F489950

General Info

Members Datasets Scaffolds Average Seq Length
1095 393 1076 211

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10010368|Ga0070658_100103689
Length 243
Sequence VAKSFTVKQIYEIFPTKLVGCCTFAEIFKLKFTIMSLQLGDAAPDFTAETTIGKINLYEFLGDSWGVLFSHPADFTPVCTTELGRTAQLQKEFEKRDVKVLAVSVDPLDKHHSWTKDINETQNCTVEFPLIADEDKTVANLYGMLHPNASATATVRSLFIIGPDKKIKLIILYPASTGRNFNEVLRVIDSLQLTANQGLTTPADWVLGDDLIVSPSISTEDAIKKFPKGVKVVKPYLRYTPQP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
4 2818991444 Filimonas endophytica 3197 Isolate Unclassified
5 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
6 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
7 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
8 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
9 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
10 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
11 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
12 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
13 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
14 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
15 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
16 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
17 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
18 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
19 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
33 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
38 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
90 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
91 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
92 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
93 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
136 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
138 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
207 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
208 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
214 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
215 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
216 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
232 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
233 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
234 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
235 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
236 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
239 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
240 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
241 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
242 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
243 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
244 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
245 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
246 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
247 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
248 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
249 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
250 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
251 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
252 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
253 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
254 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
255 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
256 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
257 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
258 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
259 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
260 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
261 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
262 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
263 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
274 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
275 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
276 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
277 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
283 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
286 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
287 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
288 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
289 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
307 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
308 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
326 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
327 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
328 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
329 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
330 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
331 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
332 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
333 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
334 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
335 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
336 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
337 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
338 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
339 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
340 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
341 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
342 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
343 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
344 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
345 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
346 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
347 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
348 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
349 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
350 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
351 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
352 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
354 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
355 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
356 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
357 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
358 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
359 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
360 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
361 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
362 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
363 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
364 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
365 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
366 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
367 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
370 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
371 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
372 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
373 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
374 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
375 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
376 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
377 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
378 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
379 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
380 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
381 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
382 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
383 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
384 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
385 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
393 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.89
Metatranscriptomes 3.38
Isolates 1.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.3
Nodule 0
Rhizoplane 1
Rhizosphere 88.4
Stem 0
Stem Tuber 0
Unclassified 4.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1762462 2162886007 Bacteria 256265
2 JGI24740J21852_10003348 3300001979 Bacteria 7062
3 JGI25154J39366_1000120 3300002738 Bacteria 63261
4 JGI25154J39366_1012097 3300002738 Bacteria 964
5 Ga0006759J45824_1076550 3300003163 Bacteria 699
6 Ga0006758J48902_1015743 3300003300 Bacteria 692
7 rootH1_10023748 3300003316 Bacteria 1337
8 rootH1_10058428 3300003316 Bacteria 1537
9 rootH2_10019577 3300003320 Bacteria 23076
10 rootH2_10158917 3300003320 Bacteria 10317
11 rootH2_10206522 3300003320 Bacteria 2947
12 rootH2_10220086 3300003320 Bacteria 1834
13 rootH2_10318247 3300003320 Unclassified 1267
14 rootL2_10172417 3300003322 Bacteria 3438
15 rootH1_10065386 3300003323 Bacteria 6032
16 rootH1_10116971 3300003323 Bacteria 1465
17 rootH1_10134083 3300003323 Bacteria 5871
18 rootH1_10165589 3300003323 Bacteria 1726
19 rootH1_10257422 3300003323 Bacteria 2319
20 rootH1_10260058 3300003323 Bacteria 1304
21 JGI25160J50197_1000701 3300003354 Bacteria 18447
22 Ga0055526_1046463 3300003771 Bacteria 1028
23 Ga0055528_1023293 3300003790 Bacteria 1895
24 Ga0058863_11748294 3300004799 Unclassified 689
25 Ga0058863_11905271 3300004799 Bacteria 816
26 Ga0058861_11695319 3300004800 Bacteria 761
27 Ga0058862_12529024 3300004803 Bacteria 754
28 Ga0058862_12773387 3300004803 Bacteria 928
29 Ga0065165_1000436 3300005262 Bacteria 65530
30 Ga0065165_1010871 3300005262 Bacteria 3875
31 Ga0065165_1027698 3300005262 Bacteria 1841
32 Ga0065714_10264965 3300005288 Bacteria 749
33 Ga0065704_10147972 3300005289 Bacteria 1454
34 Ga0065712_10000661 3300005290 Bacteria 11127
35 Ga0065712_10112451 3300005290 Bacteria 1800
36 Ga0065712_10196712 3300005290 Bacteria 1125
37 Ga0065707_10127771 3300005295 Bacteria 1974
38 Ga0065707_10183691 3300005295 Unclassified 1402
39 Ga0070658_10010368 3300005327 Bacteria 7475
40 Ga0070658_10029344 3300005327 Bacteria 4418
41 Ga0070658_10040039 3300005327 Bacteria 3781
42 Ga0070658_10093407 3300005327 Bacteria 2481
43 Ga0070658_10141091 3300005327 Bacteria 2013
44 Ga0070658_10170037 3300005327 Bacteria 1831
45 Ga0070658_10635909 3300005327 Bacteria 926
46 Ga0070676_10007488 3300005328 Bacteria 5861
47 Ga0070676_10007533 3300005328 Bacteria 5847
48 Ga0070676_10012382 3300005328 Bacteria 4653
49 Ga0070676_10072342 3300005328 Unclassified 2072
50 Ga0070676_10536328 3300005328 Bacteria 836
51 Ga0070683_100048151 3300005329 Bacteria 3941
52 Ga0070683_100049320 3300005329 Bacteria 3894
53 Ga0070683_100080317 3300005329 Bacteria 3053
54 Ga0070683_100221886 3300005329 Bacteria 1797
55 Ga0070683_100268473 3300005329 Unclassified 1623
56 Ga0070683_100329379 3300005329 Bacteria 1454
57 Ga0070683_100547939 3300005329 Bacteria 1106
58 Ga0070683_100693185 3300005329 Bacteria 975
59 Ga0070670_100021730 3300005331 Bacteria 5519
60 Ga0070670_100026081 3300005331 Bacteria 5030
61 Ga0070670_100048082 3300005331 Bacteria 3671
62 Ga0070670_100062454 3300005331 Bacteria 3198
63 Ga0070670_100133415 3300005331 Bacteria 2145
64 Ga0070670_100230943 3300005331 Bacteria 1610
65 Ga0070670_100242729 3300005331 Bacteria 1568
66 Ga0070670_100632532 3300005331 Bacteria 959
67 Ga0070670_100785560 3300005331 Bacteria 859
68 Ga0070677_10049688 3300005333 Bacteria 1690
69 Ga0068869_100001213 3300005334 Bacteria 15157
70 Ga0068869_100008940 3300005334 Bacteria 6483
71 Ga0068869_100027216 3300005334 Bacteria 3984
72 Ga0068869_100059511 3300005334 Bacteria 2797
73 Ga0068869_100119531 3300005334 Bacteria 2014
74 Ga0068869_100161236 3300005334 Unclassified 1746
75 Ga0070666_10000038 3300005335 Bacteria 115799
76 Ga0070666_10035539 3300005335 Bacteria 3305
77 Ga0070680_100029132 3300005336 Bacteria 4434
78 Ga0070680_100033145 3300005336 Bacteria 4161
79 Ga0070680_100092951 3300005336 Unclassified 2498
80 Ga0070680_100096590 3300005336 Bacteria 2450
81 Ga0070680_100332018 3300005336 Unclassified 1291
82 Ga0070682_100000462 3300005337 Bacteria 25664
83 Ga0070682_100051348 3300005337 Bacteria 2577
84 Ga0070682_100327279 3300005337 Unclassified 1134
85 Ga0068868_100002430 3300005338 Bacteria 12901
86 Ga0068868_100031755 3300005338 Bacteria 4060
87 Ga0068868_100044102 3300005338 Bacteria 3486
88 Ga0068868_100185404 3300005338 Bacteria 1728
89 Ga0068868_100192973 3300005338 Bacteria 1694
90 Ga0068868_100265052 3300005338 Bacteria 1450
91 Ga0068868_100374083 3300005338 Bacteria 1224
92 Ga0068868_100409264 3300005338 Bacteria 1172
93 Ga0068868_100624617 3300005338 Bacteria 957
94 Ga0068868_100769593 3300005338 Bacteria 866
95 Ga0070660_100049041 3300005339 Bacteria 3245
96 Ga0070660_100617242 3300005339 Bacteria 907
97 Ga0070660_100701463 3300005339 Bacteria 849
98 Ga0070660_101114491 3300005339 Bacteria 668
99 Ga0070689_100008276 3300005340 Bacteria 7318
100 Ga0070689_100015958 3300005340 Bacteria 5490
101 Ga0070689_100106396 3300005340 Bacteria 2225
102 Ga0070689_100261644 3300005340 Bacteria 1430
103 Ga0070691_10029945 3300005341 Bacteria 2548
104 Ga0070687_100390997 3300005343 Bacteria 909
105 Ga0070687_100443596 3300005343 Bacteria 861
106 Ga0070668_100002232 3300005347 Bacteria 14240
107 Ga0070668_100007815 3300005347 Bacteria 7941
108 Ga0070668_100025917 3300005347 Unclassified 4446
109 Ga0070668_100034818 3300005347 Bacteria 3838
110 Ga0070668_100083647 3300005347 Bacteria 2505
111 Ga0070668_100509255 3300005347 Bacteria 1043
112 Ga0070669_100007640 3300005353 Bacteria 7728
113 Ga0070669_100081326 3300005353 Bacteria 2413
114 Ga0070669_100137440 3300005353 Unclassified 1881
115 Ga0070675_100004112 3300005354 Bacteria 11049
116 Ga0070675_100124675 3300005354 Bacteria 2191
117 Ga0070675_100164429 3300005354 Bacteria 1910
118 Ga0070675_100197256 3300005354 Bacteria 1746
119 Ga0070675_100293294 3300005354 Bacteria 1432
120 Ga0070671_100232720 3300005355 Bacteria 1564
121 Ga0070674_100004279 3300005356 Bacteria 8121
122 Ga0070674_100197328 3300005356 Unclassified 1552
123 Ga0070673_100078528 3300005364 Bacteria 2670
124 Ga0070673_100084595 3300005364 Bacteria 2580
125 Ga0070673_100110964 3300005364 Bacteria 2274
126 Ga0070673_100136004 3300005364 Bacteria 2068
127 Ga0070688_100001613 3300005365 Bacteria 11291
128 Ga0070688_100022499 3300005365 Bacteria 3695
129 Ga0070688_100221604 3300005365 Bacteria 1333
130 Ga0070659_100064593 3300005366 Bacteria 2897
131 Ga0070659_100078815 3300005366 Bacteria 2629
132 Ga0070659_100084648 3300005366 Bacteria 2536
133 Ga0070667_100017912 3300005367 Bacteria 5871
134 Ga0070667_100019084 3300005367 Bacteria 5686
135 Ga0070667_100132615 3300005367 Bacteria 2175
136 Ga0070667_100186935 3300005367 Bacteria 1834
137 Ga0070667_100269813 3300005367 Bacteria 1525
138 Ga0070667_100752589 3300005367 Bacteria 903
139 Ga0070667_100934864 3300005367 Bacteria 808
140 Ga0070714_100588286 3300005435 Unclassified 1068
141 Ga0070713_100206609 3300005436 Bacteria 1776
142 Ga0070700_100082410 3300005441 Bacteria 2080
143 Ga0070700_100957526 3300005441 Unclassified 701
144 Ga0070663_100187307 3300005455 Bacteria 1609
145 Ga0070663_100222760 3300005455 Bacteria 1481
146 Ga0070678_100237308 3300005456 Bacteria 1523
147 Ga0070678_100599208 3300005456 Bacteria 983
148 Ga0070678_101079450 3300005456 Unclassified 741
149 Ga0070662_100581128 3300005457 Bacteria 941
150 Ga0070681_10009082 3300005458 Bacteria 9771
151 Ga0070681_10015101 3300005458 Bacteria 7681
152 Ga0070681_10121009 3300005458 Bacteria 2552
153 Ga0070681_10234554 3300005458 Bacteria 1749
154 Ga0070681_10586944 3300005458 Bacteria 1028
155 Ga0070681_10822982 3300005458 Bacteria 846
156 Ga0068867_100011969 3300005459 Bacteria 6128
157 Ga0068867_100017092 3300005459 Bacteria 5153
158 Ga0068867_100070399 3300005459 Bacteria 2615
159 Ga0068867_100076890 3300005459 Bacteria 2507
160 Ga0068867_100313416 3300005459 Bacteria 1297
161 Ga0068867_100598630 3300005459 Bacteria 961
162 Ga0070685_10008312 3300005466 Bacteria 5327
163 Ga0070698_100169759 3300005471 Bacteria 2123
164 Ga0070679_100001442 3300005530 Bacteria 21032
165 Ga0070679_100004485 3300005530 Bacteria 12895
166 Ga0070679_100072510 3300005530 Bacteria 3435
167 Ga0070679_100339490 3300005530 Bacteria 1450
168 Ga0070684_100004834 3300005535 Bacteria 10293
169 Ga0070684_100024212 3300005535 Bacteria 5090
170 Ga0070684_100152960 3300005535 Bacteria 2091
171 Ga0070684_100229730 3300005535 Bacteria 1694
172 Ga0070684_100312971 3300005535 Bacteria 1442
173 Ga0070684_100537503 3300005535 Bacteria 1084
174 Ga0070697_100893625 3300005536 Bacteria 788
175 Ga0068853_100001974 3300005539 Bacteria 15118
176 Ga0068853_100005501 3300005539 Bacteria 9930
177 Ga0068853_100069345 3300005539 Bacteria 3067
178 Ga0068853_100336038 3300005539 Bacteria 1403
179 Ga0068853_100373846 3300005539 Bacteria 1330
180 Ga0068853_100375034 3300005539 Bacteria 1328
181 Ga0068853_100425978 3300005539 Bacteria 1245
182 Ga0070672_100004965 3300005543 Bacteria 8758
183 Ga0070672_100070167 3300005543 Bacteria 2784
184 Ga0070672_100075356 3300005543 Unclassified 2693
185 Ga0070672_100577432 3300005543 Unclassified 978
186 Ga0070672_100724560 3300005543 Unclassified 872
187 Ga0070693_100007859 3300005547 Bacteria 5230
188 Ga0070665_100001841 3300005548 Bacteria 24099
189 Ga0070665_100023645 3300005548 Bacteria 6186
190 Ga0070665_100413701 3300005548 Bacteria 1357
191 Ga0068855_100001137 3300005563 Bacteria 32980
192 Ga0068855_100008055 3300005563 Bacteria 12733
193 Ga0068855_100080085 3300005563 Bacteria 3787
194 Ga0068855_100097149 3300005563 Unclassified 3393
195 Ga0068855_100232262 3300005563 Bacteria 2065
196 Ga0068855_100363654 3300005563 Bacteria 1592
197 Ga0068855_100382828 3300005563 Bacteria 1544
198 Ga0068855_100394834 3300005563 Bacteria 1517
199 Ga0070664_100006818 3300005564 Bacteria 9212
200 Ga0070664_100044832 3300005564 Bacteria 3734
201 Ga0070664_100048180 3300005564 Bacteria 3601
202 Ga0070664_100177625 3300005564 Bacteria 1891
203 Ga0070664_100667150 3300005564 Unclassified 967
204 Ga0070664_100690732 3300005564 Bacteria 950
205 Ga0068857_100035941 3300005577 Bacteria 4389
206 Ga0068857_100104574 3300005577 Bacteria 2542
207 Ga0068857_100140462 3300005577 Bacteria 2183
208 Ga0068857_100243862 3300005577 Bacteria 1646
209 Ga0068857_100246023 3300005577 Bacteria 1638
210 Ga0068857_100348961 3300005577 Bacteria 1370
211 Ga0068857_100364550 3300005577 Unclassified 1340
212 Ga0068857_100461469 3300005577 Bacteria 1189
213 Ga0068857_100613648 3300005577 Bacteria 1029
214 Ga0068857_100980941 3300005577 Bacteria 813
215 Ga0068854_100124333 3300005578 Bacteria 1963
216 Ga0068854_100369306 3300005578 Bacteria 1179
217 Ga0068856_100009166 3300005614 Bacteria 9621
218 Ga0068856_100136052 3300005614 Unclassified 2462
219 Ga0068856_100137317 3300005614 Unclassified 2451
220 Ga0068852_100001659 3300005616 Bacteria 15178
221 Ga0068852_100006054 3300005616 Bacteria 8715
222 Ga0068852_100010785 3300005616 Bacteria 6845
223 Ga0068852_100038053 3300005616 Unclassified 4040
224 Ga0068852_100039117 3300005616 Bacteria 3991
225 Ga0068852_100483536 3300005616 Bacteria 1231
226 Ga0068852_100590414 3300005616 Bacteria 1114
227 Ga0068852_100790408 3300005616 Bacteria 963
228 Ga0068859_100000007 3300005617 Bacteria 390070
229 Ga0068859_100005939 3300005617 Bacteria 12395
230 Ga0068859_100007298 3300005617 Bacteria 11213
231 Ga0068859_100053444 3300005617 Bacteria 4063
232 Ga0068859_100085938 3300005617 Bacteria 3191
233 Ga0068859_100211768 3300005617 Bacteria 2024
234 Ga0068859_100315486 3300005617 Unclassified 1657
235 Ga0068859_100373945 3300005617 Unclassified 1520
236 Ga0068859_100861076 3300005617 Bacteria 992
237 Ga0068864_100000685 3300005618 Bacteria 28427
238 Ga0068864_100078167 3300005618 Bacteria 2895
239 Ga0068864_100098112 3300005618 Bacteria 2594
240 Ga0068864_100294136 3300005618 Bacteria 1519
241 Ga0068864_100295740 3300005618 Unclassified 1515
242 Ga0068861_100011956 3300005719 Bacteria 6045
243 Ga0068861_100082382 3300005719 Bacteria 2521
244 Ga0068861_100097495 3300005719 Bacteria 2332
245 Ga0068861_100097774 3300005719 Unclassified 2329
246 Ga0068861_100566855 3300005719 Unclassified 1037
247 Ga0068861_100929290 3300005719 Bacteria 826
248 Ga0068851_10056995 3300005834 Bacteria 1994
249 Ga0068851_10083371 3300005834 Bacteria 1673
250 Ga0068851_10196126 3300005834 Unclassified 1125
251 Ga0068851_10293210 3300005834 Bacteria 933
252 Ga0068870_10013221 3300005840 Bacteria 3875
253 Ga0068870_10020019 3300005840 Unclassified 3252
254 Ga0068870_10079494 3300005840 Bacteria 1809
255 Ga0068863_100018440 3300005841 Bacteria 6679
256 Ga0068863_100029101 3300005841 Bacteria 5274
257 Ga0068863_100030116 3300005841 Bacteria 5184
258 Ga0068863_100571603 3300005841 Bacteria 1117
259 Ga0068863_100649717 3300005841 Bacteria 1046
260 Ga0068863_100684508 3300005841 Bacteria 1019
261 Ga0068858_100003163 3300005842 Bacteria 16480
262 Ga0068858_100063023 3300005842 Bacteria 3429
263 Ga0068858_100287788 3300005842 Unclassified 1566
264 Ga0068858_100318255 3300005842 Bacteria 1486
265 Ga0068858_100481076 3300005842 Bacteria 1198
266 Ga0068858_100541347 3300005842 Bacteria 1127
267 Ga0068860_100000052 3300005843 Bacteria 207351
268 Ga0068860_100001511 3300005843 Bacteria 25059
269 Ga0068860_100003681 3300005843 Bacteria 15776
270 Ga0068860_100012160 3300005843 Bacteria 8479
271 Ga0068860_100013747 3300005843 Bacteria 7937
272 Ga0068860_100014258 3300005843 Bacteria 7794
273 Ga0068860_100020337 3300005843 Bacteria 6429
274 Ga0068860_100035248 3300005843 Bacteria 4801
275 Ga0068860_100165723 3300005843 Bacteria 2133
276 Ga0068860_100167208 3300005843 Bacteria 2123
277 Ga0068860_100247929 3300005843 Bacteria 1733
278 Ga0068860_100483985 3300005843 Bacteria 1234
279 Ga0068860_100488768 3300005843 Unclassified 1227
280 Ga0068860_100512583 3300005843 Bacteria 1199
281 Ga0068862_100026484 3300005844 Bacteria 4874
282 Ga0068862_100034043 3300005844 Bacteria 4308
283 Ga0068862_100324559 3300005844 Unclassified 1422
284 Ga0081539_10000120 3300005985 Bacteria 183566
285 Ga0075367_10061073 3300006178 Bacteria 2249
286 Ga0075366_10008398 3300006195 Bacteria 5740
287 Ga0075366_10011185 3300006195 Bacteria 5060
288 Ga0075366_10161526 3300006195 Bacteria 1358
289 Ga0075366_10227556 3300006195 Bacteria 1136
290 Ga0075366_10355010 3300006195 Bacteria 900
291 Ga0097621_100000611 3300006237 Bacteria 25252
292 Ga0097621_100014924 3300006237 Bacteria 5830
293 Ga0097621_100023053 3300006237 Bacteria 4842
294 Ga0097621_100070125 3300006237 Bacteria 2894
295 Ga0097621_100133437 3300006237 Unclassified 2115
296 Ga0068871_100008869 3300006358 Bacteria 7249
297 Ga0068871_100010721 3300006358 Bacteria 6702
298 Ga0068871_100012226 3300006358 Bacteria 6320
299 Ga0068871_100022572 3300006358 Bacteria 4854
300 Ga0068871_100248949 3300006358 Unclassified 1547
301 Ga0068871_100339657 3300006358 Bacteria 1326
302 Ga0068871_100543485 3300006358 Bacteria 1051
303 Ga0068871_100771405 3300006358 Bacteria 885
304 Ga0075428_101064068 3300006844 Bacteria 855
305 Ga0075431_100005210 3300006847 Bacteria 12808
306 Ga0075429_100004647 3300006880 Bacteria 11808
307 Ga0068865_100002580 3300006881 Bacteria 10756
308 Ga0068865_100015426 3300006881 Bacteria 4873
309 Ga0068865_100128445 3300006881 Unclassified 1896
310 Ga0068865_100141727 3300006881 Bacteria 1813
311 Ga0068865_100177830 3300006881 Bacteria 1637
312 Ga0097620_100000007 3300006931 Bacteria 390070
313 Ga0097620_100005939 3300006931 Bacteria 12395
314 Ga0097620_100007298 3300006931 Bacteria 11213
315 Ga0097620_100053445 3300006931 Bacteria 4063
316 Ga0097620_100085934 3300006931 Bacteria 3191
317 Ga0097620_100211772 3300006931 Bacteria 2024
318 Ga0097620_100315489 3300006931 Unclassified 1657
319 Ga0097620_100373936 3300006931 Unclassified 1520
320 Ga0097620_100861055 3300006931 Bacteria 992
321 Ga0105240_10000728 3300009093 Bacteria 60140
322 Ga0105240_10000822 3300009093 Bacteria 56372
323 Ga0105240_10004785 3300009093 Bacteria 20422
324 Ga0105240_10007855 3300009093 Bacteria 15393
325 Ga0105240_10013063 3300009093 Bacteria 11429
326 Ga0105240_10052936 3300009093 Bacteria 5100
327 Ga0105240_10071237 3300009093 Bacteria 4299
328 Ga0105240_10155272 3300009093 Bacteria 2723
329 Ga0105240_10171975 3300009093 Bacteria 2565
330 Ga0105240_10230685 3300009093 Bacteria 2152
331 Ga0105240_10642565 3300009093 Bacteria 1164
332 Ga0105240_11326747 3300009093 Bacteria 758
333 Ga0111539_10004306 3300009094 Bacteria 18619
334 Ga0111539_10319296 3300009094 Unclassified 1807
335 Ga0105245_10414992 3300009098 Bacteria 1348
336 Ga0105247_10007816 3300009101 Bacteria 6543
337 Ga0105247_10008390 3300009101 Bacteria 6298
338 Ga0114129_10000608 3300009147 Bacteria 44314
339 Ga0114129_10097830 3300009147 Unclassified 4062
340 Ga0105241_10000104 3300009174 Bacteria 60482
341 Ga0105241_10001316 3300009174 Bacteria 18866
342 Ga0105241_10004217 3300009174 Bacteria 10615
343 Ga0105241_10052751 3300009174 Bacteria 3106
344 Ga0105241_10341167 3300009174 Bacteria 1298
345 Ga0105241_10465636 3300009174 Unclassified 1121
346 Ga0105242_10049843 3300009176 Bacteria 3408
347 Ga0105242_10204023 3300009176 Unclassified 1758
348 Ga0105248_10443938 3300009177 Bacteria 1462
349 Ga0105237_10000841 3300009545 Bacteria 41862
350 Ga0105237_10002964 3300009545 Bacteria 20540
351 Ga0105237_10006531 3300009545 Bacteria 12907
352 Ga0105237_10009111 3300009545 Bacteria 10667
353 Ga0105237_10018106 3300009545 Bacteria 7294
354 Ga0105237_10020183 3300009545 Bacteria 6877
355 Ga0105237_10055660 3300009545 Bacteria 3962
356 Ga0105237_10057748 3300009545 Bacteria 3883
357 Ga0105237_10132503 3300009545 Unclassified 2487
358 Ga0105237_10192956 3300009545 Unclassified 2036
359 Ga0105237_10497778 3300009545 Bacteria 1225
360 Ga0105237_10551310 3300009545 Bacteria 1159
361 Ga0105237_10578381 3300009545 Bacteria 1130
362 Ga0105238_10008635 3300009551 Bacteria 10195
363 Ga0105238_10016959 3300009551 Bacteria 7391
364 Ga0105238_10056612 3300009551 Bacteria 3933
365 Ga0105238_10118753 3300009551 Bacteria 2624
366 Ga0105238_10563538 3300009551 Bacteria 1144
367 Ga0105249_10000349 3300009553 Bacteria 46353
368 Ga0105249_10009352 3300009553 Bacteria 8574
369 Ga0105249_10016031 3300009553 Bacteria 6641
370 Ga0105249_10056439 3300009553 Unclassified 3595
371 Ga0105249_10081333 3300009553 Bacteria 3011
372 Ga0105249_10094912 3300009553 Bacteria 2796
373 Ga0105249_10100641 3300009553 Unclassified 2718
374 Ga0105249_10187466 3300009553 Bacteria 2016
375 Ga0105239_10000755 3300010375 Bacteria 45854
376 Ga0105239_10000936 3300010375 Bacteria 41213
377 Ga0105239_10003951 3300010375 Bacteria 17961
378 Ga0105239_10006358 3300010375 Bacteria 13727
379 Ga0105239_10016065 3300010375 Bacteria 8281
380 Ga0105239_10057673 3300010375 Bacteria 4260
381 Ga0105239_10136715 3300010375 Bacteria 2729
382 Ga0105239_10140927 3300010375 Bacteria 2686
383 Ga0105239_10245842 3300010375 Bacteria 2009
384 Ga0105239_10252875 3300010375 Bacteria 1979
385 Ga0105239_10257525 3300010375 Bacteria 1961
386 Ga0105246_10001838 3300011119 Bacteria 12732
387 Ga0105246_10207579 3300011119 Unclassified 1527
388 Ga0105246_10527338 3300011119 Bacteria 1008
389 Ga0157373_10000876 3300013100 Bacteria 23274
390 Ga0157373_10056306 3300013100 Bacteria 2793
391 Ga0157371_10001606 3300013102 Bacteria 23180
392 Ga0157371_10002634 3300013102 Bacteria 17023
393 Ga0157371_10003430 3300013102 Bacteria 14384
394 Ga0157371_10003627 3300013102 Bacteria 13899
395 Ga0157371_10011045 3300013102 Bacteria 6996
396 Ga0157371_10016632 3300013102 Bacteria 5483
397 Ga0157371_10030073 3300013102 Bacteria 3920
398 Ga0157371_10057895 3300013102 Bacteria 2749
399 Ga0157371_10099804 3300013102 Bacteria 2059
400 Ga0157371_10108302 3300013102 Bacteria 1972
401 Ga0157371_10133786 3300013102 Bacteria 1765
402 Ga0157371_10169691 3300013102 Bacteria 1559
403 Ga0157371_10352120 3300013102 Bacteria 1072
404 Ga0157370_10000473 3300013104 Bacteria 50187
405 Ga0157370_10000631 3300013104 Bacteria 43919
406 Ga0157370_10001463 3300013104 Bacteria 29196
407 Ga0157370_10001929 3300013104 Bacteria 25519
408 Ga0157370_10003253 3300013104 Bacteria 19143
409 Ga0157370_10081337 3300013104 Bacteria 3048
410 Ga0157370_10088225 3300013104 Bacteria 2913
411 Ga0157370_10192246 3300013104 Bacteria 1894
412 Ga0157370_10206077 3300013104 Bacteria 1823
413 Ga0157370_10540417 3300013104 Bacteria 1069
414 Ga0157370_10575487 3300013104 Bacteria 1032
415 Ga0157370_11211925 3300013104 Bacteria 681
416 Ga0157369_10010202 3300013105 Bacteria 10718
417 Ga0157369_10047443 3300013105 Bacteria 4664
418 Ga0157369_10190553 3300013105 Bacteria 2155
419 Ga0157369_10494325 3300013105 Bacteria 1266
420 Ga0157369_10636179 3300013105 Bacteria 1100
421 Ga0157369_10998971 3300013105 Bacteria 857
422 Ga0157374_10000082 3300013296 Bacteria 95018
423 Ga0157374_10000237 3300013296 Bacteria 51331
424 Ga0157374_10071499 3300013296 Bacteria 3271
425 Ga0157374_10116823 3300013296 Bacteria 2571
426 Ga0157374_10159523 3300013296 Bacteria 2197
427 Ga0157374_10196242 3300013296 Bacteria 1975
428 Ga0157374_10205761 3300013296 Bacteria 1929
429 Ga0157374_10362139 3300013296 Bacteria 1442
430 Ga0157374_10364020 3300013296 Bacteria 1438
431 Ga0157374_10392540 3300013296 Bacteria 1383
432 Ga0157374_11259619 3300013296 Bacteria 761
433 Ga0157378_10002819 3300013297 Bacteria 15501
434 Ga0157378_10020773 3300013297 Bacteria 5774
435 Ga0157378_10054652 3300013297 Bacteria 3555
436 Ga0157378_10071369 3300013297 Bacteria 3119
437 Ga0157378_10409947 3300013297 Bacteria 1337
438 Ga0157378_10510695 3300013297 Unclassified 1202
439 Ga0163162_10000086 3300013306 Bacteria 85949
440 Ga0163162_10000226 3300013306 Bacteria 51615
441 Ga0163162_10001051 3300013306 Bacteria 25638
442 Ga0163162_10001766 3300013306 Bacteria 20260
443 Ga0163162_10006217 3300013306 Bacteria 11572
444 Ga0163162_10015360 3300013306 Bacteria 7482
445 Ga0163162_10029801 3300013306 Bacteria 5402
446 Ga0163162_10153084 3300013306 Bacteria 2424
447 Ga0163162_10371562 3300013306 Unclassified 1563
448 Ga0163162_10388005 3300013306 Unclassified 1529
449 Ga0163162_10942027 3300013306 Bacteria 975
450 Ga0157372_10005832 3300013307 Bacteria 13117
451 Ga0157372_10006279 3300013307 Bacteria 12639
452 Ga0157372_10033052 3300013307 Bacteria 5678
453 Ga0157372_10054533 3300013307 Bacteria 4460
454 Ga0157372_10057046 3300013307 Bacteria 4365
455 Ga0157372_10084962 3300013307 Bacteria 3589
456 Ga0157372_10102814 3300013307 Bacteria 3264
457 Ga0157372_10105645 3300013307 Bacteria 3221
458 Ga0157372_10195910 3300013307 Bacteria 2340
459 Ga0157372_10211125 3300013307 Bacteria 2250
460 Ga0157372_10288797 3300013307 Bacteria 1907
461 Ga0157372_10407974 3300013307 Bacteria 1583
462 Ga0157372_10433548 3300013307 Unclassified 1532
463 Ga0157372_10466976 3300013307 Bacteria 1471
464 Ga0157372_10503053 3300013307 Bacteria 1413
465 Ga0157372_10847988 3300013307 Bacteria 1061
466 Ga0157372_10954588 3300013307 Bacteria 994
467 Ga0157372_10956967 3300013307 Bacteria 992
468 Ga0157372_11961646 3300013307 Bacteria 673
469 Ga0157375_10000115 3300013308 Bacteria 77964
470 Ga0157375_10030276 3300013308 Bacteria 5102
471 Ga0157375_10041963 3300013308 Unclassified 4423
472 Ga0157375_10059422 3300013308 Bacteria 3788
473 Ga0157375_10072306 3300013308 Bacteria 3465
474 Ga0157375_10237762 3300013308 Bacteria 1981
475 Ga0157375_10570108 3300013308 Bacteria 1293
476 Ga0163163_10000088 3300014325 Bacteria 101126
477 Ga0163163_10000244 3300014325 Bacteria 55634
478 Ga0163163_10003449 3300014325 Bacteria 13434
479 Ga0163163_10089730 3300014325 Bacteria 3086
480 Ga0163163_10206453 3300014325 Bacteria 2013
481 Ga0163163_10327720 3300014325 Bacteria 1585
482 Ga0157380_10002932 3300014326 Bacteria 11595
483 Ga0157380_10314685 3300014326 Bacteria 1448
484 Ga0157377_10013206 3300014745 Bacteria 4175
485 Ga0157377_10025801 3300014745 Unclassified 3138
486 Ga0157377_10046580 3300014745 Bacteria 2426
487 Ga0157377_10099087 3300014745 Unclassified 1733
488 Ga0157379_10011834 3300014968 Bacteria 7621
489 Ga0157379_10022878 3300014968 Bacteria 5540
490 Ga0157379_10072415 3300014968 Bacteria 3083
491 Ga0157379_10083102 3300014968 Bacteria 2870
492 Ga0157379_10130716 3300014968 Bacteria 2260
493 Ga0157379_10412908 3300014968 Bacteria 1242
494 Ga0157379_10497234 3300014968 Bacteria 1130
495 Ga0157379_10523746 3300014968 Unclassified 1101
496 Ga0157379_10617162 3300014968 Bacteria 1013
497 Ga0157376_10001060 3300014969 Bacteria 18012
498 Ga0157376_10006708 3300014969 Bacteria 8149
499 Ga0157376_10033319 3300014969 Bacteria 4147
500 Ga0157376_10113753 3300014969 Bacteria 2387
501 Ga0157376_10572390 3300014969 Unclassified 1121
502 Ga0157376_10719768 3300014969 Bacteria 1005
503 Ga0182005_1000100 3300015265 Bacteria 65235
504 Ga0163161_10000968 3300017792 Bacteria 21949
505 Ga0163161_10021573 3300017792 Bacteria 4525
506 Ga0163161_10063543 3300017792 Bacteria 2691
507 Ga0163161_10082782 3300017792 Unclassified 2365
508 Ga0163161_10203377 3300017792 Bacteria 1527
509 Ga0163161_10998847 3300017792 Unclassified 714
510 Ga0206350_10720946 3300020080 Eukaryota 831
511 Ga0206350_11190917 3300020080 Unclassified 1470
512 Ga0213876_10010328 3300021384 Bacteria 5012
513 Ga0209436_100776 3300025208 Bacteria 13217
514 Ga0209436_110527 3300025208 Bacteria 1686
515 Ga0209258_100032 3300025242 Bacteria 452764
516 Ga0209646_1000050 3300025246 Bacteria 296599
517 Ga0209646_1001058 3300025246 Bacteria 8271
518 Ga0209026_1000452 3300025250 Bacteria 32703
519 Ga0209148_1000223 3300025254 Bacteria 93490
520 Ga0209673_1000042 3300025273 Bacteria 300704
521 Ga0209130_1000921 3300025284 Bacteria 23640
522 Ga0209564_1009094 3300025295 Bacteria 4784
523 Ga0209758_1002389 3300025297 Bacteria 19314
524 Ga0209758_1018818 3300025297 Bacteria 3365
525 Ga0209050_1000295 3300025298 Bacteria 104889
526 Ga0207426_1000059 3300025302 Bacteria 363842
527 Ga0207426_1000250 3300025302 Bacteria 117492
528 Ga0207426_1000549 3300025302 Bacteria 52206
529 Ga0207426_1000732 3300025302 Bacteria 37561
530 Ga0207426_1013618 3300025302 Bacteria 3007
531 Ga0207426_1039810 3300025302 Bacteria 1469
532 Ga0209051_1047707 3300025303 Bacteria 1460
533 Ga0209257_1011800 3300025304 Bacteria 4144
534 Ga0207697_10007749 3300025315 Bacteria 4760
535 Ga0207656_10064949 3300025321 Bacteria 1610
536 Ga0207656_10223176 3300025321 Bacteria 916
537 Ga0207682_10035528 3300025893 Bacteria 2013
538 Ga0207682_10061360 3300025893 Bacteria 1574
539 Ga0207710_10066209 3300025900 Bacteria 1648
540 Ga0207710_10138769 3300025900 Bacteria 1172
541 Ga0207680_10000015 3300025903 Bacteria 138253
542 Ga0207680_10103913 3300025903 Bacteria 1830
543 Ga0207680_10425120 3300025903 Bacteria 941
544 Ga0207647_10030149 3300025904 Bacteria 3502
545 Ga0207647_10237685 3300025904 Bacteria 1047
546 Ga0207645_10007658 3300025907 Bacteria 7609
547 Ga0207645_10012916 3300025907 Bacteria 5652
548 Ga0207645_10015110 3300025907 Bacteria 5143
549 Ga0207643_10005965 3300025908 Bacteria 6510
550 Ga0207643_10036187 3300025908 Bacteria 2768
551 Ga0207705_10005519 3300025909 Bacteria 9459
552 Ga0207705_10041346 3300025909 Bacteria 3307
553 Ga0207705_10282138 3300025909 Bacteria 1272
554 Ga0207705_10332821 3300025909 Bacteria 1168
555 Ga0207654_10001648 3300025911 Bacteria 11678
556 Ga0207654_10002787 3300025911 Bacteria 8879
557 Ga0207654_10022864 3300025911 Bacteria 3341
558 Ga0207654_10023652 3300025911 Bacteria 3294
559 Ga0207654_10118760 3300025911 Bacteria 1657
560 Ga0207654_10259889 3300025911 Bacteria 1167
561 Ga0207707_10004161 3300025912 Bacteria 12820
562 Ga0207707_10121149 3300025912 Unclassified 2287
563 Ga0207707_10343707 3300025912 Bacteria 1286
564 Ga0207707_10489650 3300025912 Bacteria 1050
565 Ga0207707_10634642 3300025912 Bacteria 902
566 Ga0207695_10000189 3300025913 Bacteria 177142
567 Ga0207695_10000839 3300025913 Bacteria 56384
568 Ga0207695_10001190 3300025913 Bacteria 44747
569 Ga0207695_10024238 3300025913 Bacteria 6832
570 Ga0207695_10044697 3300025913 Bacteria 4708
571 Ga0207695_10067448 3300025913 Unclassified 3670
572 Ga0207695_10213366 3300025913 Bacteria 1840
573 Ga0207671_10001528 3300025914 Bacteria 26548
574 Ga0207671_10002710 3300025914 Bacteria 18563
575 Ga0207671_10005708 3300025914 Bacteria 11360
576 Ga0207671_10009702 3300025914 Bacteria 8018
577 Ga0207671_10020062 3300025914 Bacteria 5098
578 Ga0207671_10022134 3300025914 Bacteria 4810
579 Ga0207671_10023275 3300025914 Bacteria 4673
580 Ga0207671_10075636 3300025914 Unclassified 2519
581 Ga0207671_10121475 3300025914 Bacteria 1997
582 Ga0207671_10231696 3300025914 Bacteria 1449
583 Ga0207671_10288675 3300025914 Bacteria 1295
584 Ga0207671_10369921 3300025914 Bacteria 1138
585 Ga0207660_10014719 3300025917 Bacteria 5153
586 Ga0207660_10078611 3300025917 Bacteria 2418
587 Ga0207660_10081069 3300025917 Unclassified 2384
588 Ga0207662_10224277 3300025918 Bacteria 1225
589 Ga0207657_10023553 3300025919 Bacteria 5730
590 Ga0207657_10030450 3300025919 Bacteria 4898
591 Ga0207657_10055528 3300025919 Bacteria 3420
592 Ga0207657_10114129 3300025919 Bacteria 2228
593 Ga0207657_10370902 3300025919 Bacteria 1128
594 Ga0207649_10108330 3300025920 Bacteria 1851
595 Ga0207649_10384342 3300025920 Unclassified 1047
596 Ga0207649_10703906 3300025920 Unclassified 784
597 Ga0207652_10000055 3300025921 Bacteria 115420
598 Ga0207652_10000121 3300025921 Bacteria 85376
599 Ga0207652_10000397 3300025921 Bacteria 45365
600 Ga0207652_10026359 3300025921 Bacteria 4840
601 Ga0207652_10122844 3300025921 Bacteria 2311
602 Ga0207681_10032161 3300025923 Bacteria 3433
603 Ga0207681_10440740 3300025923 Bacteria 1058
604 Ga0207694_10009052 3300025924 Bacteria 7514
605 Ga0207694_10148385 3300025924 Bacteria 1888
606 Ga0207694_10331225 3300025924 Bacteria 1258
607 Ga0207650_10008566 3300025925 Bacteria 6982
608 Ga0207650_10069036 3300025925 Bacteria 2655
609 Ga0207650_10121053 3300025925 Bacteria 2038
610 Ga0207650_10167017 3300025925 Bacteria 1747
611 Ga0207650_10220158 3300025925 Bacteria 1527
612 Ga0207650_10270520 3300025925 Bacteria 1381
613 Ga0207650_10398018 3300025925 Bacteria 1139
614 Ga0207650_10410229 3300025925 Unclassified 1123
615 Ga0207650_10632788 3300025925 Bacteria 901
616 Ga0207659_10012225 3300025926 Bacteria 5449
617 Ga0207659_10028666 3300025926 Unclassified 3786
618 Ga0207659_10078755 3300025926 Bacteria 2429
619 Ga0207659_10080878 3300025926 Bacteria 2401
620 Ga0207659_10461905 3300025926 Bacteria 1070
621 Ga0207659_10548200 3300025926 Bacteria 983
622 Ga0207664_10076429 3300025929 Bacteria 2711
623 Ga0207644_10005946 3300025931 Bacteria 7955
624 Ga0207644_10214342 3300025931 Bacteria 1524
625 Ga0207644_10892485 3300025931 Bacteria 745
626 Ga0207690_10226221 3300025932 Bacteria 1434
627 Ga0207706_10010719 3300025933 Bacteria 8373
628 Ga0207706_10018001 3300025933 Bacteria 6357
629 Ga0207706_10522737 3300025933 Bacteria 1023
630 Ga0207706_10529011 3300025933 Bacteria 1016
631 Ga0207686_10126840 3300025934 Bacteria 1745
632 Ga0207670_10003257 3300025936 Bacteria 8605
633 Ga0207670_10037466 3300025936 Bacteria 3160
634 Ga0207670_10067319 3300025936 Bacteria 2464
635 Ga0207670_10709788 3300025936 Bacteria 833
636 Ga0207669_10696976 3300025937 Bacteria 834
637 Ga0207704_10007779 3300025938 Bacteria 5085
638 Ga0207704_10052872 3300025938 Bacteria 2465
639 Ga0207691_10002284 3300025940 Bacteria 18761
640 Ga0207691_10011435 3300025940 Bacteria 8516
641 Ga0207691_10092002 3300025940 Bacteria 2716
642 Ga0207691_10175830 3300025940 Unclassified 1872
643 Ga0207691_10179607 3300025940 Bacteria 1850
644 Ga0207691_10245352 3300025940 Bacteria 1547
645 Ga0207691_10260339 3300025940 Unclassified 1495
646 Ga0207691_10433752 3300025940 Unclassified 1119
647 Ga0207711_10372055 3300025941 Bacteria 1325
648 Ga0207689_10001007 3300025942 Bacteria 27057
649 Ga0207689_10003192 3300025942 Bacteria 15033
650 Ga0207689_10004656 3300025942 Bacteria 12404
651 Ga0207689_10015665 3300025942 Bacteria 6420
652 Ga0207689_10089680 3300025942 Bacteria 2525
653 Ga0207689_10142420 3300025942 Bacteria 1975
654 Ga0207689_10326440 3300025942 Bacteria 1274
655 Ga0207661_10008305 3300025944 Bacteria 7417
656 Ga0207661_10052833 3300025944 Bacteria 3248
657 Ga0207661_10134549 3300025944 Bacteria 2122
658 Ga0207661_10179358 3300025944 Unclassified 1849
659 Ga0207661_10183888 3300025944 Bacteria 1828
660 Ga0207661_10343734 3300025944 Unclassified 1345
661 Ga0207661_10873386 3300025944 Bacteria 828
662 Ga0207679_10004170 3300025945 Bacteria 8982
663 Ga0207679_10016760 3300025945 Bacteria 4869
664 Ga0207679_10426057 3300025945 Bacteria 1172
665 Ga0207679_10794637 3300025945 Unclassified 862
666 Ga0207667_10001711 3300025949 Bacteria 27600
667 Ga0207667_10002129 3300025949 Bacteria 24819
668 Ga0207667_10079731 3300025949 Unclassified 3393
669 Ga0207651_10021405 3300025960 Bacteria 3930
670 Ga0207651_10096548 3300025960 Bacteria 2180
671 Ga0207651_10700831 3300025960 Unclassified 892
672 Ga0207651_10854347 3300025960 Unclassified 809
673 Ga0207712_10003042 3300025961 Bacteria 10707
674 Ga0207712_10044585 3300025961 Unclassified 3066
675 Ga0207712_10100381 3300025961 Unclassified 2150
676 Ga0207712_10395078 3300025961 Bacteria 1161
677 Ga0207668_10074072 3300025972 Bacteria 2442
678 Ga0207668_10292868 3300025972 Bacteria 1340
679 Ga0207640_10016932 3300025981 Bacteria 4252
680 Ga0207640_10062196 3300025981 Bacteria 2476
681 Ga0207640_10499889 3300025981 Bacteria 1012
682 Ga0207658_10019069 3300025986 Bacteria 4744
683 Ga0207658_10083934 3300025986 Bacteria 2450
684 Ga0207658_10119811 3300025986 Bacteria 2096
685 Ga0207658_10269858 3300025986 Bacteria 1454
686 Ga0207658_10396963 3300025986 Bacteria 1211
687 Ga0207677_10005974 3300026023 Bacteria 6630
688 Ga0207677_10043133 3300026023 Bacteria 2996
689 Ga0207677_10285475 3300026023 Unclassified 1357
690 Ga0207677_10437733 3300026023 Bacteria 1117
691 Ga0207703_10004413 3300026035 Bacteria 11566
692 Ga0207703_10011330 3300026035 Bacteria 6936
693 Ga0207703_10240347 3300026035 Bacteria 1628
694 Ga0207703_10387361 3300026035 Bacteria 1294
695 Ga0207639_10035724 3300026041 Bacteria 3679
696 Ga0207639_10125984 3300026041 Bacteria 2113
697 Ga0207639_10129479 3300026041 Bacteria 2087
698 Ga0207639_10130610 3300026041 Bacteria 2079
699 Ga0207639_10197402 3300026041 Bacteria 1723
700 Ga0207639_10401729 3300026041 Bacteria 1234
701 Ga0207639_10589289 3300026041 Bacteria 1024
702 Ga0207639_10636168 3300026041 Bacteria 986
703 Ga0207639_10683019 3300026041 Bacteria 952
704 Ga0207639_10906577 3300026041 Bacteria 824
705 Ga0207639_10938750 3300026041 Bacteria 809
706 Ga0207678_10029161 3300026067 Bacteria 4816
707 Ga0207678_10600960 3300026067 Bacteria 964
708 Ga0207702_10037726 3300026078 Bacteria 4045
709 Ga0207702_10052219 3300026078 Unclassified 3458
710 Ga0207702_10096912 3300026078 Bacteria 2595
711 Ga0207702_10396300 3300026078 Bacteria 1330
712 Ga0207641_10000056 3300026088 Bacteria 170719
713 Ga0207641_10012112 3300026088 Bacteria 7075
714 Ga0207641_10022803 3300026088 Bacteria 5154
715 Ga0207641_10164057 3300026088 Bacteria 2022
716 Ga0207641_10656294 3300026088 Unclassified 1031
717 Ga0207641_10668496 3300026088 Bacteria 1021
718 Ga0207641_11037785 3300026088 Bacteria 817
719 Ga0207648_10004655 3300026089 Bacteria 14042
720 Ga0207648_10012488 3300026089 Bacteria 7953
721 Ga0207648_10016614 3300026089 Bacteria 6718
722 Ga0207648_10037624 3300026089 Bacteria 4263
723 Ga0207648_10131895 3300026089 Bacteria 2199
724 Ga0207648_10147776 3300026089 Bacteria 2073
725 Ga0207648_10212311 3300026089 Bacteria 1718
726 Ga0207648_10386947 3300026089 Bacteria 1265
727 Ga0207648_10716897 3300026089 Bacteria 928
728 Ga0207676_10035035 3300026095 Bacteria 3805
729 Ga0207676_10088827 3300026095 Unclassified 2531
730 Ga0207676_10127225 3300026095 Bacteria 2160
731 Ga0207676_10173626 3300026095 Unclassified 1880
732 Ga0207676_10417933 3300026095 Bacteria 1257
733 Ga0207674_10004751 3300026116 Bacteria 16286
734 Ga0207674_10024112 3300026116 Bacteria 6506
735 Ga0207674_10038653 3300026116 Bacteria 4950
736 Ga0207674_10039029 3300026116 Bacteria 4925
737 Ga0207674_10064267 3300026116 Bacteria 3702
738 Ga0207674_10085033 3300026116 Bacteria 3160
739 Ga0207674_10141956 3300026116 Bacteria 2361
740 Ga0207674_10179815 3300026116 Bacteria 2067
741 Ga0207674_10284796 3300026116 Bacteria 1601
742 Ga0207674_10348523 3300026116 Bacteria 1432
743 Ga0207675_100003813 3300026118 Bacteria 14671
744 Ga0207675_100007383 3300026118 Bacteria 10388
745 Ga0207675_100012540 3300026118 Bacteria 7918
746 Ga0207675_100018489 3300026118 Bacteria 6500
747 Ga0207675_100062310 3300026118 Bacteria 3483
748 Ga0207675_100074291 3300026118 Bacteria 3181
749 Ga0207675_100232223 3300026118 Bacteria 1780
750 Ga0207683_10002007 3300026121 Bacteria 18003
751 Ga0207683_10053052 3300026121 Bacteria 3554
752 Ga0207683_10229948 3300026121 Bacteria 1691
753 Ga0207683_10653236 3300026121 Bacteria 974
754 Ga0207698_10010138 3300026142 Bacteria 6037
755 Ga0207698_10018653 3300026142 Bacteria 4734
756 Ga0207698_10051843 3300026142 Bacteria 3139
757 Ga0207698_10056171 3300026142 Bacteria 3039
758 Ga0207698_10056605 3300026142 Bacteria 3029
759 Ga0207698_10225635 3300026142 Bacteria 1697
760 Ga0207698_10320805 3300026142 Unclassified 1451
761 Ga0207698_10356652 3300026142 Unclassified 1383
762 Ga0209999_1038540 3300027543 Bacteria 894
763 Ga0268266_10023889 3300028379 Bacteria 5202
764 Ga0268266_10295083 3300028379 Unclassified 1511
765 Ga0268266_10366162 3300028379 Bacteria 1357
766 Ga0268265_10067420 3300028380 Bacteria 2770
767 Ga0268265_10154331 3300028380 Unclassified 1941
768 Ga0268265_10442058 3300028380 Bacteria 1212
769 Ga0268264_10000143 3300028381 Bacteria 170031
770 Ga0268264_10001196 3300028381 Bacteria 25064
771 Ga0268264_10001996 3300028381 Bacteria 18331
772 Ga0268264_10017622 3300028381 Bacteria 5848
773 Ga0268264_10032895 3300028381 Bacteria 4256
774 Ga0268264_10063577 3300028381 Bacteria 3103
775 Ga0268264_10163267 3300028381 Bacteria 2009
776 Ga0307515_10000078 3300028794 Bacteria 227988
777 Ga0265327_10103988 3300031251 Bacteria 1366
778 Ga0307513_10058922 3300031456 Bacteria 4078
779 Ga0307513_10439506 3300031456 Bacteria 1031
780 Ga0307509_10505643 3300031507 Bacteria 892
781 Ga0307516_10000310 3300031730 Bacteria 63335
782 Ga0307516_10105729 3300031730 Unclassified 2626
783 Ga0307516_10556276 3300031730 Bacteria 801
784 Ga0307413_10416392 3300031824 Bacteria 1057
785 Ga0307410_10295184 3300031852 Bacteria 1277
786 Ga0307412_10927157 3300031911 Bacteria 765
787 Ga0307416_100469382 3300032002 Bacteria 1316
788 Ga0307416_101688856 3300032002 Bacteria 738
789 Ga0307414_10048812 3300032004 Bacteria 2923
790 Ga0307414_10146317 3300032004 Bacteria 1857
791 Ga0307414_10321574 3300032004 Bacteria 1317
792 Ga0307411_10171240 3300032005 Bacteria 1638
793 Ga0307415_100207344 3300032126 Bacteria 1561
794 Ga0307510_10001062 3300033180 Bacteria 29213
795 Ga0373923_0196712 3300035111 Bacteria 931
796 Ga0373945_0045219 3300035116 Bacteria 1603
797 Ga0373955_0101402 3300035172 Unclassified 1653
798 Ga0373924_0103694 3300035410 Unclassified 1225
799 Ga0373927_0011129 3300035695 Bacteria 5993
800 Ga0373937_0002104 3300036401 Bacteria 16647
801 Ga0265778_027271 3300036457 Unclassified 728
802 Ga0395899_0014778 3300037312 Bacteria 5958
803 Ga0395899_0018904 3300037312 Bacteria 5236
804 Ga0395899_0420753 3300037312 Bacteria 880
805 Ga0395899_0483603 3300037312 Bacteria 806
806 Ga0395900_0003621 3300037418 Bacteria 16611
807 Ga0395900_0025001 3300037418 Bacteria 6112
808 Ga0395900_0025207 3300037418 Bacteria 6088
809 Ga0395900_0154636 3300037418 Bacteria 2343
810 Ga0395900_0273229 3300037418 Unclassified 1684
811 Ga0395900_0450873 3300037418 Unclassified 1243
812 Ga0395898_0054622 3300037466 Bacteria 3896
813 Ga0395898_0068641 3300037466 Bacteria 3430
814 Ga0395898_0277980 3300037466 Bacteria 1597
815 Ga0395905_0005020 3300037471 Bacteria 13627
816 Ga0395905_0036628 3300037471 Bacteria 4608
817 Ga0395905_0068963 3300037471 Bacteria 3312
818 Ga0395905_0378668 3300037471 Bacteria 1309
819 Ga0395901_0012784 3300038443 Bacteria 8515
820 Ga0395901_0063596 3300038443 Bacteria 3840
821 Ga0395901_0305359 3300038443 Bacteria 1649
822 Ga0395901_0474814 3300038443 Bacteria 1276
823 Ga0395901_0561521 3300038443 Bacteria 1155
824 Ga0395901_0599806 3300038443 Bacteria 1110
825 Ga0436365_0262826 3300039437 Bacteria 23593
826 Ga0439436_0007077 3300041404 Bacteria 3453
827 Ga0439436_0075319 3300041404 Bacteria 940
828 Ga0439439_0006329 3300041406 Bacteria 2737
829 Ga0439439_0015516 3300041406 Bacteria 1862
830 Ga0439466_0089903 3300041411 Bacteria 963
831 Ga0439465_0010085 3300041413 Bacteria 2971
832 Ga0451807_1400206 3300041486 Unclassified 1758
833 Ga0451849_0783274 3300041505 Bacteria 1467
834 Ga0451853_1183943 3300041512 Bacteria 730
835 Ga0451853_3160169 3300041512 Bacteria 1086
836 Ga0439431_0009061 3300041997 Bacteria 2243
837 Ga0439431_0013467 3300041997 Bacteria 1887
838 Ga0439431_0013552 3300041997 Bacteria 1882
839 Ga0439441_076499 3300042001 Bacteria 724
840 Ga0439442_010332 3300042002 Bacteria 1892
841 Ga0439445_0011101 3300042004 Bacteria 2142
842 Ga0439445_0113951 3300042004 Unclassified 773
843 Ga0439445_0114136 3300042004 Bacteria 772
844 Ga0439449_0001249 3300042007 Bacteria 9967
845 Ga0439449_0025032 3300042007 Bacteria 2230
846 Ga0439449_0025747 3300042007 Bacteria 2198
847 Ga0439457_002994 3300042014 Bacteria 4694
848 Ga0439457_003090 3300042014 Bacteria 4602
849 Ga0439457_004882 3300042014 Bacteria 3444
850 Ga0439457_024395 3300042014 Bacteria 1339
851 Ga0439462_0001411 3300042015 Bacteria 5333
852 Ga0450896_013997 3300042133 Bacteria 1144
853 Ga0450898_004825 3300042134 Bacteria 2012
854 Ga0450899_000898 3300042135 Bacteria 3392
855 Ga0439434_0004572 3300042435 Bacteria 4049
856 Ga0451577_0098047 3300042876 Bacteria 2618
857 Ga0451577_0523880 3300042876 Unclassified 1076
858 Ga0466969_0000382 3300044656 Bacteria 24366
859 Ga0466972_0000010 3300044658 Bacteria 256339
860 Ga0466972_0000143 3300044658 Bacteria 58694
861 Ga0466972_0006101 3300044658 Bacteria 6054
862 Ga0466972_0027460 3300044658 Bacteria 2815
863 Ga0466972_0167925 3300044658 Bacteria 1030
864 Ga0453683_0209423 3300044673 Bacteria 1238
865 Ga0453683_0236351 3300044673 Bacteria 1163
866 Ga0466965_0376654 3300044683 Bacteria 781
867 Ga0466966_0000176 3300044684 Bacteria 42093
868 Ga0466961_0099771 3300044693 Unclassified 1830
869 Ga0466961_0167302 3300044693 Unclassified 1368
870 Ga0466964_0018699 3300044706 Bacteria 2661
871 Ga0453684_0082105 3300044712 Bacteria 4016
872 Ga0453684_0389835 3300044712 Bacteria 1562
873 Ga0453684_0633051 3300044712 Bacteria 1169
874 Ga0453684_0717052 3300044712 Bacteria 1085
875 Ga0466971_0063904 3300044719 Unclassified 1666
876 Ga0466968_0007972 3300044735 Bacteria 4046
877 Ga0466968_0219604 3300044735 Bacteria 895
878 Ga0466970_0000921 3300044765 Bacteria 14222
879 Ga0466970_0115434 3300044765 Unclassified 1468
880 Ga0466970_0175637 3300044765 Bacteria 1188
881 Ga0466970_0190026 3300044765 Bacteria 1141
882 Ga0466970_0230620 3300044765 Bacteria 1035
883 Ga0466957_0000577 3300044842 Bacteria 18517
884 Ga0466957_0385784 3300044842 Bacteria 956
885 Ga0466960_0030304 3300044901 Bacteria 2489
886 Ga0466959_0000016 3300045049 Bacteria 144600
887 Ga0466959_0014668 3300045049 Bacteria 5702
888 Ga0466959_0035604 3300045049 Bacteria 3680
889 Ga0466959_0059627 3300045049 Bacteria 2779
890 Ga0495592_0182992 3300046454 Unclassified 1426
891 Ga0495629_0214769 3300046459 Bacteria 1328
892 Ga0495638_0165194 3300046460 Bacteria 1274
893 Ga0495653_0199091 3300046463 Bacteria 1361
894 Ga0495606_0002808 3300046507 Bacteria 19390
895 Ga0495608_0264376 3300046511 Unclassified 1070
896 Ga0495618_0480110 3300046514 Bacteria 751
897 Ga0495628_0192773 3300046516 Bacteria 1538
898 Ga0495630_0003153 3300046517 Bacteria 11441
899 Ga0495648_0008648 3300046524 Bacteria 7982
900 Ga0495648_0228485 3300046524 Bacteria 913
901 Ga0495652_0526627 3300046529 Unclassified 816
902 Ga0495640_0226365 3300046533 Bacteria 1178
903 Ga0495622_0043460 3300046557 Bacteria 2089
904 Ga0495667_0218117 3300046559 Bacteria 1218
905 Ga0495634_0054328 3300046642 Bacteria 2682
906 Ga0495611_0000231 3300046648 Bacteria 38409
907 Ga0495611_0234725 3300046648 Unclassified 852
908 Ga0495625_0101589 3300046660 Bacteria 1975
909 Ga0495635_0236624 3300046663 Unclassified 1233
910 Ga0495657_0269380 3300046675 Bacteria 1021
911 Ga0495647_0180837 3300046681 Bacteria 917
912 Ga0495658_0004169 3300046683 Bacteria 7120
913 Ga0495604_0213874 3300047317 Bacteria 1331
914 Ga0495674_0006177 3300047319 Bacteria 11493
915 Ga0495674_0080161 3300047319 Bacteria 2802
916 Ga0495672_0018917 3300047320 Bacteria 4559
917 Ga0495680_0374124 3300047322 Unclassified 988
918 Ga0495687_000111 3300047443 Bacteria 124789
919 Ga0495684_0051254 3300047471 Bacteria 3150
920 Ga0495686_0088327 3300047472 Bacteria 1885
921 Ga0495602_0152944 3300048088 Bacteria 1811
922 Ga0496101_0008686 3300048904 Bacteria 6643
923 Ga0496104_0447940 3300048907 Bacteria 1203
924 Ga0496105_0606482 3300048908 Unclassified 849
925 Ga0496107_0605268 3300048910 Bacteria 810
926 Ga0496110_0313645 3300048913 Bacteria 1428
927 Ga0496114_0000397 3300048917 Bacteria 32141
928 Ga0496114_0006425 3300048917 Bacteria 9254
929 Ga0496114_0370946 3300048917 Bacteria 1267
930 Ga0496114_0907236 3300048917 Bacteria 762
931 Ga0496115_0331579 3300048918 Bacteria 1243
932 Ga0496121_0000051 3300048924 Bacteria 315378
933 Ga0496124_0112179 3300048927 Bacteria 2193
934 Ga0501308_024175 3300049128 Bacteria 780
935 Ga0501310_011220 3300049130 Bacteria 1011
936 Ga0501310_023358 3300049130 Bacteria 786
937 Ga0501343_009116 3300049132 Bacteria 799
938 Ga0501304_014492 3300049160 Bacteria 731
939 Ga0501292_005013 3300049515 Bacteria 1833
940 Ga0501298_001144 3300049521 Bacteria 3837
941 Ga0501312_022575 3300049528 Bacteria 943
942 Ga0501312_051533 3300049528 Bacteria 695
943 Ga0501313_020034 3300049529 Unclassified 821
944 Ga0501313_025394 3300049529 Bacteria 750
945 Ga0501314_005951 3300049530 Bacteria 1052
946 Ga0501314_007552 3300049530 Bacteria 966
947 Ga0501315_002390 3300049531 Bacteria 1757
948 Ga0501316_012632 3300049532 Bacteria 989
949 Ga0501319_003437 3300049535 Bacteria 1058
950 Ga0501323_037544 3300049539 Bacteria 701
951 Ga0501337_004936 3300049553 Unclassified 883
952 Ga0501338_05278 3300049554 Bacteria 798
953 Ga0501033_0019886 3300049570 Bacteria 5075
954 Ga0501033_0224297 3300049570 Bacteria 1337
955 Ga0501033_0238245 3300049570 Bacteria 1291
956 Ga0501033_0305814 3300049570 Bacteria 1119
957 Ga0501034_0022432 3300049571 Bacteria 6434
958 Ga0501034_0046484 3300049571 Bacteria 4385
959 Ga0501034_0099393 3300049571 Bacteria 2904
960 Ga0501034_0405389 3300049571 Bacteria 1286
961 Ga0501034_0792219 3300049571 Bacteria 841
962 Ga0501036_0053937 3300049572 Bacteria 3404
963 Ga0501037_0023146 3300049573 Bacteria 4595
964 Ga0501037_0345966 3300049573 Bacteria 1026
965 Ga0501038_0237267 3300049574 Bacteria 1449
966 Ga0501043_0003586 3300049579 Bacteria 12742
967 Ga0501043_0042539 3300049579 Bacteria 3570
968 Ga0501043_0184099 3300049579 Bacteria 1627
969 Ga0501047_0005137 3300049581 Bacteria 12283
970 Ga0501047_0022222 3300049581 Bacteria 6095
971 Ga0501047_0028692 3300049581 Bacteria 5367
972 Ga0501069_0108360 3300049585 Bacteria 1580
973 Ga0501070_0045242 3300049586 Bacteria 3661
974 Ga0501070_0061556 3300049586 Unclassified 3109
975 Ga0501070_0095944 3300049586 Bacteria 2453
976 Ga0501198_002353 3300049649 Bacteria 2543
977 Ga0501201_000015 3300049651 Bacteria 10456
978 Ga0501202_001553 3300049652 Bacteria 3697
979 Ga0501202_029338 3300049652 Bacteria 1140
980 Ga0501207_007739 3300049654 Bacteria 1539
981 Ga0501207_038145 3300049654 Bacteria 828
982 Ga0501216_047605 3300049660 Bacteria 836
983 Ga0501222_000903 3300049662 Bacteria 4259
984 Ga0501227_012864 3300049665 Bacteria 1837
985 Ga0501233_002623 3300049668 Bacteria 3180
986 Ga0501233_074625 3300049668 Bacteria 864
987 Ga0501235_000743 3300049669 Bacteria 6650
988 Ga0501235_033463 3300049669 Bacteria 1164
989 Ga0501238_019496 3300049671 Bacteria 953
990 Ga0501240_000328 3300049673 Bacteria 3747
991 Ga0501242_001195 3300049674 Bacteria 2556
992 Ga0501243_000227 3300049675 Bacteria 6994
993 Ga0501250_000666 3300049680 Bacteria 2464
994 Ga0501252_000192 3300049682 Bacteria 4001
995 Ga0501257_011575 3300049686 Bacteria 2015
996 Ga0501257_017172 3300049686 Bacteria 1683
997 Ga0501257_047767 3300049686 Bacteria 1062
998 Ga0501259_000319 3300049688 Bacteria 7654
999 Ga0501261_000658 3300049690 Bacteria 4339
1000 Ga0501261_008731 3300049690 Bacteria 1312
1001 Ga0501219_000650 3300049703 Bacteria 4948
1002 Ga0501221_001008 3300049704 Bacteria 4632
1003 Ga0501225_0000561 3300049705 Bacteria 11624
1004 Ga0501225_0002441 3300049705 Bacteria 5743
1005 Ga0501245_000123 3300049708 Bacteria 7876
1006 Ga0501080_0278625 3300049742 Bacteria 1521
1007 Ga0501080_0327808 3300049742 Bacteria 1385
1008 Ga0501080_0386263 3300049742 Unclassified 1261
1009 Ga0501241_001865 3300049758 Bacteria 4149
1010 Ga0501266_001851 3300049763 Bacteria 2667
1011 Ga0501268_072676 3300049765 Bacteria 698
1012 Ga0501035_0016926 3300049822 Bacteria 6720
1013 Ga0501035_0029491 3300049822 Bacteria 5003
1014 Ga0501035_0106678 3300049822 Bacteria 2456
1015 Ga0501035_0583474 3300049822 Unclassified 913
1016 Ga0501035_0587796 3300049822 Bacteria 909
1017 Ga0501044_0034967 3300049823 Bacteria 5264
1018 Ga0501044_0300321 3300049823 Unclassified 1535
1019 Ga0501044_0320531 3300049823 Bacteria 1474
1020 Ga0501284_00005 3300050005 Bacteria 164758
1021 nmdc:mga0k408_132857_c1 3300050493 Bacteria 1478
1022 nmdc:mga0k408_1625_c3 3300050493 Bacteria 5649
1023 nmdc:mga0k408_25436_c1 3300050493 Bacteria 3353
1024 nmdc:mga0k408_395428_c1 3300050493 Bacteria 823
1025 nmdc:mga0k408_7175_c1 3300050493 Bacteria 4771
1026 nmdc:mga05p37_181524_c1 3300050507 Unclassified 2560
1027 nmdc:mga05p37_914_c1 3300050507 Bacteria 33336
1028 nmdc:mga09592_112309_c1 3300050508 Unclassified 2338
1029 nmdc:mga06r32_20749_c1 3300050510 Bacteria 6052
1030 nmdc:mga08y16_12509_c1 3300050511 Bacteria 8927
1031 Ga0500578_0027483 3300053086 Bacteria 3654
1032 Ga0500578_0117443 3300053086 Bacteria 1674
1033 Ga0500644_0000032 3300053088 Bacteria 85851
1034 Ga0500646_0004811 3300053090 Bacteria 3421
1035 Ga0500646_0023054 3300053090 Bacteria 1668
1036 Ga0500646_0031861 3300053090 Bacteria 1452
1037 Ga0500583_0000037 3300053092 Bacteria 92466
1038 Ga0500583_0001860 3300053092 Bacteria 6168
1039 Ga0500583_0006441 3300053092 Bacteria 4041
1040 Ga0500569_000056 3300053109 Bacteria 19932
1041 Ga0500642_0068450 3300053130 Bacteria 1611
1042 Ga0500652_015609 3300053131 Bacteria 2745
1043 Ga0500658_0119642 3300053134 Bacteria 1166
1044 Ga0500568_0001302 3300053139 Bacteria 16386
1045 Ga0500568_0023320 3300053139 Bacteria 2633
1046 Ga0500573_0133851 3300053140 Bacteria 1371
1047 Ga0500577_0002744 3300053142 Bacteria 4522
1048 Ga0500588_0010847 3300053146 Bacteria 2215
1049 Ga0500589_059274 3300053147 Bacteria 1758
1050 Ga0500590_028379 3300053148 Bacteria 2904
1051 Ga0500604_0002834 3300053151 Bacteria 4707
1052 Ga0500616_0006422 3300053153 Bacteria 7702
1053 Ga0500616_0012198 3300053153 Bacteria 5036
1054 Ga0500616_0069763 3300053153 Bacteria 1796
1055 Ga0500616_0124652 3300053153 Bacteria 1225
1056 Ga0500622_0006216 3300053156 Bacteria 6988
1057 Ga0500622_0062897 3300053156 Bacteria 1890
1058 Ga0500633_0005002 3300053160 Bacteria 3105
1059 Ga0500634_0060050 3300053161 Bacteria 2020
1060 Ga0500639_096414 3300053163 Bacteria 1464
1061 Ga0500636_0080702 3300053177 Bacteria 1874
1062 Ga0500637_0127480 3300053178 Bacteria 1476
1063 Ga0500611_000004 3300053727 Bacteria 253326
1064 Ga0501084_0129706 3300054114 Bacteria 2122
1065 Ga0500661_014040 3300055283 Bacteria 1442
1066 Ga0587073_0145722 3300059492 Bacteria 665
1067 Ga0587077_017533 3300059493 Bacteria 1222
1068 Ga0587077_094413 3300059493 Bacteria 709
1069 Ga0587077_097345 3300059493 Bacteria 701
1070 Ga0587080_071993 3300059503 Bacteria 693
1071 Ga0587090_065552 3300059510 Bacteria 698
1072 Ga0587090_072724 3300059510 Bacteria 675
1073 Ga0587109_063764 3300059624 Unclassified 782
1074 Ga0587128_060747 3300059630 Bacteria 713
1075 Ga0587108_012644 3300059653 Bacteria 733
1076 Ga0501082_0340214 3300060353 Unclassified 1307

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10220086 rootH2_102200862 195
2 3300046557 Ga0495622_0043460 Ga0495622_0043460_162_752 196
3 3300026118 Ga0207675_100074291 Ga0207675_1000742913 198
4 3300020080 Ga0206350_10720946 Ga0206350_107209461 207
5 iso_pu_bacteria 2738541278 2738726078 207
6 iso_pu_bacteria 2818991442 2819577285 207
7 iso_pu_bacteria 2818991444 2819590391 207
8 iso_pu_bacteria 2818991460 2819676432 207
9 iso_pu_bacteria 2821136567 2821140588 207
10 iso_pu_bacteria 2840677318 2840678273 207
11 iso_pu_bacteria 2852623160 2852625131 207
12 iso_pu_bacteria 2883068021 2883070534 207
13 iso_pu_bacteria 2884791551 2884796263 207
14 iso_pu_bacteria 2884933994 2884934149 207
15 iso_pu_bacteria 2896085136 2896086090 207
16 iso_pu_bacteria 2896109856 2896115342 207
17 iso_pu_bacteria 2904467357 2904473007 207
18 iso_pu_bacteria 2929177148 2929178219 207
19 iso_pu_bacteria 2929239360 2929240531 207
20 iso_pu_bacteria 2929921140 2929922367 207
21 iso_pu_bacteria 2945977869 2945980581 207
22 iso_pu_bacteria 2946013367 2946013556 207
23 iso_pu_bacteria 8003151029 8003156785 207
24 3300005327 Ga0070658_10010368 Ga0070658_100103689 209
25 3300005336 Ga0070680_100096590 Ga0070680_1000965902 209
26 3300005456 Ga0070678_101079450 Ga0070678_1010794501 209
27 3300005535 Ga0070684_100152960 Ga0070684_1001529601 209
28 3300005543 Ga0070672_100577432 Ga0070672_1005774321 209
29 3300005563 Ga0068855_100394834 Ga0068855_1003948343 209
30 3300005577 Ga0068857_100348961 Ga0068857_1003489611 209
31 3300005616 Ga0068852_100006054 Ga0068852_1000060548 209
32 3300009093 Ga0105240_10071237 Ga0105240_100712375 209
33 3300009093 Ga0105240_11326747 Ga0105240_113267471 209
34 3300009545 Ga0105237_10055660 Ga0105237_100556603 209
35 3300013104 Ga0157370_10540417 Ga0157370_105404171 209
36 3300013104 Ga0157370_11211925 Ga0157370_112119251 209
37 3300013105 Ga0157369_10010202 Ga0157369_100102029 209
38 3300013105 Ga0157369_10998971 Ga0157369_109989711 209
39 3300013307 Ga0157372_10847988 Ga0157372_108479882 209
40 3300013307 Ga0157372_11961646 Ga0157372_119616461 209
41 3300025909 Ga0207705_10282138 Ga0207705_102821382 209
42 3300025912 Ga0207707_10343707 Ga0207707_103437072 209
43 3300025914 Ga0207671_10022134 Ga0207671_100221346 209
44 3300026041 Ga0207639_10636168 Ga0207639_106361682 209
45 3300026142 Ga0207698_10056171 Ga0207698_100561713 209
46 3300005327 Ga0070658_10141091 Ga0070658_101410911 210
47 3300005366 Ga0070659_100064593 Ga0070659_1000645933 210
48 3300005458 Ga0070681_10822982 Ga0070681_108229821 210
49 3300005530 Ga0070679_100072510 Ga0070679_1000725102 210
50 3300005563 Ga0068855_100001137 Ga0068855_10000113723 210
51 3300013100 Ga0157373_10000876 Ga0157373_100008766 210
52 3300013102 Ga0157371_10001606 Ga0157371_1000160615 210
53 3300013102 Ga0157371_10011045 Ga0157371_100110455 210
54 3300013104 Ga0157370_10000473 Ga0157370_1000047319 210
55 3300013307 Ga0157372_10033052 Ga0157372_100330524 210
56 3300013307 Ga0157372_10054533 Ga0157372_100545334 210
57 3300025932 Ga0207690_10226221 Ga0207690_102262212 210
58 3300025949 Ga0207667_10002129 Ga0207667_1000212916 210
59 3300037312 Ga0395899_0014778 Ga0395899_0014778_2474_3106 210
60 3300037418 Ga0395900_0025001 Ga0395900_0025001_3497_4129 210
61 3300037418 Ga0395900_0025207 Ga0395900_0025207_2524_3156 210
62 3300037466 Ga0395898_0054622 Ga0395898_0054622_3184_3816 210
63 3300037466 Ga0395898_0068641 Ga0395898_0068641_325_957 210
64 3300037471 Ga0395905_0036628 Ga0395905_0036628_3935_4567 210
65 3300038443 Ga0395901_0012784 Ga0395901_0012784_3083_3715 210
66 3300038443 Ga0395901_0063596 Ga0395901_0063596_3103_3735 210
67 3300038443 Ga0395901_0561521 Ga0395901_0561521_28_660 210
68 3300038443 Ga0395901_0599806 Ga0395901_0599806_368_1000 210
69 3300049554 Ga0501338_05278 Ga0501338_05278_94_726 210
70 3300059493 Ga0587077_017533 Ga0587077_017533_353_985 210
71 3300001979 JGI24740J21852_10003348 JGI24740J21852_100033485 211
72 3300002738 JGI25154J39366_1000120 JGI25154J39366_100012010 211
73 3300002738 JGI25154J39366_1012097 JGI25154J39366_10120972 211
74 3300003163 Ga0006759J45824_1076550 Ga0006759J45824_10765501 211
75 3300003300 Ga0006758J48902_1015743 Ga0006758J48902_10157431 211
76 3300003316 rootH1_10023748 rootH1_100237482 211
77 3300003320 rootH2_10019577 rootH2_100195776 211
78 3300003320 rootH2_10158917 rootH2_101589175 211
79 3300003322 rootL2_10172417 rootL2_101724175 211
80 3300003323 rootH1_10065386 rootH1_100653865 211
81 3300003323 rootH1_10134083 rootH1_101340832 211
82 3300003323 rootH1_10165589 rootH1_101655892 211
83 3300003323 rootH1_10257422 rootH1_102574223 211
84 3300003323 rootH1_10260058 rootH1_102600582 211
85 3300003771 Ga0055526_1046463 Ga0055526_10464631 211
86 3300003790 Ga0055528_1023293 Ga0055528_10232931 211
87 3300004799 Ga0058863_11748294 Ga0058863_117482941 211
88 3300004799 Ga0058863_11905271 Ga0058863_119052711 211
89 3300004800 Ga0058861_11695319 Ga0058861_116953191 211
90 3300004803 Ga0058862_12773387 Ga0058862_127733871 211
91 3300005262 Ga0065165_1000436 Ga0065165_100043610 211
92 3300005262 Ga0065165_1010871 Ga0065165_10108712 211
93 3300005262 Ga0065165_1027698 Ga0065165_10276982 211
94 3300005288 Ga0065714_10264965 Ga0065714_102649651 211
95 3300005289 Ga0065704_10147972 Ga0065704_101479722 211
96 3300005290 Ga0065712_10000661 Ga0065712_100006614 211
97 3300005290 Ga0065712_10112451 Ga0065712_101124511 211
98 3300005295 Ga0065707_10127771 Ga0065707_101277712 211
99 3300005295 Ga0065707_10183691 Ga0065707_101836912 211
100 3300005327 Ga0070658_10040039 Ga0070658_100400393 211
101 3300005327 Ga0070658_10170037 Ga0070658_101700372 211
102 3300005328 Ga0070676_10007488 Ga0070676_100074884 211
103 3300005328 Ga0070676_10007533 Ga0070676_100075335 211
104 3300005328 Ga0070676_10012382 Ga0070676_100123823 211
105 3300005329 Ga0070683_100049320 Ga0070683_1000493203 211
106 3300005329 Ga0070683_100080317 Ga0070683_1000803175 211
107 3300005329 Ga0070683_100329379 Ga0070683_1003293792 211
108 3300005331 Ga0070670_100021730 Ga0070670_1000217305 211
109 3300005331 Ga0070670_100026081 Ga0070670_1000260814 211
110 3300005331 Ga0070670_100242729 Ga0070670_1002427292 211
111 3300005334 Ga0068869_100001213 Ga0068869_1000012135 211
112 3300005334 Ga0068869_100008940 Ga0068869_1000089406 211
113 3300005334 Ga0068869_100059511 Ga0068869_1000595112 211
114 3300005334 Ga0068869_100119531 Ga0068869_1001195313 211
115 3300005334 Ga0068869_100161236 Ga0068869_1001612362 211
116 3300005335 Ga0070666_10035539 Ga0070666_100355394 211
117 3300005336 Ga0070680_100033145 Ga0070680_1000331452 211
118 3300005336 Ga0070680_100332018 Ga0070680_1003320182 211
119 3300005337 Ga0070682_100000462 Ga0070682_10000046214 211
120 3300005337 Ga0070682_100327279 Ga0070682_1003272792 211
121 3300005338 Ga0068868_100002430 Ga0068868_1000024308 211
122 3300005338 Ga0068868_100031755 Ga0068868_1000317551 211
123 3300005338 Ga0068868_100374083 Ga0068868_1003740832 211
124 3300005338 Ga0068868_100409264 Ga0068868_1004092642 211
125 3300005339 Ga0070660_100617242 Ga0070660_1006172421 211
126 3300005339 Ga0070660_101114491 Ga0070660_1011144911 211
127 3300005340 Ga0070689_100008276 Ga0070689_1000082767 211
128 3300005340 Ga0070689_100015958 Ga0070689_1000159584 211
129 3300005340 Ga0070689_100106396 Ga0070689_1001063963 211
130 3300005340 Ga0070689_100261644 Ga0070689_1002616442 211
131 3300005341 Ga0070691_10029945 Ga0070691_100299452 211
132 3300005343 Ga0070687_100443596 Ga0070687_1004435961 211
133 3300005347 Ga0070668_100002232 Ga0070668_1000022324 211
134 3300005347 Ga0070668_100007815 Ga0070668_1000078155 211
135 3300005347 Ga0070668_100034818 Ga0070668_1000348182 211
136 3300005353 Ga0070669_100007640 Ga0070669_1000076402 211
137 3300005353 Ga0070669_100081326 Ga0070669_1000813263 211
138 3300005354 Ga0070675_100004112 Ga0070675_10000411211 211
139 3300005354 Ga0070675_100164429 Ga0070675_1001644293 211
140 3300005354 Ga0070675_100293294 Ga0070675_1002932942 211
141 3300005364 Ga0070673_100084595 Ga0070673_1000845953 211
142 3300005364 Ga0070673_100110964 Ga0070673_1001109643 211
143 3300005365 Ga0070688_100001613 Ga0070688_1000016138 211
144 3300005365 Ga0070688_100022499 Ga0070688_1000224993 211
145 3300005366 Ga0070659_100084648 Ga0070659_1000846483 211
146 3300005367 Ga0070667_100019084 Ga0070667_1000190845 211
147 3300005367 Ga0070667_100132615 Ga0070667_1001326153 211
148 3300005367 Ga0070667_100752589 Ga0070667_1007525891 211
149 3300005441 Ga0070700_100082410 Ga0070700_1000824101 211
150 3300005441 Ga0070700_100957526 Ga0070700_1009575261 211
151 3300005455 Ga0070663_100187307 Ga0070663_1001873071 211
152 3300005455 Ga0070663_100222760 Ga0070663_1002227601 211
153 3300005456 Ga0070678_100237308 Ga0070678_1002373082 211
154 3300005457 Ga0070662_100581128 Ga0070662_1005811281 211
155 3300005458 Ga0070681_10015101 Ga0070681_100151013 211
156 3300005458 Ga0070681_10121009 Ga0070681_101210093 211
157 3300005458 Ga0070681_10234554 Ga0070681_102345542 211
158 3300005459 Ga0068867_100011969 Ga0068867_1000119696 211
159 3300005459 Ga0068867_100017092 Ga0068867_1000170922 211
160 3300005459 Ga0068867_100070399 Ga0068867_1000703993 211
161 3300005459 Ga0068867_100076890 Ga0068867_1000768901 211
162 3300005471 Ga0070698_100169759 Ga0070698_1001697594 211
163 3300005535 Ga0070684_100004834 Ga0070684_1000048342 211
164 3300005535 Ga0070684_100229730 Ga0070684_1002297301 211
165 3300005535 Ga0070684_100312971 Ga0070684_1003129712 211
166 3300005536 Ga0070697_100893625 Ga0070697_1008936251 211
167 3300005539 Ga0068853_100001974 Ga0068853_10000197411 211
168 3300005539 Ga0068853_100005501 Ga0068853_1000055014 211
169 3300005539 Ga0068853_100069345 Ga0068853_1000693454 211
170 3300005539 Ga0068853_100336038 Ga0068853_1003360382 211
171 3300005539 Ga0068853_100373846 Ga0068853_1003738462 211
172 3300005539 Ga0068853_100375034 Ga0068853_1003750341 211
173 3300005543 Ga0070672_100004965 Ga0070672_1000049658 211
174 3300005543 Ga0070672_100724560 Ga0070672_1007245602 211
175 3300005547 Ga0070693_100007859 Ga0070693_1000078593 211
176 3300005548 Ga0070665_100001841 Ga0070665_10000184117 211
177 3300005548 Ga0070665_100413701 Ga0070665_1004137012 211
178 3300005563 Ga0068855_100008055 Ga0068855_10000805514 211
179 3300005563 Ga0068855_100097149 Ga0068855_1000971492 211
180 3300005563 Ga0068855_100232262 Ga0068855_1002322622 211
181 3300005563 Ga0068855_100382828 Ga0068855_1003828281 211
182 3300005564 Ga0070664_100048180 Ga0070664_1000481803 211
183 3300005564 Ga0070664_100690732 Ga0070664_1006907321 211
184 3300005577 Ga0068857_100035941 Ga0068857_1000359414 211
185 3300005577 Ga0068857_100104574 Ga0068857_1001045743 211
186 3300005577 Ga0068857_100140462 Ga0068857_1001404622 211
187 3300005577 Ga0068857_100243862 Ga0068857_1002438621 211
188 3300005577 Ga0068857_100246023 Ga0068857_1002460232 211
189 3300005577 Ga0068857_100461469 Ga0068857_1004614691 211
190 3300005577 Ga0068857_100613648 Ga0068857_1006136482 211
191 3300005578 Ga0068854_100124333 Ga0068854_1001243332 211
192 3300005578 Ga0068854_100369306 Ga0068854_1003693062 211
193 3300005614 Ga0068856_100009166 Ga0068856_1000091662 211
194 3300005614 Ga0068856_100137317 Ga0068856_1001373172 211
195 3300005616 Ga0068852_100001659 Ga0068852_1000016594 211
196 3300005616 Ga0068852_100038053 Ga0068852_1000380532 211
197 3300005616 Ga0068852_100039117 Ga0068852_1000391172 211
198 3300005616 Ga0068852_100790408 Ga0068852_1007904082 211
199 3300005617 Ga0068859_100005939 Ga0068859_1000059394 211
200 3300005617 Ga0068859_100053444 Ga0068859_1000534442 211
201 3300005617 Ga0068859_100085938 Ga0068859_1000859384 211
202 3300005617 Ga0068859_100211768 Ga0068859_1002117683 211
203 3300005617 Ga0068859_100373945 Ga0068859_1003739452 211
204 3300005618 Ga0068864_100078167 Ga0068864_1000781674 211
205 3300005719 Ga0068861_100011956 Ga0068861_1000119565 211
206 3300005719 Ga0068861_100082382 Ga0068861_1000823822 211
207 3300005719 Ga0068861_100097495 Ga0068861_1000974952 211
208 3300005719 Ga0068861_100097774 Ga0068861_1000977742 211
209 3300005719 Ga0068861_100929290 Ga0068861_1009292901 211
210 3300005834 Ga0068851_10196126 Ga0068851_101961262 211
211 3300005840 Ga0068870_10013221 Ga0068870_100132214 211
212 3300005841 Ga0068863_100030116 Ga0068863_1000301162 211
213 3300005841 Ga0068863_100571603 Ga0068863_1005716032 211
214 3300005842 Ga0068858_100063023 Ga0068858_1000630232 211
215 3300005842 Ga0068858_100287788 Ga0068858_1002877882 211
216 3300005842 Ga0068858_100318255 Ga0068858_1003182551 211
217 3300005842 Ga0068858_100481076 Ga0068858_1004810762 211
218 3300005843 Ga0068860_100000052 Ga0068860_10000005275 211
219 3300005843 Ga0068860_100003681 Ga0068860_10000368113 211
220 3300005843 Ga0068860_100014258 Ga0068860_1000142587 211
221 3300005843 Ga0068860_100020337 Ga0068860_1000203373 211
222 3300005843 Ga0068860_100165723 Ga0068860_1001657231 211
223 3300005843 Ga0068860_100247929 Ga0068860_1002479292 211
224 3300005843 Ga0068860_100488768 Ga0068860_1004887681 211
225 3300005843 Ga0068860_100512583 Ga0068860_1005125831 211
226 3300005844 Ga0068862_100034043 Ga0068862_1000340434 211
227 3300005844 Ga0068862_100324559 Ga0068862_1003245591 211
228 3300006178 Ga0075367_10061073 Ga0075367_100610733 211
229 3300006195 Ga0075366_10008398 Ga0075366_100083983 211
230 3300006195 Ga0075366_10011185 Ga0075366_100111853 211
231 3300006195 Ga0075366_10161526 Ga0075366_101615262 211
232 3300006195 Ga0075366_10355010 Ga0075366_103550102 211
233 3300006237 Ga0097621_100000611 Ga0097621_10000061129 211
234 3300006237 Ga0097621_100014924 Ga0097621_1000149245 211
235 3300006237 Ga0097621_100070125 Ga0097621_1000701253 211
236 3300006237 Ga0097621_100133437 Ga0097621_1001334374 211
237 3300006358 Ga0068871_100010721 Ga0068871_1000107213 211
238 3300006358 Ga0068871_100012226 Ga0068871_1000122268 211
239 3300006358 Ga0068871_100248949 Ga0068871_1002489492 211
240 3300006358 Ga0068871_100771405 Ga0068871_1007714052 211
241 3300006844 Ga0075428_101064068 Ga0075428_1010640681 211
242 3300006881 Ga0068865_100015426 Ga0068865_1000154262 211
243 3300006881 Ga0068865_100128445 Ga0068865_1001284451 211
244 3300006881 Ga0068865_100141727 Ga0068865_1001417272 211
245 3300006881 Ga0068865_100177830 Ga0068865_1001778302 211
246 3300006931 Ga0097620_100005939 Ga0097620_1000059394 211
247 3300006931 Ga0097620_100053445 Ga0097620_1000534452 211
248 3300006931 Ga0097620_100085934 Ga0097620_1000859344 211
249 3300006931 Ga0097620_100211772 Ga0097620_1002117723 211
250 3300006931 Ga0097620_100373936 Ga0097620_1003739362 211
251 3300009093 Ga0105240_10000728 Ga0105240_100007282 211
252 3300009093 Ga0105240_10000822 Ga0105240_1000082210 211
253 3300009093 Ga0105240_10004785 Ga0105240_100047851 211
254 3300009093 Ga0105240_10007855 Ga0105240_100078559 211
255 3300009093 Ga0105240_10013063 Ga0105240_100130638 211
256 3300009093 Ga0105240_10052936 Ga0105240_100529362 211
257 3300009093 Ga0105240_10171975 Ga0105240_101719752 211
258 3300009093 Ga0105240_10642565 Ga0105240_106425652 211
259 3300009094 Ga0111539_10004306 Ga0111539_100043066 211
260 3300009094 Ga0111539_10319296 Ga0111539_103192962 211
261 3300009147 Ga0114129_10000608 Ga0114129_1000060822 211
262 3300009174 Ga0105241_10001316 Ga0105241_100013165 211
263 3300009174 Ga0105241_10004217 Ga0105241_100042178 211
264 3300009174 Ga0105241_10052751 Ga0105241_100527512 211
265 3300009174 Ga0105241_10341167 Ga0105241_103411672 211
266 3300009176 Ga0105242_10049843 Ga0105242_100498435 211
267 3300009176 Ga0105242_10204023 Ga0105242_102040232 211
268 3300009177 Ga0105248_10443938 Ga0105248_104439382 211
269 3300009545 Ga0105237_10000841 Ga0105237_1000084112 211
270 3300009545 Ga0105237_10002964 Ga0105237_100029648 211
271 3300009545 Ga0105237_10009111 Ga0105237_100091118 211
272 3300009545 Ga0105237_10018106 Ga0105237_100181062 211
273 3300009545 Ga0105237_10020183 Ga0105237_100201833 211
274 3300009545 Ga0105237_10132503 Ga0105237_101325032 211
275 3300009545 Ga0105237_10497778 Ga0105237_104977782 211
276 3300009545 Ga0105237_10551310 Ga0105237_105513101 211
277 3300009551 Ga0105238_10008635 Ga0105238_100086353 211
278 3300009551 Ga0105238_10016959 Ga0105238_100169597 211
279 3300009551 Ga0105238_10056612 Ga0105238_100566121 211
280 3300009551 Ga0105238_10118753 Ga0105238_101187532 211
281 3300009551 Ga0105238_10563538 Ga0105238_105635382 211
282 3300009553 Ga0105249_10000349 Ga0105249_100003494 211
283 3300009553 Ga0105249_10016031 Ga0105249_100160311 211
284 3300009553 Ga0105249_10081333 Ga0105249_100813331 211
285 3300009553 Ga0105249_10094912 Ga0105249_100949122 211
286 3300009553 Ga0105249_10100641 Ga0105249_101006413 211
287 3300009553 Ga0105249_10187466 Ga0105249_101874661 211
288 3300010375 Ga0105239_10000755 Ga0105239_100007558 211
289 3300010375 Ga0105239_10000936 Ga0105239_1000093635 211
290 3300010375 Ga0105239_10006358 Ga0105239_100063582 211
291 3300010375 Ga0105239_10016065 Ga0105239_100160654 211
292 3300010375 Ga0105239_10057673 Ga0105239_100576731 211
293 3300010375 Ga0105239_10140927 Ga0105239_101409272 211
294 3300010375 Ga0105239_10245842 Ga0105239_102458422 211
295 3300010375 Ga0105239_10252875 Ga0105239_102528751 211
296 3300010375 Ga0105239_10257525 Ga0105239_102575252 211
297 3300011119 Ga0105246_10207579 Ga0105246_102075792 211
298 3300011119 Ga0105246_10527338 Ga0105246_105273382 211
299 3300013102 Ga0157371_10002634 Ga0157371_100026343 211
300 3300013102 Ga0157371_10003627 Ga0157371_100036274 211
301 3300013102 Ga0157371_10016632 Ga0157371_100166323 211
302 3300013102 Ga0157371_10057895 Ga0157371_100578953 211
303 3300013102 Ga0157371_10108302 Ga0157371_101083022 211
304 3300013102 Ga0157371_10169691 Ga0157371_101696912 211
305 3300013104 Ga0157370_10000631 Ga0157370_1000063119 211
306 3300013104 Ga0157370_10001929 Ga0157370_1000192927 211
307 3300013104 Ga0157370_10003253 Ga0157370_100032538 211
308 3300013104 Ga0157370_10206077 Ga0157370_102060771 211
309 3300013104 Ga0157370_10575487 Ga0157370_105754872 211
310 3300013105 Ga0157369_10047443 Ga0157369_100474432 211
311 3300013105 Ga0157369_10190553 Ga0157369_101905532 211
312 3300013105 Ga0157369_10494325 Ga0157369_104943252 211
313 3300013105 Ga0157369_10636179 Ga0157369_106361791 211
314 3300013296 Ga0157374_10000082 Ga0157374_1000008270 211
315 3300013296 Ga0157374_10000237 Ga0157374_1000023725 211
316 3300013296 Ga0157374_10116823 Ga0157374_101168232 211
317 3300013296 Ga0157374_10159523 Ga0157374_101595232 211
318 3300013296 Ga0157374_10196242 Ga0157374_101962422 211
319 3300013296 Ga0157374_10362139 Ga0157374_103621391 211
320 3300013296 Ga0157374_10364020 Ga0157374_103640202 211
321 3300013296 Ga0157374_11259619 Ga0157374_112596191 211
322 3300013297 Ga0157378_10071369 Ga0157378_100713693 211
323 3300013297 Ga0157378_10409947 Ga0157378_104099472 211
324 3300013306 Ga0163162_10000086 Ga0163162_1000008673 211
325 3300013306 Ga0163162_10001051 Ga0163162_1000105113 211
326 3300013306 Ga0163162_10001766 Ga0163162_100017665 211
327 3300013306 Ga0163162_10006217 Ga0163162_100062173 211
328 3300013306 Ga0163162_10029801 Ga0163162_100298014 211
329 3300013306 Ga0163162_10371562 Ga0163162_103715623 211
330 3300013307 Ga0157372_10005832 Ga0157372_100058323 211
331 3300013307 Ga0157372_10057046 Ga0157372_100570462 211
332 3300013307 Ga0157372_10102814 Ga0157372_101028142 211
333 3300013307 Ga0157372_10211125 Ga0157372_102111252 211
334 3300013307 Ga0157372_10288797 Ga0157372_102887972 211
335 3300013307 Ga0157372_10407974 Ga0157372_104079742 211
336 3300013307 Ga0157372_10954588 Ga0157372_109545882 211
337 3300013308 Ga0157375_10000115 Ga0157375_100001155 211
338 3300013308 Ga0157375_10041963 Ga0157375_100419632 211
339 3300013308 Ga0157375_10072306 Ga0157375_100723064 211
340 3300013308 Ga0157375_10237762 Ga0157375_102377622 211
341 3300014325 Ga0163163_10000088 Ga0163163_1000008850 211
342 3300014325 Ga0163163_10000244 Ga0163163_100002447 211
343 3300014326 Ga0157380_10002932 Ga0157380_100029325 211
344 3300014326 Ga0157380_10314685 Ga0157380_103146853 211
345 3300014745 Ga0157377_10013206 Ga0157377_100132064 211
346 3300014745 Ga0157377_10046580 Ga0157377_100465803 211
347 3300014745 Ga0157377_10099087 Ga0157377_100990872 211
348 3300014968 Ga0157379_10011834 Ga0157379_100118349 211
349 3300014968 Ga0157379_10022878 Ga0157379_100228783 211
350 3300014968 Ga0157379_10083102 Ga0157379_100831023 211
351 3300014968 Ga0157379_10130716 Ga0157379_101307163 211
352 3300014968 Ga0157379_10412908 Ga0157379_104129081 211
353 3300014968 Ga0157379_10497234 Ga0157379_104972341 211
354 3300014968 Ga0157379_10523746 Ga0157379_105237462 211
355 3300014969 Ga0157376_10001060 Ga0157376_100010605 211
356 3300014969 Ga0157376_10006708 Ga0157376_100067083 211
357 3300014969 Ga0157376_10572390 Ga0157376_105723902 211
358 3300014969 Ga0157376_10719768 Ga0157376_107197681 211
359 3300015265 Ga0182005_1000100 Ga0182005_100010034 211
360 3300017792 Ga0163161_10000968 Ga0163161_100009684 211
361 3300017792 Ga0163161_10021573 Ga0163161_100215731 211
362 3300017792 Ga0163161_10063543 Ga0163161_100635433 211
363 3300017792 Ga0163161_10082782 Ga0163161_100827824 211
364 3300021384 Ga0213876_10010328 Ga0213876_100103282 211
365 3300025208 Ga0209436_100776 Ga0209436_1007768 211
366 3300025208 Ga0209436_110527 Ga0209436_1105272 211
367 3300025242 Ga0209258_100032 Ga0209258_10003282 211
368 3300025246 Ga0209646_1000050 Ga0209646_100005046 211
369 3300025246 Ga0209646_1001058 Ga0209646_10010587 211
370 3300025250 Ga0209026_1000452 Ga0209026_10004525 211
371 3300025254 Ga0209148_1000223 Ga0209148_100022344 211
372 3300025273 Ga0209673_1000042 Ga0209673_1000042206 211
373 3300025284 Ga0209130_1000921 Ga0209130_100092113 211
374 3300025295 Ga0209564_1009094 Ga0209564_10090942 211
375 3300025297 Ga0209758_1002389 Ga0209758_10023893 211
376 3300025297 Ga0209758_1018818 Ga0209758_10188182 211
377 3300025298 Ga0209050_1000295 Ga0209050_10002958 211
378 3300025302 Ga0207426_1000250 Ga0207426_100025097 211
379 3300025302 Ga0207426_1000549 Ga0207426_10005496 211
380 3300025302 Ga0207426_1000732 Ga0207426_100073226 211
381 3300025302 Ga0207426_1013618 Ga0207426_10136183 211
382 3300025302 Ga0207426_1039810 Ga0207426_10398102 211
383 3300025303 Ga0209051_1047707 Ga0209051_10477072 211
384 3300025304 Ga0209257_1011800 Ga0209257_10118005 211
385 3300025315 Ga0207697_10007749 Ga0207697_100077493 211
386 3300025903 Ga0207680_10103913 Ga0207680_101039132 211
387 3300025903 Ga0207680_10425120 Ga0207680_104251201 211
388 3300025907 Ga0207645_10007658 Ga0207645_100076587 211
389 3300025907 Ga0207645_10015110 Ga0207645_100151105 211
390 3300025908 Ga0207643_10036187 Ga0207643_100361874 211
391 3300025909 Ga0207705_10041346 Ga0207705_100413462 211
392 3300025909 Ga0207705_10332821 Ga0207705_103328212 211
393 3300025911 Ga0207654_10001648 Ga0207654_100016483 211
394 3300025911 Ga0207654_10022864 Ga0207654_100228643 211
395 3300025911 Ga0207654_10023652 Ga0207654_100236522 211
396 3300025911 Ga0207654_10118760 Ga0207654_101187602 211
397 3300025911 Ga0207654_10259889 Ga0207654_102598892 211
398 3300025912 Ga0207707_10004161 Ga0207707_100041613 211
399 3300025913 Ga0207695_10000189 Ga0207695_10000189163 211
400 3300025913 Ga0207695_10000839 Ga0207695_1000083910 211
401 3300025913 Ga0207695_10001190 Ga0207695_1000119016 211
402 3300025913 Ga0207695_10024238 Ga0207695_100242384 211
403 3300025913 Ga0207695_10067448 Ga0207695_100674483 211
404 3300025913 Ga0207695_10213366 Ga0207695_102133662 211
405 3300025914 Ga0207671_10002710 Ga0207671_1000271012 211
406 3300025914 Ga0207671_10005708 Ga0207671_100057081 211
407 3300025914 Ga0207671_10009702 Ga0207671_100097023 211
408 3300025914 Ga0207671_10020062 Ga0207671_100200622 211
409 3300025914 Ga0207671_10023275 Ga0207671_100232752 211
410 3300025914 Ga0207671_10075636 Ga0207671_100756362 211
411 3300025914 Ga0207671_10121475 Ga0207671_101214751 211
412 3300025914 Ga0207671_10231696 Ga0207671_102316961 211
413 3300025914 Ga0207671_10369921 Ga0207671_103699211 211
414 3300025917 Ga0207660_10014719 Ga0207660_100147193 211
415 3300025919 Ga0207657_10055528 Ga0207657_100555284 211
416 3300025920 Ga0207649_10108330 Ga0207649_101083302 211
417 3300025920 Ga0207649_10703906 Ga0207649_107039061 211
418 3300025921 Ga0207652_10000397 Ga0207652_1000039714 211
419 3300025921 Ga0207652_10026359 Ga0207652_100263592 211
420 3300025923 Ga0207681_10032161 Ga0207681_100321613 211
421 3300025924 Ga0207694_10009052 Ga0207694_100090523 211
422 3300025924 Ga0207694_10148385 Ga0207694_101483852 211
423 3300025924 Ga0207694_10331225 Ga0207694_103312251 211
424 3300025925 Ga0207650_10069036 Ga0207650_100690361 211
425 3300025925 Ga0207650_10121053 Ga0207650_101210532 211
426 3300025925 Ga0207650_10270520 Ga0207650_102705202 211
427 3300025926 Ga0207659_10012225 Ga0207659_100122256 211
428 3300025926 Ga0207659_10080878 Ga0207659_100808782 211
429 3300025926 Ga0207659_10548200 Ga0207659_105482001 211
430 3300025931 Ga0207644_10005946 Ga0207644_100059467 211
431 3300025933 Ga0207706_10010719 Ga0207706_100107196 211
432 3300025933 Ga0207706_10018001 Ga0207706_100180017 211
433 3300025933 Ga0207706_10529011 Ga0207706_105290111 211
434 3300025934 Ga0207686_10126840 Ga0207686_101268403 211
435 3300025936 Ga0207670_10003257 Ga0207670_100032575 211
436 3300025936 Ga0207670_10037466 Ga0207670_100374663 211
437 3300025936 Ga0207670_10067319 Ga0207670_100673192 211
438 3300025938 Ga0207704_10007779 Ga0207704_100077795 211
439 3300025938 Ga0207704_10052872 Ga0207704_100528722 211
440 3300025940 Ga0207691_10002284 Ga0207691_1000228411 211
441 3300025940 Ga0207691_10011435 Ga0207691_100114359 211
442 3300025940 Ga0207691_10433752 Ga0207691_104337521 211
443 3300025941 Ga0207711_10372055 Ga0207711_103720552 211
444 3300025942 Ga0207689_10003192 Ga0207689_100031925 211
445 3300025942 Ga0207689_10015665 Ga0207689_100156653 211
446 3300025942 Ga0207689_10089680 Ga0207689_100896802 211
447 3300025942 Ga0207689_10142420 Ga0207689_101424203 211
448 3300025944 Ga0207661_10052833 Ga0207661_100528333 211
449 3300025944 Ga0207661_10134549 Ga0207661_101345492 211
450 3300025944 Ga0207661_10179358 Ga0207661_101793583 211
451 3300025945 Ga0207679_10016760 Ga0207679_100167605 211
452 3300025945 Ga0207679_10426057 Ga0207679_104260572 211
453 3300025945 Ga0207679_10794637 Ga0207679_107946372 211
454 3300025949 Ga0207667_10001711 Ga0207667_1000171116 211
455 3300025949 Ga0207667_10079731 Ga0207667_100797314 211
456 3300025960 Ga0207651_10021405 Ga0207651_100214053 211
457 3300025960 Ga0207651_10700831 Ga0207651_107008312 211
458 3300025960 Ga0207651_10854347 Ga0207651_108543471 211
459 3300025961 Ga0207712_10003042 Ga0207712_100030428 211
460 3300025961 Ga0207712_10100381 Ga0207712_101003812 211
461 3300025961 Ga0207712_10395078 Ga0207712_103950782 211
462 3300025972 Ga0207668_10074072 Ga0207668_100740722 211
463 3300025981 Ga0207640_10016932 Ga0207640_100169322 211
464 3300025986 Ga0207658_10019069 Ga0207658_100190695 211
465 3300025986 Ga0207658_10119811 Ga0207658_101198111 211
466 3300025986 Ga0207658_10396963 Ga0207658_103969632 211
467 3300026023 Ga0207677_10043133 Ga0207677_100431334 211
468 3300026035 Ga0207703_10011330 Ga0207703_100113306 211
469 3300026035 Ga0207703_10240347 Ga0207703_102403472 211
470 3300026035 Ga0207703_10387361 Ga0207703_103873611 211
471 3300026041 Ga0207639_10035724 Ga0207639_100357241 211
472 3300026041 Ga0207639_10130610 Ga0207639_101306102 211
473 3300026041 Ga0207639_10197402 Ga0207639_101974021 211
474 3300026041 Ga0207639_10589289 Ga0207639_105892891 211
475 3300026041 Ga0207639_10683019 Ga0207639_106830192 211
476 3300026041 Ga0207639_10906577 Ga0207639_109065771 211
477 3300026067 Ga0207678_10029161 Ga0207678_100291614 211
478 3300026067 Ga0207678_10600960 Ga0207678_106009601 211
479 3300026078 Ga0207702_10052219 Ga0207702_100522193 211
480 3300026078 Ga0207702_10096912 Ga0207702_100969122 211
481 3300026078 Ga0207702_10396300 Ga0207702_103963001 211
482 3300026088 Ga0207641_10022803 Ga0207641_100228035 211
483 3300026088 Ga0207641_10164057 Ga0207641_101640571 211
484 3300026088 Ga0207641_11037785 Ga0207641_110377851 211
485 3300026089 Ga0207648_10016614 Ga0207648_100166142 211
486 3300026089 Ga0207648_10037624 Ga0207648_100376245 211
487 3300026089 Ga0207648_10131895 Ga0207648_101318952 211
488 3300026089 Ga0207648_10147776 Ga0207648_101477761 211
489 3300026089 Ga0207648_10212311 Ga0207648_102123112 211
490 3300026095 Ga0207676_10173626 Ga0207676_101736263 211
491 3300026116 Ga0207674_10004751 Ga0207674_1000475112 211
492 3300026116 Ga0207674_10024112 Ga0207674_100241121 211
493 3300026116 Ga0207674_10038653 Ga0207674_100386533 211
494 3300026116 Ga0207674_10039029 Ga0207674_100390294 211
495 3300026116 Ga0207674_10064267 Ga0207674_100642673 211
496 3300026116 Ga0207674_10085033 Ga0207674_100850333 211
497 3300026116 Ga0207674_10141956 Ga0207674_101419562 211
498 3300026116 Ga0207674_10179815 Ga0207674_101798152 211
499 3300026116 Ga0207674_10284796 Ga0207674_102847961 211
500 3300026118 Ga0207675_100003813 Ga0207675_1000038132 211
501 3300026118 Ga0207675_100007383 Ga0207675_1000073834 211
502 3300026118 Ga0207675_100018489 Ga0207675_1000184896 211
503 3300026118 Ga0207675_100062310 Ga0207675_1000623103 211
504 3300026121 Ga0207683_10229948 Ga0207683_102299482 211
505 3300026142 Ga0207698_10056605 Ga0207698_100566052 211
506 3300026142 Ga0207698_10225635 Ga0207698_102256352 211
507 3300026142 Ga0207698_10356652 Ga0207698_103566522 211
508 3300028379 Ga0268266_10295083 Ga0268266_102950831 211
509 3300028379 Ga0268266_10366162 Ga0268266_103661621 211
510 3300028380 Ga0268265_10067420 Ga0268265_100674204 211
511 3300028380 Ga0268265_10154331 Ga0268265_101543312 211
512 3300028381 Ga0268264_10000143 Ga0268264_10000143102 211
513 3300028381 Ga0268264_10017622 Ga0268264_100176223 211
514 3300028381 Ga0268264_10063577 Ga0268264_100635772 211
515 3300031456 Ga0307513_10439506 Ga0307513_104395061 211
516 3300031730 Ga0307516_10000310 Ga0307516_1000031029 211
517 3300031730 Ga0307516_10105729 Ga0307516_101057293 211
518 3300031852 Ga0307410_10295184 Ga0307410_102951842 211
519 3300033180 Ga0307510_10001062 Ga0307510_100010627 211
520 3300035111 Ga0373923_0196712 Ga0373923_0196712_111_746 211
521 3300035116 Ga0373945_0045219 Ga0373945_0045219_689_1324 211
522 3300035172 Ga0373955_0101402 Ga0373955_0101402_580_1215 211
523 3300035410 Ga0373924_0103694 Ga0373924_0103694_251_886 211
524 3300035695 Ga0373927_0011129 Ga0373927_0011129_790_1425 211
525 3300036401 Ga0373937_0002104 Ga0373937_0002104_8622_9257 211
526 3300036457 Ga0265778_027271 Ga0265778_027271_68_703 211
527 3300039437 Ga0436365_0262826 Ga0436365_0262826_18988_19623 211
528 3300041404 Ga0439436_0007077 Ga0439436_0007077_2794_3429 211
529 3300041404 Ga0439436_0075319 Ga0439436_0075319_130_765 211
530 3300041406 Ga0439439_0006329 Ga0439439_0006329_2009_2644 211
531 3300041406 Ga0439439_0015516 Ga0439439_0015516_261_896 211
532 3300041411 Ga0439466_0089903 Ga0439466_0089903_141_776 211
533 3300041413 Ga0439465_0010085 Ga0439465_0010085_686_1321 211
534 3300041486 Ga0451807_1400206 Ga0451807_1400206_750_1385 211
535 3300041505 Ga0451849_0783274 Ga0451849_0783274_300_935 211
536 3300041512 Ga0451853_1183943 Ga0451853_1183943_56_691 211
537 3300041512 Ga0451853_3160169 Ga0451853_3160169_36_671 211
538 3300041997 Ga0439431_0009061 Ga0439431_0009061_833_1468 211
539 3300041997 Ga0439431_0013467 Ga0439431_0013467_724_1359 211
540 3300041997 Ga0439431_0013552 Ga0439431_0013552_804_1439 211
541 3300042001 Ga0439441_076499 Ga0439441_076499_22_657 211
542 3300042002 Ga0439442_010332 Ga0439442_010332_730_1365 211
543 3300042004 Ga0439445_0011101 Ga0439445_0011101_1320_1955 211
544 3300042004 Ga0439445_0113951 Ga0439445_0113951_80_715 211
545 3300042007 Ga0439449_0025032 Ga0439449_0025032_1313_1948 211
546 3300042007 Ga0439449_0025747 Ga0439449_0025747_753_1388 211
547 3300042014 Ga0439457_002994 Ga0439457_002994_2770_3405 211
548 3300042014 Ga0439457_003090 Ga0439457_003090_2044_2679 211
549 3300042014 Ga0439457_024395 Ga0439457_024395_363_998 211
550 3300042015 Ga0439462_0001411 Ga0439462_0001411_3581_4216 211
551 3300042133 Ga0450896_013997 Ga0450896_013997_433_1068 211
552 3300042134 Ga0450898_004825 Ga0450898_004825_1203_1838 211
553 3300042135 Ga0450899_000898 Ga0450899_000898_2030_2665 211
554 3300042435 Ga0439434_0004572 Ga0439434_0004572_1056_1691 211
555 3300042876 Ga0451577_0523880 Ga0451577_0523880_315_950 211
556 3300044656 Ga0466969_0000382 Ga0466969_0000382_11715_12350 211
557 3300044658 Ga0466972_0000010 Ga0466972_0000010_73526_74161 211
558 3300044658 Ga0466972_0000143 Ga0466972_0000143_29494_30129 211
559 3300044658 Ga0466972_0006101 Ga0466972_0006101_4422_5057 211
560 3300044658 Ga0466972_0027460 Ga0466972_0027460_1649_2284 211
561 3300044658 Ga0466972_0167925 Ga0466972_0167925_253_888 211
562 3300044673 Ga0453683_0209423 Ga0453683_0209423_433_1068 211
563 3300044673 Ga0453683_0236351 Ga0453683_0236351_51_686 211
564 3300044684 Ga0466966_0000176 Ga0466966_0000176_6085_6720 211
565 3300044693 Ga0466961_0099771 Ga0466961_0099771_736_1371 211
566 3300044693 Ga0466961_0167302 Ga0466961_0167302_530_1165 211
567 3300044706 Ga0466964_0018699 Ga0466964_0018699_476_1111 211
568 3300044712 Ga0453684_0633051 Ga0453684_0633051_408_1043 211
569 3300044712 Ga0453684_0717052 Ga0453684_0717052_50_685 211
570 3300044719 Ga0466971_0063904 Ga0466971_0063904_282_917 211
571 3300044735 Ga0466968_0007972 Ga0466968_0007972_824_1459 211
572 3300044735 Ga0466968_0219604 Ga0466968_0219604_165_800 211
573 3300044765 Ga0466970_0000921 Ga0466970_0000921_8227_8862 211
574 3300044765 Ga0466970_0175637 Ga0466970_0175637_509_1144 211
575 3300044765 Ga0466970_0190026 Ga0466970_0190026_378_1013 211
576 3300044765 Ga0466970_0230620 Ga0466970_0230620_256_891 211
577 3300044842 Ga0466957_0000577 Ga0466957_0000577_4488_5123 211
578 3300044842 Ga0466957_0385784 Ga0466957_0385784_66_701 211
579 3300044901 Ga0466960_0030304 Ga0466960_0030304_934_1569 211
580 3300045049 Ga0466959_0000016 Ga0466959_0000016_54595_55230 211
581 3300045049 Ga0466959_0014668 Ga0466959_0014668_243_878 211
582 3300045049 Ga0466959_0035604 Ga0466959_0035604_913_1548 211
583 3300046454 Ga0495592_0182992 Ga0495592_0182992_376_1011 211
584 3300046459 Ga0495629_0214769 Ga0495629_0214769_148_783 211
585 3300046463 Ga0495653_0199091 Ga0495653_0199091_96_731 211
586 3300046507 Ga0495606_0002808 Ga0495606_0002808_16999_17634 211
587 3300046511 Ga0495608_0264376 Ga0495608_0264376_318_953 211
588 3300046514 Ga0495618_0480110 Ga0495618_0480110_58_693 211
589 3300046516 Ga0495628_0192773 Ga0495628_0192773_377_1012 211
590 3300046517 Ga0495630_0003153 Ga0495630_0003153_2163_2798 211
591 3300046524 Ga0495648_0008648 Ga0495648_0008648_1590_2225 211
592 3300046524 Ga0495648_0228485 Ga0495648_0228485_93_728 211
593 3300046529 Ga0495652_0526627 Ga0495652_0526627_89_724 211
594 3300046533 Ga0495640_0226365 Ga0495640_0226365_370_1005 211
595 3300046559 Ga0495667_0218117 Ga0495667_0218117_115_750 211
596 3300046642 Ga0495634_0054328 Ga0495634_0054328_1353_1988 211
597 3300046648 Ga0495611_0000231 Ga0495611_0000231_28565_29200 211
598 3300046648 Ga0495611_0234725 Ga0495611_0234725_124_759 211
599 3300046660 Ga0495625_0101589 Ga0495625_0101589_1144_1779 211
600 3300046663 Ga0495635_0236624 Ga0495635_0236624_70_705 211
601 3300046675 Ga0495657_0269380 Ga0495657_0269380_144_779 211
602 3300046681 Ga0495647_0180837 Ga0495647_0180837_156_791 211
603 3300046683 Ga0495658_0004169 Ga0495658_0004169_5746_6381 211
604 3300047317 Ga0495604_0213874 Ga0495604_0213874_333_968 211
605 3300047319 Ga0495674_0006177 Ga0495674_0006177_6691_7326 211
606 3300047319 Ga0495674_0080161 Ga0495674_0080161_553_1188 211
607 3300047320 Ga0495672_0018917 Ga0495672_0018917_767_1402 211
608 3300047322 Ga0495680_0374124 Ga0495680_0374124_311_946 211
609 3300047443 Ga0495687_000111 Ga0495687_000111_111913_112548 211
610 3300047471 Ga0495684_0051254 Ga0495684_0051254_1582_2217 211
611 3300047472 Ga0495686_0088327 Ga0495686_0088327_1144_1779 211
612 3300048088 Ga0495602_0152944 Ga0495602_0152944_644_1279 211
613 3300048904 Ga0496101_0008686 Ga0496101_0008686_2127_2762 211
614 3300048907 Ga0496104_0447940 Ga0496104_0447940_200_835 211
615 3300048908 Ga0496105_0606482 Ga0496105_0606482_142_777 211
616 3300048910 Ga0496107_0605268 Ga0496107_0605268_30_665 211
617 3300048913 Ga0496110_0313645 Ga0496110_0313645_86_721 211
618 3300048917 Ga0496114_0006425 Ga0496114_0006425_7541_8176 211
619 3300048917 Ga0496114_0370946 Ga0496114_0370946_219_854 211
620 3300048917 Ga0496114_0907236 Ga0496114_0907236_52_687 211
621 3300048918 Ga0496115_0331579 Ga0496115_0331579_204_839 211
622 3300048924 Ga0496121_0000051 Ga0496121_0000051_46940_47575 211
623 3300048927 Ga0496124_0112179 Ga0496124_0112179_1322_1957 211
624 3300049528 Ga0501312_051533 Ga0501312_051533_31_666 211
625 3300049570 Ga0501033_0019886 Ga0501033_0019886_1393_2028 211
626 3300049570 Ga0501033_0224297 Ga0501033_0224297_683_1318 211
627 3300049570 Ga0501033_0238245 Ga0501033_0238245_289_924 211
628 3300049570 Ga0501033_0305814 Ga0501033_0305814_72_707 211
629 3300049571 Ga0501034_0022432 Ga0501034_0022432_3747_4382 211
630 3300049571 Ga0501034_0046484 Ga0501034_0046484_1062_1697 211
631 3300049571 Ga0501034_0099393 Ga0501034_0099393_186_821 211
632 3300049571 Ga0501034_0405389 Ga0501034_0405389_127_762 211
633 3300049571 Ga0501034_0792219 Ga0501034_0792219_70_705 211
634 3300049572 Ga0501036_0053937 Ga0501036_0053937_720_1355 211
635 3300049573 Ga0501037_0023146 Ga0501037_0023146_2890_3525 211
636 3300049573 Ga0501037_0345966 Ga0501037_0345966_274_909 211
637 3300049574 Ga0501038_0237267 Ga0501038_0237267_756_1391 211
638 3300049579 Ga0501043_0003586 Ga0501043_0003586_8595_9230 211
639 3300049579 Ga0501043_0042539 Ga0501043_0042539_916_1551 211
640 3300049579 Ga0501043_0184099 Ga0501043_0184099_749_1384 211
641 3300049581 Ga0501047_0005137 Ga0501047_0005137_10314_10949 211
642 3300049581 Ga0501047_0022222 Ga0501047_0022222_3647_4282 211
643 3300049581 Ga0501047_0028692 Ga0501047_0028692_3522_4157 211
644 3300049585 Ga0501069_0108360 Ga0501069_0108360_789_1424 211
645 3300049586 Ga0501070_0045242 Ga0501070_0045242_2797_3432 211
646 3300049586 Ga0501070_0061556 Ga0501070_0061556_361_996 211
647 3300049586 Ga0501070_0095944 Ga0501070_0095944_320_955 211
648 3300049671 Ga0501238_019496 Ga0501238_019496_264_899 211
649 3300049703 Ga0501219_000650 Ga0501219_000650_3617_4252 211
650 3300049705 Ga0501225_0002441 Ga0501225_0002441_389_1024 211
651 3300049742 Ga0501080_0278625 Ga0501080_0278625_533_1168 211
652 3300049742 Ga0501080_0327808 Ga0501080_0327808_165_800 211
653 3300049742 Ga0501080_0386263 Ga0501080_0386263_449_1084 211
654 3300049758 Ga0501241_001865 Ga0501241_001865_874_1509 211
655 3300049822 Ga0501035_0016926 Ga0501035_0016926_4168_4803 211
656 3300049822 Ga0501035_0029491 Ga0501035_0029491_4069_4704 211
657 3300049822 Ga0501035_0106678 Ga0501035_0106678_841_1476 211
658 3300049822 Ga0501035_0583474 Ga0501035_0583474_156_791 211
659 3300049822 Ga0501035_0587796 Ga0501035_0587796_172_807 211
660 3300049823 Ga0501044_0034967 Ga0501044_0034967_3639_4274 211
661 3300049823 Ga0501044_0320531 Ga0501044_0320531_396_1031 211
662 3300050005 Ga0501284_00005 Ga0501284_00005_118733_119368 211
663 3300050493 nmdc:mga0k408_132857_c1 nmdc:mga0k408_132857_c1_402_1037 211
664 3300050493 nmdc:mga0k408_1625_c3 nmdc:mga0k408_1625_c3_1620_2255 211
665 3300050493 nmdc:mga0k408_25436_c1 nmdc:mga0k408_25436_c1_2228_2863 211
666 3300050493 nmdc:mga0k408_395428_c1 nmdc:mga0k408_395428_c1_123_758 211
667 3300050493 nmdc:mga0k408_7175_c1 nmdc:mga0k408_7175_c1_348_983 211
668 3300050507 nmdc:mga05p37_914_c1 nmdc:mga05p37_914_c1_20541_21176 211
669 3300050511 nmdc:mga08y16_12509_c1 nmdc:mga08y16_12509_c1_5028_5663 211
670 3300053086 Ga0500578_0027483 Ga0500578_0027483_580_1215 211
671 3300053086 Ga0500578_0117443 Ga0500578_0117443_1014_1649 211
672 3300053088 Ga0500644_0000032 Ga0500644_0000032_36552_37187 211
673 3300053090 Ga0500646_0004811 Ga0500646_0004811_2664_3299 211
674 3300053090 Ga0500646_0023054 Ga0500646_0023054_890_1525 211
675 3300053092 Ga0500583_0006441 Ga0500583_0006441_2479_3114 211
676 3300053109 Ga0500569_000056 Ga0500569_000056_8421_9056 211
677 3300053130 Ga0500642_0068450 Ga0500642_0068450_683_1318 211
678 3300053131 Ga0500652_015609 Ga0500652_015609_1176_1811 211
679 3300053134 Ga0500658_0119642 Ga0500658_0119642_507_1142 211
680 3300053139 Ga0500568_0001302 Ga0500568_0001302_15208_15843 211
681 3300053139 Ga0500568_0023320 Ga0500568_0023320_32_667 211
682 3300053140 Ga0500573_0133851 Ga0500573_0133851_519_1154 211
683 3300053142 Ga0500577_0002744 Ga0500577_0002744_2812_3447 211
684 3300053148 Ga0500590_028379 Ga0500590_028379_121_756 211
685 3300053153 Ga0500616_0012198 Ga0500616_0012198_498_1133 211
686 3300053153 Ga0500616_0069763 Ga0500616_0069763_563_1198 211
687 3300053153 Ga0500616_0124652 Ga0500616_0124652_172_807 211
688 3300053156 Ga0500622_0006216 Ga0500622_0006216_6296_6931 211
689 3300053160 Ga0500633_0005002 Ga0500633_0005002_1947_2582 211
690 3300053161 Ga0500634_0060050 Ga0500634_0060050_291_926 211
691 3300053163 Ga0500639_096414 Ga0500639_096414_313_948 211
692 3300053177 Ga0500636_0080702 Ga0500636_0080702_230_865 211
693 3300053178 Ga0500637_0127480 Ga0500637_0127480_101_736 211
694 3300053727 Ga0500611_000004 Ga0500611_000004_243488_244171 211
695 3300054114 Ga0501084_0129706 Ga0501084_0129706_700_1335 211
696 3300055283 Ga0500661_014040 Ga0500661_014040_198_833 211
697 3300059492 Ga0587073_0145722 Ga0587073_0145722_17_652 211
698 3300059493 Ga0587077_094413 Ga0587077_094413_14_649 211
699 3300059493 Ga0587077_097345 Ga0587077_097345_34_669 211
700 3300059503 Ga0587080_071993 Ga0587080_071993_13_648 211
701 3300059510 Ga0587090_065552 Ga0587090_065552_20_655 211
702 3300059510 Ga0587090_072724 Ga0587090_072724_17_652 211
703 3300059630 Ga0587128_060747 Ga0587128_060747_68_703 211
704 3300059653 Ga0587108_012644 Ga0587108_012644_31_666 211
705 3300060353 Ga0501082_0340214 Ga0501082_0340214_453_1088 211
706 2162886007 SwRhRL2b_contig_1762462 SwRhRL2b_0592.00004270 212
707 3300003316 rootH1_10058428 rootH1_100584282 212
708 3300003320 rootH2_10206522 rootH2_102065222 212
709 3300003320 rootH2_10318247 rootH2_103182472 212
710 3300003323 rootH1_10116971 rootH1_101169711 212
711 3300003354 JGI25160J50197_1000701 JGI25160J50197_10007019 212
712 3300004803 Ga0058862_12529024 Ga0058862_125290241 212
713 3300005290 Ga0065712_10196712 Ga0065712_101967122 212
714 3300005327 Ga0070658_10029344 Ga0070658_100293443 212
715 3300005327 Ga0070658_10093407 Ga0070658_100934073 212
716 3300005327 Ga0070658_10635909 Ga0070658_106359091 212
717 3300005328 Ga0070676_10072342 Ga0070676_100723422 212
718 3300005328 Ga0070676_10536328 Ga0070676_105363281 212
719 3300005329 Ga0070683_100048151 Ga0070683_1000481514 212
720 3300005329 Ga0070683_100221886 Ga0070683_1002218862 212
721 3300005329 Ga0070683_100268473 Ga0070683_1002684733 212
722 3300005329 Ga0070683_100547939 Ga0070683_1005479392 212
723 3300005329 Ga0070683_100693185 Ga0070683_1006931851 212
724 3300005331 Ga0070670_100048082 Ga0070670_1000480823 212
725 3300005331 Ga0070670_100062454 Ga0070670_1000624542 212
726 3300005331 Ga0070670_100133415 Ga0070670_1001334152 212
727 3300005331 Ga0070670_100230943 Ga0070670_1002309432 212
728 3300005331 Ga0070670_100632532 Ga0070670_1006325322 212
729 3300005331 Ga0070670_100785560 Ga0070670_1007855601 212
730 3300005333 Ga0070677_10049688 Ga0070677_100496881 212
731 3300005334 Ga0068869_100027216 Ga0068869_1000272162 212
732 3300005335 Ga0070666_10000038 Ga0070666_1000003888 212
733 3300005336 Ga0070680_100029132 Ga0070680_1000291323 212
734 3300005336 Ga0070680_100092951 Ga0070680_1000929514 212
735 3300005337 Ga0070682_100051348 Ga0070682_1000513483 212
736 3300005338 Ga0068868_100044102 Ga0068868_1000441022 212
737 3300005338 Ga0068868_100185404 Ga0068868_1001854042 212
738 3300005338 Ga0068868_100192973 Ga0068868_1001929732 212
739 3300005338 Ga0068868_100265052 Ga0068868_1002650522 212
740 3300005338 Ga0068868_100624617 Ga0068868_1006246172 212
741 3300005338 Ga0068868_100769593 Ga0068868_1007695931 212
742 3300005339 Ga0070660_100049041 Ga0070660_1000490413 212
743 3300005339 Ga0070660_100701463 Ga0070660_1007014631 212
744 3300005343 Ga0070687_100390997 Ga0070687_1003909971 212
745 3300005347 Ga0070668_100025917 Ga0070668_1000259172 212
746 3300005347 Ga0070668_100083647 Ga0070668_1000836472 212
747 3300005347 Ga0070668_100509255 Ga0070668_1005092551 212
748 3300005353 Ga0070669_100137440 Ga0070669_1001374402 212
749 3300005354 Ga0070675_100124675 Ga0070675_1001246752 212
750 3300005354 Ga0070675_100197256 Ga0070675_1001972561 212
751 3300005355 Ga0070671_100232720 Ga0070671_1002327202 212
752 3300005356 Ga0070674_100004279 Ga0070674_1000042792 212
753 3300005356 Ga0070674_100197328 Ga0070674_1001973281 212
754 3300005364 Ga0070673_100078528 Ga0070673_1000785282 212
755 3300005364 Ga0070673_100136004 Ga0070673_1001360042 212
756 3300005365 Ga0070688_100221604 Ga0070688_1002216042 212
757 3300005366 Ga0070659_100078815 Ga0070659_1000788152 212
758 3300005367 Ga0070667_100017912 Ga0070667_1000179126 212
759 3300005367 Ga0070667_100186935 Ga0070667_1001869352 212
760 3300005367 Ga0070667_100269813 Ga0070667_1002698132 212
761 3300005367 Ga0070667_100934864 Ga0070667_1009348641 212
762 3300005435 Ga0070714_100588286 Ga0070714_1005882862 212
763 3300005436 Ga0070713_100206609 Ga0070713_1002066093 212
764 3300005456 Ga0070678_100599208 Ga0070678_1005992081 212
765 3300005458 Ga0070681_10009082 Ga0070681_100090823 212
766 3300005458 Ga0070681_10586944 Ga0070681_105869441 212
767 3300005459 Ga0068867_100313416 Ga0068867_1003134162 212
768 3300005459 Ga0068867_100598630 Ga0068867_1005986302 212
769 3300005466 Ga0070685_10008312 Ga0070685_100083123 212
770 3300005530 Ga0070679_100001442 Ga0070679_1000014424 212
771 3300005530 Ga0070679_100004485 Ga0070679_1000044854 212
772 3300005530 Ga0070679_100339490 Ga0070679_1003394901 212
773 3300005535 Ga0070684_100024212 Ga0070684_1000242122 212
774 3300005535 Ga0070684_100537503 Ga0070684_1005375031 212
775 3300005539 Ga0068853_100425978 Ga0068853_1004259782 212
776 3300005543 Ga0070672_100070167 Ga0070672_1000701672 212
777 3300005543 Ga0070672_100075356 Ga0070672_1000753562 212
778 3300005548 Ga0070665_100023645 Ga0070665_1000236453 212
779 3300005563 Ga0068855_100080085 Ga0068855_1000800852 212
780 3300005563 Ga0068855_100363654 Ga0068855_1003636542 212
781 3300005564 Ga0070664_100006818 Ga0070664_1000068185 212
782 3300005564 Ga0070664_100044832 Ga0070664_1000448323 212
783 3300005564 Ga0070664_100177625 Ga0070664_1001776254 212
784 3300005564 Ga0070664_100667150 Ga0070664_1006671501 212
785 3300005577 Ga0068857_100364550 Ga0068857_1003645502 212
786 3300005577 Ga0068857_100980941 Ga0068857_1009809411 212
787 3300005614 Ga0068856_100136052 Ga0068856_1001360522 212
788 3300005616 Ga0068852_100010785 Ga0068852_1000107852 212
789 3300005616 Ga0068852_100483536 Ga0068852_1004835362 212
790 3300005616 Ga0068852_100590414 Ga0068852_1005904141 212
791 3300005617 Ga0068859_100000007 Ga0068859_10000000794 212
792 3300005617 Ga0068859_100007298 Ga0068859_1000072983 212
793 3300005617 Ga0068859_100315486 Ga0068859_1003154861 212
794 3300005617 Ga0068859_100861076 Ga0068859_1008610762 212
795 3300005618 Ga0068864_100000685 Ga0068864_10000068518 212
796 3300005618 Ga0068864_100098112 Ga0068864_1000981122 212
797 3300005618 Ga0068864_100294136 Ga0068864_1002941362 212
798 3300005618 Ga0068864_100295740 Ga0068864_1002957402 212
799 3300005719 Ga0068861_100566855 Ga0068861_1005668551 212
800 3300005834 Ga0068851_10056995 Ga0068851_100569952 212
801 3300005834 Ga0068851_10083371 Ga0068851_100833713 212
802 3300005834 Ga0068851_10293210 Ga0068851_102932101 212
803 3300005840 Ga0068870_10020019 Ga0068870_100200192 212
804 3300005840 Ga0068870_10079494 Ga0068870_100794942 212
805 3300005841 Ga0068863_100018440 Ga0068863_1000184407 212
806 3300005841 Ga0068863_100029101 Ga0068863_1000291016 212
807 3300005841 Ga0068863_100649717 Ga0068863_1006497172 212
808 3300005841 Ga0068863_100684508 Ga0068863_1006845081 212
809 3300005842 Ga0068858_100003163 Ga0068858_10000316311 212
810 3300005842 Ga0068858_100541347 Ga0068858_1005413472 212
811 3300005843 Ga0068860_100001511 Ga0068860_10000151113 212
812 3300005843 Ga0068860_100012160 Ga0068860_1000121602 212
813 3300005843 Ga0068860_100013747 Ga0068860_1000137477 212
814 3300005843 Ga0068860_100035248 Ga0068860_1000352483 212
815 3300005843 Ga0068860_100167208 Ga0068860_1001672084 212
816 3300005843 Ga0068860_100483985 Ga0068860_1004839852 212
817 3300005844 Ga0068862_100026484 Ga0068862_1000264847 212
818 3300005985 Ga0081539_10000120 Ga0081539_1000012022 212
819 3300006195 Ga0075366_10227556 Ga0075366_102275561 212
820 3300006237 Ga0097621_100023053 Ga0097621_1000230533 212
821 3300006358 Ga0068871_100008869 Ga0068871_1000088699 212
822 3300006358 Ga0068871_100022572 Ga0068871_1000225724 212
823 3300006358 Ga0068871_100339657 Ga0068871_1003396572 212
824 3300006358 Ga0068871_100543485 Ga0068871_1005434851 212
825 3300006847 Ga0075431_100005210 Ga0075431_1000052107 212
826 3300006880 Ga0075429_100004647 Ga0075429_1000046473 212
827 3300006881 Ga0068865_100002580 Ga0068865_10000258010 212
828 3300006931 Ga0097620_100000007 Ga0097620_10000000795 212
829 3300006931 Ga0097620_100007298 Ga0097620_1000072983 212
830 3300006931 Ga0097620_100315489 Ga0097620_1003154891 212
831 3300006931 Ga0097620_100861055 Ga0097620_1008610552 212
832 3300009093 Ga0105240_10155272 Ga0105240_101552722 212
833 3300009093 Ga0105240_10230685 Ga0105240_102306852 212
834 3300009098 Ga0105245_10414992 Ga0105245_104149922 212
835 3300009101 Ga0105247_10007816 Ga0105247_100078165 212
836 3300009101 Ga0105247_10008390 Ga0105247_100083908 212
837 3300009147 Ga0114129_10097830 Ga0114129_100978303 212
838 3300009174 Ga0105241_10000104 Ga0105241_1000010459 212
839 3300009174 Ga0105241_10465636 Ga0105241_104656361 212
840 3300009545 Ga0105237_10006531 Ga0105237_100065316 212
841 3300009545 Ga0105237_10057748 Ga0105237_100577484 212
842 3300009545 Ga0105237_10192956 Ga0105237_101929562 212
843 3300009545 Ga0105237_10578381 Ga0105237_105783812 212
844 3300009553 Ga0105249_10009352 Ga0105249_100093522 212
845 3300009553 Ga0105249_10056439 Ga0105249_100564394 212
846 3300010375 Ga0105239_10003951 Ga0105239_1000395114 212
847 3300010375 Ga0105239_10136715 Ga0105239_101367151 212
848 3300011119 Ga0105246_10001838 Ga0105246_100018388 212
849 3300013100 Ga0157373_10056306 Ga0157373_100563062 212
850 3300013102 Ga0157371_10003430 Ga0157371_100034308 212
851 3300013102 Ga0157371_10030073 Ga0157371_100300733 212
852 3300013102 Ga0157371_10099804 Ga0157371_100998043 212
853 3300013102 Ga0157371_10133786 Ga0157371_101337862 212
854 3300013102 Ga0157371_10352120 Ga0157371_103521202 212
855 3300013104 Ga0157370_10001463 Ga0157370_100014635 212
856 3300013104 Ga0157370_10081337 Ga0157370_100813374 212
857 3300013104 Ga0157370_10088225 Ga0157370_100882254 212
858 3300013104 Ga0157370_10192246 Ga0157370_101922462 212
859 3300013296 Ga0157374_10071499 Ga0157374_100714994 212
860 3300013296 Ga0157374_10205761 Ga0157374_102057612 212
861 3300013296 Ga0157374_10392540 Ga0157374_103925401 212
862 3300013297 Ga0157378_10002819 Ga0157378_1000281912 212
863 3300013297 Ga0157378_10020773 Ga0157378_100207733 212
864 3300013297 Ga0157378_10054652 Ga0157378_100546522 212
865 3300013297 Ga0157378_10510695 Ga0157378_105106951 212
866 3300013306 Ga0163162_10000226 Ga0163162_1000022622 212
867 3300013306 Ga0163162_10015360 Ga0163162_100153602 212
868 3300013306 Ga0163162_10153084 Ga0163162_101530842 212
869 3300013306 Ga0163162_10388005 Ga0163162_103880052 212
870 3300013306 Ga0163162_10942027 Ga0163162_109420271 212
871 3300013307 Ga0157372_10006279 Ga0157372_100062798 212
872 3300013307 Ga0157372_10084962 Ga0157372_100849624 212
873 3300013307 Ga0157372_10105645 Ga0157372_101056452 212
874 3300013307 Ga0157372_10195910 Ga0157372_101959103 212
875 3300013307 Ga0157372_10433548 Ga0157372_104335482 212
876 3300013307 Ga0157372_10466976 Ga0157372_104669762 212
877 3300013307 Ga0157372_10503053 Ga0157372_105030532 212
878 3300013307 Ga0157372_10956967 Ga0157372_109569672 212
879 3300013308 Ga0157375_10030276 Ga0157375_100302762 212
880 3300013308 Ga0157375_10059422 Ga0157375_100594222 212
881 3300013308 Ga0157375_10570108 Ga0157375_105701082 212
882 3300014325 Ga0163163_10003449 Ga0163163_1000344912 212
883 3300014325 Ga0163163_10089730 Ga0163163_100897302 212
884 3300014325 Ga0163163_10206453 Ga0163163_102064532 212
885 3300014325 Ga0163163_10327720 Ga0163163_103277202 212
886 3300014745 Ga0157377_10025801 Ga0157377_100258012 212
887 3300014968 Ga0157379_10072415 Ga0157379_100724152 212
888 3300014968 Ga0157379_10617162 Ga0157379_106171622 212
889 3300014969 Ga0157376_10033319 Ga0157376_100333192 212
890 3300014969 Ga0157376_10113753 Ga0157376_101137532 212
891 3300017792 Ga0163161_10203377 Ga0163161_102033772 212
892 3300017792 Ga0163161_10998847 Ga0163161_109988471 212
893 3300020080 Ga0206350_11190917 Ga0206350_111909173 212
894 3300025302 Ga0207426_1000059 Ga0207426_1000059323 212
895 3300025321 Ga0207656_10064949 Ga0207656_100649492 212
896 3300025321 Ga0207656_10223176 Ga0207656_102231761 212
897 3300025893 Ga0207682_10035528 Ga0207682_100355282 212
898 3300025893 Ga0207682_10061360 Ga0207682_100613602 212
899 3300025900 Ga0207710_10066209 Ga0207710_100662092 212
900 3300025900 Ga0207710_10138769 Ga0207710_101387692 212
901 3300025903 Ga0207680_10000015 Ga0207680_1000001590 212
902 3300025904 Ga0207647_10030149 Ga0207647_100301495 212
903 3300025904 Ga0207647_10237685 Ga0207647_102376852 212
904 3300025907 Ga0207645_10012916 Ga0207645_100129166 212
905 3300025908 Ga0207643_10005965 Ga0207643_100059655 212
906 3300025909 Ga0207705_10005519 Ga0207705_100055196 212
907 3300025911 Ga0207654_10002787 Ga0207654_100027879 212
908 3300025912 Ga0207707_10121149 Ga0207707_101211493 212
909 3300025912 Ga0207707_10489650 Ga0207707_104896501 212
910 3300025912 Ga0207707_10634642 Ga0207707_106346421 212
911 3300025913 Ga0207695_10044697 Ga0207695_100446972 212
912 3300025914 Ga0207671_10001528 Ga0207671_1000152823 212
913 3300025914 Ga0207671_10288675 Ga0207671_102886751 212
914 3300025917 Ga0207660_10078611 Ga0207660_100786112 212
915 3300025917 Ga0207660_10081069 Ga0207660_100810693 212
916 3300025918 Ga0207662_10224277 Ga0207662_102242772 212
917 3300025919 Ga0207657_10023553 Ga0207657_100235535 212
918 3300025919 Ga0207657_10030450 Ga0207657_100304503 212
919 3300025919 Ga0207657_10114129 Ga0207657_101141291 212
920 3300025919 Ga0207657_10370902 Ga0207657_103709021 212
921 3300025920 Ga0207649_10384342 Ga0207649_103843422 212
922 3300025921 Ga0207652_10000055 Ga0207652_1000005549 212
923 3300025921 Ga0207652_10000121 Ga0207652_1000012123 212
924 3300025921 Ga0207652_10122844 Ga0207652_101228442 212
925 3300025923 Ga0207681_10440740 Ga0207681_104407402 212
926 3300025925 Ga0207650_10008566 Ga0207650_100085664 212
927 3300025925 Ga0207650_10167017 Ga0207650_101670172 212
928 3300025925 Ga0207650_10220158 Ga0207650_102201582 212
929 3300025925 Ga0207650_10398018 Ga0207650_103980181 212
930 3300025925 Ga0207650_10410229 Ga0207650_104102292 212
931 3300025925 Ga0207650_10632788 Ga0207650_106327881 212
932 3300025926 Ga0207659_10028666 Ga0207659_100286664 212
933 3300025926 Ga0207659_10078755 Ga0207659_100787552 212
934 3300025926 Ga0207659_10461905 Ga0207659_104619052 212
935 3300025929 Ga0207664_10076429 Ga0207664_100764294 212
936 3300025931 Ga0207644_10214342 Ga0207644_102143422 212
937 3300025931 Ga0207644_10892485 Ga0207644_108924851 212
938 3300025933 Ga0207706_10522737 Ga0207706_105227371 212
939 3300025936 Ga0207670_10709788 Ga0207670_107097882 212
940 3300025937 Ga0207669_10696976 Ga0207669_106969761 212
941 3300025940 Ga0207691_10092002 Ga0207691_100920023 212
942 3300025940 Ga0207691_10175830 Ga0207691_101758302 212
943 3300025940 Ga0207691_10179607 Ga0207691_101796071 212
944 3300025940 Ga0207691_10245352 Ga0207691_102453523 212
945 3300025940 Ga0207691_10260339 Ga0207691_102603392 212
946 3300025942 Ga0207689_10001007 Ga0207689_1000100724 212
947 3300025942 Ga0207689_10004656 Ga0207689_100046566 212
948 3300025942 Ga0207689_10326440 Ga0207689_103264401 212
949 3300025944 Ga0207661_10008305 Ga0207661_100083054 212
950 3300025944 Ga0207661_10183888 Ga0207661_101838882 212
951 3300025944 Ga0207661_10343734 Ga0207661_103437342 212
952 3300025944 Ga0207661_10873386 Ga0207661_108733861 212
953 3300025945 Ga0207679_10004170 Ga0207679_100041705 212
954 3300025960 Ga0207651_10096548 Ga0207651_100965482 212
955 3300025961 Ga0207712_10044585 Ga0207712_100445854 212
956 3300025972 Ga0207668_10292868 Ga0207668_102928682 212
957 3300025981 Ga0207640_10062196 Ga0207640_100621963 212
958 3300025981 Ga0207640_10499889 Ga0207640_104998892 212
959 3300025986 Ga0207658_10083934 Ga0207658_100839341 212
960 3300025986 Ga0207658_10269858 Ga0207658_102698581 212
961 3300026023 Ga0207677_10005974 Ga0207677_100059742 212
962 3300026023 Ga0207677_10285475 Ga0207677_102854752 212
963 3300026023 Ga0207677_10437733 Ga0207677_104377332 212
964 3300026035 Ga0207703_10004413 Ga0207703_100044133 212
965 3300026041 Ga0207639_10125984 Ga0207639_101259842 212
966 3300026041 Ga0207639_10129479 Ga0207639_101294793 212
967 3300026041 Ga0207639_10401729 Ga0207639_104017292 212
968 3300026041 Ga0207639_10938750 Ga0207639_109387502 212
969 3300026078 Ga0207702_10037726 Ga0207702_100377261 212
970 3300026088 Ga0207641_10000056 Ga0207641_1000005689 212
971 3300026088 Ga0207641_10012112 Ga0207641_100121125 212
972 3300026088 Ga0207641_10656294 Ga0207641_106562941 212
973 3300026088 Ga0207641_10668496 Ga0207641_106684961 212
974 3300026089 Ga0207648_10004655 Ga0207648_100046554 212
975 3300026089 Ga0207648_10012488 Ga0207648_100124882 212
976 3300026089 Ga0207648_10386947 Ga0207648_103869472 212
977 3300026089 Ga0207648_10716897 Ga0207648_107168971 212
978 3300026095 Ga0207676_10035035 Ga0207676_100350353 212
979 3300026095 Ga0207676_10088827 Ga0207676_100888274 212
980 3300026095 Ga0207676_10127225 Ga0207676_101272252 212
981 3300026095 Ga0207676_10417933 Ga0207676_104179331 212
982 3300026116 Ga0207674_10348523 Ga0207674_103485232 212
983 3300026118 Ga0207675_100012540 Ga0207675_1000125401 212
984 3300026118 Ga0207675_100232223 Ga0207675_1002322232 212
985 3300026121 Ga0207683_10002007 Ga0207683_1000200717 212
986 3300026121 Ga0207683_10053052 Ga0207683_100530522 212
987 3300026121 Ga0207683_10653236 Ga0207683_106532362 212
988 3300026142 Ga0207698_10010138 Ga0207698_100101383 212
989 3300026142 Ga0207698_10018653 Ga0207698_100186532 212
990 3300026142 Ga0207698_10051843 Ga0207698_100518432 212
991 3300026142 Ga0207698_10320805 Ga0207698_103208053 212
992 3300027543 Ga0209999_1038540 Ga0209999_10385401 212
993 3300028379 Ga0268266_10023889 Ga0268266_100238896 212
994 3300028380 Ga0268265_10442058 Ga0268265_104420582 212
995 3300028381 Ga0268264_10001196 Ga0268264_1000119612 212
996 3300028381 Ga0268264_10001996 Ga0268264_1000199613 212
997 3300028381 Ga0268264_10032895 Ga0268264_100328952 212
998 3300028381 Ga0268264_10163267 Ga0268264_101632671 212
999 3300028794 Ga0307515_10000078 Ga0307515_1000007854 212
1000 3300031251 Ga0265327_10103988 Ga0265327_101039882 212
1001 3300031456 Ga0307513_10058922 Ga0307513_100589224 212
1002 3300031507 Ga0307509_10505643 Ga0307509_105056431 212
1003 3300031730 Ga0307516_10556276 Ga0307516_105562761 212
1004 3300031824 Ga0307413_10416392 Ga0307413_104163922 212
1005 3300031911 Ga0307412_10927157 Ga0307412_109271571 212
1006 3300032002 Ga0307416_100469382 Ga0307416_1004693821 212
1007 3300032002 Ga0307416_101688856 Ga0307416_1016888561 212
1008 3300032004 Ga0307414_10048812 Ga0307414_100488122 212
1009 3300032004 Ga0307414_10146317 Ga0307414_101463172 212
1010 3300032004 Ga0307414_10321574 Ga0307414_103215742 212
1011 3300032005 Ga0307411_10171240 Ga0307411_101712402 212
1012 3300032126 Ga0307415_100207344 Ga0307415_1002073442 212
1013 3300037312 Ga0395899_0018904 Ga0395899_0018904_1477_2115 212
1014 3300037312 Ga0395899_0420753 Ga0395899_0420753_136_774 212
1015 3300037312 Ga0395899_0483603 Ga0395899_0483603_19_657 212
1016 3300037418 Ga0395900_0003621 Ga0395900_0003621_935_1573 212
1017 3300037418 Ga0395900_0154636 Ga0395900_0154636_334_972 212
1018 3300037418 Ga0395900_0273229 Ga0395900_0273229_684_1322 212
1019 3300037418 Ga0395900_0450873 Ga0395900_0450873_447_1085 212
1020 3300037466 Ga0395898_0277980 Ga0395898_0277980_832_1470 212
1021 3300037471 Ga0395905_0005020 Ga0395905_0005020_9286_9924 212
1022 3300037471 Ga0395905_0068963 Ga0395905_0068963_2531_3169 212
1023 3300037471 Ga0395905_0378668 Ga0395905_0378668_69_707 212
1024 3300038443 Ga0395901_0305359 Ga0395901_0305359_996_1634 212
1025 3300038443 Ga0395901_0474814 Ga0395901_0474814_216_854 212
1026 3300042004 Ga0439445_0114136 Ga0439445_0114136_27_665 212
1027 3300042007 Ga0439449_0001249 Ga0439449_0001249_6025_6666 212
1028 3300042014 Ga0439457_004882 Ga0439457_004882_1399_2040 212
1029 3300042876 Ga0451577_0098047 Ga0451577_0098047_389_1030 212
1030 3300044683 Ga0466965_0376654 Ga0466965_0376654_67_705 212
1031 3300044712 Ga0453684_0082105 Ga0453684_0082105_2183_2821 212
1032 3300044712 Ga0453684_0389835 Ga0453684_0389835_67_708 212
1033 3300044765 Ga0466970_0115434 Ga0466970_0115434_776_1414 212
1034 3300045049 Ga0466959_0059627 Ga0466959_0059627_1445_2083 212
1035 3300046460 Ga0495638_0165194 Ga0495638_0165194_255_896 212
1036 3300048917 Ga0496114_0000397 Ga0496114_0000397_146_784 212
1037 3300049128 Ga0501308_024175 Ga0501308_024175_128_766 212
1038 3300049130 Ga0501310_011220 Ga0501310_011220_17_655 212
1039 3300049130 Ga0501310_023358 Ga0501310_023358_123_761 212
1040 3300049132 Ga0501343_009116 Ga0501343_009116_12_650 212
1041 3300049160 Ga0501304_014492 Ga0501304_014492_72_710 212
1042 3300049515 Ga0501292_005013 Ga0501292_005013_1060_1698 212
1043 3300049521 Ga0501298_001144 Ga0501298_001144_1897_2535 212
1044 3300049528 Ga0501312_022575 Ga0501312_022575_291_929 212
1045 3300049529 Ga0501313_020034 Ga0501313_020034_168_806 212
1046 3300049529 Ga0501313_025394 Ga0501313_025394_17_655 212
1047 3300049530 Ga0501314_005951 Ga0501314_005951_328_966 212
1048 3300049530 Ga0501314_007552 Ga0501314_007552_14_652 212
1049 3300049531 Ga0501315_002390 Ga0501315_002390_1103_1741 212
1050 3300049532 Ga0501316_012632 Ga0501316_012632_335_973 212
1051 3300049535 Ga0501319_003437 Ga0501319_003437_14_652 212
1052 3300049539 Ga0501323_037544 Ga0501323_037544_14_652 212
1053 3300049553 Ga0501337_004936 Ga0501337_004936_146_784 212
1054 3300049649 Ga0501198_002353 Ga0501198_002353_592_1230 212
1055 3300049651 Ga0501201_000015 Ga0501201_000015_7364_8002 212
1056 3300049652 Ga0501202_001553 Ga0501202_001553_2663_3301 212
1057 3300049652 Ga0501202_029338 Ga0501202_029338_364_1002 212
1058 3300049654 Ga0501207_007739 Ga0501207_007739_706_1344 212
1059 3300049654 Ga0501207_038145 Ga0501207_038145_73_711 212
1060 3300049660 Ga0501216_047605 Ga0501216_047605_185_823 212
1061 3300049662 Ga0501222_000903 Ga0501222_000903_2669_3307 212
1062 3300049665 Ga0501227_012864 Ga0501227_012864_658_1296 212
1063 3300049668 Ga0501233_002623 Ga0501233_002623_2381_3019 212
1064 3300049668 Ga0501233_074625 Ga0501233_074625_26_667 212
1065 3300049669 Ga0501235_000743 Ga0501235_000743_2805_3443 212
1066 3300049669 Ga0501235_033463 Ga0501235_033463_259_897 212
1067 3300049673 Ga0501240_000328 Ga0501240_000328_2956_3594 212
1068 3300049674 Ga0501242_001195 Ga0501242_001195_1556_2194 212
1069 3300049675 Ga0501243_000227 Ga0501243_000227_957_1595 212
1070 3300049680 Ga0501250_000666 Ga0501250_000666_1657_2298 212
1071 3300049682 Ga0501252_000192 Ga0501252_000192_2464_3102 212
1072 3300049686 Ga0501257_011575 Ga0501257_011575_770_1408 212
1073 3300049686 Ga0501257_017172 Ga0501257_017172_567_1205 212
1074 3300049686 Ga0501257_047767 Ga0501257_047767_23_664 212
1075 3300049688 Ga0501259_000319 Ga0501259_000319_4618_5256 212
1076 3300049690 Ga0501261_000658 Ga0501261_000658_1814_2452 212
1077 3300049690 Ga0501261_008731 Ga0501261_008731_17_658 212
1078 3300049704 Ga0501221_001008 Ga0501221_001008_1274_1912 212
1079 3300049705 Ga0501225_0000561 Ga0501225_0000561_10833_11471 212
1080 3300049708 Ga0501245_000123 Ga0501245_000123_5797_6435 212
1081 3300049763 Ga0501266_001851 Ga0501266_001851_23_661 212
1082 3300049765 Ga0501268_072676 Ga0501268_072676_42_683 212
1083 3300049823 Ga0501044_0300321 Ga0501044_0300321_382_1053 212
1084 3300050507 nmdc:mga05p37_181524_c1 nmdc:mga05p37_181524_c1_977_1615 212
1085 3300050508 nmdc:mga09592_112309_c1 nmdc:mga09592_112309_c1_1294_1932 212
1086 3300050510 nmdc:mga06r32_20749_c1 nmdc:mga06r32_20749_c1_3020_3658 212
1087 3300053090 Ga0500646_0031861 Ga0500646_0031861_59_700 212
1088 3300053092 Ga0500583_0000037 Ga0500583_0000037_35839_36480 212
1089 3300053092 Ga0500583_0001860 Ga0500583_0001860_3935_4576 212
1090 3300053146 Ga0500588_0010847 Ga0500588_0010847_733_1371 212
1091 3300053147 Ga0500589_059274 Ga0500589_059274_638_1279 212
1092 3300053151 Ga0500604_0002834 Ga0500604_0002834_3251_3892 212
1093 3300053153 Ga0500616_0006422 Ga0500616_0006422_2228_2866 212
1094 3300053156 Ga0500622_0062897 Ga0500622_0062897_27_668 212
1095 3300059624 Ga0587109_063764 Ga0587109_063764_92_730 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

39

170

0.97

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

190

229

0.95

PF08534

Redoxin

Redoxin

38

188

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9763 3 210
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9719 3 210
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9715 3 210
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9624 3 210
5ykj-assembly1.cif.gz_A structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems 0.953 3 207
ID Description Score Start End Superfamily
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9776 146 209 3.30.1020.10
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9726 146 207 3.30.1020.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9685 5 106 3.40.30.10
af_I1KRJ7_151_218_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9671 146 207 3.30.1020.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9629 146 209 3.30.1020.10
ID Description Score Start End GO Terms
AF-A4CMK5-F1-model_v4 Putative antioxidant protein 0.988 19 103 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A1T5DCE5-F1-model_v4 Alkyl hydroperoxide reductase subunit AhpC (Peroxiredoxin) 0.9876 1 207 GO:0005829
GO:0016020
GO:0045454
GO:0051920
AF-U7HQQ4-F1-model_v4 Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) 0.9872 1 207 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A2E5EKQ1-F1-model_v4 Peroxidase 0.9856 1 211 GO:0005829
GO:0045454
GO:0051920
AF-A0A523Q014-F1-model_v4 Peroxiredoxin 0.9855 1 211 GO:0005829
GO:0045454
GO:0051920

Feature Viewer

pLDDT pTM Quality
93.28 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map