ga0068859_100053444 | Ga0068859_1000534442 | 211 |
| 201 | 3300005617 | Ga0068859_100085938 | Ga0068859_1000859384 | 211 |
| 202 | 3300005617 | Ga0068859_100211768 | Ga0068859_1002117683 | 211 |
| 203 | 3300005617 | Ga0068859_100373945 | Ga0068859_1003739452 | 211 |
| 204 | 3300005618 | Ga0068864_100078167 | Ga0068864_1000781674 | 211 |
| 205 | 3300005719 | Ga0068861_100011956 | Ga0068861_1000119565 | 211 |
| 206 | 3300005719 | Ga0068861_100082382 | Ga0068861_1000823822 | 211 |
| 207 | 3300005719 | Ga0068861_100097495 | Ga0068861_1000974952 | 211 |
| 208 | 3300005719 | Ga0068861_100097774 | Ga0068861_1000977742 | 211 |
| 209 | 3300005719 | Ga0068861_100929290 | Ga0068861_1009292901 | 211 |
| 210 | 3300005834 | Ga0068851_10196126 | Ga0068851_101961262 | 211 |
| 211 | 3300005840 | Ga0068870_10013221 | Ga0068870_100132214 | 211 |
| 212 | 3300005841 | Ga0068863_100030116 | Ga0068863_1000301162 | 211 |
| 213 | 3300005841 | Ga0068863_100571603 | Ga0068863_1005716032 | 211 |
| 214 | 3300005842 | Ga0068858_100063023 | Ga0068858_1000630232 | 211 |
| 215 | 3300005842 | Ga0068858_100287788 | Ga0068858_1002877882 | 211 |
| 216 | 3300005842 | Ga0068858_100318255 | Ga0068858_1003182551 | 211 |
| 217 | 3300005842 | Ga0068858_100481076 | Ga0068858_1004810762 | 211 |
| 218 | 3300005843 | Ga0068860_100000052 | Ga0068860_10000005275 | 211 |
| 219 | 3300005843 | Ga0068860_100003681 | Ga0068860_10000368113 | 211 |
| 220 | 3300005843 | Ga0068860_100014258 | Ga0068860_1000142587 | 211 |
| 221 | 3300005843 | Ga0068860_100020337 | Ga0068860_1000203373 | 211 |
| 222 | 3300005843 | Ga0068860_100165723 | Ga0068860_1001657231 | 211 |
| 223 | 3300005843 | Ga0068860_100247929 | Ga0068860_1002479292 | 211 |
| 224 | 3300005843 | Ga0068860_100488768 | Ga0068860_1004887681 | 211 |
| 225 | 3300005843 | Ga0068860_100512583 | Ga0068860_1005125831 | 211 |
| 226 | 3300005844 | Ga0068862_100034043 | Ga0068862_1000340434 | 211 |
| 227 | 3300005844 | Ga0068862_100324559 | Ga0068862_1003245591 | 211 |
| 228 | 3300006178 | Ga0075367_10061073 | Ga0075367_100610733 | 211 |
| 229 | 3300006195 | Ga0075366_10008398 | Ga0075366_100083983 | 211 |
| 230 | 3300006195 | Ga0075366_10011185 | Ga0075366_100111853 | 211 |
| 231 | 3300006195 | Ga0075366_10161526 | Ga0075366_101615262 | 211 |
| 232 | 3300006195 | Ga0075366_10355010 | Ga0075366_103550102 | 211 |
| 233 | 3300006237 | Ga0097621_100000611 | Ga0097621_10000061129 | 211 |
| 234 | 3300006237 | Ga0097621_100014924 | Ga0097621_1000149245 | 211 |
| 235 | 3300006237 | Ga0097621_100070125 | Ga0097621_1000701253 | 211 |
| 236 | 3300006237 | Ga0097621_100133437 | Ga0097621_1001334374 | 211 |
| 237 | 3300006358 | Ga0068871_100010721 | Ga0068871_1000107213 | 211 |
| 238 | 3300006358 | Ga0068871_100012226 | Ga0068871_1000122268 | 211 |
| 239 | 3300006358 | Ga0068871_100248949 | Ga0068871_1002489492 | 211 |
| 240 | 3300006358 | Ga0068871_100771405 | Ga0068871_1007714052 | 211 |
| 241 | 3300006844 | Ga0075428_101064068 | Ga0075428_1010640681 | 211 |
| 242 | 3300006881 | Ga0068865_100015426 | Ga0068865_1000154262 | 211 |
| 243 | 3300006881 | Ga0068865_100128445 | Ga0068865_1001284451 | 211 |
| 244 | 3300006881 | Ga0068865_100141727 | Ga0068865_1001417272 | 211 |
| 245 | 3300006881 | Ga0068865_100177830 | Ga0068865_1001778302 | 211 |
| 246 | 3300006931 | Ga0097620_100005939 | Ga0097620_1000059394 | 211 |
| 247 | 3300006931 | Ga0097620_100053445 | Ga0097620_1000534452 | 211 |
| 248 | 3300006931 | Ga0097620_100085934 | Ga0097620_1000859344 | 211 |
| 249 | 3300006931 | Ga0097620_100211772 | Ga0097620_1002117723 | 211 |
| 250 | 3300006931 | Ga0097620_100373936 | Ga0097620_1003739362 | 211 |
| 251 | 3300009093 | Ga0105240_10000728 | Ga0105240_100007282 | 211 |
| 252 | 3300009093 | Ga0105240_10000822 | Ga0105240_1000082210 | 211 |
| 253 | 3300009093 | Ga0105240_10004785 | Ga0105240_100047851 | 211 |
| 254 | 3300009093 | Ga0105240_10007855 | Ga0105240_100078559 | 211 |
| 255 | 3300009093 | Ga0105240_10013063 | Ga0105240_100130638 | 211 |
| 256 | 3300009093 | Ga0105240_10052936 | Ga0105240_100529362 | 211 |
| 257 | 3300009093 | Ga0105240_10171975 | Ga0105240_101719752 | 211 |
| 258 | 3300009093 | Ga0105240_10642565 | Ga0105240_106425652 | 211 |
| 259 | 3300009094 | Ga0111539_10004306 | Ga0111539_100043066 | 211 |
| 260 | 3300009094 | Ga0111539_10319296 | Ga0111539_103192962 | 211 |
| 261 | 3300009147 | Ga0114129_10000608 | Ga0114129_1000060822 | 211 |
| 262 | 3300009174 | Ga0105241_10001316 | Ga0105241_100013165 | 211 |
| 263 | 3300009174 | Ga0105241_10004217 | Ga0105241_100042178 | 211 |
| 264 | 3300009174 | Ga0105241_10052751 | Ga0105241_100527512 | 211 |
| 265 | 3300009174 | Ga0105241_10341167 | Ga0105241_103411672 | 211 |
| 266 | 3300009176 | Ga0105242_10049843 | Ga0105242_100498435 | 211 |
| 267 | 3300009176 | Ga0105242_10204023 | Ga0105242_102040232 | 211 |
| 268 | 3300009177 | Ga0105248_10443938 | Ga0105248_104439382 | 211 |
| 269 | 3300009545 | Ga0105237_10000841 | Ga0105237_1000084112 | 211 |
| 270 | 3300009545 | Ga0105237_10002964 | Ga0105237_100029648 | 211 |
| 271 | 3300009545 | Ga0105237_10009111 | Ga0105237_100091118 | 211 |
| 272 | 3300009545 | Ga0105237_10018106 | Ga0105237_100181062 | 211 |
| 273 | 3300009545 | Ga0105237_10020183 | Ga0105237_100201833 | 211 |
| 274 | 3300009545 | Ga0105237_10132503 | Ga0105237_101325032 | 211 |
| 275 | 3300009545 | Ga0105237_10497778 | Ga0105237_104977782 | 211 |
| 276 | 3300009545 | Ga0105237_10551310 | Ga0105237_105513101 | 211 |
| 277 | 3300009551 | Ga0105238_10008635 | Ga0105238_100086353 | 211 |
| 278 | 3300009551 | Ga0105238_10016959 | Ga0105238_100169597 | 211 |
| 279 | 3300009551 | Ga0105238_10056612 | Ga0105238_100566121 | 211 |
| 280 | 3300009551 | Ga0105238_10118753 | Ga0105238_101187532 | 211 |
| 281 | 3300009551 | Ga0105238_10563538 | Ga0105238_105635382 | 211 |
| 282 | 3300009553 | Ga0105249_10000349 | Ga0105249_100003494 | 211 |
| 283 | 3300009553 | Ga0105249_10016031 | Ga0105249_100160311 | 211 |
| 284 | 3300009553 | Ga0105249_10081333 | Ga0105249_100813331 | 211 |
| 285 | 3300009553 | Ga0105249_10094912 | Ga0105249_100949122 | 211 |
| 286 | 3300009553 | Ga0105249_10100641 | Ga0105249_101006413 | 211 |
| 287 | 3300009553 | Ga0105249_10187466 | Ga0105249_101874661 | 211 |
| 288 | 3300010375 | Ga0105239_10000755 | Ga0105239_100007558 | 211 |
| 289 | 3300010375 | Ga0105239_10000936 | Ga0105239_1000093635 | 211 |
| 290 | 3300010375 | Ga0105239_10006358 | Ga0105239_100063582 | 211 |
| 291 | 3300010375 | Ga0105239_10016065 | Ga0105239_100160654 | 211 |
| 292 | 3300010375 | Ga0105239_10057673 | Ga0105239_100576731 | 211 |
| 293 | 3300010375 | Ga0105239_10140927 | Ga0105239_101409272 | 211 |
| 294 | 3300010375 | Ga0105239_10245842 | Ga0105239_102458422 | 211 |
| 295 | 3300010375 | Ga0105239_10252875 | Ga0105239_102528751 | 211 |
| 296 | 3300010375 | Ga0105239_10257525 | Ga0105239_102575252 | 211 |
| 297 | 3300011119 | Ga0105246_10207579 | Ga0105246_102075792 | 211 |
| 298 | 3300011119 | Ga0105246_10527338 | Ga0105246_105273382 | 211 |
| 299 | 3300013102 | Ga0157371_10002634 | Ga0157371_100026343 | 211 |
| 300 | 3300013102 | Ga0157371_10003627 | Ga0157371_100036274 | 211 |
| 301 | 3300013102 | Ga0157371_10016632 | Ga0157371_100166323 | 211 |
| 302 | 3300013102 | Ga0157371_10057895 | Ga0157371_100578953 | 211 |
| 303 | 3300013102 | Ga0157371_10108302 | Ga0157371_101083022 | 211 |
| 304 | 3300013102 | Ga0157371_10169691 | Ga0157371_101696912 | 211 |
| 305 | 3300013104 | Ga0157370_10000631 | Ga0157370_1000063119 | 211 |
| 306 | 3300013104 | Ga0157370_10001929 | Ga0157370_1000192927 | 211 |
| 307 | 3300013104 | Ga0157370_10003253 | Ga0157370_100032538 | 211 |
| 308 | 3300013104 | Ga0157370_10206077 | Ga0157370_102060771 | 211 |
| 309 | 3300013104 | Ga0157370_10575487 | Ga0157370_105754872 | 211 |
| 310 | 3300013105 | Ga0157369_10047443 | Ga0157369_100474432 | 211 |
| 311 | 3300013105 | Ga0157369_10190553 | Ga0157369_101905532 | 211 |
| 312 | 3300013105 | Ga0157369_10494325 | Ga0157369_104943252 | 211 |
| 313 | 3300013105 | Ga0157369_10636179 | Ga0157369_106361791 | 211 |
| 314 | 3300013296 | Ga0157374_10000082 | Ga0157374_1000008270 | 211 |
| 315 | 3300013296 | Ga0157374_10000237 | Ga0157374_1000023725 | 211 |
| 316 | 3300013296 | Ga0157374_10116823 | Ga0157374_101168232 | 211 |
| 317 | 3300013296 | Ga0157374_10159523 | Ga0157374_101595232 | 211 |
| 318 | 3300013296 | Ga0157374_10196242 | Ga0157374_101962422 | 211 |
| 319 | 3300013296 | Ga0157374_10362139 | Ga0157374_103621391 | 211 |
| 320 | 3300013296 | Ga0157374_10364020 | Ga0157374_103640202 | 211 |
| 321 | 3300013296 | Ga0157374_11259619 | Ga0157374_112596191 | 211 |
| 322 | 3300013297 | Ga0157378_10071369 | Ga0157378_100713693 | 211 |
| 323 | 3300013297 | Ga0157378_10409947 | Ga0157378_104099472 | 211 |
| 324 | 3300013306 | Ga0163162_10000086 | Ga0163162_1000008673 | 211 |
| 325 | 3300013306 | Ga0163162_10001051 | Ga0163162_1000105113 | 211 |
| 326 | 3300013306 | Ga0163162_10001766 | Ga0163162_100017665 | 211 |
| 327 | 3300013306 | Ga0163162_10006217 | Ga0163162_100062173 | 211 |
| 328 | 3300013306 | Ga0163162_10029801 | Ga0163162_100298014 | 211 |
| 329 | 3300013306 | Ga0163162_10371562 | Ga0163162_103715623 | 211 |
| 330 | 3300013307 | Ga0157372_10005832 | Ga0157372_100058323 | 211 |
| 331 | 3300013307 | Ga0157372_10057046 | Ga0157372_100570462 | 211 |
| 332 | 3300013307 | Ga0157372_10102814 | Ga0157372_101028142 | 211 |
| 333 | 3300013307 | Ga0157372_10211125 | Ga0157372_102111252 | 211 |
| 334 | 3300013307 | Ga0157372_10288797 | Ga0157372_102887972 | 211 |
| 335 | 3300013307 | Ga0157372_10407974 | Ga0157372_104079742 | 211 |
| 336 | 3300013307 | Ga0157372_10954588 | Ga0157372_109545882 | 211 |
| 337 | 3300013308 | Ga0157375_10000115 | Ga0157375_100001155 | 211 |
| 338 | 3300013308 | Ga0157375_10041963 | Ga0157375_100419632 | 211 |
| 339 | 3300013308 | Ga0157375_10072306 | Ga0157375_100723064 | 211 |
| 340 | 3300013308 | Ga0157375_10237762 | Ga0157375_102377622 | 211 |
| 341 | 3300014325 | Ga0163163_10000088 | Ga0163163_1000008850 | 211 |
| 342 | 3300014325 | Ga0163163_10000244 | Ga0163163_100002447 | 211 |
| 343 | 3300014326 | Ga0157380_10002932 | Ga0157380_100029325 | 211 |
| 344 | 3300014326 | Ga0157380_10314685 | Ga0157380_103146853 | 211 |
| 345 | 3300014745 | Ga0157377_10013206 | Ga0157377_100132064 | 211 |
| 346 | 3300014745 | Ga0157377_10046580 | Ga0157377_100465803 | 211 |
| 347 | 3300014745 | Ga0157377_10099087 | Ga0157377_100990872 | 211 |
| 348 | 3300014968 | Ga0157379_10011834 | Ga0157379_100118349 | 211 |
| 349 | 3300014968 | Ga0157379_10022878 | Ga0157379_100228783 | 211 |
| 350 | 3300014968 | Ga0157379_10083102 | Ga0157379_100831023 | 211 |
| 351 | 3300014968 | Ga0157379_10130716 | Ga0157379_101307163 | 211 |
| 352 | 3300014968 | Ga0157379_10412908 | Ga0157379_104129081 | 211 |
| 353 | 3300014968 | Ga0157379_10497234 | Ga0157379_104972341 | 211 |
| 354 | 3300014968 | Ga0157379_10523746 | Ga0157379_105237462 | 211 |
| 355 | 3300014969 | Ga0157376_10001060 | Ga0157376_100010605 | 211 |
| 356 | 3300014969 | Ga0157376_10006708 | Ga0157376_100067083 | 211 |
| 357 | 3300014969 | Ga0157376_10572390 | Ga0157376_105723902 | 211 |
| 358 | 3300014969 | Ga0157376_10719768 | Ga0157376_107197681 | 211 |
| 359 | 3300015265 | Ga0182005_1000100 | Ga0182005_100010034 | 211 |
| 360 | 3300017792 | Ga0163161_10000968 | Ga0163161_100009684 | 211 |
| 361 | 3300017792 | Ga0163161_10021573 | Ga0163161_100215731 | 211 |
| 362 | 3300017792 | Ga0163161_10063543 | Ga0163161_100635433 | 211 |
| 363 | 3300017792 | Ga0163161_10082782 | Ga0163161_100827824 | 211 |
| 364 | 3300021384 | Ga0213876_10010328 | Ga0213876_100103282 | 211 |
| 365 | 3300025208 | Ga0209436_100776 | Ga0209436_1007768 | 211 |
| 366 | 3300025208 | Ga0209436_110527 | Ga0209436_1105272 | 211 |
| 367 | 3300025242 | Ga0209258_100032 | Ga0209258_10003282 | 211 |
| 368 | 3300025246 | Ga0209646_1000050 | Ga0209646_100005046 | 211 |
| 369 | 3300025246 | Ga0209646_1001058 | Ga0209646_10010587 | 211 |
| 370 | 3300025250 | Ga0209026_1000452 | Ga0209026_10004525 | 211 |
| 371 | 3300025254 | Ga0209148_1000223 | Ga0209148_100022344 | 211 |
| 372 | 3300025273 | Ga0209673_1000042 | Ga0209673_1000042206 | 211 |
| 373 | 3300025284 | Ga0209130_1000921 | Ga0209130_100092113 | 211 |
| 374 | 3300025295 | Ga0209564_1009094 | Ga0209564_10090942 | 211 |
| 375 | 3300025297 | Ga0209758_1002389 | Ga0209758_10023893 | 211 |
| 376 | 3300025297 | Ga0209758_1018818 | Ga0209758_10188182 | 211 |
| 377 | 3300025298 | Ga0209050_1000295 | Ga0209050_10002958 | 211 |
| 378 | 3300025302 | Ga0207426_1000250 | Ga0207426_100025097 | 211 |
| 379 | 3300025302 | Ga0207426_1000549 | Ga0207426_10005496 | 211 |
| 380 | 3300025302 | Ga0207426_1000732 | Ga0207426_100073226 | 211 |
| 381 | 3300025302 | Ga0207426_1013618 | Ga0207426_10136183 | 211 |
| 382 | 3300025302 | Ga0207426_1039810 | Ga0207426_10398102 | 211 |
| 383 | 3300025303 | Ga0209051_1047707 | Ga0209051_10477072 | 211 |
| 384 | 3300025304 | Ga0209257_1011800 | Ga0209257_10118005 | 211 |
| 385 | 3300025315 | Ga0207697_10007749 | Ga0207697_100077493 | 211 |
| 386 | 3300025903 | Ga0207680_10103913 | Ga0207680_101039132 | 211 |
| 387 | 3300025903 | Ga0207680_10425120 | Ga0207680_104251201 | 211 |
| 388 | 3300025907 | Ga0207645_10007658 | Ga0207645_100076587 | 211 |
| 389 | 3300025907 | Ga0207645_10015110 | Ga0207645_100151105 | 211 |
| 390 | 3300025908 | Ga0207643_10036187 | Ga0207643_100361874 | 211 |
| 391 | 3300025909 | Ga0207705_10041346 | Ga0207705_100413462 | 211 |
| 392 | 3300025909 | Ga0207705_10332821 | Ga0207705_103328212 | 211 |
| 393 | 3300025911 | Ga0207654_10001648 | Ga0207654_100016483 | 211 |
| 394 | 3300025911 | Ga0207654_10022864 | Ga0207654_100228643 | 211 |
| 395 | 3300025911 | Ga0207654_10023652 | Ga0207654_100236522 | 211 |
| 396 | 3300025911 | Ga0207654_10118760 | Ga0207654_101187602 | 211 |
| 397 | 3300025911 | Ga0207654_10259889 | Ga0207654_102598892 | 211 |
| 398 | 3300025912 | Ga0207707_10004161 | Ga0207707_100041613 | 211 |
| 399 | 3300025913 | Ga0207695_10000189 | Ga0207695_10000189163 | 211 |
| 400 | 3300025913 | Ga0207695_10000839 | Ga0207695_1000083910 | 211 |
| 401 | 3300025913 | Ga0207695_10001190 | Ga0207695_1000119016 | 211 |
| 402 | 3300025913 | Ga0207695_10024238 | Ga0207695_100242384 | 211 |
| 403 | 3300025913 | Ga0207695_10067448 | Ga0207695_100674483 | 211 |
| 404 | 3300025913 | Ga0207695_10213366 | Ga0207695_102133662 | 211 |
| 405 | 3300025914 | Ga0207671_10002710 | Ga0207671_1000271012 | 211 |
| 406 | 3300025914 | Ga0207671_10005708 | Ga0207671_100057081 | 211 |
| 407 | 3300025914 | Ga0207671_10009702 | Ga0207671_100097023 | 211 |
| 408 | 3300025914 | Ga0207671_10020062 | Ga0207671_100200622 | 211 |
| 409 | 3300025914 | Ga0207671_10023275 | Ga0207671_100232752 | 211 |
| 410 | 3300025914 | Ga0207671_10075636 | Ga0207671_100756362 | 211 |
| 411 | 3300025914 | Ga0207671_10121475 | Ga0207671_101214751 | 211 |
| 412 | 3300025914 | Ga0207671_10231696 | Ga0207671_102316961 | 211 |
| 413 | 3300025914 | Ga0207671_10369921 | Ga0207671_103699211 | 211 |
| 414 | 3300025917 | Ga0207660_10014719 | Ga0207660_100147193 | 211 |
| 415 | 3300025919 | Ga0207657_10055528 | Ga0207657_100555284 | 211 |
| 416 | 3300025920 | Ga0207649_10108330 | Ga0207649_101083302 | 211 |
| 417 | 3300025920 | Ga0207649_10703906 | Ga0207649_107039061 | 211 |
| 418 | 3300025921 | Ga0207652_10000397 | Ga0207652_1000039714 | 211 |
| 419 | 3300025921 | Ga0207652_10026359 | Ga0207652_100263592 | 211 |
| 420 | 3300025923 | Ga0207681_10032161 | Ga0207681_100321613 | 211 |
| 421 | 3300025924 | Ga0207694_10009052 | Ga0207694_100090523 | 211 |
| 422 | 3300025924 | Ga0207694_10148385 | Ga0207694_101483852 | 211 |
| 423 | 3300025924 | Ga0207694_10331225 | Ga0207694_103312251 | 211 |
| 424 | 3300025925 | Ga0207650_10069036 | Ga0207650_100690361 | 211 |
| 425 | 3300025925 | Ga0207650_10121053 | Ga0207650_101210532 | 211 |
| 426 | 3300025925 | Ga0207650_10270520 | Ga0207650_102705202 | 211 |
| 427 | 3300025926 | Ga0207659_10012225 | Ga0207659_100122256 | 211 |
| 428 | 3300025926 | Ga0207659_10080878 | Ga0207659_100808782 | 211 |
| 429 | 3300025926 | Ga0207659_10548200 | Ga0207659_105482001 | 211 |
| 430 | 3300025931 | Ga0207644_10005946 | Ga0207644_100059467 | 211 |
| 431 | 3300025933 | Ga0207706_10010719 | Ga0207706_100107196 | 211 |
| 432 | 3300025933 | Ga0207706_10018001 | Ga0207706_100180017 | 211 |
| 433 | 3300025933 | Ga0207706_10529011 | Ga0207706_105290111 | 211 |
| 434 | 3300025934 | Ga0207686_10126840 | Ga0207686_101268403 | 211 |
| 435 | 3300025936 | Ga0207670_10003257 | Ga0207670_100032575 | 211 |
| 436 | 3300025936 | Ga0207670_10037466 | Ga0207670_100374663 | 211 |
| 437 | 3300025936 | Ga0207670_10067319 | Ga0207670_100673192 | 211 |
| 438 | 3300025938 | Ga0207704_10007779 | Ga0207704_100077795 | 211 |
| 439 | 3300025938 | Ga0207704_10052872 | Ga0207704_100528722 | 211 |
| 440 | 3300025940 | Ga0207691_10002284 | Ga0207691_1000228411 | 211 |
| 441 | 3300025940 | Ga0207691_10011435 | Ga0207691_100114359 | 211 |
| 442 | 3300025940 | Ga0207691_10433752 | Ga0207691_104337521 | 211 |
| 443 | 3300025941 | Ga0207711_10372055 | Ga0207711_103720552 | 211 |
| 444 | 3300025942 | Ga0207689_10003192 | Ga0207689_100031925 | 211 |
| 445 | 3300025942 | Ga0207689_10015665 | Ga0207689_100156653 | 211 |
| 446 | 3300025942 | Ga0207689_10089680 | Ga0207689_100896802 | 211 |
| 447 | 3300025942 | Ga0207689_10142420 | Ga0207689_101424203 | 211 |
| 448 | 3300025944 | Ga0207661_10052833 | Ga0207661_100528333 | 211 |
| 449 | 3300025944 | Ga0207661_10134549 | Ga0207661_101345492 | 211 |
| 450 | 3300025944 | Ga0207661_10179358 | Ga0207661_101793583 | 211 |
| 451 | 3300025945 | Ga0207679_10016760 | Ga0207679_100167605 | 211 |
| 452 | 3300025945 | Ga0207679_10426057 | Ga0207679_104260572 | 211 |
| 453 | 3300025945 | Ga0207679_10794637 | Ga0207679_107946372 | 211 |
| 454 | 3300025949 | Ga0207667_10001711 | Ga0207667_1000171116 | 211 |
| 455 | 3300025949 | Ga0207667_10079731 | Ga0207667_100797314 | 211 |
| 456 | 3300025960 | Ga0207651_10021405 | Ga0207651_100214053 | 211 |
| 457 | 3300025960 | Ga0207651_10700831 | Ga0207651_107008312 | 211 |
| 458 | 3300025960 | Ga0207651_10854347 | Ga0207651_108543471 | 211 |
| 459 | 3300025961 | Ga0207712_10003042 | Ga0207712_100030428 | 211 |
| 460 | 3300025961 | Ga0207712_10100381 | Ga0207712_101003812 | 211 |
| 461 | 3300025961 | Ga0207712_10395078 | Ga0207712_103950782 | 211 |
| 462 | 3300025972 | Ga0207668_10074072 | Ga0207668_100740722 | 211 |
| 463 | 3300025981 | Ga0207640_10016932 | Ga0207640_100169322 | 211 |
| 464 | 3300025986 | Ga0207658_10019069 | Ga0207658_100190695 | 211 |
| 465 | 3300025986 | Ga0207658_10119811 | Ga0207658_101198111 | 211 |
| 466 | 3300025986 | Ga0207658_10396963 | Ga0207658_103969632 | 211 |
| 467 | 3300026023 | Ga0207677_10043133 | Ga0207677_100431334 | 211 |
| 468 | 3300026035 | Ga0207703_10011330 | Ga0207703_100113306 | 211 |
| 469 | 3300026035 | Ga0207703_10240347 | Ga0207703_102403472 | 211 |
| 470 | 3300026035 | Ga0207703_10387361 | Ga0207703_103873611 | 211 |
| 471 | 3300026041 | Ga0207639_10035724 | Ga0207639_100357241 | 211 |
| 472 | 3300026041 | Ga0207639_10130610 | Ga0207639_101306102 | 211 |
| 473 | 3300026041 | Ga0207639_10197402 | Ga0207639_101974021 | 211 |
| 474 | 3300026041 | Ga0207639_10589289 | Ga0207639_105892891 | 211 |
| 475 | 3300026041 | Ga0207639_10683019 | Ga0207639_106830192 | 211 |
| 476 | 3300026041 | Ga0207639_10906577 | Ga0207639_109065771 | 211 |
| 477 | 3300026067 | Ga0207678_10029161 | Ga0207678_100291614 | 211 |
| 478 | 3300026067 | Ga0207678_10600960 | Ga0207678_106009601 | 211 |
| 479 | 3300026078 | Ga0207702_10052219 | Ga0207702_100522193 | 211 |
| 480 | 3300026078 | Ga0207702_10096912 | Ga0207702_100969122 | 211 |
| 481 | 3300026078 | Ga0207702_10396300 | Ga0207702_103963001 | 211 |
| 482 | 3300026088 | Ga0207641_10022803 | Ga0207641_100228035 | 211 |
| 483 | 3300026088 | Ga0207641_10164057 | Ga0207641_101640571 | 211 |
| 484 | 3300026088 | Ga0207641_11037785 | Ga0207641_110377851 | 211 |
| 485 | 3300026089 | Ga0207648_10016614 | Ga0207648_100166142 | 211 |
| 486 | 3300026089 | Ga0207648_10037624 | Ga0207648_100376245 | 211 |
| 487 | 3300026089 | Ga0207648_10131895 | Ga0207648_101318952 | 211 |
| 488 | 3300026089 | Ga0207648_10147776 | Ga0207648_101477761 | 211 |
| 489 | 3300026089 | Ga0207648_10212311 | Ga0207648_102123112 | 211 |
| 490 | 3300026095 | Ga0207676_10173626 | Ga0207676_101736263 | 211 |
| 491 | 3300026116 | Ga0207674_10004751 | Ga0207674_1000475112 | 211 |
| 492 | 3300026116 | Ga0207674_10024112 | Ga0207674_100241121 | 211 |
| 493 | 3300026116 | Ga0207674_10038653 | Ga0207674_100386533 | 211 |
| 494 | 3300026116 | Ga0207674_10039029 | Ga0207674_100390294 | 211 |
| 495 | 3300026116 | Ga0207674_10064267 | Ga0207674_100642673 | 211 |
| 496 | 3300026116 | Ga0207674_10085033 | Ga0207674_100850333 | 211 |
| 497 | 3300026116 | Ga0207674_10141956 | Ga0207674_101419562 | 211 |
| 498 | 3300026116 | Ga0207674_10179815 | Ga0207674_101798152 | 211 |
| 499 | 3300026116 | Ga0207674_10284796 | Ga0207674_102847961 | 211 |
| 500 | 3300026118 | Ga0207675_100003813 | Ga0207675_1000038132 | 211 |
| 501 | 3300026118 | Ga0207675_100007383 | Ga0207675_1000073834 | 211 |
| 502 | 3300026118 | Ga0207675_100018489 | Ga0207675_1000184896 | 211 |
| 503 | 3300026118 | Ga0207675_100062310 | Ga0207675_1000623103 | 211 |
| 504 | 3300026121 | Ga0207683_10229948 | Ga0207683_102299482 | 211 |
| 505 | 3300026142 | Ga0207698_10056605 | Ga0207698_100566052 | 211 |
| 506 | 3300026142 | Ga0207698_10225635 | Ga0207698_102256352 | 211 |
| 507 | 3300026142 | Ga0207698_10356652 | Ga0207698_103566522 | 211 |
| 508 | 3300028379 | Ga0268266_10295083 | Ga0268266_102950831 | 211 |
| 509 | 3300028379 | Ga0268266_10366162 | Ga0268266_103661621 | 211 |
| 510 | 3300028380 | Ga0268265_10067420 | Ga0268265_100674204 | 211 |
| 511 | 3300028380 | Ga0268265_10154331 | Ga0268265_101543312 | 211 |
| 512 | 3300028381 | Ga0268264_10000143 | Ga0268264_10000143102 | 211 |
| 513 | 3300028381 | Ga0268264_10017622 | Ga0268264_100176223 | 211 |
| 514 | 3300028381 | Ga0268264_10063577 | Ga0268264_100635772 | 211 |
| 515 | 3300031456 | Ga0307513_10439506 | Ga0307513_104395061 | 211 |
| 516 | 3300031730 | Ga0307516_10000310 | Ga0307516_1000031029 | 211 |
| 517 | 3300031730 | Ga0307516_10105729 | Ga0307516_101057293 | 211 |
| 518 | 3300031852 | Ga0307410_10295184 | Ga0307410_102951842 | 211 |
| 519 | 3300033180 | Ga0307510_10001062 | Ga0307510_100010627 | 211 |
| 520 | 3300035111 | Ga0373923_0196712 | Ga0373923_0196712_111_746 | 211 |
| 521 | 3300035116 | Ga0373945_0045219 | Ga0373945_0045219_689_1324 | 211 |
| 522 | 3300035172 | Ga0373955_0101402 | Ga0373955_0101402_580_1215 | 211 |
| 523 | 3300035410 | Ga0373924_0103694 | Ga0373924_0103694_251_886 | 211 |
| 524 | 3300035695 | Ga0373927_0011129 | Ga0373927_0011129_790_1425 | 211 |
| 525 | 3300036401 | Ga0373937_0002104 | Ga0373937_0002104_8622_9257 | 211 |
| 526 | 3300036457 | Ga0265778_027271 | Ga0265778_027271_68_703 | 211 |
| 527 | 3300039437 | Ga0436365_0262826 | Ga0436365_0262826_18988_19623 | 211 |
| 528 | 3300041404 | Ga0439436_0007077 | Ga0439436_0007077_2794_3429 | 211 |
| 529 | 3300041404 | Ga0439436_0075319 | Ga0439436_0075319_130_765 | 211 |
| 530 | 3300041406 | Ga0439439_0006329 | Ga0439439_0006329_2009_2644 | 211 |
| 531 | 3300041406 | Ga0439439_0015516 | Ga0439439_0015516_261_896 | 211 |
| 532 | 3300041411 | Ga0439466_0089903 | Ga0439466_0089903_141_776 | 211 |
| 533 | 3300041413 | Ga0439465_0010085 | Ga0439465_0010085_686_1321 | 211 |
| 534 | 3300041486 | Ga0451807_1400206 | Ga0451807_1400206_750_1385 | 211 |
| 535 | 3300041505 | Ga0451849_0783274 | Ga0451849_0783274_300_935 | 211 |
| 536 | 3300041512 | Ga0451853_1183943 | Ga0451853_1183943_56_691 | 211 |
| 537 | 3300041512 | Ga0451853_3160169 | Ga0451853_3160169_36_671 | 211 |
| 538 | 3300041997 | Ga0439431_0009061 | Ga0439431_0009061_833_1468 | 211 |
| 539 | 3300041997 | Ga0439431_0013467 | Ga0439431_0013467_724_1359 | 211 |
| 540 | 3300041997 | Ga0439431_0013552 | Ga0439431_0013552_804_1439 | 211 |
| 541 | 3300042001 | Ga0439441_076499 | Ga0439441_076499_22_657 | 211 |
| 542 | 3300042002 | Ga0439442_010332 | Ga0439442_010332_730_1365 | 211 |
| 543 | 3300042004 | Ga0439445_0011101 | Ga0439445_0011101_1320_1955 | 211 |
| 544 | 3300042004 | Ga0439445_0113951 | Ga0439445_0113951_80_715 | 211 |
| 545 | 3300042007 | Ga0439449_0025032 | Ga0439449_0025032_1313_1948 | 211 |
| 546 | 3300042007 | Ga0439449_0025747 | Ga0439449_0025747_753_1388 | 211 |
| 547 | 3300042014 | Ga0439457_002994 | Ga0439457_002994_2770_3405 | 211 |
| 548 | 3300042014 | Ga0439457_003090 | Ga0439457_003090_2044_2679 | 211 |
| 549 | 3300042014 | Ga0439457_024395 | Ga0439457_024395_363_998 | 211 |
| 550 | 3300042015 | Ga0439462_0001411 | Ga0439462_0001411_3581_4216 | 211 |
| 551 | 3300042133 | Ga0450896_013997 | Ga0450896_013997_433_1068 | 211 |
| 552 | 3300042134 | Ga0450898_004825 | Ga0450898_004825_1203_1838 | 211 |
| 553 | 3300042135 | Ga0450899_000898 | Ga0450899_000898_2030_2665 | 211 |
| 554 | 3300042435 | Ga0439434_0004572 | Ga0439434_0004572_1056_1691 | 211 |
| 555 | 3300042876 | Ga0451577_0523880 | Ga0451577_0523880_315_950 | 211 |
| 556 | 3300044656 | Ga0466969_0000382 | Ga0466969_0000382_11715_12350 | 211 |
| 557 | 3300044658 | Ga0466972_0000010 | Ga0466972_0000010_73526_74161 | 211 |
| 558 | 3300044658 | Ga0466972_0000143 | Ga0466972_0000143_29494_30129 | 211 |
| 559 | 3300044658 | Ga0466972_0006101 | Ga0466972_0006101_4422_5057 | 211 |
| 560 | 3300044658 | Ga0466972_0027460 | Ga0466972_0027460_1649_2284 | 211 |
| 561 | 3300044658 | Ga0466972_0167925 | Ga0466972_0167925_253_888 | 211 |
| 562 | 3300044673 | Ga0453683_0209423 | Ga0453683_0209423_433_1068 | 211 |
| 563 | 3300044673 | Ga0453683_0236351 | Ga0453683_0236351_51_686 | 211 |
| 564 | 3300044684 | Ga0466966_0000176 | Ga0466966_0000176_6085_6720 | 211 |
| 565 | 3300044693 | Ga0466961_0099771 | Ga0466961_0099771_736_1371 | 211 |
| 566 | 3300044693 | Ga0466961_0167302 | Ga0466961_0167302_530_1165 | 211 |
| 567 | 3300044706 | Ga0466964_0018699 | Ga0466964_0018699_476_1111 | 211 |
| 568 | 3300044712 | Ga0453684_0633051 | Ga0453684_0633051_408_1043 | 211 |
| 569 | 3300044712 | Ga0453684_0717052 | Ga0453684_0717052_50_685 | 211 |
| 570 | 3300044719 | Ga0466971_0063904 | Ga0466971_0063904_282_917 | 211 |
| 571 | 3300044735 | Ga0466968_0007972 | Ga0466968_0007972_824_1459 | 211 |
| 572 | 3300044735 | Ga0466968_0219604 | Ga0466968_0219604_165_800 | 211 |
| 573 | 3300044765 | Ga0466970_0000921 | Ga0466970_0000921_8227_8862 | 211 |
| 574 | 3300044765 | Ga0466970_0175637 | Ga0466970_0175637_509_1144 | 211 |
| 575 | 3300044765 | Ga0466970_0190026 | Ga0466970_0190026_378_1013 | 211 |
| 576 | 3300044765 | Ga0466970_0230620 | Ga0466970_0230620_256_891 | 211 |
| 577 | 3300044842 | Ga0466957_0000577 | Ga0466957_0000577_4488_5123 | 211 |
| 578 | 3300044842 | Ga0466957_0385784 | Ga0466957_0385784_66_701 | 211 |
| 579 | 3300044901 | Ga0466960_0030304 | Ga0466960_0030304_934_1569 | 211 |
| 580 | 3300045049 | Ga0466959_0000016 | Ga0466959_0000016_54595_55230 | 211 |
| 581 | 3300045049 | Ga0466959_0014668 | Ga0466959_0014668_243_878 | 211 |
| 582 | 3300045049 | Ga0466959_0035604 | Ga0466959_0035604_913_1548 | 211 |
| 583 | 3300046454 | Ga0495592_0182992 | Ga0495592_0182992_376_1011 | 211 |
| 584 | 3300046459 | Ga0495629_0214769 | Ga0495629_0214769_148_783 | 211 |
| 585 | 3300046463 | Ga0495653_0199091 | Ga0495653_0199091_96_731 | 211 |
| 586 | 3300046507 | Ga0495606_0002808 | Ga0495606_0002808_16999_17634 | 211 |
| 587 | 3300046511 | Ga0495608_0264376 | Ga0495608_0264376_318_953 | 211 |
| 588 | 3300046514 | Ga0495618_0480110 | Ga0495618_0480110_58_693 | 211 |
| 589 | 3300046516 | Ga0495628_0192773 | Ga0495628_0192773_377_1012 | 211 |
| 590 | 3300046517 | Ga0495630_0003153 | Ga0495630_0003153_2163_2798 | 211 |
| 591 | 3300046524 | Ga0495648_0008648 | Ga0495648_0008648_1590_2225 | 211 |
| 592 | 3300046524 | Ga0495648_0228485 | Ga0495648_0228485_93_728 | 211 |
| 593 | 3300046529 | Ga0495652_0526627 | Ga0495652_0526627_89_724 | 211 |
| 594 | 3300046533 | Ga0495640_0226365 | Ga0495640_0226365_370_1005 | 211 |
| 595 | 3300046559 | Ga0495667_0218117 | Ga0495667_0218117_115_750 | 211 |
| 596 | 3300046642 | Ga0495634_0054328 | Ga0495634_0054328_1353_1988 | 211 |
| 597 | 3300046648 | Ga0495611_0000231 | Ga0495611_0000231_28565_29200 | 211 |
| 598 | 3300046648 | Ga0495611_0234725 | Ga0495611_0234725_124_759 | 211 |
| 599 | 3300046660 | Ga0495625_0101589 | Ga0495625_0101589_1144_1779 | 211 |
| 600 | 3300046663 | Ga0495635_0236624 | Ga0495635_0236624_70_705 | 211 |
| 601 | 3300046675 | Ga0495657_0269380 | Ga0495657_0269380_144_779 | 211 |
| 602 | 3300046681 | Ga0495647_0180837 | Ga0495647_0180837_156_791 | 211 |
| 603 | 3300046683 | Ga0495658_0004169 | Ga0495658_0004169_5746_6381 | 211 |
| 604 | 3300047317 | Ga0495604_0213874 | Ga0495604_0213874_333_968 | 211 |
| 605 | 3300047319 | Ga0495674_0006177 | Ga0495674_0006177_6691_7326 | 211 |
| 606 | 3300047319 | Ga0495674_0080161 | Ga0495674_0080161_553_1188 | 211 |
| 607 | 3300047320 | Ga0495672_0018917 | Ga0495672_0018917_767_1402 | 211 |
| 608 | 3300047322 | Ga0495680_0374124 | Ga0495680_0374124_311_946 | 211 |
| 609 | 3300047443 | Ga0495687_000111 | Ga0495687_000111_111913_112548 | 211 |
| 610 | 3300047471 | Ga0495684_0051254 | Ga0495684_0051254_1582_2217 | 211 |
| 611 | 3300047472 | Ga0495686_0088327 | Ga0495686_0088327_1144_1779 | 211 |
| 612 | 3300048088 | Ga0495602_0152944 | Ga0495602_0152944_644_1279 | 211 |
| 613 | 3300048904 | Ga0496101_0008686 | Ga0496101_0008686_2127_2762 | 211 |
| 614 | 3300048907 | Ga0496104_0447940 | Ga0496104_0447940_200_835 | 211 |
| 615 | 3300048908 | Ga0496105_0606482 | Ga0496105_0606482_142_777 | 211 |
| 616 | 3300048910 | Ga0496107_0605268 | Ga0496107_0605268_30_665 | 211 |
| 617 | 3300048913 | Ga0496110_0313645 | Ga0496110_0313645_86_721 | 211 |
| 618 | 3300048917 | Ga0496114_0006425 | Ga0496114_0006425_7541_8176 | 211 |
| 619 | 3300048917 | Ga0496114_0370946 | Ga0496114_0370946_219_854 | 211 |
| 620 | 3300048917 | Ga0496114_0907236 | Ga0496114_0907236_52_687 | 211 |
| 621 | 3300048918 | Ga0496115_0331579 | Ga0496115_0331579_204_839 | 211 |
| 622 | 3300048924 | Ga0496121_0000051 | Ga0496121_0000051_46940_47575 | 211 |
| 623 | 3300048927 | Ga0496124_0112179 | Ga0496124_0112179_1322_1957 | 211 |
| 624 | 3300049528 | Ga0501312_051533 | Ga0501312_051533_31_666 | 211 |
| 625 | 3300049570 | Ga0501033_0019886 | Ga0501033_0019886_1393_2028 | 211 |
| 626 | 3300049570 | Ga0501033_0224297 | Ga0501033_0224297_683_1318 | 211 |
| 627 | 3300049570 | Ga0501033_0238245 | Ga0501033_0238245_289_924 | 211 |
| 628 | 3300049570 | Ga0501033_0305814 | Ga0501033_0305814_72_707 | 211 |
| 629 | 3300049571 | Ga0501034_0022432 | Ga0501034_0022432_3747_4382 | 211 |
| 630 | 3300049571 | Ga0501034_0046484 | Ga0501034_0046484_1062_1697 | 211 |
| 631 | 3300049571 | Ga0501034_0099393 | Ga0501034_0099393_186_821 | 211 |
| 632 | 3300049571 | Ga0501034_0405389 | Ga0501034_0405389_127_762 | 211 |
| 633 | 3300049571 | Ga0501034_0792219 | Ga0501034_0792219_70_705 | 211 |
| 634 | 3300049572 | Ga0501036_0053937 | Ga0501036_0053937_720_1355 | 211 |
| 635 | 3300049573 | Ga0501037_0023146 | Ga0501037_0023146_2890_3525 | 211 |
| 636 | 3300049573 | Ga0501037_0345966 | Ga0501037_0345966_274_909 | 211 |
| 637 | 3300049574 | Ga0501038_0237267 | Ga0501038_0237267_756_1391 | 211 |
| 638 | 3300049579 | Ga0501043_0003586 | Ga0501043_0003586_8595_9230 | 211 |
| 639 | 3300049579 | Ga0501043_0042539 | Ga0501043_0042539_916_1551 | 211 |
| 640 | 3300049579 | Ga0501043_0184099 | Ga0501043_0184099_749_1384 | 211 |
| 641 | 3300049581 | Ga0501047_0005137 | Ga0501047_0005137_10314_10949 | 211 |
| 642 | 3300049581 | Ga0501047_0022222 | Ga0501047_0022222_3647_4282 | 211 |
| 643 | 3300049581 | Ga0501047_0028692 | Ga0501047_0028692_3522_4157 | 211 |
| 644 | 3300049585 | Ga0501069_0108360 | Ga0501069_0108360_789_1424 | 211 |
| 645 | 3300049586 | Ga0501070_0045242 | Ga0501070_0045242_2797_3432 | 211 |
| 646 | 3300049586 | Ga0501070_0061556 | Ga0501070_0061556_361_996 | 211 |
| 647 | 3300049586 | Ga0501070_0095944 | Ga0501070_0095944_320_955 | 211 |
| 648 | 3300049671 | Ga0501238_019496 | Ga0501238_019496_264_899 | 211 |
| 649 | 3300049703 | Ga0501219_000650 | Ga0501219_000650_3617_4252 | 211 |
| 650 | 3300049705 | Ga0501225_0002441 | Ga0501225_0002441_389_1024 | 211 |
| 651 | 3300049742 | Ga0501080_0278625 | Ga0501080_0278625_533_1168 | 211 |
| 652 | 3300049742 | Ga0501080_0327808 | Ga0501080_0327808_165_800 | 211 |
| 653 | 3300049742 | Ga0501080_0386263 | Ga0501080_0386263_449_1084 | 211 |
| 654 | 3300049758 | Ga0501241_001865 | Ga0501241_001865_874_1509 | 211 |
| 655 | 3300049822 | Ga0501035_0016926 | Ga0501035_0016926_4168_4803 | 211 |
| 656 | 3300049822 | Ga0501035_0029491 | Ga0501035_0029491_4069_4704 | 211 |
| 657 | 3300049822 | Ga0501035_0106678 | Ga0501035_0106678_841_1476 | 211 |
| 658 | 3300049822 | Ga0501035_0583474 | Ga0501035_0583474_156_791 | 211 |
| 659 | 3300049822 | Ga0501035_0587796 | Ga0501035_0587796_172_807 | 211 |
| 660 | 3300049823 | Ga0501044_0034967 | Ga0501044_0034967_3639_4274 | 211 |
| 661 | 3300049823 | Ga0501044_0320531 | Ga0501044_0320531_396_1031 | 211 |
| 662 | 3300050005 | Ga0501284_00005 | Ga0501284_00005_118733_119368 | 211 |
| 663 | 3300050493 | nmdc:mga0k408_132857_c1 | nmdc:mga0k408_132857_c1_402_1037 | 211 |
| 664 | 3300050493 | nmdc:mga0k408_1625_c3 | nmdc:mga0k408_1625_c3_1620_2255 | 211 |
| 665 | 3300050493 | nmdc:mga0k408_25436_c1 | nmdc:mga0k408_25436_c1_2228_2863 | 211 |
| 666 | 3300050493 | nmdc:mga0k408_395428_c1 | nmdc:mga0k408_395428_c1_123_758 | 211 |
| 667 | 3300050493 | nmdc:mga0k408_7175_c1 | nmdc:mga0k408_7175_c1_348_983 | 211 |
| 668 | 3300050507 | nmdc:mga05p37_914_c1 | nmdc:mga05p37_914_c1_20541_21176 | 211 |
| 669 | 3300050511 | nmdc:mga08y16_12509_c1 | nmdc:mga08y16_12509_c1_5028_5663 | 211 |
| 670 | 3300053086 | Ga0500578_0027483 | Ga0500578_0027483_580_1215 | 211 |
| 671 | 3300053086 | Ga0500578_0117443 | Ga0500578_0117443_1014_1649 | 211 |
| 672 | 3300053088 | Ga0500644_0000032 | Ga0500644_0000032_36552_37187 | 211 |
| 673 | 3300053090 | Ga0500646_0004811 | Ga0500646_0004811_2664_3299 | 211 |
| 674 | 3300053090 | Ga0500646_0023054 | Ga0500646_0023054_890_1525 | 211 |
| 675 | 3300053092 | Ga0500583_0006441 | Ga0500583_0006441_2479_3114 | 211 |
| 676 | 3300053109 | Ga0500569_000056 | Ga0500569_000056_8421_9056 | 211 |
| 677 | 3300053130 | Ga0500642_0068450 | Ga0500642_0068450_683_1318 | 211 |
| 678 | 3300053131 | Ga0500652_015609 | Ga0500652_015609_1176_1811 | 211 |
| 679 | 3300053134 | Ga0500658_0119642 | Ga0500658_0119642_507_1142 | 211 |
| 680 | 3300053139 | Ga0500568_0001302 | Ga0500568_0001302_15208_15843 | 211 |
| 681 | 3300053139 | Ga0500568_0023320 | Ga0500568_0023320_32_667 | 211 |
| 682 | 3300053140 | Ga0500573_0133851 | Ga0500573_0133851_519_1154 | 211 |
| 683 | 3300053142 | Ga0500577_0002744 | Ga0500577_0002744_2812_3447 | 211 |
| 684 | 3300053148 | Ga0500590_028379 | Ga0500590_028379_121_756 | 211 |
| 685 | 3300053153 | Ga0500616_0012198 | Ga0500616_0012198_498_1133 | 211 |
| 686 | 3300053153 | Ga0500616_0069763 | Ga0500616_0069763_563_1198 | 211 |
| 687 | 3300053153 | Ga0500616_0124652 | Ga0500616_0124652_172_807 | 211 |
| 688 | 3300053156 | Ga0500622_0006216 | Ga0500622_0006216_6296_6931 | 211 |
| 689 | 3300053160 | Ga0500633_0005002 | Ga0500633_0005002_1947_2582 | 211 |
| 690 | 3300053161 | Ga0500634_0060050 | Ga0500634_0060050_291_926 | 211 |
| 691 | 3300053163 | Ga0500639_096414 | Ga0500639_096414_313_948 | 211 |
| 692 | 3300053177 | Ga0500636_0080702 | Ga0500636_0080702_230_865 | 211 |
| 693 | 3300053178 | Ga0500637_0127480 | Ga0500637_0127480_101_736 | 211 |
| 694 | 3300053727 | Ga0500611_000004 | Ga0500611_000004_243488_244171 | 211 |
| 695 | 3300054114 | Ga0501084_0129706 | Ga0501084_0129706_700_1335 | 211 |
| 696 | 3300055283 | Ga0500661_014040 | Ga0500661_014040_198_833 | 211 |
| 697 | 3300059492 | Ga0587073_0145722 | Ga0587073_0145722_17_652 | 211 |
| 698 | 3300059493 | Ga0587077_094413 | Ga0587077_094413_14_649 | 211 |
| 699 | 3300059493 | Ga0587077_097345 | Ga0587077_097345_34_669 | 211 |
| 700 | 3300059503 | Ga0587080_071993 | Ga0587080_071993_13_648 | 211 |
| 701 | 3300059510 | Ga0587090_065552 | Ga0587090_065552_20_655 | 211 |
| 702 | 3300059510 | Ga0587090_072724 | Ga0587090_072724_17_652 | 211 |
| 703 | 3300059630 | Ga0587128_060747 | Ga0587128_060747_68_703 | 211 |
| 704 | 3300059653 | Ga0587108_012644 | Ga0587108_012644_31_666 | 211 |
| 705 | 3300060353 | Ga0501082_0340214 | Ga0501082_0340214_453_1088 | 211 |
| 706 | 2162886007 | SwRhRL2b_contig_1762462 | SwRhRL2b_0592.00004270 | 212 |
| 707 | 3300003316 | rootH1_10058428 | rootH1_100584282 | 212 |
| 708 | 3300003320 | rootH2_10206522 | rootH2_102065222 | 212 |
| 709 | 3300003320 | rootH2_10318247 | rootH2_103182472 | 212 |
| 710 | 3300003323 | rootH1_10116971 | rootH1_101169711 | 212 |
| 711 | 3300003354 | JGI25160J50197_1000701 | JGI25160J50197_10007019 | 212 |
| 712 | 3300004803 | Ga0058862_12529024 | Ga0058862_125290241 | 212 |
| 713 | 3300005290 | Ga0065712_10196712 | Ga0065712_101967122 | 212 |
| 714 | 3300005327 | Ga0070658_10029344 | Ga0070658_100293443 | 212 |
| 715 | 3300005327 | Ga0070658_10093407 | Ga0070658_100934073 | 212 |
| 716 | 3300005327 | Ga0070658_10635909 | Ga0070658_106359091 | 212 |
| 717 | 3300005328 | Ga0070676_10072342 | Ga0070676_100723422 | 212 |
| 718 | 3300005328 | Ga0070676_10536328 | Ga0070676_105363281 | 212 |
| 719 | 3300005329 | Ga0070683_100048151 | Ga0070683_1000481514 | 212 |
| 720 | 3300005329 | Ga0070683_100221886 | Ga0070683_1002218862 | 212 |
| 721 | 3300005329 | Ga0070683_100268473 | Ga0070683_1002684733 | 212 |
| 722 | 3300005329 | Ga0070683_100547939 | Ga0070683_1005479392 | 212 |
| 723 | 3300005329 | Ga0070683_100693185 | Ga0070683_1006931851 | 212 |
| 724 | 3300005331 | Ga0070670_100048082 | Ga0070670_1000480823 | 212 |
| 725 | 3300005331 | Ga0070670_100062454 | Ga0070670_1000624542 | 212 |
| 726 | 3300005331 | Ga0070670_100133415 | Ga0070670_1001334152 | 212 |
| 727 | 3300005331 | Ga0070670_100230943 | Ga0070670_1002309432 | 212 |
| 728 | 3300005331 | Ga0070670_100632532 | Ga0070670_1006325322 | 212 |
| 729 | 3300005331 | Ga0070670_100785560 | Ga0070670_1007855601 | 212 |
| 730 | 3300005333 | Ga0070677_10049688 | Ga0070677_100496881 | 212 |
| 731 | 3300005334 | Ga0068869_100027216 | Ga0068869_1000272162 | 212 |
| 732 | 3300005335 | Ga0070666_10000038 | Ga0070666_1000003888 | 212 |
| 733 | 3300005336 | Ga0070680_100029132 | Ga0070680_1000291323 | 212 |
| 734 | 3300005336 | Ga0070680_100092951 | Ga0070680_1000929514 | 212 |
| 735 | 3300005337 | Ga0070682_100051348 | Ga0070682_1000513483 | 212 |
| 736 | 3300005338 | Ga0068868_100044102 | Ga0068868_1000441022 | 212 |
| 737 | 3300005338 | Ga0068868_100185404 | Ga0068868_1001854042 | 212 |
| 738 | 3300005338 | Ga0068868_100192973 | Ga0068868_1001929732 | 212 |
| 739 | 3300005338 | Ga0068868_100265052 | Ga0068868_1002650522 | 212 |
| 740 | 3300005338 | Ga0068868_100624617 | Ga0068868_1006246172 | 212 |
| 741 | 3300005338 | Ga0068868_100769593 | Ga0068868_1007695931 | 212 |
| 742 | 3300005339 | Ga0070660_100049041 | Ga0070660_1000490413 | 212 |
| 743 | 3300005339 | Ga0070660_100701463 | Ga0070660_1007014631 | 212 |
| 744 | 3300005343 | Ga0070687_100390997 | Ga0070687_1003909971 | 212 |
| 745 | 3300005347 | Ga0070668_100025917 | Ga0070668_1000259172 | 212 |
| 746 | 3300005347 | Ga0070668_100083647 | Ga0070668_1000836472 | 212 |
| 747 | 3300005347 | Ga0070668_100509255 | Ga0070668_1005092551 | 212 |
| 748 | 3300005353 | Ga0070669_100137440 | Ga0070669_1001374402 | 212 |
| 749 | 3300005354 | Ga0070675_100124675 | Ga0070675_1001246752 | 212 |
| 750 | 3300005354 | Ga0070675_100197256 | Ga0070675_1001972561 | 212 |
| 751 | 3300005355 | Ga0070671_100232720 | Ga0070671_1002327202 | 212 |
| 752 | 3300005356 | Ga0070674_100004279 | Ga0070674_1000042792 | 212 |
| 753 | 3300005356 | Ga0070674_100197328 | Ga0070674_1001973281 | 212 |
| 754 | 3300005364 | Ga0070673_100078528 | Ga0070673_1000785282 | 212 |
| 755 | 3300005364 | Ga0070673_100136004 | Ga0070673_1001360042 | 212 |
| 756 | 3300005365 | Ga0070688_100221604 | Ga0070688_1002216042 | 212 |
| 757 | 3300005366 | Ga0070659_100078815 | Ga0070659_1000788152 | 212 |
| 758 | 3300005367 | Ga0070667_100017912 | Ga0070667_1000179126 | 212 |
| 759 | 3300005367 | Ga0070667_100186935 | Ga0070667_1001869352 | 212 |
| 760 | 3300005367 | Ga0070667_100269813 | Ga0070667_1002698132 | 212 |
| 761 | 3300005367 | Ga0070667_100934864 | Ga0070667_1009348641 | 212 |
| 762 | 3300005435 | Ga0070714_100588286 | Ga0070714_1005882862 | 212 |
| 763 | 3300005436 | Ga0070713_100206609 | Ga0070713_1002066093 | 212 |
| 764 | 3300005456 | Ga0070678_100599208 | Ga0070678_1005992081 | 212 |
| 765 | 3300005458 | Ga0070681_10009082 | Ga0070681_100090823 | 212 |
| 766 | 3300005458 | Ga0070681_10586944 | Ga0070681_105869441 | 212 |
| 767 | 3300005459 | Ga0068867_100313416 | Ga0068867_1003134162 | 212 |
| 768 | 3300005459 | Ga0068867_100598630 | Ga0068867_1005986302 | 212 |
| 769 | 3300005466 | Ga0070685_10008312 | Ga0070685_100083123 | 212 |
| 770 | 3300005530 | Ga0070679_100001442 | Ga0070679_1000014424 | 212 |
| 771 | 3300005530 | Ga0070679_100004485 | Ga0070679_1000044854 | 212 |
| 772 | 3300005530 | Ga0070679_100339490 | Ga0070679_1003394901 | 212 |
| 773 | 3300005535 | Ga0070684_100024212 | Ga0070684_1000242122 | 212 |
| 774 | 3300005535 | Ga0070684_100537503 | Ga0070684_1005375031 | 212 |
| 775 | 3300005539 | Ga0068853_100425978 | Ga0068853_1004259782 | 212 |
| 776 | 3300005543 | Ga0070672_100070167 | Ga0070672_1000701672 | 212 |
| 777 | 3300005543 | Ga0070672_100075356 | Ga0070672_1000753562 | 212 |
| 778 | 3300005548 | Ga0070665_100023645 | Ga0070665_1000236453 | 212 |
| 779 | 3300005563 | Ga0068855_100080085 | Ga0068855_1000800852 | 212 |
| 780 | 3300005563 | Ga0068855_100363654 | Ga0068855_1003636542 | 212 |
| 781 | 3300005564 | Ga0070664_100006818 | Ga0070664_1000068185 | 212 |
| 782 | 3300005564 | Ga0070664_100044832 | Ga0070664_1000448323 | 212 |
| 783 | 3300005564 | Ga0070664_100177625 | Ga0070664_1001776254 | 212 |
| 784 | 3300005564 | Ga0070664_100667150 | Ga0070664_1006671501 | 212 |
| 785 | 3300005577 | Ga0068857_100364550 | Ga0068857_1003645502 | 212 |
| 786 | 3300005577 | Ga0068857_100980941 | Ga0068857_1009809411 | 212 |
| 787 | 3300005614 | Ga0068856_100136052 | Ga0068856_1001360522 | 212 |
| 788 | 3300005616 | Ga0068852_100010785 | Ga0068852_1000107852 | 212 |
| 789 | 3300005616 | Ga0068852_100483536 | Ga0068852_1004835362 | 212 |
| 790 | 3300005616 | Ga0068852_100590414 | Ga0068852_1005904141 | 212 |
| 791 | 3300005617 | Ga0068859_100000007 | Ga0068859_10000000794 | 212 |
| 792 | 3300005617 | Ga0068859_100007298 | Ga0068859_1000072983 | 212 |
| 793 | 3300005617 | Ga0068859_100315486 | Ga0068859_1003154861 | 212 |
| 794 | 3300005617 | Ga0068859_100861076 | Ga0068859_1008610762 | 212 |
| 795 | 3300005618 | Ga0068864_100000685 | Ga0068864_10000068518 | 212 |
| 796 | 3300005618 | Ga0068864_100098112 | Ga0068864_1000981122 | 212 |
| 797 | 3300005618 | Ga0068864_100294136 | Ga0068864_1002941362 | 212 |
| 798 | 3300005618 | Ga0068864_100295740 | Ga0068864_1002957402 | 212 |
| 799 | 3300005719 | Ga0068861_100566855 | Ga0068861_1005668551 | 212 |
| 800 | 3300005834 | Ga0068851_10056995 | Ga0068851_100569952 | 212 |
| 801 | 3300005834 | Ga0068851_10083371 | Ga0068851_100833713 | 212 |
| 802 | 3300005834 | Ga0068851_10293210 | Ga0068851_102932101 | 212 |
| 803 | 3300005840 | Ga0068870_10020019 | Ga0068870_100200192 | 212 |
| 804 | 3300005840 | Ga0068870_10079494 | Ga0068870_100794942 | 212 |
| 805 | 3300005841 | Ga0068863_100018440 | Ga0068863_1000184407 | 212 |
| 806 | 3300005841 | Ga0068863_100029101 | Ga0068863_1000291016 | 212 |
| 807 | 3300005841 | Ga0068863_100649717 | Ga0068863_1006497172 | 212 |
| 808 | 3300005841 | Ga0068863_100684508 | Ga0068863_1006845081 | 212 |
| 809 | 3300005842 | Ga0068858_100003163 | Ga0068858_10000316311 | 212 |
| 810 | 3300005842 | Ga0068858_100541347 | Ga0068858_1005413472 | 212 |
| 811 | 3300005843 | Ga0068860_100001511 | Ga0068860_10000151113 | 212 |
| 812 | 3300005843 | Ga0068860_100012160 | Ga0068860_1000121602 | 212 |
| 813 | 3300005843 | Ga0068860_100013747 | Ga0068860_1000137477 | 212 |
| 814 | 3300005843 | Ga0068860_100035248 | Ga0068860_1000352483 | 212 |
| 815 | 3300005843 | Ga0068860_100167208 | Ga0068860_1001672084 | 212 |
| 816 | 3300005843 | Ga0068860_100483985 | Ga0068860_1004839852 | 212 |
| 817 | 3300005844 | Ga0068862_100026484 | Ga0068862_1000264847 | 212 |
| 818 | 3300005985 | Ga0081539_10000120 | Ga0081539_1000012022 | 212 |
| 819 | 3300006195 | Ga0075366_10227556 | Ga0075366_102275561 | 212 |
| 820 | 3300006237 | Ga0097621_100023053 | Ga0097621_1000230533 | 212 |
| 821 | 3300006358 | Ga0068871_100008869 | Ga0068871_1000088699 | 212 |
| 822 | 3300006358 | Ga0068871_100022572 | Ga0068871_1000225724 | 212 |
| 823 | 3300006358 | Ga0068871_100339657 | Ga0068871_1003396572 | 212 |
| 824 | 3300006358 | Ga0068871_100543485 | Ga0068871_1005434851 | 212 |
| 825 | 3300006847 | Ga0075431_100005210 | Ga0075431_1000052107 | 212 |
| 826 | 3300006880 | Ga0075429_100004647 | Ga0075429_1000046473 | 212 |
| 827 | 3300006881 | Ga0068865_100002580 | Ga0068865_10000258010 | 212 |
| 828 | 3300006931 | Ga0097620_100000007 | Ga0097620_10000000795 | 212 |
| 829 | 3300006931 | Ga0097620_100007298 | Ga0097620_1000072983 | 212 |
| 830 | 3300006931 | Ga0097620_100315489 | Ga0097620_1003154891 | 212 |
| 831 | 3300006931 | Ga0097620_100861055 | Ga0097620_1008610552 | 212 |
| 832 | 3300009093 | Ga0105240_10155272 | Ga0105240_101552722 | 212 |
| 833 | 3300009093 | Ga0105240_10230685 | Ga0105240_102306852 | 212 |
| 834 | 3300009098 | Ga0105245_10414992 | Ga0105245_104149922 | 212 |
| 835 | 3300009101 | Ga0105247_10007816 | Ga0105247_100078165 | 212 |
| 836 | 3300009101 | Ga0105247_10008390 | Ga0105247_100083908 | 212 |
| 837 | 3300009147 | Ga0114129_10097830 | Ga0114129_100978303 | 212 |
| 838 | 3300009174 | Ga0105241_10000104 | Ga0105241_1000010459 | 212 |
| 839 | 3300009174 | Ga0105241_10465636 | Ga0105241_104656361 | 212 |
| 840 | 3300009545 | Ga0105237_10006531 | Ga0105237_100065316 | 212 |
| 841 | 3300009545 | Ga0105237_10057748 | Ga0105237_100577484 | 212 |
| 842 | 3300009545 | Ga0105237_10192956 | Ga0105237_101929562 | 212 |
| 843 | 3300009545 | Ga0105237_10578381 | Ga0105237_105783812 | 212 |
| 844 | 3300009553 | Ga0105249_10009352 | Ga0105249_100093522 | 212 |
| 845 | 3300009553 | Ga0105249_10056439 | Ga0105249_100564394 | 212 |
| 846 | 3300010375 | Ga0105239_10003951 | Ga0105239_1000395114 | 212 |
| 847 | 3300010375 | Ga0105239_10136715 | Ga0105239_101367151 | 212 |
| 848 | 3300011119 | Ga0105246_10001838 | Ga0105246_100018388 | 212 |
| 849 | 3300013100 | Ga0157373_10056306 | Ga0157373_100563062 | 212 |
| 850 | 3300013102 | Ga0157371_10003430 | Ga0157371_100034308 | 212 |
| 851 | 3300013102 | Ga0157371_10030073 | Ga0157371_100300733 | 212 |
| 852 | 3300013102 | Ga0157371_10099804 | Ga0157371_100998043 | 212 |
| 853 | 3300013102 | Ga0157371_10133786 | Ga0157371_101337862 | 212 |
| 854 | 3300013102 | Ga0157371_10352120 | Ga0157371_103521202 | 212 |
| 855 | 3300013104 | Ga0157370_10001463 | Ga0157370_100014635 | 212 |
| 856 | 3300013104 | Ga0157370_10081337 | Ga0157370_100813374 | 212 |
| 857 | 3300013104 | Ga0157370_10088225 | Ga0157370_100882254 | 212 |
| 858 | 3300013104 | Ga0157370_10192246 | Ga0157370_101922462 | 212 |
| 859 | 3300013296 | Ga0157374_10071499 | Ga0157374_100714994 | 212 |
| 860 | 3300013296 | Ga0157374_10205761 | Ga0157374_102057612 | 212 |
| 861 | 3300013296 | Ga0157374_10392540 | Ga0157374_103925401 | 212 |
| 862 | 3300013297 | Ga0157378_10002819 | Ga0157378_1000281912 | 212 |
| 863 | 3300013297 | Ga0157378_10020773 | Ga0157378_100207733 | 212 |
| 864 | 3300013297 | Ga0157378_10054652 | Ga0157378_100546522 | 212 |
| 865 | 3300013297 | Ga0157378_10510695 | Ga0157378_105106951 | 212 |
| 866 | 3300013306 | Ga0163162_10000226 | Ga0163162_1000022622 | 212 |
| 867 | 3300013306 | Ga0163162_10015360 | Ga0163162_100153602 | 212 |
| 868 | 3300013306 | Ga0163162_10153084 | Ga0163162_101530842 | 212 |
| 869 | 3300013306 | Ga0163162_10388005 | Ga0163162_103880052 | 212 |
| 870 | 3300013306 | Ga0163162_10942027 | Ga0163162_109420271 | 212 |
| 871 | 3300013307 | Ga0157372_10006279 | Ga0157372_100062798 | 212 |
| 872 | 3300013307 | Ga0157372_10084962 | Ga0157372_100849624 | 212 |
| 873 | 3300013307 | Ga0157372_10105645 | Ga0157372_101056452 | 212 |
| 874 | 3300013307 | Ga0157372_10195910 | Ga0157372_101959103 | 212 |
| 875 | 3300013307 | Ga0157372_10433548 | Ga0157372_104335482 | 212 |
| 876 | 3300013307 | Ga0157372_10466976 | Ga0157372_104669762 | 212 |
| 877 | 3300013307 | Ga0157372_10503053 | Ga0157372_105030532 | 212 |
| 878 | 3300013307 | Ga0157372_10956967 | Ga0157372_109569672 | 212 |
| 879 | 3300013308 | Ga0157375_10030276 | Ga0157375_100302762 | 212 |
| 880 | 3300013308 | Ga0157375_10059422 | Ga0157375_100594222 | 212 |
| 881 | 3300013308 | Ga0157375_10570108 | Ga0157375_105701082 | 212 |
| 882 | 3300014325 | Ga0163163_10003449 | Ga0163163_1000344912 | 212 |
| 883 | 3300014325 | Ga0163163_10089730 | Ga0163163_100897302 | 212 |
| 884 | 3300014325 | Ga0163163_10206453 | Ga0163163_102064532 | 212 |
| 885 | 3300014325 | Ga0163163_10327720 | Ga0163163_103277202 | 212 |
| 886 | 3300014745 | Ga0157377_10025801 | Ga0157377_100258012 | 212 |
| 887 | 3300014968 | Ga0157379_10072415 | Ga0157379_100724152 | 212 |
| 888 | 3300014968 | Ga0157379_10617162 | Ga0157379_106171622 | 212 |
| 889 | 3300014969 | Ga0157376_10033319 | Ga0157376_100333192 | 212 |
| 890 | 3300014969 | Ga0157376_10113753 | Ga0157376_101137532 | 212 |
| 891 | 3300017792 | Ga0163161_10203377 | Ga0163161_102033772 | 212 |
| 892 | 3300017792 | Ga0163161_10998847 | Ga0163161_109988471 | 212 |
| 893 | 3300020080 | Ga0206350_11190917 | Ga0206350_111909173 | 212 |
| 894 | 3300025302 | Ga0207426_1000059 | Ga0207426_1000059323 | 212 |
| 895 | 3300025321 | Ga0207656_10064949 | Ga0207656_100649492 | 212 |
| 896 | 3300025321 | Ga0207656_10223176 | Ga0207656_102231761 | 212 |
| 897 | 3300025893 | Ga0207682_10035528 | Ga0207682_100355282 | 212 |
| 898 | 3300025893 | Ga0207682_10061360 | Ga0207682_100613602 | 212 |
| 899 | 3300025900 | Ga0207710_10066209 | Ga0207710_100662092 | 212 |
| 900 | 3300025900 | Ga0207710_10138769 | Ga0207710_101387692 | 212 |
| 901 | 3300025903 | Ga0207680_10000015 | Ga0207680_1000001590 | 212 |
| 902 | 3300025904 | Ga0207647_10030149 | Ga0207647_100301495 | 212 |
| 903 | 3300025904 | Ga0207647_10237685 | Ga0207647_102376852 | 212 |
| 904 | 3300025907 | Ga0207645_10012916 | Ga0207645_100129166 | 212 |
| 905 | 3300025908 | Ga0207643_10005965 | Ga0207643_100059655 | 212 |
| 906 | 3300025909 | Ga0207705_10005519 | Ga0207705_100055196 | 212 |
| 907 | 3300025911 | Ga0207654_10002787 | Ga0207654_100027879 | 212 |
| 908 | 3300025912 | Ga0207707_10121149 | Ga0207707_101211493 | 212 |
| 909 | 3300025912 | Ga0207707_10489650 | Ga0207707_104896501 | 212 |
| 910 | 3300025912 | Ga0207707_10634642 | Ga0207707_106346421 | 212 |
| 911 | 3300025913 | Ga0207695_10044697 | Ga0207695_100446972 | 212 |
| 912 | 3300025914 | Ga0207671_10001528 | Ga0207671_1000152823 | 212 |
| 913 | 3300025914 | Ga0207671_10288675 | Ga0207671_102886751 | 212 |
| 914 | 3300025917 | Ga0207660_10078611 | Ga0207660_100786112 | 212 |
| 915 | 3300025917 | Ga0207660_10081069 | Ga0207660_100810693 | 212 |
| 916 | 3300025918 | Ga0207662_10224277 | Ga0207662_102242772 | 212 |
| 917 | 3300025919 | Ga0207657_10023553 | Ga0207657_100235535 | 212 |
| 918 | 3300025919 | Ga0207657_10030450 | Ga0207657_100304503 | 212 |
| 919 | 3300025919 | Ga0207657_10114129 | Ga0207657_101141291 | 212 |
| 920 | 3300025919 | Ga0207657_10370902 | Ga0207657_103709021 | 212 |
| 921 | 3300025920 | Ga0207649_10384342 | Ga0207649_103843422 | 212 |
| 922 | 3300025921 | Ga0207652_10000055 | Ga0207652_1000005549 | 212 |
| 923 | 3300025921 | Ga0207652_10000121 | Ga0207652_1000012123 | 212 |
| 924 | 3300025921 | Ga0207652_10122844 | Ga0207652_101228442 | 212 |
| 925 | 3300025923 | Ga0207681_10440740 | Ga0207681_104407402 | 212 |
| 926 | 3300025925 | Ga0207650_10008566 | Ga0207650_100085664 | 212 |
| 927 | 3300025925 | Ga0207650_10167017 | Ga0207650_101670172 | 212 |
| 928 | 3300025925 | Ga0207650_10220158 | Ga0207650_102201582 | 212 |
| 929 | 3300025925 | Ga0207650_10398018 | Ga0207650_103980181 | 212 |
| 930 | 3300025925 | Ga0207650_10410229 | Ga0207650_104102292 | 212 |
| 931 | 3300025925 | Ga0207650_10632788 | Ga0207650_106327881 | 212 |
| 932 | 3300025926 | Ga0207659_10028666 | Ga0207659_100286664 | 212 |
| 933 | 3300025926 | Ga0207659_10078755 | Ga0207659_100787552 | 212 |
| 934 | 3300025926 | Ga0207659_10461905 | Ga0207659_104619052 | 212 |
| 935 | 3300025929 | Ga0207664_10076429 | Ga0207664_100764294 | 212 |
| 936 | 3300025931 | Ga0207644_10214342 | Ga0207644_102143422 | 212 |
| 937 | 3300025931 | Ga0207644_10892485 | Ga0207644_108924851 | 212 |
| 938 | 3300025933 | Ga0207706_10522737 | Ga0207706_105227371 | 212 |
| 939 | 3300025936 | Ga0207670_10709788 | Ga0207670_107097882 | 212 |
| 940 | 3300025937 | Ga0207669_10696976 | Ga0207669_106969761 | 212 |
| 941 | 3300025940 | Ga0207691_10092002 | Ga0207691_100920023 | 212 |
| 942 | 3300025940 | Ga0207691_10175830 | Ga0207691_101758302 | 212 |
| 943 | 3300025940 | Ga0207691_10179607 | Ga0207691_101796071 | 212 |
| 944 | 3300025940 | Ga0207691_10245352 | Ga0207691_102453523 | 212 |
| 945 | 3300025940 | Ga0207691_10260339 | Ga0207691_102603392 | 212 |
| 946 | 3300025942 | Ga0207689_10001007 | Ga0207689_1000100724 | 212 |
| 947 | 3300025942 | Ga0207689_10004656 | Ga0207689_100046566 | 212 |
| 948 | 3300025942 | Ga0207689_10326440 | Ga0207689_103264401 | 212 |
| 949 | 3300025944 | Ga0207661_10008305 | Ga0207661_100083054 | 212 |
| 950 | 3300025944 | Ga0207661_10183888 | Ga0207661_101838882 | 212 |
| 951 | 3300025944 | Ga0207661_10343734 | Ga0207661_103437342 | 212 |
| 952 | 3300025944 | Ga0207661_10873386 | Ga0207661_108733861 | 212 |
| 953 | 3300025945 | Ga0207679_10004170 | Ga0207679_100041705 | 212 |
| 954 | 3300025960 | Ga0207651_10096548 | Ga0207651_100965482 | 212 |
| 955 | 3300025961 | Ga0207712_10044585 | Ga0207712_100445854 | 212 |
| 956 | 3300025972 | Ga0207668_10292868 | Ga0207668_102928682 | 212 |
| 957 | 3300025981 | Ga0207640_10062196 | Ga0207640_100621963 | 212 |
| 958 | 3300025981 | Ga0207640_10499889 | Ga0207640_104998892 | 212 |
| 959 | 3300025986 | Ga0207658_10083934 | Ga0207658_100839341 | 212 |
| 960 | 3300025986 | Ga0207658_10269858 | Ga0207658_102698581 | 212 |
| 961 | 3300026023 | Ga0207677_10005974 | Ga0207677_100059742 | 212 |
| 962 | 3300026023 | Ga0207677_10285475 | Ga0207677_102854752 | 212 |
| 963 | 3300026023 | Ga0207677_10437733 | Ga0207677_104377332 | 212 |
| 964 | 3300026035 | Ga0207703_10004413 | Ga0207703_100044133 | 212 |
| 965 | 3300026041 | Ga0207639_10125984 | Ga0207639_101259842 | 212 |
| 966 | 3300026041 | Ga0207639_10129479 | Ga0207639_101294793 | 212 |
| 967 | 3300026041 | Ga0207639_10401729 | Ga0207639_104017292 | 212 |
| 968 | 3300026041 | Ga0207639_10938750 | Ga0207639_109387502 | 212 |
| 969 | 3300026078 | Ga0207702_10037726 | Ga0207702_100377261 | 212 |
| 970 | 3300026088 | Ga0207641_10000056 | Ga0207641_1000005689 | 212 |
| 971 | 3300026088 | Ga0207641_10012112 | Ga0207641_100121125 | 212 |
| 972 | 3300026088 | Ga0207641_10656294 | Ga0207641_106562941 | 212 |
| 973 | 3300026088 | Ga0207641_10668496 | Ga0207641_106684961 | 212 |
| 974 | 3300026089 | Ga0207648_10004655 | Ga0207648_100046554 | 212 |
| 975 | 3300026089 | Ga0207648_10012488 | Ga0207648_100124882 | 212 |
| 976 | 3300026089 | Ga0207648_10386947 | Ga0207648_103869472 | 212 |
| 977 | 3300026089 | Ga0207648_10716897 | Ga0207648_107168971 | 212 |
| 978 | 3300026095 | Ga0207676_10035035 | Ga0207676_100350353 | 212 |
| 979 | 3300026095 | Ga0207676_10088827 | Ga0207676_100888274 | 212 |
| 980 | 3300026095 | Ga0207676_10127225 | Ga0207676_101272252 | 212 |
| 981 | 3300026095 | Ga0207676_10417933 | Ga0207676_104179331 | 212 |
| 982 | 3300026116 | Ga0207674_10348523 | Ga0207674_103485232 | 212 |
| 983 | 3300026118 | Ga0207675_100012540 | Ga0207675_1000125401 | 212 |
| 984 | 3300026118 | Ga0207675_100232223 | Ga0207675_1002322232 | 212 |
| 985 | 3300026121 | Ga0207683_10002007 | Ga0207683_1000200717 | 212 |
| 986 | 3300026121 | Ga0207683_10053052 | Ga0207683_100530522 | 212 |
| 987 | 3300026121 | Ga0207683_10653236 | Ga0207683_106532362 | 212 |
| 988 | 3300026142 | Ga0207698_10010138 | Ga0207698_100101383 | 212 |
| 989 | 3300026142 | Ga0207698_10018653 | Ga0207698_100186532 | 212 |
| 990 | 3300026142 | Ga0207698_10051843 | Ga0207698_100518432 | 212 |
| 991 | 3300026142 | Ga0207698_10320805 | Ga0207698_103208053 | 212 |
| 992 | 3300027543 | Ga0209999_1038540 | Ga0209999_10385401 | 212 |
| 993 | 3300028379 | Ga0268266_10023889 | Ga0268266_100238896 | 212 |
| 994 | 3300028380 | Ga0268265_10442058 | Ga0268265_104420582 | 212 |
| 995 | 3300028381 | Ga0268264_10001196 | Ga0268264_1000119612 | 212 |
| 996 | 3300028381 | Ga0268264_10001996 | Ga0268264_1000199613 | 212 |
| 997 | 3300028381 | Ga0268264_10032895 | Ga0268264_100328952 | 212 |
| 998 | 3300028381 | Ga0268264_10163267 | Ga0268264_101632671 | 212 |
| 999 | 3300028794 | Ga0307515_10000078 | Ga0307515_1000007854 | 212 |
| 1000 | 3300031251 | Ga0265327_10103988 | Ga0265327_101039882 | 212 |
| 1001 | 3300031456 | Ga0307513_10058922 | Ga0307513_100589224 | 212 |
| 1002 | 3300031507 | Ga0307509_10505643 | Ga0307509_105056431 | 212 |
| 1003 | 3300031730 | Ga0307516_10556276 | Ga0307516_105562761 | 212 |
| 1004 | 3300031824 | Ga0307413_10416392 | Ga0307413_104163922 | 212 |
| 1005 | 3300031911 | Ga0307412_10927157 | Ga0307412_109271571 | 212 |
| 1006 | 3300032002 | Ga0307416_100469382 | Ga0307416_1004693821 | 212 |
| 1007 | 3300032002 | Ga0307416_101688856 | Ga0307416_1016888561 | 212 |
| 1008 | 3300032004 | Ga0307414_10048812 | Ga0307414_100488122 | 212 |
| 1009 | 3300032004 | Ga0307414_10146317 | Ga0307414_101463172 | 212 |
| 1010 | 3300032004 | Ga0307414_10321574 | Ga0307414_103215742 | 212 |
| 1011 | 3300032005 | Ga0307411_10171240 | Ga0307411_101712402 | 212 |
| 1012 | 3300032126 | Ga0307415_100207344 | Ga0307415_1002073442 | 212 |
| 1013 | 3300037312 | Ga0395899_0018904 | Ga0395899_0018904_1477_2115 | 212 |
| 1014 | 3300037312 | Ga0395899_0420753 | Ga0395899_0420753_136_774 | 212 |
| 1015 | 3300037312 | Ga0395899_0483603 | Ga0395899_0483603_19_657 | 212 |
| 1016 | 3300037418 | Ga0395900_0003621 | Ga0395900_0003621_935_1573 | 212 |
| 1017 | 3300037418 | Ga0395900_0154636 | Ga0395900_0154636_334_972 | 212 |
| 1018 | 3300037418 | Ga0395900_0273229 | Ga0395900_0273229_684_1322 | 212 |
| 1019 | 3300037418 | Ga0395900_0450873 | Ga0395900_0450873_447_1085 | 212 |
| 1020 | 3300037466 | Ga0395898_0277980 | Ga0395898_0277980_832_1470 | 212 |
| 1021 | 3300037471 | Ga0395905_0005020 | Ga0395905_0005020_9286_9924 | 212 |
| 1022 | 3300037471 | Ga0395905_0068963 | Ga0395905_0068963_2531_3169 | 212 |
| 1023 | 3300037471 | Ga0395905_0378668 | Ga0395905_0378668_69_707 | 212 |
| 1024 | 3300038443 | Ga0395901_0305359 | Ga0395901_0305359_996_1634 | 212 |
| 1025 | 3300038443 | Ga0395901_0474814 | Ga0395901_0474814_216_854 | 212 |
| 1026 | 3300042004 | Ga0439445_0114136 | Ga0439445_0114136_27_665 | 212 |
| 1027 | 3300042007 | Ga0439449_0001249 | Ga0439449_0001249_6025_6666 | 212 |
| 1028 | 3300042014 | Ga0439457_004882 | Ga0439457_004882_1399_2040 | 212 |
| 1029 | 3300042876 | Ga0451577_0098047 | Ga0451577_0098047_389_1030 | 212 |
| 1030 | 3300044683 | Ga0466965_0376654 | Ga0466965_0376654_67_705 | 212 |
| 1031 | 3300044712 | Ga0453684_0082105 | Ga0453684_0082105_2183_2821 | 212 |
| 1032 | 3300044712 | Ga0453684_0389835 | Ga0453684_0389835_67_708 | 212 |
| 1033 | 3300044765 | Ga0466970_0115434 | Ga0466970_0115434_776_1414 | 212 |
| 1034 | 3300045049 | Ga0466959_0059627 | Ga0466959_0059627_1445_2083 | 212 |
| 1035 | 3300046460 | Ga0495638_0165194 | Ga0495638_0165194_255_896 | 212 |
| 1036 | 3300048917 | Ga0496114_0000397 | Ga0496114_0000397_146_784 | 212 |
| 1037 | 3300049128 | Ga0501308_024175 | Ga0501308_024175_128_766 | 212 |
| 1038 | 3300049130 | Ga0501310_011220 | Ga0501310_011220_17_655 | 212 |
| 1039 | 3300049130 | Ga0501310_023358 | Ga0501310_023358_123_761 | 212 |
| 1040 | 3300049132 | Ga0501343_009116 | Ga0501343_009116_12_650 | 212 |
| 1041 | 3300049160 | Ga0501304_014492 | Ga0501304_014492_72_710 | 212 |
| 1042 | 3300049515 | Ga0501292_005013 | Ga0501292_005013_1060_1698 | 212 |
| 1043 | 3300049521 | Ga0501298_001144 | Ga0501298_001144_1897_2535 | 212 |
| 1044 | 3300049528 | Ga0501312_022575 | Ga0501312_022575_291_929 | 212 |
| 1045 | 3300049529 | Ga0501313_020034 | Ga0501313_020034_168_806 | 212 |
| 1046 | 3300049529 | Ga0501313_025394 | Ga0501313_025394_17_655 | 212 |
| 1047 | 3300049530 | Ga0501314_005951 | Ga0501314_005951_328_966 | 212 |
| 1048 | 3300049530 | Ga0501314_007552 | Ga0501314_007552_14_652 | 212 |
| 1049 | 3300049531 | Ga0501315_002390 | Ga0501315_002390_1103_1741 | 212 |
| 1050 | 3300049532 | Ga0501316_012632 | Ga0501316_012632_335_973 | 212 |
| 1051 | 3300049535 | Ga0501319_003437 | Ga0501319_003437_14_652 | 212 |
| 1052 | 3300049539 | Ga0501323_037544 | Ga0501323_037544_14_652 | 212 |
| 1053 | 3300049553 | Ga0501337_004936 | Ga0501337_004936_146_784 | 212 |
| 1054 | 3300049649 | Ga0501198_002353 | Ga0501198_002353_592_1230 | 212 |
| 1055 | 3300049651 | Ga0501201_000015 | Ga0501201_000015_7364_8002 | 212 |
| 1056 | 3300049652 | Ga0501202_001553 | Ga0501202_001553_2663_3301 | 212 |
| 1057 | 3300049652 | Ga0501202_029338 | Ga0501202_029338_364_1002 | 212 |
| 1058 | 3300049654 | Ga0501207_007739 | Ga0501207_007739_706_1344 | 212 |
| 1059 | 3300049654 | Ga0501207_038145 | Ga0501207_038145_73_711 | 212 |
| 1060 | 3300049660 | Ga0501216_047605 | Ga0501216_047605_185_823 | 212 |
| 1061 | 3300049662 | Ga0501222_000903 | Ga0501222_000903_2669_3307 | 212 |
| 1062 | 3300049665 | Ga0501227_012864 | Ga0501227_012864_658_1296 | 212 |
| 1063 | 3300049668 | Ga0501233_002623 | Ga0501233_002623_2381_3019 | 212 |
| 1064 | 3300049668 | Ga0501233_074625 | Ga0501233_074625_26_667 | 212 |
| 1065 | 3300049669 | Ga0501235_000743 | Ga0501235_000743_2805_3443 | 212 |
| 1066 | 3300049669 | Ga0501235_033463 | Ga0501235_033463_259_897 | 212 |
| 1067 | 3300049673 | Ga0501240_000328 | Ga0501240_000328_2956_3594 | 212 |
| 1068 | 3300049674 | Ga0501242_001195 | Ga0501242_001195_1556_2194 | 212 |
| 1069 | 3300049675 | Ga0501243_000227 | Ga0501243_000227_957_1595 | 212 |
| 1070 | 3300049680 | Ga0501250_000666 | Ga0501250_000666_1657_2298 | 212 |
| 1071 | 3300049682 | Ga0501252_000192 | Ga0501252_000192_2464_3102 | 212 |
| 1072 | 3300049686 | Ga0501257_011575 | Ga0501257_011575_770_1408 | 212 |
| 1073 | 3300049686 | Ga0501257_017172 | Ga0501257_017172_567_1205 | 212 |
| 1074 | 3300049686 | Ga0501257_047767 | Ga0501257_047767_23_664 | 212 |
| 1075 | 3300049688 | Ga0501259_000319 | Ga0501259_000319_4618_5256 | 212 |
| 1076 | 3300049690 | Ga0501261_000658 | Ga0501261_000658_1814_2452 | 212 |
| 1077 | 3300049690 | Ga0501261_008731 | Ga0501261_008731_17_658 | 212 |
| 1078 | 3300049704 | Ga0501221_001008 | Ga0501221_001008_1274_1912 | 212 |
| 1079 | 3300049705 | Ga0501225_0000561 | Ga0501225_0000561_10833_11471 | 212 |
| 1080 | 3300049708 | Ga0501245_000123 | Ga0501245_000123_5797_6435 | 212 |
| 1081 | 3300049763 | Ga0501266_001851 | Ga0501266_001851_23_661 | 212 |
| 1082 | 3300049765 | Ga0501268_072676 | Ga0501268_072676_42_683 | 212 |
| 1083 | 3300049823 | Ga0501044_0300321 | Ga0501044_0300321_382_1053 | 212 |
| 1084 | 3300050507 | nmdc:mga05p37_181524_c1 | nmdc:mga05p37_181524_c1_977_1615 | 212 |
| 1085 | 3300050508 | nmdc:mga09592_112309_c1 | nmdc:mga09592_112309_c1_1294_1932 | 212 |
| 1086 | 3300050510 | nmdc:mga06r32_20749_c1 | nmdc:mga06r32_20749_c1_3020_3658 | 212 |
| 1087 | 3300053090 | Ga0500646_0031861 | Ga0500646_0031861_59_700 | 212 |
| 1088 | 3300053092 | Ga0500583_0000037 | Ga0500583_0000037_35839_36480 | 212 |
| 1089 | 3300053092 | Ga0500583_0001860 | Ga0500583_0001860_3935_4576 | 212 |
| 1090 | 3300053146 | Ga0500588_0010847 | Ga0500588_0010847_733_1371 | 212 |
| 1091 | 3300053147 | Ga0500589_059274 | Ga0500589_059274_638_1279 | 212 |
| 1092 | 3300053151 | Ga0500604_0002834 | Ga0500604_0002834_3251_3892 | 212 |
| 1093 | 3300053153 | Ga0500616_0006422 | Ga0500616_0006422_2228_2866 | 212 |
| 1094 | 3300053156 | Ga0500622_0062897 | Ga0500622_0062897_27_668 | 212 |
| 1095 | 3300059624 | Ga0587109_063764 | Ga0587109_063764_92_730 | 212 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9763 | 3 | 210 |
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.9719 | 3 | 210 |
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9715 | 3 | 210 |
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.9624 | 3 | 210 |
| 5ykj-assembly1.cif.gz_A | structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems | 0.953 | 3 | 207 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9776 | 146 | 209 | 3.30.1020.10 |
| af_P34227_199_260_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9726 | 146 | 207 | 3.30.1020.10 |
| af_A0A0R0K508_6_109_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9685 | 5 | 106 | 3.40.30.10 |
| af_I1KRJ7_151_218_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9671 | 146 | 207 | 3.30.1020.10 |
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9629 | 146 | 209 | 3.30.1020.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A4CMK5-F1-model_v4 | Putative antioxidant protein | 0.988 | 19 | 103 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A1T5DCE5-F1-model_v4 | Alkyl hydroperoxide reductase subunit AhpC (Peroxiredoxin) | 0.9876 | 1 | 207 |
GO:0005829
GO:0016020 GO:0045454 GO:0051920 |
| AF-U7HQQ4-F1-model_v4 | Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) | 0.9872 | 1 | 207 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A2E5EKQ1-F1-model_v4 | Peroxidase | 0.9856 | 1 | 211 |
GO:0005829
GO:0045454 GO:0051920 |
| AF-A0A523Q014-F1-model_v4 | Peroxiredoxin | 0.9855 | 1 | 211 |
GO:0005829
GO:0045454 GO:0051920 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar