F489857

General Info

Members Datasets Scaffolds Average Seq Length
1090 379 2180 144

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10951353|Ga0105249_109513532
Length 156
Sequence MAIGVKVLQRPTRQVSYVRATLKGMALTFKHMFEKKVTMQYPEEKSTDSEHGGGRWSISPRWRGTHRMLTDEQGRSKCVACGLCPQICPANCIKLVPGGDEQGNRYPLIYAIDEHVGVHYENSEYSRGRFVYDLERLSSQTHAVSTLWDPTDPAGE

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
193 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
194 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
197 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
198 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
199 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
208 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
209 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
210 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
211 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
222 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
223 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
224 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
225 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
226 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
227 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
228 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
229 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
230 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
231 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
232 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
235 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
250 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
257 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
258 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
261 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
264 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
265 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
266 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
267 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
271 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
274 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
275 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
276 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
277 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
278 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
279 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
280 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
283 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
286 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
291 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
292 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
293 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
294 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
312 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
313 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
314 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
315 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
327 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
328 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
329 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
330 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
331 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
332 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
333 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
334 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
335 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
336 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
337 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
338 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
339 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
340 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
341 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
342 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
343 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
344 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
345 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
346 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
347 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
348 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
349 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
350 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
351 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
352 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
353 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
354 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
357 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
358 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
359 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
360 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
367 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
370 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
371 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
372 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
373 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
374 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
375 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
376 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
377 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
378 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
379 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.59
Rhizosphere 95.23
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10951353 3300009553 Bacteria 927
2 JGI24035J26624_1010786 3300002126 Bacteria 911
3 Ga0065704_10309014 3300005289 Bacteria 871
4 Ga0065712_10209844 3300005290 Bacteria 1077
5 Ga0065715_10095370 3300005293 Bacteria 4100
6 Ga0065715_10114834 3300005293 Bacteria 2436
7 Ga0065715_10115624 3300005293 Bacteria 2409
8 Ga0065715_10327045 3300005293 Bacteria 989
9 Ga0065707_10106041 3300005295 Bacteria 2616
10 Ga0065707_10132388 3300005295 Bacteria 1898
11 Ga0065707_10181595 3300005295 Bacteria 1415
12 Ga0070676_10004121 3300005328 Bacteria 7633
13 Ga0070676_10547162 3300005328 Bacteria 828
14 Ga0070683_100014508 3300005329 Bacteria 6894
15 Ga0070683_100063353 3300005329 Bacteria 3439
16 Ga0070690_100133236 3300005330 Bacteria 1680
17 Ga0070690_100136093 3300005330 Bacteria 1664
18 Ga0070670_100567986 3300005331 Bacteria 1013
19 Ga0070677_10072422 3300005333 Bacteria 1453
20 Ga0068869_100009677 3300005334 Bacteria 6258
21 Ga0068869_100490246 3300005334 Bacteria 1024
22 Ga0068869_100809023 3300005334 Bacteria 806
23 Ga0068869_101874884 3300005334 Bacteria 537
24 Ga0070666_10134298 3300005335 Bacteria 1721
25 Ga0070680_100006769 3300005336 Bacteria 8733
26 Ga0070680_100036618 3300005336 Bacteria 3964
27 Ga0070680_100055793 3300005336 Bacteria 3229
28 Ga0070680_100090003 3300005336 Bacteria 2540
29 Ga0070680_100091775 3300005336 Bacteria 2514
30 Ga0070680_100239347 3300005336 Bacteria 1534
31 Ga0070680_100239467 3300005336 Bacteria 1533
32 Ga0070682_101256512 3300005337 Bacteria 627
33 Ga0068868_100453646 3300005338 Bacteria 1116
34 Ga0068868_101213331 3300005338 Bacteria 698
35 Ga0070660_100159803 3300005339 Bacteria 1815
36 Ga0070660_100964924 3300005339 Bacteria 720
37 Ga0070689_100017388 3300005340 Bacteria 5280
38 Ga0070689_100858791 3300005340 Bacteria 801
39 Ga0070691_10036165 3300005341 Bacteria 2327
40 Ga0070691_10070855 3300005341 Bacteria 1692
41 Ga0070691_10569035 3300005341 Bacteria 665
42 Ga0070687_100145255 3300005343 Bacteria 1386
43 Ga0070687_100554344 3300005343 Bacteria 783
44 Ga0070661_100021254 3300005344 Bacteria 4632
45 Ga0070661_100199308 3300005344 Bacteria 1529
46 Ga0070692_10009037 3300005345 Bacteria 4474
47 Ga0070692_10015783 3300005345 Bacteria 3579
48 Ga0070668_100018601 3300005347 Bacteria 5216
49 Ga0070668_100027586 3300005347 Bacteria 4311
50 Ga0070668_100046286 3300005347 Bacteria 3340
51 Ga0070668_100206583 3300005347 Bacteria 1614
52 Ga0070669_100045882 3300005353 Bacteria 3185
53 Ga0070675_100006655 3300005354 Bacteria 8887
54 Ga0070675_100099102 3300005354 Bacteria 2452
55 Ga0070675_100172341 3300005354 Bacteria 1867
56 Ga0070675_100426774 3300005354 Bacteria 1186
57 Ga0070671_100007440 3300005355 Bacteria 8753
58 Ga0070674_100000493 3300005356 Bacteria 19842
59 Ga0070674_100164850 3300005356 Bacteria 1684
60 Ga0070673_100072914 3300005364 Bacteria 2763
61 Ga0070673_100264996 3300005364 Bacteria 1502
62 Ga0070688_100545057 3300005365 Unclassified 881
63 Ga0070659_100041621 3300005366 Bacteria 3592
64 Ga0070667_100092416 3300005367 Bacteria 2603
65 Ga0070667_101438478 3300005367 Unclassified 647
66 Ga0070703_10000072 3300005406 Bacteria 50010
67 Ga0070703_10102537 3300005406 Bacteria 1011
68 Ga0070703_10195872 3300005406 Bacteria 790
69 Ga0070709_10001433 3300005434 Bacteria 12869
70 Ga0070709_10062745 3300005434 Bacteria 2370
71 Ga0070714_100873242 3300005435 Bacteria 873
72 Ga0070710_10493581 3300005437 Bacteria 837
73 Ga0070701_10005809 3300005438 Bacteria 5138
74 Ga0070701_10169865 3300005438 Bacteria 1269
75 Ga0070711_100000082 3300005439 Bacteria 52402
76 Ga0070711_100005417 3300005439 Bacteria 7630
77 Ga0070711_100598133 3300005439 Bacteria 920
78 Ga0070705_100000906 3300005440 Bacteria 16561
79 Ga0070705_100012045 3300005440 Bacteria 4382
80 Ga0070705_100016019 3300005440 Bacteria 3886
81 Ga0070705_100068863 3300005440 Bacteria 2132
82 Ga0070705_100096133 3300005440 Bacteria 1859
83 Ga0070705_100125991 3300005440 Bacteria 1662
84 Ga0070705_100135304 3300005440 Bacteria 1614
85 Ga0070705_100183332 3300005440 Bacteria 1420
86 Ga0070705_101143668 3300005440 Bacteria 639
87 Ga0070700_100083299 3300005441 Bacteria 2070
88 Ga0070700_100345248 3300005441 Bacteria 1101
89 Ga0070700_100408737 3300005441 Bacteria 1023
90 Ga0070700_100463658 3300005441 Bacteria 967
91 Ga0070694_100001018 3300005444 Bacteria 15919
92 Ga0070694_100004577 3300005444 Bacteria 8317
93 Ga0070694_100005532 3300005444 Bacteria 7650
94 Ga0070694_100027910 3300005444 Bacteria 3669
95 Ga0070694_100050054 3300005444 Bacteria 2815
96 Ga0070694_100065844 3300005444 Bacteria 2484
97 Ga0070694_100085467 3300005444 Bacteria 2203
98 Ga0070694_100093404 3300005444 Bacteria 2115
99 Ga0070694_100310615 3300005444 Bacteria 1211
100 Ga0070694_100503751 3300005444 Bacteria 964
101 Ga0070694_100700168 3300005444 Bacteria 824
102 Ga0070694_100807552 3300005444 Bacteria 770
103 Ga0070708_100003233 3300005445 Bacteria 12711
104 Ga0070708_100023006 3300005445 Bacteria 5293
105 Ga0070708_100037594 3300005445 Bacteria 4224
106 Ga0070708_100245675 3300005445 Bacteria 1681
107 Ga0070708_100327239 3300005445 Bacteria 1444
108 Ga0070708_100327691 3300005445 Bacteria 1443
109 Ga0070708_100781670 3300005445 Bacteria 897
110 Ga0070708_100849306 3300005445 Bacteria 858
111 Ga0070708_100996681 3300005445 Bacteria 786
112 Ga0070708_101597443 3300005445 Bacteria 607
113 Ga0070663_100009306 3300005455 Bacteria 6080
114 Ga0070663_100030065 3300005455 Bacteria 3719
115 Ga0070663_101039097 3300005455 Bacteria 714
116 Ga0070678_100001265 3300005456 Bacteria 13416
117 Ga0070678_100040752 3300005456 Bacteria 3288
118 Ga0070678_100812073 3300005456 Bacteria 850
119 Ga0070662_100001259 3300005457 Bacteria 15571
120 Ga0070662_100085344 3300005457 Bacteria 2359
121 Ga0070662_100195401 3300005457 Bacteria 1602
122 Ga0070662_100637717 3300005457 Bacteria 898
123 Ga0070681_10028388 3300005458 Bacteria 5625
124 Ga0070681_10071107 3300005458 Bacteria 3444
125 Ga0070681_10119665 3300005458 Bacteria 2569
126 Ga0070681_10183046 3300005458 Bacteria 2016
127 Ga0070681_10312731 3300005458 Bacteria 1480
128 Ga0070681_10404324 3300005458 Bacteria 1277
129 Ga0068867_100003191 3300005459 Bacteria 11554
130 Ga0068867_100280972 3300005459 Bacteria 1365
131 Ga0068867_100535582 3300005459 Bacteria 1012
132 Ga0070685_10446692 3300005466 Bacteria 905
133 Ga0070685_10730011 3300005466 Bacteria 725
134 Ga0070706_100007941 3300005467 Bacteria 9908
135 Ga0070706_100008602 3300005467 Bacteria 9515
136 Ga0070706_100095328 3300005467 Bacteria 2762
137 Ga0070706_100129383 3300005467 Bacteria 2356
138 Ga0070706_100173545 3300005467 Bacteria 2013
139 Ga0070706_100273128 3300005467 Bacteria 1577
140 Ga0070706_100838062 3300005467 Bacteria 850
141 Ga0070707_100004591 3300005468 Bacteria 12920
142 Ga0070707_100005123 3300005468 Bacteria 12282
143 Ga0070707_100172445 3300005468 Bacteria 2108
144 Ga0070707_100222565 3300005468 Bacteria 1838
145 Ga0070707_100605886 3300005468 Bacteria 1058
146 Ga0070707_100694028 3300005468 Bacteria 981
147 Ga0070707_101063716 3300005468 Bacteria 775
148 Ga0070698_100025822 3300005471 Bacteria 6121
149 Ga0070698_100033122 3300005471 Bacteria 5353
150 Ga0070698_100047086 3300005471 Bacteria 4408
151 Ga0070698_100074111 3300005471 Bacteria 3409
152 Ga0070698_100104949 3300005471 Bacteria 2796
153 Ga0070698_100249749 3300005471 Bacteria 1707
154 Ga0070698_101125985 3300005471 Bacteria 734
155 Ga0070699_100000224 3300005518 Bacteria 56041
156 Ga0070699_100005020 3300005518 Bacteria 11653
157 Ga0070699_100011684 3300005518 Bacteria 7581
158 Ga0070699_100012086 3300005518 Bacteria 7449
159 Ga0070699_100021845 3300005518 Bacteria 5516
160 Ga0070699_100068944 3300005518 Bacteria 3073
161 Ga0070699_100124063 3300005518 Bacteria 2273
162 Ga0070699_100202660 3300005518 Bacteria 1765
163 Ga0070699_100222103 3300005518 Bacteria 1684
164 Ga0070699_100271290 3300005518 Bacteria 1518
165 Ga0070699_100327468 3300005518 Bacteria 1377
166 Ga0070699_100741950 3300005518 Bacteria 898
167 Ga0070679_100020660 3300005530 Bacteria 6422
168 Ga0070679_100084813 3300005530 Bacteria 3155
169 Ga0070684_100054200 3300005535 Bacteria 3494
170 Ga0070684_100491903 3300005535 Bacteria 1136
171 Ga0070684_100851120 3300005535 Bacteria 854
172 Ga0070684_100928975 3300005535 Bacteria 815
173 Ga0070697_100004258 3300005536 Bacteria 10968
174 Ga0070697_100005930 3300005536 Bacteria 9437
175 Ga0070697_100019221 3300005536 Bacteria 5395
176 Ga0070697_100034444 3300005536 Bacteria 4083
177 Ga0070697_100048847 3300005536 Bacteria 3432
178 Ga0070697_100135019 3300005536 Bacteria 2071
179 Ga0070697_100356792 3300005536 Bacteria 1263
180 Ga0070697_100379692 3300005536 Bacteria 1224
181 Ga0070697_100837747 3300005536 Bacteria 815
182 Ga0070697_100883272 3300005536 Bacteria 793
183 Ga0070697_101485596 3300005536 Bacteria 605
184 Ga0068853_100009430 3300005539 Bacteria 7863
185 Ga0068853_100138011 3300005539 Bacteria 2187
186 Ga0070672_100024918 3300005543 Bacteria 4429
187 Ga0070672_100529364 3300005543 Bacteria 1022
188 Ga0070672_101072174 3300005543 Bacteria 715
189 Ga0070686_100025411 3300005544 Bacteria 3564
190 Ga0070695_100007340 3300005545 Bacteria 6534
191 Ga0070695_100010351 3300005545 Bacteria 5567
192 Ga0070695_100017218 3300005545 Bacteria 4382
193 Ga0070695_100045386 3300005545 Bacteria 2801
194 Ga0070695_100066863 3300005545 Bacteria 2343
195 Ga0070695_100085741 3300005545 Bacteria 2091
196 Ga0070695_100194506 3300005545 Bacteria 1446
197 Ga0070695_100493535 3300005545 Bacteria 946
198 Ga0070695_100965346 3300005545 Bacteria 691
199 Ga0070696_100000364 3300005546 Bacteria 27704
200 Ga0070696_100001799 3300005546 Bacteria 14064
201 Ga0070696_100022592 3300005546 Bacteria 4274
202 Ga0070696_100032798 3300005546 Bacteria 3565
203 Ga0070696_100034017 3300005546 Bacteria 3505
204 Ga0070696_100072835 3300005546 Bacteria 2420
205 Ga0070696_100131235 3300005546 Bacteria 1823
206 Ga0070696_100174946 3300005546 Bacteria 1589
207 Ga0070696_100183718 3300005546 Bacteria 1552
208 Ga0070696_100204369 3300005546 Bacteria 1476
209 Ga0070696_100366133 3300005546 Bacteria 1120
210 Ga0070693_100014075 3300005547 Bacteria 4089
211 Ga0070693_100402846 3300005547 Bacteria 949
212 Ga0070693_101013242 3300005547 Bacteria 629
213 Ga0070665_100091210 3300005548 Bacteria 3052
214 Ga0070665_100163868 3300005548 Bacteria 2225
215 Ga0070704_100002360 3300005549 Bacteria 10594
216 Ga0070704_100002973 3300005549 Bacteria 9635
217 Ga0070704_100003943 3300005549 Bacteria 8542
218 Ga0070704_100006949 3300005549 Bacteria 6711
219 Ga0070704_100009721 3300005549 Bacteria 5829
220 Ga0070704_100019216 3300005549 Bacteria 4387
221 Ga0070704_100022229 3300005549 Bacteria 4124
222 Ga0070704_100041206 3300005549 Bacteria 3185
223 Ga0070704_100062277 3300005549 Bacteria 2673
224 Ga0070704_100094132 3300005549 Bacteria 2241
225 Ga0070704_100308773 3300005549 Bacteria 1321
226 Ga0070704_100523133 3300005549 Bacteria 1033
227 Ga0068855_100066513 3300005563 Bacteria 4202
228 Ga0068855_100090040 3300005563 Bacteria 3542
229 Ga0068855_101015322 3300005563 Bacteria 871
230 Ga0070664_100022195 3300005564 Bacteria 5235
231 Ga0070664_100086597 3300005564 Bacteria 2707
232 Ga0070664_100129406 3300005564 Bacteria 2217
233 Ga0070664_100179465 3300005564 Bacteria 1881
234 Ga0070664_100897779 3300005564 Bacteria 831
235 Ga0068857_100005311 3300005577 Bacteria 10970
236 Ga0068857_100021299 3300005577 Bacteria 5707
237 Ga0068854_100002496 3300005578 Bacteria 11405
238 Ga0070702_100027307 3300005615 Bacteria 3078
239 Ga0070702_100037842 3300005615 Bacteria 2682
240 Ga0070702_100212480 3300005615 Bacteria 1288
241 Ga0068852_100022866 3300005616 Bacteria 5022
242 Ga0068852_100658578 3300005616 Bacteria 1055
243 Ga0068859_100040318 3300005617 Bacteria 4687
244 Ga0068859_100127109 3300005617 Bacteria 2619
245 Ga0068859_100183883 3300005617 Bacteria 2173
246 Ga0068864_100003845 3300005618 Bacteria 12371
247 Ga0068864_100102023 3300005618 Bacteria 2546
248 Ga0068866_10000778 3300005718 Bacteria 14329
249 Ga0068861_100006059 3300005719 Bacteria 8223
250 Ga0068851_10086507 3300005834 Bacteria 1645
251 Ga0068870_10015723 3300005840 Bacteria 3598
252 Ga0068863_100068229 3300005841 Bacteria 3364
253 Ga0068863_101347728 3300005841 Bacteria 721
254 Ga0068858_100034837 3300005842 Bacteria 4669
255 Ga0068858_100496575 3300005842 Bacteria 1179
256 Ga0068860_100024836 3300005843 Bacteria 5787
257 Ga0068860_100056109 3300005843 Bacteria 3746
258 Ga0068862_100002474 3300005844 Bacteria 16357
259 Ga0068862_100330474 3300005844 Bacteria 1409
260 Ga0068862_102002834 3300005844 Bacteria 590
261 Ga0081455_10036305 3300005937 Bacteria 4390
262 Ga0081455_10188084 3300005937 Bacteria 1558
263 Ga0081538_10034194 3300005981 Bacteria 3365
264 Ga0070717_10087110 3300006028 Bacteria 2629
265 Ga0070715_10280650 3300006163 Unclassified 883
266 Ga0070712_100056894 3300006175 Bacteria 2745
267 Ga0070712_100178254 3300006175 Bacteria 1654
268 Ga0075427_10057744 3300006194 Bacteria 676
269 Ga0075428_100103164 3300006844 Bacteria 3111
270 Ga0075428_100190459 3300006844 Bacteria 2218
271 Ga0075428_100286426 3300006844 Bacteria 1772
272 Ga0075428_101032362 3300006844 Bacteria 870
273 Ga0075430_100008807 3300006846 Bacteria 8517
274 Ga0075430_100024844 3300006846 Bacteria 5096
275 Ga0075430_100318485 3300006846 Bacteria 1286
276 Ga0075430_100752795 3300006846 Bacteria 803
277 Ga0075431_100003686 3300006847 Bacteria 14880
278 Ga0075431_100012956 3300006847 Bacteria 8418
279 Ga0075431_100081962 3300006847 Bacteria 3330
280 Ga0075431_100103689 3300006847 Bacteria 2935
281 Ga0075431_100106698 3300006847 Bacteria 2890
282 Ga0075431_100106714 3300006847 Bacteria 2890
283 Ga0075431_100293814 3300006847 Bacteria 1643
284 Ga0075431_100315104 3300006847 Bacteria 1578
285 Ga0075431_100471763 3300006847 Bacteria 1249
286 Ga0075431_100519809 3300006847 Bacteria 1180
287 Ga0075433_10001886 3300006852 Bacteria 15757
288 Ga0075433_10032415 3300006852 Bacteria 4475
289 Ga0075433_10040219 3300006852 Bacteria 4046
290 Ga0075433_10067112 3300006852 Bacteria 3148
291 Ga0075433_10110517 3300006852 Bacteria 2439
292 Ga0075433_10131723 3300006852 Bacteria 2221
293 Ga0075433_10142805 3300006852 Bacteria 2128
294 Ga0075433_10174486 3300006852 Bacteria 1913
295 Ga0075433_10176607 3300006852 Bacteria 1901
296 Ga0075433_10275909 3300006852 Bacteria 1490
297 Ga0075433_10562662 3300006852 Bacteria 1002
298 Ga0075433_10695203 3300006852 Bacteria 891
299 Ga0075434_100011488 3300006871 Bacteria 8356
300 Ga0075434_100018541 3300006871 Bacteria 6725
301 Ga0075434_100021559 3300006871 Bacteria 6263
302 Ga0075434_100071759 3300006871 Bacteria 3454
303 Ga0075434_100101894 3300006871 Bacteria 2878
304 Ga0075434_100248070 3300006871 Bacteria 1800
305 Ga0075434_100296665 3300006871 Bacteria 1636
306 Ga0075434_100337597 3300006871 Bacteria 1527
307 Ga0075434_100366959 3300006871 Bacteria 1461
308 Ga0075434_100464851 3300006871 Bacteria 1286
309 Ga0075434_100494724 3300006871 Bacteria 1244
310 Ga0075434_100756001 3300006871 Bacteria 989
311 Ga0075434_100787963 3300006871 Bacteria 967
312 Ga0075429_100057452 3300006880 Bacteria 3388
313 Ga0075429_100124543 3300006880 Bacteria 2254
314 Ga0075429_100134233 3300006880 Bacteria 2165
315 Ga0068865_100004159 3300006881 Bacteria 8705
316 Ga0068865_100062382 3300006881 Bacteria 2616
317 Ga0075436_100008613 3300006914 Bacteria 6973
318 Ga0075436_100011422 3300006914 Bacteria 6096
319 Ga0075436_100019596 3300006914 Bacteria 4637
320 Ga0075436_100020391 3300006914 Bacteria 4550
321 Ga0075436_100032480 3300006914 Bacteria 3598
322 Ga0075436_100035530 3300006914 Bacteria 3437
323 Ga0075436_100056837 3300006914 Bacteria 2702
324 Ga0075436_100070129 3300006914 Bacteria 2423
325 Ga0075436_100198915 3300006914 Bacteria 1419
326 Ga0075436_100267787 3300006914 Bacteria 1219
327 Ga0075436_100549573 3300006914 Bacteria 848
328 Ga0075436_100622910 3300006914 Bacteria 796
329 Ga0097620_100040318 3300006931 Bacteria 4687
330 Ga0097620_100127112 3300006931 Bacteria 2619
331 Ga0097620_100183889 3300006931 Bacteria 2173
332 Ga0075435_100003527 3300007076 Bacteria 10617
333 Ga0075435_100124191 3300007076 Bacteria 2156
334 Ga0075435_100316241 3300007076 Bacteria 1336
335 Ga0075435_100402231 3300007076 Bacteria 1178
336 Ga0075435_100450460 3300007076 Bacteria 1110
337 Ga0075435_100496981 3300007076 Bacteria 1054
338 Ga0075435_100942057 3300007076 Bacteria 753
339 Ga0099794_10000064 3300007265 Bacteria 40634
340 Ga0099794_10001130 3300007265 Bacteria 9146
341 Ga0099794_10089761 3300007265 Bacteria 1524
342 Ga0099794_10204645 3300007265 Bacteria 1011
343 Ga0099795_10103849 3300007788 Bacteria 1118
344 Ga0105240_10559757 3300009093 Bacteria 1264
345 Ga0111539_10185760 3300009094 Bacteria 2428
346 Ga0111539_10211482 3300009094 Bacteria 2260
347 Ga0111539_10899912 3300009094 Bacteria 1029
348 Ga0111539_11278165 3300009094 Bacteria 852
349 Ga0105245_10047748 3300009098 Bacteria 3828
350 Ga0105245_10601338 3300009098 Bacteria 1126
351 Ga0105247_10235479 3300009101 Bacteria 1245
352 Ga0114129_10000112 3300009147 Bacteria 80956
353 Ga0114129_10012908 3300009147 Bacteria 11887
354 Ga0114129_10083785 3300009147 Bacteria 4427
355 Ga0114129_10101686 3300009147 Bacteria 3976
356 Ga0114129_10109513 3300009147 Bacteria 3813
357 Ga0114129_10305012 3300009147 Bacteria 2121
358 Ga0114129_10398208 3300009147 Bacteria 1815
359 Ga0114129_10445547 3300009147 Bacteria 1699
360 Ga0114129_10567331 3300009147 Bacteria 1474
361 Ga0114129_10691980 3300009147 Bacteria 1311
362 Ga0114129_11046500 3300009147 Bacteria 1025
363 Ga0105243_10003291 3300009148 Bacteria 13126
364 Ga0105243_10630342 3300009148 Bacteria 1036
365 Ga0105243_10757796 3300009148 Bacteria 952
366 Ga0105243_11023453 3300009148 Bacteria 830
367 Ga0105241_10061050 3300009174 Bacteria 2902
368 Ga0105241_10684222 3300009174 Bacteria 935
369 Ga0105242_10020454 3300009176 Bacteria 5190
370 Ga0105248_10073091 3300009177 Bacteria 3854
371 Ga0105248_10081521 3300009177 Bacteria 3637
372 Ga0105248_10134058 3300009177 Bacteria 2794
373 Ga0105248_10652471 3300009177 Bacteria 1187
374 Ga0105248_10744369 3300009177 Bacteria 1106
375 Ga0105237_10264860 3300009545 Bacteria 1722
376 Ga0105237_10367939 3300009545 Bacteria 1442
377 Ga0105238_10527845 3300009551 Bacteria 1183
378 Ga0105238_10805333 3300009551 Bacteria 955
379 Ga0105249_10000078 3300009553 Bacteria 140030
380 Ga0105249_10018617 3300009553 Bacteria 6184
381 Ga0105249_10054085 3300009553 Bacteria 3670
382 Ga0105249_10418459 3300009553 Bacteria 1373
383 Ga0105249_10581327 3300009553 Bacteria 1173
384 Ga0105249_10783495 3300009553 Bacteria 1017
385 Ga0105249_10787827 3300009553 Bacteria 1014
386 Ga0105239_10003966 3300010375 Bacteria 17933
387 Ga0105239_10141900 3300010375 Bacteria 2677
388 Ga0105239_10757922 3300010375 Bacteria 1111
389 Ga0105239_11943339 3300010375 Bacteria 683
390 Ga0105246_10004518 3300011119 Bacteria 8462
391 Ga0157373_10626966 3300013100 Bacteria 784
392 Ga0157373_11036482 3300013100 Bacteria 613
393 Ga0157371_10003723 3300013102 Bacteria 13669
394 Ga0157370_10046071 3300013104 Bacteria 4182
395 Ga0157374_10323408 3300013296 Bacteria 1529
396 Ga0157378_10000421 3300013297 Bacteria 41701
397 Ga0163162_10048371 3300013306 Bacteria 4260
398 Ga0163162_10048923 3300013306 Bacteria 4237
399 Ga0163162_10069330 3300013306 Bacteria 3578
400 Ga0163162_10114855 3300013306 Bacteria 2792
401 Ga0157372_10065132 3300013307 Bacteria 4091
402 Ga0157372_10206871 3300013307 Bacteria 2274
403 Ga0157375_10124783 3300013308 Bacteria 2688
404 Ga0157375_10231693 3300013308 Bacteria 2006
405 Ga0157375_10510492 3300013308 Bacteria 1366
406 Ga0163163_10068187 3300014325 Bacteria 3539
407 Ga0163163_10100730 3300014325 Bacteria 2911
408 Ga0163163_10113768 3300014325 Bacteria 2736
409 Ga0163163_10442060 3300014325 Bacteria 1360
410 Ga0163163_10524040 3300014325 Bacteria 1247
411 Ga0163163_11030501 3300014325 Bacteria 886
412 Ga0157380_10077056 3300014326 Bacteria 2716
413 Ga0157380_10146002 3300014326 Bacteria 2039
414 Ga0157380_10334405 3300014326 Bacteria 1410
415 Ga0182008_10025812 3300014497 Bacteria 2982
416 Ga0182008_10454413 3300014497 Bacteria 697
417 Ga0157377_10011126 3300014745 Bacteria 4480
418 Ga0157377_10358861 3300014745 Bacteria 980
419 Ga0157377_10621232 3300014745 Bacteria 774
420 Ga0157377_10885691 3300014745 Bacteria 666
421 Ga0157379_10008398 3300014968 Bacteria 8975
422 Ga0157379_10075024 3300014968 Bacteria 3027
423 Ga0157379_10250494 3300014968 Bacteria 1608
424 Ga0157379_11276192 3300014968 Bacteria 708
425 Ga0157376_10012749 3300014969 Bacteria 6251
426 Ga0157376_10095156 3300014969 Bacteria 2590
427 Ga0157376_10153520 3300014969 Bacteria 2079
428 Ga0157376_11140257 3300014969 Bacteria 806
429 Ga0163161_10054355 3300017792 Bacteria 2906
430 Ga0163161_10196759 3300017792 Bacteria 1552
431 Ga0163161_10240993 3300017792 Bacteria 1406
432 Ga0163161_10244804 3300017792 Bacteria 1396
433 Ga0207666_1011230 3300025271 Bacteria 1236
434 Ga0207697_10001571 3300025315 Bacteria 12339
435 Ga0207653_10000053 3300025885 Bacteria 87641
436 Ga0207653_10159372 3300025885 Bacteria 834
437 Ga0207682_10166401 3300025893 Bacteria 1001
438 Ga0207642_10006202 3300025899 Bacteria 3961
439 Ga0207647_10079640 3300025904 Bacteria 1966
440 Ga0207685_10184978 3300025905 Bacteria 968
441 Ga0207699_10016425 3300025906 Bacteria 3872
442 Ga0207699_10039505 3300025906 Bacteria 2712
443 Ga0207645_10000052 3300025907 Bacteria 83428
444 Ga0207643_10044738 3300025908 Bacteria 2499
445 Ga0207684_10021988 3300025910 Bacteria 5447
446 Ga0207684_10083288 3300025910 Bacteria 2724
447 Ga0207684_10103663 3300025910 Bacteria 2432
448 Ga0207684_10177364 3300025910 Bacteria 1837
449 Ga0207684_10266325 3300025910 Bacteria 1479
450 Ga0207684_10284349 3300025910 Bacteria 1426
451 Ga0207684_10305664 3300025910 Bacteria 1371
452 Ga0207654_10002457 3300025911 Bacteria 9435
453 Ga0207707_10000322 3300025912 Bacteria 50600
454 Ga0207707_10004621 3300025912 Bacteria 12097
455 Ga0207707_10128664 3300025912 Bacteria 2214
456 Ga0207707_10223319 3300025912 Bacteria 1640
457 Ga0207707_10420683 3300025912 Bacteria 1146
458 Ga0207695_10379921 3300025913 Bacteria 1298
459 Ga0207693_10251756 3300025915 Bacteria 1386
460 Ga0207693_11071085 3300025915 Bacteria 613
461 Ga0207663_10000059 3300025916 Bacteria 56317
462 Ga0207663_10058408 3300025916 Bacteria 2434
463 Ga0207660_10009265 3300025917 Bacteria 6372
464 Ga0207660_10013753 3300025917 Bacteria 5310
465 Ga0207660_10108221 3300025917 Bacteria 2087
466 Ga0207660_10164164 3300025917 Bacteria 1716
467 Ga0207660_10257676 3300025917 Bacteria 1378
468 Ga0207662_10011631 3300025918 Bacteria 4888
469 Ga0207662_10163705 3300025918 Bacteria 1422
470 Ga0207657_10051891 3300025919 Bacteria 3563
471 Ga0207657_10325173 3300025919 Bacteria 1215
472 Ga0207657_10652458 3300025919 Bacteria 819
473 Ga0207649_10020278 3300025920 Bacteria 3810
474 Ga0207649_10397162 3300025920 Bacteria 1031
475 Ga0207649_10867197 3300025920 Bacteria 707
476 Ga0207652_10002512 3300025921 Bacteria 15407
477 Ga0207652_10026420 3300025921 Bacteria 4835
478 Ga0207652_10062405 3300025921 Bacteria 3220
479 Ga0207652_10362665 3300025921 Bacteria 1308
480 Ga0207652_10400648 3300025921 Bacteria 1238
481 Ga0207646_10002302 3300025922 Bacteria 22670
482 Ga0207646_10009808 3300025922 Bacteria 9429
483 Ga0207646_10015117 3300025922 Bacteria 7304
484 Ga0207646_10028311 3300025922 Bacteria 5102
485 Ga0207646_10069294 3300025922 Bacteria 3150
486 Ga0207646_10155758 3300025922 Bacteria 2061
487 Ga0207646_10253284 3300025922 Bacteria 1591
488 Ga0207646_10707454 3300025922 Bacteria 901
489 Ga0207681_10038311 3300025923 Bacteria 3175
490 Ga0207681_10061754 3300025923 Bacteria 2577
491 Ga0207681_10097261 3300025923 Bacteria 2115
492 Ga0207650_10065094 3300025925 Bacteria 2730
493 Ga0207659_10045341 3300025926 Bacteria 3099
494 Ga0207659_10280579 3300025926 Bacteria 1362
495 Ga0207659_10728067 3300025926 Bacteria 850
496 Ga0207687_10105118 3300025927 Bacteria 2085
497 Ga0207644_10024215 3300025931 Bacteria 4165
498 Ga0207690_10110728 3300025932 Bacteria 1977
499 Ga0207706_10000233 3300025933 Bacteria 60777
500 Ga0207706_10002460 3300025933 Bacteria 18078
501 Ga0207706_10314968 3300025933 Bacteria 1362
502 Ga0207706_10388835 3300025933 Bacteria 1210
503 Ga0207706_10508738 3300025933 Bacteria 1039
504 Ga0207686_10000067 3300025934 Bacteria 94339
505 Ga0207709_10246527 3300025935 Bacteria 1302
506 Ga0207670_10004394 3300025936 Bacteria 7586
507 Ga0207669_10050286 3300025937 Bacteria 2490
508 Ga0207704_10006365 3300025938 Bacteria 5503
509 Ga0207704_10028041 3300025938 Bacteria 3118
510 Ga0207665_10085301 3300025939 Bacteria 2180
511 Ga0207691_10001361 3300025940 Bacteria 24383
512 Ga0207691_10035660 3300025940 Bacteria 4615
513 Ga0207691_10116001 3300025940 Bacteria 2377
514 Ga0207711_10026644 3300025941 Bacteria 4852
515 Ga0207711_10029951 3300025941 Bacteria 4591
516 Ga0207711_10070251 3300025941 Bacteria 3036
517 Ga0207711_10488942 3300025941 Bacteria 1147
518 Ga0207689_10006033 3300025942 Bacteria 10709
519 Ga0207689_10019127 3300025942 Bacteria 5775
520 Ga0207689_10268628 3300025942 Bacteria 1412
521 Ga0207661_10007949 3300025944 Bacteria 7562
522 Ga0207661_10170940 3300025944 Bacteria 1892
523 Ga0207661_10472093 3300025944 Bacteria 1144
524 Ga0207661_10860781 3300025944 Bacteria 835
525 Ga0207661_10864770 3300025944 Bacteria 833
526 Ga0207679_10000491 3300025945 Bacteria 27303
527 Ga0207679_10052582 3300025945 Bacteria 2987
528 Ga0207679_10288073 3300025945 Bacteria 1411
529 Ga0207667_10141025 3300025949 Bacteria 2481
530 Ga0207667_10355141 3300025949 Bacteria 1495
531 Ga0207651_10056275 3300025960 Bacteria 2706
532 Ga0207651_10060359 3300025960 Bacteria 2632
533 Ga0207651_10247338 3300025960 Bacteria 1457
534 Ga0207712_10000079 3300025961 Bacteria 115164
535 Ga0207712_10000422 3300025961 Bacteria 36283
536 Ga0207712_10002159 3300025961 Bacteria 12848
537 Ga0207712_10120937 3300025961 Bacteria 1981
538 Ga0207668_10021280 3300025972 Bacteria 4134
539 Ga0207668_10022657 3300025972 Bacteria 4025
540 Ga0207668_10034153 3300025972 Bacteria 3375
541 Ga0207668_10187272 3300025972 Bacteria 1637
542 Ga0207640_10065179 3300025981 Bacteria 2430
543 Ga0207658_10027037 3300025986 Bacteria 4029
544 Ga0207658_10027256 3300025986 Bacteria 4012
545 Ga0207677_10108441 3300026023 Bacteria 2062
546 Ga0207703_10307682 3300026035 Bacteria 1447
547 Ga0207703_10577108 3300026035 Bacteria 1062
548 Ga0207703_11483374 3300026035 Bacteria 652
549 Ga0207639_10049215 3300026041 Bacteria 3195
550 Ga0207639_10426083 3300026041 Bacteria 1200
551 Ga0207678_10045382 3300026067 Bacteria 3800
552 Ga0207678_10137365 3300026067 Bacteria 2086
553 Ga0207678_10208550 3300026067 Bacteria 1671
554 Ga0207708_10141305 3300026075 Bacteria 1889
555 Ga0207708_10218177 3300026075 Bacteria 1527
556 Ga0207708_10419169 3300026075 Bacteria 1110
557 Ga0207708_10996881 3300026075 Bacteria 728
558 Ga0207641_10028325 3300026088 Bacteria 4628
559 Ga0207648_10000030 3300026089 Bacteria 129654
560 Ga0207648_11267085 3300026089 Bacteria 693
561 Ga0207676_10004008 3300026095 Bacteria 10398
562 Ga0207676_10014848 3300026095 Bacteria 5611
563 Ga0207676_10565657 3300026095 Bacteria 1088
564 Ga0207674_10001353 3300026116 Bacteria 31708
565 Ga0207674_10020675 3300026116 Bacteria 7103
566 Ga0207674_10513198 3300026116 Bacteria 1158
567 Ga0207675_100000096 3300026118 Bacteria 69990
568 Ga0207675_100015444 3300026118 Bacteria 7123
569 Ga0207675_100180577 3300026118 Bacteria 2021
570 Ga0207675_100882348 3300026118 Bacteria 910
571 Ga0207675_101235129 3300026118 Bacteria 768
572 Ga0207683_10002858 3300026121 Bacteria 15062
573 Ga0207683_10409880 3300026121 Bacteria 1247
574 Ga0207698_10036693 3300026142 Bacteria 3601
575 Ga0209999_1081121 3300027543 Bacteria 626
576 Ga0209983_1042709 3300027665 Bacteria 983
577 Ga0209588_1000171 3300027671 Bacteria 18229
578 Ga0209588_1000290 3300027671 Bacteria 13273
579 Ga0209974_10031297 3300027876 Bacteria 1762
580 Ga0268266_10165570 3300028379 Bacteria 2003
581 Ga0268265_10021188 3300028380 Bacteria 4548
582 Ga0268265_10532238 3300028380 Bacteria 1112
583 Ga0268265_11569783 3300028380 Unclassified 663
584 Ga0268265_11831814 3300028380 Bacteria 613
585 Ga0268264_10036137 3300028381 Bacteria 4068
586 Ga0268264_10289553 3300028381 Bacteria 1538
587 Ga0268264_11619300 3300028381 Bacteria 658
588 Ga0265325_10302145 3300031241 Bacteria 714
589 Ga0307408_100006769 3300031548 Bacteria 7599
590 Ga0307408_100075696 3300031548 Bacteria 2502
591 Ga0307408_100107836 3300031548 Bacteria 2134
592 Ga0307408_100293843 3300031548 Bacteria 1358
593 Ga0307408_101111838 3300031548 Bacteria 733
594 Ga0316575_10032631 3300031665 Bacteria 2041
595 Ga0316579_10051296 3300031691 Bacteria 1930
596 Ga0316578_10025414 3300031728 Bacteria 3330
597 Ga0307405_10046684 3300031731 Bacteria 2663
598 Ga0307405_10083556 3300031731 Bacteria 2093
599 Ga0307405_10141634 3300031731 Bacteria 1678
600 Ga0307405_10339142 3300031731 Bacteria 1155
601 Ga0307405_10899054 3300031731 Bacteria 749
602 Ga0307405_10942320 3300031731 Bacteria 733
603 Ga0307413_10002046 3300031824 Bacteria 8043
604 Ga0307413_10009285 3300031824 Bacteria 4699
605 Ga0307413_10023130 3300031824 Bacteria 3363
606 Ga0307413_10097982 3300031824 Bacteria 1929
607 Ga0307413_10226495 3300031824 Bacteria 1369
608 Ga0307413_10240431 3300031824 Bacteria 1336
609 Ga0307410_10005206 3300031852 Bacteria 6852
610 Ga0307410_10009013 3300031852 Bacteria 5570
611 Ga0307410_10016499 3300031852 Bacteria 4407
612 Ga0307410_10027696 3300031852 Bacteria 3584
613 Ga0307410_10031076 3300031852 Bacteria 3422
614 Ga0307410_10108848 3300031852 Bacteria 2002
615 Ga0307406_10054292 3300031901 Bacteria 2556
616 Ga0307406_10064968 3300031901 Bacteria 2370
617 Ga0307406_10358325 3300031901 Bacteria 1142
618 Ga0307406_10397397 3300031901 Bacteria 1091
619 Ga0307407_10006430 3300031903 Bacteria 5221
620 Ga0307407_10009737 3300031903 Bacteria 4491
621 Ga0307407_10207919 3300031903 Bacteria 1316
622 Ga0307407_10235925 3300031903 Bacteria 1245
623 Ga0307407_11078938 3300031903 Bacteria 623
624 Ga0307412_10032874 3300031911 Bacteria 3291
625 Ga0307412_10083663 3300031911 Bacteria 2213
626 Ga0307409_100002426 3300031995 Bacteria 9740
627 Ga0307409_100010854 3300031995 Bacteria 5700
628 Ga0307409_100031677 3300031995 Bacteria 3821
629 Ga0307409_100039839 3300031995 Bacteria 3491
630 Ga0307409_100097744 3300031995 Bacteria 2426
631 Ga0307409_100098415 3300031995 Bacteria 2419
632 Ga0307409_100202315 3300031995 Bacteria 1778
633 Ga0307409_100344728 3300031995 Bacteria 1403
634 Ga0307409_100453512 3300031995 Bacteria 1238
635 Ga0307409_100641862 3300031995 Bacteria 1054
636 Ga0307409_100911238 3300031995 Bacteria 893
637 Ga0307416_100002505 3300032002 Bacteria 10561
638 Ga0307416_100016376 3300032002 Bacteria 5151
639 Ga0307416_100036703 3300032002 Bacteria 3762
640 Ga0307416_100053123 3300032002 Bacteria 3249
641 Ga0307416_100056341 3300032002 Bacteria 3172
642 Ga0307416_100071671 3300032002 Bacteria 2880
643 Ga0307416_100073971 3300032002 Bacteria 2844
644 Ga0307416_100171971 3300032002 Bacteria 2018
645 Ga0307416_100570926 3300032002 Bacteria 1207
646 Ga0307414_10079838 3300032004 Bacteria 2390
647 Ga0307414_10108800 3300032004 Bacteria 2104
648 Ga0307414_10186951 3300032004 Bacteria 1672
649 Ga0307414_10204495 3300032004 Bacteria 1609
650 Ga0307414_10369626 3300032004 Bacteria 1236
651 Ga0307414_10473269 3300032004 Bacteria 1103
652 Ga0307414_11195964 3300032004 Bacteria 704
653 Ga0307411_10001515 3300032005 Bacteria 9568
654 Ga0307411_10006918 3300032005 Bacteria 5721
655 Ga0307411_10013846 3300032005 Bacteria 4467
656 Ga0307411_10022193 3300032005 Bacteria 3732
657 Ga0307411_10067270 3300032005 Bacteria 2410
658 Ga0307415_100003453 3300032126 Bacteria 8046
659 Ga0307415_100487711 3300032126 Bacteria 1074
660 Ga0307415_100673392 3300032126 Bacteria 930
661 Ga0316596_1103036 3300033541 Bacteria 772
662 Ga0373950_0029762 3300034818 Bacteria 1006
663 Ga0373958_0070358 3300034819 Bacteria 775
664 Ga0373926_0253992 3300035083 Bacteria 682
665 Ga0373951_0089306 3300035091 Bacteria 807
666 Ga0373939_0070890 3300035114 Bacteria 1134
667 Ga0373956_0503591 3300035119 Bacteria 578
668 Ga0373960_0086250 3300035121 Bacteria 997
669 Ga0373955_0245331 3300035172 Bacteria 1073
670 Ga0373955_0489630 3300035172 Bacteria 751
671 Ga0373955_0745186 3300035172 Bacteria 602
672 Ga0316574_0031489 3300035398 Bacteria 3217
673 Ga0316574_0343722 3300035398 Bacteria 945
674 Ga0373931_0017973 3300035691 Bacteria 3508
675 Ga0373931_0179699 3300035691 Bacteria 1252
676 Ga0373931_0278421 3300035691 Bacteria 1026
677 Ga0373935_0702652 3300035692 Bacteria 744
678 Ga0373937_0087903 3300036401 Bacteria 2877
679 Ga0373937_0338383 3300036401 Bacteria 1425
680 Ga0316584_0768728 3300036712 Bacteria 656
681 Ga0395905_0092324 3300037471 Bacteria 2839
682 Ga0395905_0149844 3300037471 Bacteria 2195
683 Ga0242420_000858 3300038996 Bacteria 3742
684 Ga0242420_112960 3300038996 Bacteria 586
685 Ga0439461_0063657 3300041410 Bacteria 842
686 Ga0451839_1636063 3300041496 Bacteria 1073
687 Ga0451845_0882694 3300041501 Bacteria 1200
688 Ga0439448_0061412 3300042005 Bacteria 1243
689 Ga0439452_073970 3300042010 Bacteria 748
690 Ga0439462_0061760 3300042015 Bacteria 1014
691 Ga0439462_0171214 3300042015 Unclassified 614
692 Ga0450923_020561 3300042125 Bacteria 1280
693 Ga0450898_076215 3300042134 Bacteria 678
694 Ga0439446_0025710 3300042156 Bacteria 1684
695 Ga0439435_0046691 3300042436 Bacteria 1228
696 Ga0439460_0174190 3300042461 Bacteria 725
697 Ga0451577_0016579 3300042876 Bacteria 6818
698 Ga0451577_0051331 3300042876 Bacteria 3681
699 Ga0451577_0253419 3300042876 Bacteria 1593
700 Ga0451577_1136461 3300042876 Bacteria 698
701 Ga0439440_0089031 3300042993 Bacteria 826
702 Ga0453683_0090628 3300044673 Bacteria 1917
703 Ga0453683_0094503 3300044673 Bacteria 1875
704 Ga0453683_0117468 3300044673 Bacteria 1674
705 Ga0453683_0316458 3300044673 Bacteria 1000
706 Ga0453683_0325997 3300044673 Bacteria 984
707 Ga0453683_0343042 3300044673 Bacteria 959
708 Ga0453683_1101867 3300044673 Bacteria 529
709 Ga0453684_0000368 3300044712 Bacteria 185018
710 Ga0453684_0028508 3300044712 Bacteria 7961
711 Ga0453684_0219858 3300044712 Bacteria 2201
712 Ga0466960_0157379 3300044901 Bacteria 1218
713 Ga0466960_0498668 3300044901 Bacteria 713
714 Ga0451576_0011357 3300045051 Bacteria 10131
715 Ga0451576_0015555 3300045051 Bacteria 8423
716 Ga0451576_0084072 3300045051 Bacteria 3310
717 Ga0451576_0090668 3300045051 Bacteria 3180
718 Ga0451576_0321777 3300045051 Bacteria 1618
719 Ga0451576_0410607 3300045051 Bacteria 1420
720 Ga0451576_0793071 3300045051 Bacteria 995
721 Ga0451576_0936633 3300045051 Bacteria 908
722 Ga0451576_1472869 3300045051 Bacteria 707
723 Ga0451576_2008620 3300045051 Bacteria 596
724 Ga0466967_1039686 3300045976 Bacteria 816
725 Ga0495592_0203849 3300046454 Bacteria 1333
726 Ga0495592_0630368 3300046454 Bacteria 651
727 Ga0495603_0031067 3300046455 Bacteria 3215
728 Ga0495603_0144897 3300046455 Bacteria 1381
729 Ga0495629_0316248 3300046459 Bacteria 1068
730 Ga0495629_0379189 3300046459 Bacteria 962
731 Ga0495638_0072958 3300046460 Bacteria 2096
732 Ga0495651_0145730 3300046462 Bacteria 1712
733 Ga0495651_0468529 3300046462 Bacteria 811
734 Ga0495653_0263903 3300046463 Bacteria 1137
735 Ga0495580_0022895 3300046472 Bacteria 4593
736 Ga0495580_0318987 3300046472 Bacteria 1056
737 Ga0495582_0017485 3300046473 Bacteria 3923
738 Ga0495639_0003886 3300046475 Bacteria 6419
739 Ga0495639_0285512 3300046475 Bacteria 821
740 Ga0495662_0031055 3300046476 Bacteria 2580
741 Ga0495664_0149192 3300046477 Bacteria 1418
742 Ga0495664_0332306 3300046477 Bacteria 916
743 Ga0495594_0007516 3300046499 Bacteria 5608
744 Ga0495594_0085591 3300046499 Bacteria 1763
745 Ga0495594_0246212 3300046499 Bacteria 1018
746 Ga0495608_0018686 3300046511 Bacteria 4777
747 Ga0495608_0064626 3300046511 Bacteria 2398
748 Ga0495608_0409726 3300046511 Bacteria 828
749 Ga0495618_0021654 3300046514 Bacteria 3964
750 Ga0495618_0434806 3300046514 Bacteria 798
751 Ga0495628_0074901 3300046516 Bacteria 2636
752 Ga0495628_0089850 3300046516 Bacteria 2378
753 Ga0495628_0122688 3300046516 Bacteria 1992
754 Ga0495628_0792579 3300046516 Bacteria 663
755 Ga0495630_0035765 3300046517 Bacteria 3711
756 Ga0495630_0045750 3300046517 Bacteria 3270
757 Ga0495630_0566819 3300046517 Bacteria 871
758 Ga0495663_0116580 3300046525 Bacteria 891
759 Ga0495663_0127129 3300046525 Bacteria 857
760 Ga0495666_0000412 3300046526 Bacteria 18941
761 Ga0495642_0153766 3300046528 Bacteria 996
762 Ga0495652_0030933 3300046529 Bacteria 4691
763 Ga0495652_0368567 3300046529 Bacteria 1024
764 Ga0495652_0585302 3300046529 Unclassified 763
765 Ga0495640_0004108 3300046533 Bacteria 11646
766 Ga0495640_0039092 3300046533 Bacteria 3332
767 Ga0495586_0002073 3300046535 Bacteria 10892
768 Ga0495586_0104136 3300046535 Bacteria 1576
769 Ga0495587_0022177 3300046536 Bacteria 3912
770 Ga0495609_0122974 3300046538 Bacteria 1115
771 Ga0495621_0113012 3300046539 Bacteria 1043
772 Ga0495645_0184120 3300046543 Bacteria 1428
773 Ga0495622_0263033 3300046557 Bacteria 757
774 Ga0495633_0245712 3300046558 Bacteria 817
775 Ga0495667_0071491 3300046559 Bacteria 2263
776 Ga0495667_0163432 3300046559 Bacteria 1431
777 Ga0495656_0004299 3300046615 Bacteria 4868
778 Ga0495634_0039494 3300046642 Bacteria 3213
779 Ga0495611_0073438 3300046648 Bacteria 1566
780 Ga0495635_0028673 3300046663 Bacteria 3869
781 Ga0495635_0455341 3300046663 Bacteria 845
782 Ga0495659_0032250 3300046664 Bacteria 1833
783 Ga0495588_0195589 3300046674 Bacteria 1068
784 Ga0495599_0153175 3300046678 Bacteria 1427
785 Ga0495623_0139534 3300046679 Bacteria 1443
786 Ga0495623_0175940 3300046679 Bacteria 1247
787 Ga0495646_0087486 3300046680 Bacteria 1806
788 Ga0495647_0459901 3300046681 Bacteria 590
789 Ga0495658_0002871 3300046683 Bacteria 8656
790 Ga0495669_0148028 3300046684 Bacteria 1111
791 Ga0495613_0004856 3300046689 Bacteria 10092
792 Ga0495613_0079021 3300046689 Bacteria 2392
793 Ga0495624_0028526 3300046690 Bacteria 3647
794 Ga0495624_0049571 3300046690 Bacteria 2663
795 Ga0495670_0293441 3300046691 Bacteria 871
796 Ga0495670_0426469 3300046691 Bacteria 718
797 Ga0495600_0026746 3300046809 Bacteria 3726
798 Ga0495600_0675899 3300046809 Bacteria 622
799 Ga0495604_0139306 3300047317 Bacteria 1735
800 Ga0495604_0258852 3300047317 Bacteria 1183
801 Ga0495636_0084004 3300047318 Bacteria 1375
802 Ga0495674_0010409 3300047319 Bacteria 8804
803 Ga0495674_0041030 3300047319 Bacteria 4136
804 Ga0495674_0052097 3300047319 Bacteria 3603
805 Ga0495676_0309324 3300047321 Bacteria 1064
806 Ga0495680_0010113 3300047322 Bacteria 8435
807 Ga0495680_0022538 3300047322 Bacteria 5245
808 Ga0495675_0061668 3300047444 Bacteria 2375
809 Ga0495677_0078183 3300047445 Bacteria 1238
810 Ga0495684_0005355 3300047471 Bacteria 9991
811 Ga0495684_0061988 3300047471 Bacteria 2845
812 Ga0495684_0873408 3300047471 Bacteria 581
813 Ga0495593_0050560 3300047673 Bacteria 2202
814 Ga0495602_0171857 3300048088 Bacteria 1681
815 Ga0496100_0107846 3300048903 Bacteria 1930
816 Ga0496101_0162672 3300048904 Bacteria 1712
817 Ga0496101_0479724 3300048904 Bacteria 982
818 Ga0496101_0589812 3300048904 Bacteria 879
819 Ga0496102_0031875 3300048905 Bacteria 4732
820 Ga0496102_0040425 3300048905 Bacteria 4218
821 Ga0496102_0498409 3300048905 Bacteria 1140
822 Ga0496102_0693467 3300048905 Bacteria 941
823 Ga0496102_1292689 3300048905 Bacteria 649
824 Ga0496103_0052541 3300048906 Bacteria 2524
825 Ga0496103_0302351 3300048906 Bacteria 1029
826 Ga0496103_0543311 3300048906 Bacteria 742
827 Ga0496104_0004047 3300048907 Bacteria 12714
828 Ga0496104_0034288 3300048907 Bacteria 4731
829 Ga0496104_0095576 3300048907 Bacteria 2843
830 Ga0496105_0024919 3300048908 Bacteria 4863
831 Ga0496105_0558223 3300048908 Bacteria 893
832 Ga0496106_0044531 3300048909 Bacteria 3331
833 Ga0496106_0496875 3300048909 Bacteria 980
834 Ga0496106_0835917 3300048909 Bacteria 729
835 Ga0496106_1008614 3300048909 Bacteria 654
836 Ga0496106_1446029 3300048909 Bacteria 530
837 Ga0496107_0260686 3300048910 Bacteria 1290
838 Ga0496107_0761121 3300048910 Bacteria 710
839 Ga0496108_0001015 3300048911 Bacteria 21893
840 Ga0496108_0004278 3300048911 Bacteria 11495
841 Ga0496108_0025466 3300048911 Bacteria 4876
842 Ga0496108_0119206 3300048911 Bacteria 2263
843 Ga0496108_0570856 3300048911 Bacteria 986
844 Ga0496109_0001618 3300048912 Bacteria 18825
845 Ga0496109_0026171 3300048912 Bacteria 5200
846 Ga0496109_0029711 3300048912 Bacteria 4897
847 Ga0496109_0413463 3300048912 Bacteria 1274
848 Ga0496109_0551608 3300048912 Bacteria 1087
849 Ga0496110_0004611 3300048913 Bacteria 10705
850 Ga0496110_0043308 3300048913 Bacteria 3930
851 Ga0496110_0048749 3300048913 Bacteria 3713
852 Ga0496110_0839736 3300048913 Bacteria 824
853 Ga0496111_0065615 3300048914 Bacteria 2635
854 Ga0496111_0156626 3300048914 Bacteria 1690
855 Ga0496112_0000777 3300048915 Bacteria 22477
856 Ga0496112_0001653 3300048915 Bacteria 17323
857 Ga0496112_0090310 3300048915 Bacteria 3032
858 Ga0496112_0751219 3300048915 Bacteria 901
859 Ga0496113_0000735 3300048916 Bacteria 16815
860 Ga0496113_0009041 3300048916 Bacteria 6525
861 Ga0496113_0442942 3300048916 Bacteria 1043
862 Ga0496114_0530807 3300048917 Bacteria 1040
863 Ga0496114_0659513 3300048917 Bacteria 920
864 Ga0496115_0016946 3300048918 Bacteria 5559
865 Ga0501291_012103 3300049514 Bacteria 1255
866 Ga0501292_017612 3300049515 Bacteria 1131
867 Ga0501300_039793 3300049523 Bacteria 707
868 Ga0501303_036150 3300049526 Bacteria 599
869 Ga0501031_0027298 3300049568 Bacteria 3723
870 Ga0501031_0352664 3300049568 Bacteria 952
871 Ga0501033_0105418 3300049570 Bacteria 2055
872 Ga0501033_0347261 3300049570 Bacteria 1040
873 Ga0501033_0407886 3300049570 Bacteria 947
874 Ga0501034_0000957 3300049571 Bacteria 41717
875 Ga0501034_0092144 3300049571 Bacteria 3028
876 Ga0501038_0751669 3300049574 Bacteria 727
877 Ga0501039_0290308 3300049575 Bacteria 1286
878 Ga0501039_0719954 3300049575 Bacteria 780
879 Ga0501040_0099719 3300049576 Bacteria 2025
880 Ga0501040_0284827 3300049576 Bacteria 1180
881 Ga0501040_0343582 3300049576 Bacteria 1069
882 Ga0501041_0011939 3300049577 Bacteria 5143
883 Ga0501041_0024948 3300049577 Bacteria 3591
884 Ga0501041_0165433 3300049577 Bacteria 1383
885 Ga0501041_0254225 3300049577 Bacteria 1105
886 Ga0501041_0302042 3300049577 Bacteria 1009
887 Ga0501042_0036520 3300049578 Bacteria 3486
888 Ga0501042_0125334 3300049578 Bacteria 1849
889 Ga0501046_0128973 3300049580 Bacteria 1919
890 Ga0501047_0055771 3300049581 Bacteria 3821
891 Ga0501048_0077280 3300049582 Bacteria 2350
892 Ga0501048_0143098 3300049582 Bacteria 1691
893 Ga0501048_0476589 3300049582 Bacteria 894
894 Ga0501067_0001051 3300049583 Bacteria 14859
895 Ga0501067_0015493 3300049583 Bacteria 4219
896 Ga0501067_0076734 3300049583 Bacteria 1851
897 Ga0501067_0162778 3300049583 Bacteria 1242
898 Ga0501067_0567663 3300049583 Bacteria 636
899 Ga0501068_0000075 3300049584 Bacteria 39857
900 Ga0501068_0002185 3300049584 Bacteria 10424
901 Ga0501068_0008876 3300049584 Bacteria 5610
902 Ga0501068_0657969 3300049584 Bacteria 684
903 Ga0501069_0000201 3300049585 Bacteria 26361
904 Ga0501069_0000583 3300049585 Bacteria 16870
905 Ga0501069_0006547 3300049585 Bacteria 6092
906 Ga0501069_0008559 3300049585 Bacteria 5381
907 Ga0501070_0002218 3300049586 Bacteria 17067
908 Ga0501070_0002776 3300049586 Bacteria 15278
909 Ga0501070_0027034 3300049586 Bacteria 4813
910 Ga0501070_0224342 3300049586 Bacteria 1540
911 Ga0501071_0000468 3300049587 Bacteria 20369
912 Ga0501071_0001022 3300049587 Bacteria 15424
913 Ga0501071_0027346 3300049587 Bacteria 4012
914 Ga0501071_0097254 3300049587 Bacteria 2167
915 Ga0501071_0473919 3300049587 Bacteria 959
916 Ga0501072_0030811 3300049588 Bacteria 4196
917 Ga0501072_0045958 3300049588 Bacteria 3435
918 Ga0501072_0100001 3300049588 Bacteria 2305
919 Ga0501072_0963984 3300049588 Bacteria 665
920 Ga0501073_0001702 3300049589 Bacteria 16308
921 Ga0501073_0010626 3300049589 Bacteria 6736
922 Ga0501074_0000981 3300049590 Bacteria 18483
923 Ga0501074_0003108 3300049590 Bacteria 11705
924 Ga0501074_0265538 3300049590 Bacteria 1220
925 Ga0501074_0312834 3300049590 Bacteria 1116
926 Ga0501074_0459185 3300049590 Bacteria 903
927 Ga0501075_0028411 3300049591 Bacteria 4129
928 Ga0501075_0062151 3300049591 Bacteria 2815
929 Ga0501075_0267163 3300049591 Bacteria 1304
930 Ga0501075_0272972 3300049591 Bacteria 1289
931 Ga0501075_0410308 3300049591 Bacteria 1033
932 Ga0501075_0511318 3300049591 Bacteria 916
933 Ga0501076_0041095 3300049592 Bacteria 3636
934 Ga0501076_0241330 3300049592 Bacteria 1478
935 Ga0501076_0278897 3300049592 Bacteria 1369
936 Ga0501077_0000496 3300049593 Bacteria 23850
937 Ga0501077_0070935 3300049593 Bacteria 2208
938 Ga0501077_0076735 3300049593 Bacteria 2117
939 Ga0501198_012171 3300049649 Bacteria 1291
940 Ga0501199_008318 3300049650 Bacteria 1084
941 Ga0501199_031045 3300049650 Bacteria 659
942 Ga0501209_064104 3300049656 Bacteria 1032
943 Ga0501214_002938 3300049659 Bacteria 1475
944 Ga0501216_032379 3300049660 Bacteria 971
945 Ga0501217_032285 3300049661 Bacteria 1295
946 Ga0501217_041562 3300049661 Bacteria 1172
947 Ga0501228_009028 3300049666 Bacteria 967
948 Ga0501230_063880 3300049667 Bacteria 749
949 Ga0501235_054694 3300049669 Bacteria 929
950 Ga0501235_069058 3300049669 Bacteria 834
951 Ga0501239_011135 3300049672 Bacteria 1001
952 Ga0501242_016370 3300049674 Bacteria 929
953 Ga0501249_019940 3300049679 Bacteria 1457
954 Ga0501249_064828 3300049679 Bacteria 849
955 Ga0501253_038702 3300049683 Bacteria 950
956 Ga0501261_037482 3300049690 Bacteria 754
957 Ga0501225_0285626 3300049705 Bacteria 554
958 Ga0501229_028220 3300049706 Bacteria 762
959 Ga0501234_033074 3300049707 Bacteria 838
960 Ga0501079_0001564 3300049741 Bacteria 16235
961 Ga0501079_0013695 3300049741 Bacteria 6184
962 Ga0501079_0095581 3300049741 Bacteria 2303
963 Ga0501079_0139064 3300049741 Bacteria 1891
964 Ga0501079_0154567 3300049741 Bacteria 1788
965 Ga0501079_0215165 3300049741 Bacteria 1501
966 Ga0501079_0822548 3300049741 Bacteria 731
967 Ga0501080_0010181 3300049742 Bacteria 8598
968 Ga0501080_0037842 3300049742 Bacteria 4505
969 Ga0501080_0038695 3300049742 Bacteria 4452
970 Ga0501080_0223618 3300049742 Bacteria 1722
971 Ga0501081_0045796 3300049743 Bacteria 3004
972 Ga0501081_0087256 3300049743 Bacteria 2191
973 Ga0501081_0302177 3300049743 Bacteria 1174
974 Ga0501081_0480124 3300049743 Bacteria 925
975 Ga0501081_0612140 3300049743 Bacteria 816
976 Ga0501081_0627781 3300049743 Bacteria 805
977 Ga0501081_1338769 3300049743 Bacteria 543
978 Ga0501083_0000108 3300049744 Bacteria 55825
979 Ga0501083_0005191 3300049744 Bacteria 9215
980 Ga0501083_0150431 3300049744 Bacteria 1524
981 Ga0501083_0163865 3300049744 Bacteria 1454
982 Ga0501083_0259514 3300049744 Bacteria 1131
983 Ga0501083_0419021 3300049744 Bacteria 871
984 Ga0501083_0491465 3300049744 Bacteria 799
985 Ga0501271_013306 3300049768 Bacteria 900
986 Ga0501273_016619 3300049770 Bacteria 965
987 Ga0501283_008049 3300049779 Bacteria 1513
988 Ga0501035_1020958 3300049822 Bacteria 649
989 Ga0501045_0028718 3300049824 Bacteria 4013
990 Ga0501045_0072414 3300049824 Bacteria 2537
991 Ga0501045_0353307 3300049824 Bacteria 1094
992 Ga0501226_008187 3300049853 Bacteria 1168
993 nmdc:mga05p37_1143769_c1 3300050507 Bacteria 810
994 nmdc:mga05p37_216491_c1 3300050507 Bacteria 2313
995 nmdc:mga05p37_217432_c1 3300050507 Bacteria 2307
996 nmdc:mga05p37_2322_c1 3300050507 Bacteria 22147
997 nmdc:mga05p37_295566_c2 3300050507 Bacteria 1099
998 nmdc:mga05p37_297423_c2 3300050507 Bacteria 1077
999 nmdc:mga05p37_3130_c1 3300050507 Bacteria 19231
1000 nmdc:mga05p37_339778_c1 3300050507 Bacteria 1771
1001 nmdc:mga05p37_58693_c1 3300050507 Bacteria 4224
1002 nmdc:mga05p37_647861_c1 3300050507 Bacteria 1183
1003 nmdc:mga05p37_651502_c1 3300050507 Bacteria 1179
1004 nmdc:mga05p37_719520_c1 3300050507 Bacteria 1106
1005 nmdc:mga05p37_735073_c1 3300050507 Bacteria 1090
1006 nmdc:mga05p37_807385_c1 3300050507 Bacteria 1025
1007 nmdc:mga09592_148760_c1 3300050508 Bacteria 2020
1008 nmdc:mga09592_507763_c1 3300050508 Bacteria 1038
1009 nmdc:mga09592_517386_c1 3300050508 Bacteria 1027
1010 nmdc:mga09592_56658_c1 3300050508 Bacteria 3311
1011 nmdc:mga09592_94953_c1 3300050508 Bacteria 2550
1012 nmdc:mga0qj67_18998_c1 3300050509 Bacteria 5246
1013 nmdc:mga0qj67_42939_c1 3300050509 Bacteria 3560
1014 nmdc:mga0qj67_515849_c1 3300050509 Bacteria 960
1015 nmdc:mga0qj67_604079_c1 3300050509 Bacteria 877
1016 nmdc:mga06r32_110425_c1 3300050510 Bacteria 2705
1017 nmdc:mga06r32_1317109_c1 3300050510 Bacteria 666
1018 nmdc:mga06r32_264419_c1 3300050510 Bacteria 1708
1019 nmdc:mga06r32_35158_c1 3300050510 Bacteria 4728
1020 nmdc:mga06r32_36602_c1 3300050510 Bacteria 4639
1021 nmdc:mga06r32_389731_c1 3300050510 Bacteria 1376
1022 nmdc:mga06r32_444504_c1 3300050510 Bacteria 1276
1023 nmdc:mga06r32_98227_c1 3300050510 Bacteria 2870
1024 nmdc:mga08y16_450830_c1 3300050511 Bacteria 1312
1025 nmdc:mga08y16_888842_c1 3300050511 Bacteria 878
1026 nmdc:mga0n895_1011278_c1 3300050512 Bacteria 812
1027 nmdc:mga0n895_11022_c1 3300050512 Bacteria 8037
1028 nmdc:mga0n895_129893_c1 3300050512 Bacteria 2544
1029 nmdc:mga0n895_14919_c1 3300050512 Bacteria 7076
1030 nmdc:mga0n895_14999_c1 3300050512 Bacteria 7059
1031 nmdc:mga0n895_224532_c1 3300050512 Bacteria 1907
1032 nmdc:mga0n895_480705_c1 3300050512 Bacteria 1253
1033 nmdc:mga0n895_61183_c1 3300050512 Bacteria 3716
1034 nmdc:mga0n895_6120_c1 3300050512 Bacteria 10161
1035 nmdc:mga0n895_643266_c1 3300050512 Bacteria 1060
1036 nmdc:mga0n895_789307_c1 3300050512 Bacteria 941
1037 nmdc:mga0n895_80249_c1 3300050512 Bacteria 3250
1038 nmdc:mga0n895_9918_c1 3300050512 Bacteria 8377
1039 nmdc:mga0rr50_231190_c1 3300050513 Bacteria 1530
1040 nmdc:mga0rr50_267947_c1 3300050513 Bacteria 1422
1041 nmdc:mga0rr50_39050_c1 3300050513 Bacteria 3441
1042 nmdc:mga0rr50_67381_c1 3300050513 Bacteria 2719
1043 nmdc:mga0rr50_767468_c1 3300050513 Bacteria 823
1044 nmdc:mga0rr50_865628_c1 3300050513 Bacteria 771
1045 nmdc:mga08x19_13426_c1 3300050514 Bacteria 4952
1046 nmdc:mga08x19_155718_c1 3300050514 Bacteria 1549
1047 nmdc:mga08x19_23624_c1 3300050514 Bacteria 3815
1048 nmdc:mga08x19_26757_c1 3300050514 Bacteria 3601
1049 nmdc:mga08x19_307177_c1 3300050514 Bacteria 1102
1050 nmdc:mga08x19_317487_c1 3300050514 Bacteria 1084
1051 nmdc:mga08x19_37122_c1 3300050514 Bacteria 3090
1052 nmdc:mga08x19_495803_c1 3300050514 Bacteria 862
1053 nmdc:mga08x19_4984_c1 3300050514 Bacteria 7850
1054 nmdc:mga08x19_56164_c1 3300050514 Bacteria 2540
1055 nmdc:mga0a205_1092862_c1 3300050515 Bacteria 645
1056 nmdc:mga0a205_114816_c1 3300050515 Bacteria 2591
1057 nmdc:mga0a205_2075_c1 3300050515 Bacteria 17529
1058 nmdc:mga0a205_346212_c1 3300050515 Bacteria 1354
1059 nmdc:mga0a205_379546_c1 3300050515 Bacteria 1279
1060 nmdc:mga0a205_473509_c1 3300050515 Bacteria 1111
1061 nmdc:mga0a205_49334_c1 3300050515 Bacteria 4063
1062 nmdc:mga0a205_577196_c1 3300050515 Bacteria 978
1063 nmdc:mga0a205_64246_c1 3300050515 Bacteria 3545
1064 nmdc:mga0a205_74986_c1 3300050515 Bacteria 3268
1065 nmdc:mga0a205_8322_c1 3300050515 Bacteria 9433
1066 nmdc:mga0a205_85093_c1 3300050515 Bacteria 3054
1067 Ga0501084_0004050 3300054114 Bacteria 11935
1068 Ga0501084_0006504 3300054114 Bacteria 9605
1069 Ga0501084_0032290 3300054114 Bacteria 4379
1070 Ga0501084_0035475 3300054114 Bacteria 4169
1071 Ga0501084_0128201 3300054114 Bacteria 2136
1072 Ga0501084_0148231 3300054114 Bacteria 1977
1073 Ga0501084_0564703 3300054114 Bacteria 961
1074 Ga0501084_0640409 3300054114 Bacteria 897
1075 Ga0590071_000860 3300059421 Bacteria 8459
1076 Ga0590071_003713 3300059421 Bacteria 3747
1077 Ga0590071_016843 3300059421 Bacteria 1715
1078 Ga0590074_028343 3300059423 Bacteria 983
1079 Ga0590074_070738 3300059423 Bacteria 657
1080 Ga0590075_007116 3300059424 Bacteria 2654
1081 Ga0590077_005037 3300059426 Bacteria 2701
1082 Ga0590077_018010 3300059426 Bacteria 1489
1083 Ga0501082_0001928 3300060353 Bacteria 18242
1084 Ga0501082_0069154 3300060353 Bacteria 3040
1085 Ga0501082_0106281 3300060353 Bacteria 2428
1086 Ga0501082_0221179 3300060353 Bacteria 1647
1087 Ga0501082_0251093 3300060353 Bacteria 1539
1088 Ga0530510_0084506 3300061734 Bacteria 2312
1089 Ga0530510_0237592 3300061734 Bacteria 1356
1090 Ga0530510_0315775 3300061734 Bacteria 1171
1091 Ga0105249_10951353
1092 JGI24035J26624_1010786
1093 Ga0065704_10309014
1094 Ga0065712_10209844
1095 Ga0065715_10095370
1096 Ga0065715_10114834
1097 Ga0065715_10115624
1098 Ga0065715_10327045
1099 Ga0065707_10106041
1100 Ga0065707_10132388
1101 Ga0065707_10181595
1102 Ga0070676_10004121
1103 Ga0070676_10547162
1104 Ga0070683_100014508
1105 Ga0070683_100063353
1106 Ga0070690_100133236
1107 Ga0070690_100136093
1108 Ga0070670_100567986
1109 Ga0070677_10072422
1110 Ga0068869_100009677
1111 Ga0068869_100490246
1112 Ga0068869_100809023
1113 Ga0068869_101874884
1114 Ga0070666_10134298
1115 Ga0070680_100006769
1116 Ga0070680_100036618
1117 Ga0070680_100055793
1118 Ga0070680_100090003
1119 Ga0070680_100091775
1120 Ga0070680_100239347
1121 Ga0070680_100239467
1122 Ga0070682_101256512
1123 Ga0068868_100453646
1124 Ga0068868_101213331
1125 Ga0070660_100159803
1126 Ga0070660_100964924
1127 Ga0070689_100017388
1128 Ga0070689_100858791
1129 Ga0070691_10036165
1130 Ga0070691_10070855
1131 Ga0070691_10569035
1132 Ga0070687_100145255
1133 Ga0070687_100554344
1134 Ga0070661_100021254
1135 Ga0070661_100199308
1136 Ga0070692_10009037
1137 Ga0070692_10015783
1138 Ga0070668_100018601
1139 Ga0070668_100027586
1140 Ga0070668_100046286
1141 Ga0070668_100206583
1142 Ga0070669_100045882
1143 Ga0070675_100006655
1144 Ga0070675_100099102
1145 Ga0070675_100172341
1146 Ga0070675_100426774
1147 Ga0070671_100007440
1148 Ga0070674_100000493
1149 Ga0070674_100164850
1150 Ga0070673_100072914
1151 Ga0070673_100264996
1152 Ga0070688_100545057
1153 Ga0070659_100041621
1154 Ga0070667_100092416
1155 Ga0070667_101438478
1156 Ga0070703_10000072
1157 Ga0070703_10102537
1158 Ga0070703_10195872
1159 Ga0070709_10001433
1160 Ga0070709_10062745
1161 Ga0070714_100873242
1162 Ga0070710_10493581
1163 Ga0070701_10005809
1164 Ga0070701_10169865
1165 Ga0070711_100000082
1166 Ga0070711_100005417
1167 Ga0070711_100598133
1168 Ga0070705_100000906
1169 Ga0070705_100012045
1170 Ga0070705_100016019
1171 Ga0070705_100068863
1172 Ga0070705_100096133
1173 Ga0070705_100125991
1174 Ga0070705_100135304
1175 Ga0070705_100183332
1176 Ga0070705_101143668
1177 Ga0070700_100083299
1178 Ga0070700_100345248
1179 Ga0070700_100408737
1180 Ga0070700_100463658
1181 Ga0070694_100001018
1182 Ga0070694_100004577
1183 Ga0070694_100005532
1184 Ga0070694_100027910
1185 Ga0070694_100050054
1186 Ga0070694_100065844
1187 Ga0070694_100085467
1188 Ga0070694_100093404
1189 Ga0070694_100310615
1190 Ga0070694_100503751
1191 Ga0070694_100700168
1192 Ga0070694_100807552
1193 Ga0070708_100003233
1194 Ga0070708_100023006
1195 Ga0070708_100037594
1196 Ga0070708_100245675
1197 Ga0070708_100327239
1198 Ga0070708_100327691
1199 Ga0070708_100781670
1200 Ga0070708_100849306
1201 Ga0070708_100996681
1202 Ga0070708_101597443
1203 Ga0070663_100009306
1204 Ga0070663_100030065
1205 Ga0070663_101039097
1206 Ga0070678_100001265
1207 Ga0070678_100040752
1208 Ga0070678_100812073
1209 Ga0070662_100001259
1210 Ga0070662_100085344
1211 Ga0070662_100195401
1212 Ga0070662_100637717
1213 Ga0070681_10028388
1214 Ga0070681_10071107
1215 Ga0070681_10119665
1216 Ga0070681_10183046
1217 Ga0070681_10312731
1218 Ga0070681_10404324
1219 Ga0068867_100003191
1220 Ga0068867_100280972
1221 Ga0068867_100535582
1222 Ga0070685_10446692
1223 Ga0070685_10730011
1224 Ga0070706_100007941
1225 Ga0070706_100008602
1226 Ga0070706_100095328
1227 Ga0070706_100129383
1228 Ga0070706_100173545
1229 Ga0070706_100273128
1230 Ga0070706_100838062
1231 Ga0070707_100004591
1232 Ga0070707_100005123
1233 Ga0070707_100172445
1234 Ga0070707_100222565
1235 Ga0070707_100605886
1236 Ga0070707_100694028
1237 Ga0070707_101063716
1238 Ga0070698_100025822
1239 Ga0070698_100033122
1240 Ga0070698_100047086
1241 Ga0070698_100074111
1242 Ga0070698_100104949
1243 Ga0070698_100249749
1244 Ga0070698_101125985
1245 Ga0070699_100000224
1246 Ga0070699_100005020
1247 Ga0070699_100011684
1248 Ga0070699_100012086
1249 Ga0070699_100021845
1250 Ga0070699_100068944
1251 Ga0070699_100124063
1252 Ga0070699_100202660
1253 Ga0070699_100222103
1254 Ga0070699_100271290
1255 Ga0070699_100327468
1256 Ga0070699_100741950
1257 Ga0070679_100020660
1258 Ga0070679_100084813
1259 Ga0070684_100054200
1260 Ga0070684_100491903
1261 Ga0070684_100851120
1262 Ga0070684_100928975
1263 Ga0070697_100004258
1264 Ga0070697_100005930
1265 Ga0070697_100019221
1266 Ga0070697_100034444
1267 Ga0070697_100048847
1268 Ga0070697_100135019
1269 Ga0070697_100356792
1270 Ga0070697_100379692
1271 Ga0070697_100837747
1272 Ga0070697_100883272
1273 Ga0070697_101485596
1274 Ga0068853_100009430
1275 Ga0068853_100138011
1276 Ga0070672_100024918
1277 Ga0070672_100529364
1278 Ga0070672_101072174
1279 Ga0070686_100025411
1280 Ga0070695_100007340
1281 Ga0070695_100010351
1282 Ga0070695_100017218
1283 Ga0070695_100045386
1284 Ga0070695_100066863
1285 Ga0070695_100085741
1286 Ga0070695_100194506
1287 Ga0070695_100493535
1288 Ga0070695_100965346
1289 Ga0070696_100000364
1290 Ga0070696_100001799
1291 Ga0070696_100022592
1292 Ga0070696_100032798
1293 Ga0070696_100034017
1294 Ga0070696_100072835
1295 Ga0070696_100131235
1296 Ga0070696_100174946
1297 Ga0070696_100183718
1298 Ga0070696_100204369
1299 Ga0070696_100366133
1300 Ga0070693_100014075
1301 Ga0070693_100402846
1302 Ga0070693_101013242
1303 Ga0070665_100091210
1304 Ga0070665_100163868
1305 Ga0070704_100002360
1306 Ga0070704_100002973
1307 Ga0070704_100003943
1308 Ga0070704_100006949
1309 Ga0070704_100009721
1310 Ga0070704_100019216
1311 Ga0070704_100022229
1312 Ga0070704_100041206
1313 Ga0070704_100062277
1314 Ga0070704_100094132
1315 Ga0070704_100308773
1316 Ga0070704_100523133
1317 Ga0068855_100066513
1318 Ga0068855_100090040
1319 Ga0068855_101015322
1320 Ga0070664_100022195
1321 Ga0070664_100086597
1322 Ga0070664_100129406
1323 Ga0070664_100179465
1324 Ga0070664_100897779
1325 Ga0068857_100005311
1326 Ga0068857_100021299
1327 Ga0068854_100002496
1328 Ga0070702_100027307
1329 Ga0070702_100037842
1330 Ga0070702_100212480
1331 Ga0068852_100022866
1332 Ga0068852_100658578
1333 Ga0068859_100040318
1334 Ga0068859_100127109
1335 Ga0068859_100183883
1336 Ga0068864_100003845
1337 Ga0068864_100102023
1338 Ga0068866_10000778
1339 Ga0068861_100006059
1340 Ga0068851_10086507
1341 Ga0068870_10015723
1342 Ga0068863_100068229
1343 Ga0068863_101347728
1344 Ga0068858_100034837
1345 Ga0068858_100496575
1346 Ga0068860_100024836
1347 Ga0068860_100056109
1348 Ga0068862_100002474
1349 Ga0068862_100330474
1350 Ga0068862_102002834
1351 Ga0081455_10036305
1352 Ga0081455_10188084
1353 Ga0081538_10034194
1354 Ga0070717_10087110
1355 Ga0070715_10280650
1356 Ga0070712_100056894
1357 Ga0070712_100178254
1358 Ga0075427_10057744
1359 Ga0075428_100103164
1360 Ga0075428_100190459
1361 Ga0075428_100286426
1362 Ga0075428_101032362
1363 Ga0075430_100008807
1364 Ga0075430_100024844
1365 Ga0075430_100318485
1366 Ga0075430_100752795
1367 Ga0075431_100003686
1368 Ga0075431_100012956
1369 Ga0075431_100081962
1370 Ga0075431_100103689
1371 Ga0075431_100106698
1372 Ga0075431_100106714
1373 Ga0075431_100293814
1374 Ga0075431_100315104
1375 Ga0075431_100471763
1376 Ga0075431_100519809
1377 Ga0075433_10001886
1378 Ga0075433_10032415
1379 Ga0075433_10040219
1380 Ga0075433_10067112
1381 Ga0075433_10110517
1382 Ga0075433_10131723
1383 Ga0075433_10142805
1384 Ga0075433_10174486
1385 Ga0075433_10176607
1386 Ga0075433_10275909
1387 Ga0075433_10562662
1388 Ga0075433_10695203
1389 Ga0075434_100011488
1390 Ga0075434_100018541
1391 Ga0075434_100021559
1392 Ga0075434_100071759
1393 Ga0075434_100101894
1394 Ga0075434_100248070
1395 Ga0075434_100296665
1396 Ga0075434_100337597
1397 Ga0075434_100366959
1398 Ga0075434_100464851
1399 Ga0075434_100494724
1400 Ga0075434_100756001
1401 Ga0075434_100787963
1402 Ga0075429_100057452
1403 Ga0075429_100124543
1404 Ga0075429_100134233
1405 Ga0068865_100004159
1406 Ga0068865_100062382
1407 Ga0075436_100008613
1408 Ga0075436_100011422
1409 Ga0075436_100019596
1410 Ga0075436_100020391
1411 Ga0075436_100032480
1412 Ga0075436_100035530
1413 Ga0075436_100056837
1414 Ga0075436_100070129
1415 Ga0075436_100198915
1416 Ga0075436_100267787
1417 Ga0075436_100549573
1418 Ga0075436_100622910
1419 Ga0097620_100040318
1420 Ga0097620_100127112
1421 Ga0097620_100183889
1422 Ga0075435_100003527
1423 Ga0075435_100124191
1424 Ga0075435_100316241
1425 Ga0075435_100402231
1426 Ga0075435_100450460
1427 Ga0075435_100496981
1428 Ga0075435_100942057
1429 Ga0099794_10000064
1430 Ga0099794_10001130
1431 Ga0099794_10089761
1432 Ga0099794_10204645
1433 Ga0099795_10103849
1434 Ga0105240_10559757
1435 Ga0111539_10185760
1436 Ga0111539_10211482
1437 Ga0111539_10899912
1438 Ga0111539_11278165
1439 Ga0105245_10047748
1440 Ga0105245_10601338
1441 Ga0105247_10235479
1442 Ga0114129_10000112
1443 Ga0114129_10012908
1444 Ga0114129_10083785
1445 Ga0114129_10101686
1446 Ga0114129_10109513
1447 Ga0114129_10305012
1448 Ga0114129_10398208
1449 Ga0114129_10445547
1450 Ga0114129_10567331
1451 Ga0114129_10691980
1452 Ga0114129_11046500
1453 Ga0105243_10003291
1454 Ga0105243_10630342
1455 Ga0105243_10757796
1456 Ga0105243_11023453
1457 Ga0105241_10061050
1458 Ga0105241_10684222
1459 Ga0105242_10020454
1460 Ga0105248_10073091
1461 Ga0105248_10081521
1462 Ga0105248_10134058
1463 Ga0105248_10652471
1464 Ga0105248_10744369
1465 Ga0105237_10264860
1466 Ga0105237_10367939
1467 Ga0105238_10527845
1468 Ga0105238_10805333
1469 Ga0105249_10000078
1470 Ga0105249_10018617
1471 Ga0105249_10054085
1472 Ga0105249_10418459
1473 Ga0105249_10581327
1474 Ga0105249_10783495
1475 Ga0105249_10787827
1476 Ga0105239_10003966
1477 Ga0105239_10141900
1478 Ga0105239_10757922
1479 Ga0105239_11943339
1480 Ga0105246_10004518
1481 Ga0157373_10626966
1482 Ga0157373_11036482
1483 Ga0157371_10003723
1484 Ga0157370_10046071
1485 Ga0157374_10323408
1486 Ga0157378_10000421
1487 Ga0163162_10048371
1488 Ga0163162_10048923
1489 Ga0163162_10069330
1490 Ga0163162_10114855
1491 Ga0157372_10065132
1492 Ga0157372_10206871
1493 Ga0157375_10124783
1494 Ga0157375_10231693
1495 Ga0157375_10510492
1496 Ga0163163_10068187
1497 Ga0163163_10100730
1498 Ga0163163_10113768
1499 Ga0163163_10442060
1500 Ga0163163_10524040
1501 Ga0163163_11030501
1502 Ga0157380_10077056
1503 Ga0157380_10146002
1504 Ga0157380_10334405
1505 Ga0182008_10025812
1506 Ga0182008_10454413
1507 Ga0157377_10011126
1508 Ga0157377_10358861
1509 Ga0157377_10621232
1510 Ga0157377_10885691
1511 Ga0157379_10008398
1512 Ga0157379_10075024
1513 Ga0157379_10250494
1514 Ga0157379_11276192
1515 Ga0157376_10012749
1516 Ga0157376_10095156
1517 Ga0157376_10153520
1518 Ga0157376_11140257
1519 Ga0163161_10054355
1520 Ga0163161_10196759
1521 Ga0163161_10240993
1522 Ga0163161_10244804
1523 Ga0207666_1011230
1524 Ga0207697_10001571
1525 Ga0207653_10000053
1526 Ga0207653_10159372
1527 Ga0207682_10166401
1528 Ga0207642_10006202
1529 Ga0207647_10079640
1530 Ga0207685_10184978
1531 Ga0207699_10016425
1532 Ga0207699_10039505
1533 Ga0207645_10000052
1534 Ga0207643_10044738
1535 Ga0207684_10021988
1536 Ga0207684_10083288
1537 Ga0207684_10103663
1538 Ga0207684_10177364
1539 Ga0207684_10266325
1540 Ga0207684_10284349
1541 Ga0207684_10305664
1542 Ga0207654_10002457
1543 Ga0207707_10000322
1544 Ga0207707_10004621
1545 Ga0207707_10128664
1546 Ga0207707_10223319
1547 Ga0207707_10420683
1548 Ga0207695_10379921
1549 Ga0207693_10251756
1550 Ga0207693_11071085
1551 Ga0207663_10000059
1552 Ga0207663_10058408
1553 Ga0207660_10009265
1554 Ga0207660_10013753
1555 Ga0207660_10108221
1556 Ga0207660_10164164
1557 Ga0207660_10257676
1558 Ga0207662_10011631
1559 Ga0207662_10163705
1560 Ga0207657_10051891
1561 Ga0207657_10325173
1562 Ga0207657_10652458
1563 Ga0207649_10020278
1564 Ga0207649_10397162
1565 Ga0207649_10867197
1566 Ga0207652_10002512
1567 Ga0207652_10026420
1568 Ga0207652_10062405
1569 Ga0207652_10362665
1570 Ga0207652_10400648
1571 Ga0207646_10002302
1572 Ga0207646_10009808
1573 Ga0207646_10015117
1574 Ga0207646_10028311
1575 Ga0207646_10069294
1576 Ga0207646_10155758
1577 Ga0207646_10253284
1578 Ga0207646_10707454
1579 Ga0207681_10038311
1580 Ga0207681_10061754
1581 Ga0207681_10097261
1582 Ga0207650_10065094
1583 Ga0207659_10045341
1584 Ga0207659_10280579
1585 Ga0207659_10728067
1586 Ga0207687_10105118
1587 Ga0207644_10024215
1588 Ga0207690_10110728
1589 Ga0207706_10000233
1590 Ga0207706_10002460
1591 Ga0207706_10314968
1592 Ga0207706_10388835
1593 Ga0207706_10508738
1594 Ga0207686_10000067
1595 Ga0207709_10246527
1596 Ga0207670_10004394
1597 Ga0207669_10050286
1598 Ga0207704_10006365
1599 Ga0207704_10028041
1600 Ga0207665_10085301
1601 Ga0207691_10001361
1602 Ga0207691_10035660
1603 Ga0207691_10116001
1604 Ga0207711_10026644
1605 Ga0207711_10029951
1606 Ga0207711_10070251
1607 Ga0207711_10488942
1608 Ga0207689_10006033
1609 Ga0207689_10019127
1610 Ga0207689_10268628
1611 Ga0207661_10007949
1612 Ga0207661_10170940
1613 Ga0207661_10472093
1614 Ga0207661_10860781
1615 Ga0207661_10864770
1616 Ga0207679_10000491
1617 Ga0207679_10052582
1618 Ga0207679_10288073
1619 Ga0207667_10141025
1620 Ga0207667_10355141
1621 Ga0207651_10056275
1622 Ga0207651_10060359
1623 Ga0207651_10247338
1624 Ga0207712_10000079
1625 Ga0207712_10000422
1626 Ga0207712_10002159
1627 Ga0207712_10120937
1628 Ga0207668_10021280
1629 Ga0207668_10022657
1630 Ga0207668_10034153
1631 Ga0207668_10187272
1632 Ga0207640_10065179
1633 Ga0207658_10027037
1634 Ga0207658_10027256
1635 Ga0207677_10108441
1636 Ga0207703_10307682
1637 Ga0207703_10577108
1638 Ga0207703_11483374
1639 Ga0207639_10049215
1640 Ga0207639_10426083
1641 Ga0207678_10045382
1642 Ga0207678_10137365
1643 Ga0207678_10208550
1644 Ga0207708_10141305
1645 Ga0207708_10218177
1646 Ga0207708_10419169
1647 Ga0207708_10996881
1648 Ga0207641_10028325
1649 Ga0207648_10000030
1650 Ga0207648_11267085
1651 Ga0207676_10004008
1652 Ga0207676_10014848
1653 Ga0207676_10565657
1654 Ga0207674_10001353
1655 Ga0207674_10020675
1656 Ga0207674_10513198
1657 Ga0207675_100000096
1658 Ga0207675_100015444
1659 Ga0207675_100180577
1660 Ga0207675_100882348
1661 Ga0207675_101235129
1662 Ga0207683_10002858
1663 Ga0207683_10409880
1664 Ga0207698_10036693
1665 Ga0209999_1081121
1666 Ga0209983_1042709
1667 Ga0209588_1000171
1668 Ga0209588_1000290
1669 Ga0209974_10031297
1670 Ga0268266_10165570
1671 Ga0268265_10021188
1672 Ga0268265_10532238
1673 Ga0268265_11569783
1674 Ga0268265_11831814
1675 Ga0268264_10036137
1676 Ga0268264_10289553
1677 Ga0268264_11619300
1678 Ga0265325_10302145
1679 Ga0307408_100006769
1680 Ga0307408_100075696
1681 Ga0307408_100107836
1682 Ga0307408_100293843
1683 Ga0307408_101111838
1684 Ga0316575_10032631
1685 Ga0316579_10051296
1686 Ga0316578_10025414
1687 Ga0307405_10046684
1688 Ga0307405_10083556
1689 Ga0307405_10141634
1690 Ga0307405_10339142
1691 Ga0307405_10899054
1692 Ga0307405_10942320
1693 Ga0307413_10002046
1694 Ga0307413_10009285
1695 Ga0307413_10023130
1696 Ga0307413_10097982
1697 Ga0307413_10226495
1698 Ga0307413_10240431
1699 Ga0307410_10005206
1700 Ga0307410_10009013
1701 Ga0307410_10016499
1702 Ga0307410_10027696
1703 Ga0307410_10031076
1704 Ga0307410_10108848
1705 Ga0307406_10054292
1706 Ga0307406_10064968
1707 Ga0307406_10358325
1708 Ga0307406_10397397
1709 Ga0307407_10006430
1710 Ga0307407_10009737
1711 Ga0307407_10207919
1712 Ga0307407_10235925
1713 Ga0307407_11078938
1714 Ga0307412_10032874
1715 Ga0307412_10083663
1716 Ga0307409_100002426
1717 Ga0307409_100010854
1718 Ga0307409_100031677
1719 Ga0307409_100039839
1720 Ga0307409_100097744
1721 Ga0307409_100098415
1722 Ga0307409_100202315
1723 Ga0307409_100344728
1724 Ga0307409_100453512
1725 Ga0307409_100641862
1726 Ga0307409_100911238
1727 Ga0307416_100002505
1728 Ga0307416_100016376
1729 Ga0307416_100036703
1730 Ga0307416_100053123
1731 Ga0307416_100056341
1732 Ga0307416_100071671
1733 Ga0307416_100073971
1734 Ga0307416_100171971
1735 Ga0307416_100570926
1736 Ga0307414_10079838
1737 Ga0307414_10108800
1738 Ga0307414_10186951
1739 Ga0307414_10204495
1740 Ga0307414_10369626
1741 Ga0307414_10473269
1742 Ga0307414_11195964
1743 Ga0307411_10001515
1744 Ga0307411_10006918
1745 Ga0307411_10013846
1746 Ga0307411_10022193
1747 Ga0307411_10067270
1748 Ga0307415_100003453
1749 Ga0307415_100487711
1750 Ga0307415_100673392
1751 Ga0316596_1103036
1752 Ga0373950_0029762
1753 Ga0373958_0070358
1754 Ga0373926_0253992
1755 Ga0373951_0089306
1756 Ga0373939_0070890
1757 Ga0373956_0503591
1758 Ga0373960_0086250
1759 Ga0373955_0245331
1760 Ga0373955_0489630
1761 Ga0373955_0745186
1762 Ga0316574_0031489
1763 Ga0316574_0343722
1764 Ga0373931_0017973
1765 Ga0373931_0179699
1766 Ga0373931_0278421
1767 Ga0373935_0702652
1768 Ga0373937_0087903
1769 Ga0373937_0338383
1770 Ga0316584_0768728
1771 Ga0395905_0092324
1772 Ga0395905_0149844
1773 Ga0242420_000858
1774 Ga0242420_112960
1775 Ga0439461_0063657
1776 Ga0451839_1636063
1777 Ga0451845_0882694
1778 Ga0439448_0061412
1779 Ga0439452_073970
1780 Ga0439462_0061760
1781 Ga0439462_0171214
1782 Ga0450923_020561
1783 Ga0450898_076215
1784 Ga0439446_0025710
1785 Ga0439435_0046691
1786 Ga0439460_0174190
1787 Ga0451577_0016579
1788 Ga0451577_0051331
1789 Ga0451577_0253419
1790 Ga0451577_1136461
1791 Ga0439440_0089031
1792 Ga0453683_0090628
1793 Ga0453683_0094503
1794 Ga0453683_0117468
1795 Ga0453683_0316458
1796 Ga0453683_0325997
1797 Ga0453683_0343042
1798 Ga0453683_1101867
1799 Ga0453684_0000368
1800 Ga0453684_0028508
1801 Ga0453684_0219858
1802 Ga0466960_0157379
1803 Ga0466960_0498668
1804 Ga0451576_0011357
1805 Ga0451576_0015555
1806 Ga0451576_0084072
1807 Ga0451576_0090668
1808 Ga0451576_0321777
1809 Ga0451576_0410607
1810 Ga0451576_0793071
1811 Ga0451576_0936633
1812 Ga0451576_1472869
1813 Ga0451576_2008620
1814 Ga0466967_1039686
1815 Ga0495592_0203849
1816 Ga0495592_0630368
1817 Ga0495603_0031067
1818 Ga0495603_0144897
1819 Ga0495629_0316248
1820 Ga0495629_0379189
1821 Ga0495638_0072958
1822 Ga0495651_0145730
1823 Ga0495651_0468529
1824 Ga0495653_0263903
1825 Ga0495580_0022895
1826 Ga0495580_0318987
1827 Ga0495582_0017485
1828 Ga0495639_0003886
1829 Ga0495639_0285512
1830 Ga0495662_0031055
1831 Ga0495664_0149192
1832 Ga0495664_0332306
1833 Ga0495594_0007516
1834 Ga0495594_0085591
1835 Ga0495594_0246212
1836 Ga0495608_0018686
1837 Ga0495608_0064626
1838 Ga0495608_0409726
1839 Ga0495618_0021654
1840 Ga0495618_0434806
1841 Ga0495628_0074901
1842 Ga0495628_0089850
1843 Ga0495628_0122688
1844 Ga0495628_0792579
1845 Ga0495630_0035765
1846 Ga0495630_0045750
1847 Ga0495630_0566819
1848 Ga0495663_0116580
1849 Ga0495663_0127129
1850 Ga0495666_0000412
1851 Ga0495642_0153766
1852 Ga0495652_0030933
1853 Ga0495652_0368567
1854 Ga0495652_0585302
1855 Ga0495640_0004108
1856 Ga0495640_0039092
1857 Ga0495586_0002073
1858 Ga0495586_0104136
1859 Ga0495587_0022177
1860 Ga0495609_0122974
1861 Ga0495621_0113012
1862 Ga0495645_0184120
1863 Ga0495622_0263033
1864 Ga0495633_0245712
1865 Ga0495667_0071491
1866 Ga0495667_0163432
1867 Ga0495656_0004299
1868 Ga0495634_0039494
1869 Ga0495611_0073438
1870 Ga0495635_0028673
1871 Ga0495635_0455341
1872 Ga0495659_0032250
1873 Ga0495588_0195589
1874 Ga0495599_0153175
1875 Ga0495623_0139534
1876 Ga0495623_0175940
1877 Ga0495646_0087486
1878 Ga0495647_0459901
1879 Ga0495658_0002871
1880 Ga0495669_0148028
1881 Ga0495613_0004856
1882 Ga0495613_0079021
1883 Ga0495624_0028526
1884 Ga0495624_0049571
1885 Ga0495670_0293441
1886 Ga0495670_0426469
1887 Ga0495600_0026746
1888 Ga0495600_0675899
1889 Ga0495604_0139306
1890 Ga0495604_0258852
1891 Ga0495636_0084004
1892 Ga0495674_0010409
1893 Ga0495674_0041030
1894 Ga0495674_0052097
1895 Ga0495676_0309324
1896 Ga0495680_0010113
1897 Ga0495680_0022538
1898 Ga0495675_0061668
1899 Ga0495677_0078183
1900 Ga0495684_0005355
1901 Ga0495684_0061988
1902 Ga0495684_0873408
1903 Ga0495593_0050560
1904 Ga0495602_0171857
1905 Ga0496100_0107846
1906 Ga0496101_0162672
1907 Ga0496101_0479724
1908 Ga0496101_0589812
1909 Ga0496102_0031875
1910 Ga0496102_0040425
1911 Ga0496102_0498409
1912 Ga0496102_0693467
1913 Ga0496102_1292689
1914 Ga0496103_0052541
1915 Ga0496103_0302351
1916 Ga0496103_0543311
1917 Ga0496104_0004047
1918 Ga0496104_0034288
1919 Ga0496104_0095576
1920 Ga0496105_0024919
1921 Ga0496105_0558223
1922 Ga0496106_0044531
1923 Ga0496106_0496875
1924 Ga0496106_0835917
1925 Ga0496106_1008614
1926 Ga0496106_1446029
1927 Ga0496107_0260686
1928 Ga0496107_0761121
1929 Ga0496108_0001015
1930 Ga0496108_0004278
1931 Ga0496108_0025466
1932 Ga0496108_0119206
1933 Ga0496108_0570856
1934 Ga0496109_0001618
1935 Ga0496109_0026171
1936 Ga0496109_0029711
1937 Ga0496109_0413463
1938 Ga0496109_0551608
1939 Ga0496110_0004611
1940 Ga0496110_0043308
1941 Ga0496110_0048749
1942 Ga0496110_0839736
1943 Ga0496111_0065615
1944 Ga0496111_0156626
1945 Ga0496112_0000777
1946 Ga0496112_0001653
1947 Ga0496112_0090310
1948 Ga0496112_0751219
1949 Ga0496113_0000735
1950 Ga0496113_0009041
1951 Ga0496113_0442942
1952 Ga0496114_0530807
1953 Ga0496114_0659513
1954 Ga0496115_0016946
1955 Ga0501291_012103
1956 Ga0501292_017612
1957 Ga0501300_039793
1958 Ga0501303_036150
1959 Ga0501031_0027298
1960 Ga0501031_0352664
1961 Ga0501033_0105418
1962 Ga0501033_0347261
1963 Ga0501033_0407886
1964 Ga0501034_0000957
1965 Ga0501034_0092144
1966 Ga0501038_0751669
1967 Ga0501039_0290308
1968 Ga0501039_0719954
1969 Ga0501040_0099719
1970 Ga0501040_0284827
1971 Ga0501040_0343582
1972 Ga0501041_0011939
1973 Ga0501041_0024948
1974 Ga0501041_0165433
1975 Ga0501041_0254225
1976 Ga0501041_0302042
1977 Ga0501042_0036520
1978 Ga0501042_0125334
1979 Ga0501046_0128973
1980 Ga0501047_0055771
1981 Ga0501048_0077280
1982 Ga0501048_0143098
1983 Ga0501048_0476589
1984 Ga0501067_0001051
1985 Ga0501067_0015493
1986 Ga0501067_0076734
1987 Ga0501067_0162778
1988 Ga0501067_0567663
1989 Ga0501068_0000075
1990 Ga0501068_0002185
1991 Ga0501068_0008876
1992 Ga0501068_0657969
1993 Ga0501069_0000201
1994 Ga0501069_0000583
1995 Ga0501069_0006547
1996 Ga0501069_0008559
1997 Ga0501070_0002218
1998 Ga0501070_0002776
1999 Ga0501070_0027034
2000 Ga0501070_0224342
2001 Ga0501071_0000468
2002 Ga0501071_0001022
2003 Ga0501071_0027346
2004 Ga0501071_0097254
2005 Ga0501071_0473919
2006 Ga0501072_0030811
2007 Ga0501072_0045958
2008 Ga0501072_0100001
2009 Ga0501072_0963984
2010 Ga0501073_0001702
2011 Ga0501073_0010626
2012 Ga0501074_0000981
2013 Ga0501074_0003108
2014 Ga0501074_0265538
2015 Ga0501074_0312834
2016 Ga0501074_0459185
2017 Ga0501075_0028411
2018 Ga0501075_0062151
2019 Ga0501075_0267163
2020 Ga0501075_0272972
2021 Ga0501075_0410308
2022 Ga0501075_0511318
2023 Ga0501076_0041095
2024 Ga0501076_0241330
2025 Ga0501076_0278897
2026 Ga0501077_0000496
2027 Ga0501077_0070935
2028 Ga0501077_0076735
2029 Ga0501198_012171
2030 Ga0501199_008318
2031 Ga0501199_031045
2032 Ga0501209_064104
2033 Ga0501214_002938
2034 Ga0501216_032379
2035 Ga0501217_032285
2036 Ga0501217_041562
2037 Ga0501228_009028
2038 Ga0501230_063880
2039 Ga0501235_054694
2040 Ga0501235_069058
2041 Ga0501239_011135
2042 Ga0501242_016370
2043 Ga0501249_019940
2044 Ga0501249_064828
2045 Ga0501253_038702
2046 Ga0501261_037482
2047 Ga0501225_0285626
2048 Ga0501229_028220
2049 Ga0501234_033074
2050 Ga0501079_0001564
2051 Ga0501079_0013695
2052 Ga0501079_0095581
2053 Ga0501079_0139064
2054 Ga0501079_0154567
2055 Ga0501079_0215165
2056 Ga0501079_0822548
2057 Ga0501080_0010181
2058 Ga0501080_0037842
2059 Ga0501080_0038695
2060 Ga0501080_0223618
2061 Ga0501081_0045796
2062 Ga0501081_0087256
2063 Ga0501081_0302177
2064 Ga0501081_0480124
2065 Ga0501081_0612140
2066 Ga0501081_0627781
2067 Ga0501081_1338769
2068 Ga0501083_0000108
2069 Ga0501083_0005191
2070 Ga0501083_0150431
2071 Ga0501083_0163865
2072 Ga0501083_0259514
2073 Ga0501083_0419021
2074 Ga0501083_0491465
2075 Ga0501271_013306
2076 Ga0501273_016619
2077 Ga0501283_008049
2078 Ga0501035_1020958
2079 Ga0501045_0028718
2080 Ga0501045_0072414
2081 Ga0501045_0353307
2082 Ga0501226_008187
2083 nmdc:mga05p37_1143769_c1
2084 nmdc:mga05p37_216491_c1
2085 nmdc:mga05p37_217432_c1
2086 nmdc:mga05p37_2322_c1
2087 nmdc:mga05p37_295566_c2
2088 nmdc:mga05p37_297423_c2
2089 nmdc:mga05p37_3130_c1
2090 nmdc:mga05p37_339778_c1
2091 nmdc:mga05p37_58693_c1
2092 nmdc:mga05p37_647861_c1
2093 nmdc:mga05p37_651502_c1
2094 nmdc:mga05p37_719520_c1
2095 nmdc:mga05p37_735073_c1
2096 nmdc:mga05p37_807385_c1
2097 nmdc:mga09592_148760_c1
2098 nmdc:mga09592_507763_c1
2099 nmdc:mga09592_517386_c1
2100 nmdc:mga09592_56658_c1
2101 nmdc:mga09592_94953_c1
2102 nmdc:mga0qj67_18998_c1
2103 nmdc:mga0qj67_42939_c1
2104 nmdc:mga0qj67_515849_c1
2105 nmdc:mga0qj67_604079_c1
2106 nmdc:mga06r32_110425_c1
2107 nmdc:mga06r32_1317109_c1
2108 nmdc:mga06r32_264419_c1
2109 nmdc:mga06r32_35158_c1
2110 nmdc:mga06r32_36602_c1
2111 nmdc:mga06r32_389731_c1
2112 nmdc:mga06r32_444504_c1
2113 nmdc:mga06r32_98227_c1
2114 nmdc:mga08y16_450830_c1
2115 nmdc:mga08y16_888842_c1
2116 nmdc:mga0n895_1011278_c1
2117 nmdc:mga0n895_11022_c1
2118 nmdc:mga0n895_129893_c1
2119 nmdc:mga0n895_14919_c1
2120 nmdc:mga0n895_14999_c1
2121 nmdc:mga0n895_224532_c1
2122 nmdc:mga0n895_480705_c1
2123 nmdc:mga0n895_61183_c1
2124 nmdc:mga0n895_6120_c1
2125 nmdc:mga0n895_643266_c1
2126 nmdc:mga0n895_789307_c1
2127 nmdc:mga0n895_80249_c1
2128 nmdc:mga0n895_9918_c1
2129 nmdc:mga0rr50_231190_c1
2130 nmdc:mga0rr50_267947_c1
2131 nmdc:mga0rr50_39050_c1
2132 nmdc:mga0rr50_67381_c1
2133 nmdc:mga0rr50_767468_c1
2134 nmdc:mga0rr50_865628_c1
2135 nmdc:mga08x19_13426_c1
2136 nmdc:mga08x19_155718_c1
2137 nmdc:mga08x19_23624_c1
2138 nmdc:mga08x19_26757_c1
2139 nmdc:mga08x19_307177_c1
2140 nmdc:mga08x19_317487_c1
2141 nmdc:mga08x19_37122_c1
2142 nmdc:mga08x19_495803_c1
2143 nmdc:mga08x19_4984_c1
2144 nmdc:mga08x19_56164_c1
2145 nmdc:mga0a205_1092862_c1
2146 nmdc:mga0a205_114816_c1
2147 nmdc:mga0a205_2075_c1
2148 nmdc:mga0a205_346212_c1
2149 nmdc:mga0a205_379546_c1
2150 nmdc:mga0a205_473509_c1
2151 nmdc:mga0a205_49334_c1
2152 nmdc:mga0a205_577196_c1
2153 nmdc:mga0a205_64246_c1
2154 nmdc:mga0a205_74986_c1
2155 nmdc:mga0a205_8322_c1
2156 nmdc:mga0a205_85093_c1
2157 Ga0501084_0004050
2158 Ga0501084_0006504
2159 Ga0501084_0032290
2160 Ga0501084_0035475
2161 Ga0501084_0128201
2162 Ga0501084_0148231
2163 Ga0501084_0564703
2164 Ga0501084_0640409
2165 Ga0590071_000860
2166 Ga0590071_003713
2167 Ga0590071_016843
2168 Ga0590074_028343
2169 Ga0590074_070738
2170 Ga0590075_007116
2171 Ga0590077_005037
2172 Ga0590077_018010
2173 Ga0501082_0001928
2174 Ga0501082_0069154
2175 Ga0501082_0106281
2176 Ga0501082_0221179
2177 Ga0501082_0251093
2178 Ga0530510_0084506
2179 Ga0530510_0237592
2180 Ga0530510_0315775

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map