metagRoot

F489803

General Info

Members	Datasets	Scaffolds	Average Seq Length
1087	493	978	397

Family's Representative Sequence

Representative Sequence	3300013105\|Ga0157369_10014338\|Ga0157369_100143385
Length	430
Sequence	VIGDATALDRRAGTAILQPRLLNYHSVTREASMTRLAHTPGLTDVQEAILATVREFVTKEIIPHAQRLEHDDTYPADIVDGMREMGLFGLTIDEEYGGLGESLLTYALVVEELARGWMSISGIVNTHFIVAYLVSQHGTAEQKRRLLPRLATGEMRGAFSMSEPGCGSDVAGIRSRAVPDGDGFVLNGQKMWLTNGAYSSVVATLMKTDTGADSVYGNMTTFLLEKEPGFGETAPGLAIPGKIEKMGYKGVETTEMVLDNHSVSAIAVLGGAEGVGRGFYQMMDGIEVGRVNVAARACGIAIRAFELAIGYAQQRQTFGKPLYQHQAIAFKLAEMGTKIEAGHALMVNAARLKDSGQRNDVEAGMAKLLASEYCAEVVQESFRIHGGYGYSKEYEIERLMREAPFLLIGEGTSEIQKTIISRGLLKEYRQ

Samples

	Sample ID	Description	Type	Environment
1	2501939600	Micromonospora sp. L5	Isolate	Unclassified
2	2506783011	Frankia datiscae Dg1	Isolate	Nodule
3	2508501039	Frankia saprophytica CN3	Isolate	Nodule
4	2515154088	Salinispora arenicola CNT800	Isolate	Rhizosphere
5	2515154129	Salinispora pacifica CNS103	Isolate	Rhizosphere
6	2515154137	Salinispora arenicola CNX482	Isolate	Rhizosphere
7	2515154202	Salinispora pacifica CNT084	Isolate	Rhizosphere
8	2515154203	Salinispora arenicola CNR921	Isolate	Rhizosphere
9	2517572101	Frankia sp. DC12	Isolate	Nodule
10	2523231044	Gordonia rhizosphera NBRC 16068	Isolate	Rhizosphere
11	2527291627	Frankia casuarinae Thr	Isolate	Nodule
12	2527291629	Frankia sp. BMG5.23	Isolate	Nodule
13	2546825537	Frankia sp. CcI6	Isolate	Rhizoplane
14	2558860112	Pseudonocardia acaciae DSM 45401	Isolate	Unclassified
15	2558860280	Kutzneria sp. 744	Isolate	Unclassified
16	2576861822	Frankia sp. CeD	Isolate	Nodule
17	2579778521	Frankia torreyi CpI1-S	Isolate	Unclassified
18	2582580736	Prauserella sp. Am3	Isolate	Unclassified
19	2585427649	Amycolatopsis japonica MG417-CF17, DSM 44213	Isolate	Unclassified
20	2619618881	Frankia sp. ACN1ag	Isolate	Unclassified
21	2619619003	Frankia sp. CpI1-P	Isolate	Nodule
22	2622736605	Geodermatophilus ruber DSM 45317	Isolate	Rhizosphere
23	2622736626	Micromonospora rhizosphaerae DSM 45431	Isolate	Rhizosphere
24	2626541554	Frankia sp. AvcI.1	Isolate	Nodule
25	2643221687	Mycobacterium sp. Root135	Isolate	Unclassified
26	2643221715	Mycobacterium sp. Root265	Isolate	Unclassified
27	2671180195	Frankia sp. CcI49	Isolate	Nodule
28	2675902999	Frankia asymbiotica NRRL B-16386	Isolate	Nodule
29	2675903059	Asanoa hainanensis CGMCC 4.5593	Isolate	Rhizosphere
30	2684623035	Frankia sp. NRRL B-16219	Isolate	Rhizosphere
31	2684623036	Frankia sp. CgIM4	Isolate	Nodule
32	2687453737	Frankia sp. BMG5.36	Isolate	Nodule
33	2710264753	Frankia sp. KB5	Isolate	Nodule
34	2738541264	Mycobacterium sp. OK889	Isolate	Unclassified
35	2738541274	Mycobacterium sp. YR708	Isolate	Unclassified
36	2738541356	Mycobacterium sp. OK887	Isolate	Unclassified
37	2738543028	Mycobacterium sp. YR782	Isolate	Unclassified
38	2751185734	Saccharothrix sp. NRRL B-16314	Isolate	Rhizosphere
39	2772190715	Micromonospora chokoriensis NRRL B-24750	Isolate	Unclassified
40	2773857921	Frankia asymbiotica NRRL B-16386	Isolate	Nodule
41	2773857922	Frankia sp. CcI49	Isolate	Nodule
42	2773857924	Frankia sp. CgIS1	Isolate	Nodule
43	2773857933	Frankia sp. BMG5.30	Isolate	Nodule
44	2791354901	Actinophytocola xanthii 11-183	Isolate	Rhizosphere
45	2795385472	Herbihabitans rhizosphaerae DSM 101727	Isolate	Rhizosphere
46	2808606522	Amycolatopsis sp. BJA-103	Isolate	Unclassified
47	2816332139	Pseudonocardia kunmingensis DSM 45301	Isolate	Unclassified
48	2842134933	Mycolicibacterium obuense SEMIA 442	Isolate	Nodule
49	2855020534	Paracoccus endophyticus SYSUP0003	Isolate	Stem Tuber
50	2855670206	Micromonospora noduli Lupac 07	Isolate	Nodule
51	2855676851	Micromonospora saelicesensis GAR05	Isolate	Unclassified
52	2855683550	Micromonospora sp. RP3T	Isolate	Unclassified
53	2856858025	Micromonospora aurantiaca 110B(2018)	Isolate	Unclassified
54	2857288857	Micromonospora noduli ONO23	Isolate	Unclassified
55	2858848962	Micromonospora saelicesensis GAR06	Isolate	Unclassified
56	2858868258	Micromonospora sp. MH33	Isolate	Unclassified
57	2858882152	Micromonospora noduli MED15	Isolate	Nodule
58	2858888857	Micromonospora saelicesensis Lupac 06	Isolate	Unclassified
59	2858895516	Micromonospora saelicesensis PSN13	Isolate	Unclassified
60	2858902515	Micromonospora sp. MW-13	Isolate	Rhizosphere
61	2861520306	Phytomonospora endophytica DSM 45386	Isolate	Unclassified
62	2866612099	Amycolatopsis suaedae 8-3EHSu	Isolate	Unclassified
63	2867302475	Micromonospora globbae WPS1-2	Isolate	Unclassified
64	2867312974	Micromonospora musae NGC1-4	Isolate	Unclassified
65	2867319477	Micromonospora musae MS1-9	Isolate	Unclassified
66	2869048445	Micromonospora saelicesensis PSN01	Isolate	Unclassified
67	2869061728	Micromonospora noduli ONO86	Isolate	Unclassified
68	2869068681	Micromonospora noduli GUI43	Isolate	Unclassified
69	2870721527	Saccharothrix ecbatanensis DSM 45486	Isolate	Rhizosphere
70	2870782633	Pseudonocardia eucalypti DSM 45351	Isolate	Unclassified
71	2880489317	Micromonospora ureilytica DSM 101692	Isolate	Unclassified
72	2880495981	Micromonospora vinacea DSM 101695	Isolate	Unclassified
73	2887478801	Catellatospora paridis NEAU-CL2	Isolate	Rhizosphere
74	2891326441	Actinokineospora pegani TRM65233	Isolate	Unclassified
75	2895880812	Frankia sp. BMG5.11	Isolate	Unclassified
76	2899359706	Amycolatopsis anabasis EGI 650086	Isolate	Unclassified
77	2899370129	Amycolatopsis alkalitolerans SYSUP0005	Isolate	Stem Tuber
78	2902582711	Micromonospora sp. AP08	Isolate	Unclassified
79	2902792274	Mycolicibacterium sp. P9-64	Isolate	Unclassified
80	2902799365	Mycolicibacterium sp. P1-5	Isolate	Unclassified
81	2915768154	Amycolatopsis pittospori PIP199	Isolate	Unclassified
82	2917736166	Amycolatopsis dendrobii DR6-1	Isolate	Unclassified
83	2929212328	Mycolicibacterium sp. R-73050 Hybrid assembly	Isolate	Unclassified
84	2929219909	Micromonospora sp. R-75348 Hybrid assembly	Isolate	Unclassified
85	2929226422	Micromonospora sp. R-74116 Hybrid assembly	Isolate	Unclassified
86	2939582691	Mycolicibacterium sp. 624	Isolate	Rhizosphere
87	2996221748	Micromonospora veneta CAP181	Isolate	Unclassified
88	3002998708	Actinomadura barringtoniae GKU 128	Isolate	Unclassified
89	3300000549	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled	Metagenome	Rhizosphere
90	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
91	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
92	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
93	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
94	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
95	3300002155	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7	Metagenome	Rhizosphere
96	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
97	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
98	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
99	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
100	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
101	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
102	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
103	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
104	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
105	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
106	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
107	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
108	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
109	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
110	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
111	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
112	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
113	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
114	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
115	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
116	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
117	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
118	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
119	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
120	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
121	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
122	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
123	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
124	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
125	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
126	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
127	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
128	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
129	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
130	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
131	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
132	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
133	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
134	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
135	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
136	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
137	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
138	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
139	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
140	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
141	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
142	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
143	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
144	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
145	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
146	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
147	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
148	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
149	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
150	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
151	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
152	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
153	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
154	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
155	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
156	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
157	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
158	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
159	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
160	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
161	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
162	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
163	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
164	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
165	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
166	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
167	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
168	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
169	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
170	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
171	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
172	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
173	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
174	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
175	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
176	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
177	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
178	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
179	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
180	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
181	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
182	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
183	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
184	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
185	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
186	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
187	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
188	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
189	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
190	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
191	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
192	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
193	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
194	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
195	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
196	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
197	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
198	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
199	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
200	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
201	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
202	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
203	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
204	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
205	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
206	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
207	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
208	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
209	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
210	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
211	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
212	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
213	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
214	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
215	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
216	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
217	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
218	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
219	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
220	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
221	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
222	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
223	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
224	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
225	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
226	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
227	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
228	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
284	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
288	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
289	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
290	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
291	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
292	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
293	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
294	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
295	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
296	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
297	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
298	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
299	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
300	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
301	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
302	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
303	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
304	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
305	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
306	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
307	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
308	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
309	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
310	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
311	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
312	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
313	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
314	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
315	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
316	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
317	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
318	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
319	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
320	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
321	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
322	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
323	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
324	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
325	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
326	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
327	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
328	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
329	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
330	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
331	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
332	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
333	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
334	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
335	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
336	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
337	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
338	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
339	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
340	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
341	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
342	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
343	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
344	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
345	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
346	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
347	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
348	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
349	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
350	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
351	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
352	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
353	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
354	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
355	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
356	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
357	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
358	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
359	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
360	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
361	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
362	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
363	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
364	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
365	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
366	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
367	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
368	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
369	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
370	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
371	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
372	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
373	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
374	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
375	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
376	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
377	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
378	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
379	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
380	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
381	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
382	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
383	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
384	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
385	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
386	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
387	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
388	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
389	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
390	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
391	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
392	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
393	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
394	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
395	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
396	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
397	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
398	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
399	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
400	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
401	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
402	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
403	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
404	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
405	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
406	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
407	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
408	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
409	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
410	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
411	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
412	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
413	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
414	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
415	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
416	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
417	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
418	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
419	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
420	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
421	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
422	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
423	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
424	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
425	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
426	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
427	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
428	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
429	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
430	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
431	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
432	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
433	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
434	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
435	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
436	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
437	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
438	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
439	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
440	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
441	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
442	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
443	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
444	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
445	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
446	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
447	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
448	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
449	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
450	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
451	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
452	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
453	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
454	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
455	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
456	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
457	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
458	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
459	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
460	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
461	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
462	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
463	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
464	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
465	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
466	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
467	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
468	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
469	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
470	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
471	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
472	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
473	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
474	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
475	637000116	Frankia casuarinae CcI3	Isolate	Nodule
476	649633069	Micromonospora sp. L5	Isolate	Unclassified
477	8001781756	Catellatospora tritici NEAU-YM18	Isolate	Rhizosphere
478	8002775197	Frankia nepalensis CN7	Isolate	Nodule
479	8002784119	Frankia sp. AgB1.9	Isolate	Nodule
480	8003314358	Amycolatopsis sp. MtRt-6	Isolate	Unclassified
481	8003830390	Micromonospora parastrephiae STR1_7	Isolate	Rhizosphere
482	8003856774	Micromonospora echinofusca MPMI6	Isolate	Unclassified
483	8003870546	Micromonospora tarensis STR1s_6	Isolate	Rhizosphere
484	8047710418	Umezawaea endophytica DSM 103496	Isolate	Unclassified
485	8054472261	Pseudonocardia terrae RS11V-5	Isolate	Rhizosphere
486	8054704163	Micromonospora trifolii NIE79	Isolate	Nodule
487	8054727385	Micromonospora alfalfae MED01	Isolate	Nodule
488	8054734606	Micromonospora hortensis NIE111	Isolate	Nodule
489	8054913762	Frankia gtarii Agncl-10	Isolate	Nodule
490	8054920844	Frankia tisae Agncl-8	Isolate	Nodule
491	8055157932	Frankia umida Ag45/Mut15	Isolate	Nodule
492	8055412473	Micromonospora phytophila DSM 105363	Isolate	Nodule
493	8057568493	Actinorhabdospora filicis NBRC 111898	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	89.33
Metatranscriptomes	0.64
Isolates	10.03

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	5.43
Nodule	2.85
Rhizoplane	8.65
Rhizosphere	70.93
Stem	0
Stem Tuber	0.18
Unclassified	11.96

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	LJQas_1002727	3300000549	Bacteria	2429
2	JGI24739J22299_10039237	3300001989	Bacteria	1587
3	JGI24737J22298_10025874	3300001990	Bacteria	1853
4	JGI24743J22301_10001350	3300001991	Bacteria	3367
5	JGI24735J21928_10007384	3300002067	Bacteria	3587
6	JGI24744J21845_10002473	3300002077	Bacteria	3766
7	JGI24033J26618_1005562	3300002155	Bacteria	1393
8	JGI24034J26672_10001418	3300002239	Bacteria	3179
9	JGI24742J22300_10000583	3300002244	Bacteria	5485
10	JGI25406J46586_10002477	3300003203	Bacteria	8731
11	JGI25406J46586_10024529	3300003203	Bacteria	2360
12	Ga0055540_1000003	3300003792	Bacteria	428375
13	Ga0055540_1000261	3300003792	Bacteria	47645
14	Ga0055540_1002970	3300003792	Bacteria	8507
15	Ga0055540_1016606	3300003792	Bacteria	2087
16	JGI25405J52794_10009820	3300003911	Bacteria	1813
17	Ga0070658_10001192	3300005327	Bacteria	22232
18	Ga0070658_10003430	3300005327	Bacteria	13031
19	Ga0070676_10021409	3300005328	Bacteria	3621
20	Ga0070683_100009730	3300005329	Bacteria	8233
21	Ga0070690_100071686	3300005330	Bacteria	2251
22	Ga0070670_100001154	3300005331	Bacteria	20925
23	Ga0068869_100002993	3300005334	Bacteria	10267
24	Ga0068869_100014710	3300005334	Bacteria	5233
25	Ga0068869_100108312	3300005334	Bacteria	2111
26	Ga0068869_100114859	3300005334	Bacteria	2052
27	Ga0070666_10025034	3300005335	Bacteria	3890
28	Ga0070680_100000297	3300005336	Bacteria	33160
29	Ga0070680_100112545	3300005336	Bacteria	2266
30	Ga0070682_100000335	3300005337	Bacteria	32356
31	Ga0070682_100054424	3300005337	Bacteria	2511
32	Ga0068868_100004268	3300005338	Bacteria	10003
33	Ga0068868_100008435	3300005338	Bacteria	7379
34	Ga0068868_100008450	3300005338	Bacteria	7371
35	Ga0068868_100064065	3300005338	Bacteria	2917
36	Ga0070660_100001969	3300005339	Bacteria	14171
37	Ga0070660_100085916	3300005339	Bacteria	2475
38	Ga0070689_100067656	3300005340	Bacteria	2785
39	Ga0070689_100089896	3300005340	Bacteria	2419
40	Ga0070691_10003837	3300005341	Bacteria	6790
41	Ga0070691_10015402	3300005341	Bacteria	3514
42	Ga0070692_10000043	3300005345	Bacteria	24251
43	Ga0070668_100001102	3300005347	Bacteria	19064
44	Ga0070668_100002458	3300005347	Bacteria	13634
45	Ga0070668_100031527	3300005347	Bacteria	4033
46	Ga0070668_100194534	3300005347	Bacteria	1662
47	Ga0070669_100172314	3300005353	Bacteria	1688
48	Ga0070675_100000578	3300005354	Bacteria	25111
49	Ga0070675_100005371	3300005354	Bacteria	9793
50	Ga0070671_100001349	3300005355	Bacteria	18370
51	Ga0070671_100001748	3300005355	Bacteria	16507
52	Ga0070674_100021522	3300005356	Bacteria	4142
53	Ga0070673_100029092	3300005364	Bacteria	4117
54	Ga0070688_100010150	3300005365	Bacteria	5182
55	Ga0070659_100048536	3300005366	Bacteria	3335
56	Ga0070659_100060152	3300005366	Bacteria	3001
57	Ga0070659_100179378	3300005366	Bacteria	1737
58	Ga0070667_100000087	3300005367	Bacteria	114528
59	Ga0070667_100004630	3300005367	Bacteria	11547
60	Ga0070667_100007753	3300005367	Bacteria	8902
61	Ga0070667_100038520	3300005367	Bacteria	4007
62	Ga0070667_100047658	3300005367	Bacteria	3606
63	Ga0070703_10024660	3300005406	Bacteria	1779
64	Ga0070709_10061429	3300005434	Bacteria	2392
65	Ga0070714_100000057	3300005435	Bacteria	103150
66	Ga0070714_100000701	3300005435	Bacteria	23697
67	Ga0070714_100198913	3300005435	Bacteria	1832
68	Ga0070714_100232497	3300005435	Bacteria	1699
69	Ga0070710_10000110	3300005437	Bacteria	38306
70	Ga0070710_10002992	3300005437	Bacteria	8030
71	Ga0070701_10002400	3300005438	Bacteria	7209
72	Ga0070711_100001653	3300005439	Bacteria	12332
73	Ga0070711_100002316	3300005439	Bacteria	10815
74	Ga0070711_100002351	3300005439	Bacteria	10752
75	Ga0070705_100005450	3300005440	Bacteria	6200
76	Ga0070700_100000031	3300005441	Bacteria	117217
77	Ga0070700_100001352	3300005441	Bacteria	12196
78	Ga0070700_100003917	3300005441	Bacteria	7734
79	Ga0070700_100005474	3300005441	Bacteria	6733
80	Ga0070700_100006150	3300005441	Bacteria	6396
81	Ga0070694_100018471	3300005444	Bacteria	4424
82	Ga0070663_100001468	3300005455	Bacteria	12965
83	Ga0070663_100003006	3300005455	Bacteria	9625
84	Ga0070663_100016296	3300005455	Bacteria	4823
85	Ga0070663_100048175	3300005455	Bacteria	3021
86	Ga0070663_100170063	3300005455	Bacteria	1684
87	Ga0070663_100271223	3300005455	Bacteria	1349
88	Ga0070678_100000372	3300005456	Bacteria	20951
89	Ga0070678_100003411	3300005456	Bacteria	8859
90	Ga0070662_100015433	3300005457	Bacteria	5117
91	Ga0070681_10001041	3300005458	Bacteria	23550
92	Ga0070681_10025473	3300005458	Bacteria	5950
93	Ga0070681_10056346	3300005458	Bacteria	3912
94	Ga0070685_10177846	3300005466	Bacteria	1367
95	Ga0070679_100006559	3300005530	Bacteria	10844
96	Ga0070679_100086354	3300005530	Bacteria	3124
97	Ga0070684_100010145	3300005535	Bacteria	7448
98	Ga0068853_100016915	3300005539	Bacteria	6011
99	Ga0068853_100018399	3300005539	Bacteria	5783
100	Ga0068853_100073150	3300005539	Bacteria	2987
101	Ga0068853_100078561	3300005539	Bacteria	2884
102	Ga0070672_100095272	3300005543	Bacteria	2407
103	Ga0070672_100141087	3300005543	Bacteria	1987
104	Ga0070672_100240741	3300005543	Bacteria	1522
105	Ga0070686_100144858	3300005544	Bacteria	1658
106	Ga0070695_100127130	3300005545	Bacteria	1752
107	Ga0070696_100002982	3300005546	Bacteria	11245
108	Ga0070696_100061054	3300005546	Bacteria	2637
109	Ga0070696_100178864	3300005546	Bacteria	1572
110	Ga0070693_100000246	3300005547	Bacteria	25400
111	Ga0070665_100002158	3300005548	Bacteria	21947
112	Ga0070665_100003039	3300005548	Bacteria	18078
113	Ga0070665_100011089	3300005548	Bacteria	9106
114	Ga0070665_100031876	3300005548	Bacteria	5306
115	Ga0070665_100045698	3300005548	Bacteria	4397
116	Ga0070665_100054609	3300005548	Bacteria	4007
117	Ga0070704_100000113	3300005549	Bacteria	28575
118	Ga0068855_100006282	3300005563	Bacteria	14479
119	Ga0068855_100029171	3300005563	Bacteria	6597
120	Ga0068855_100032959	3300005563	Bacteria	6184
121	Ga0070664_100009850	3300005564	Bacteria	7744
122	Ga0070664_100151040	3300005564	Bacteria	2051
123	Ga0068857_100089002	3300005577	Bacteria	2762
124	Ga0068854_100000637	3300005578	Bacteria	20747
125	Ga0068854_100029847	3300005578	Bacteria	3778
126	Ga0068854_100057853	3300005578	Bacteria	2797
127	Ga0068856_100047641	3300005614	Bacteria	4223
128	Ga0070702_100000639	3300005615	Bacteria	12985
129	Ga0070702_100050915	3300005615	Bacteria	2368
130	Ga0068852_100012774	3300005616	Bacteria	6396
131	Ga0068852_100019689	3300005616	Bacteria	5349
132	Ga0068852_100039518	3300005616	Bacteria	3972
133	Ga0068852_100058283	3300005616	Bacteria	3345
134	Ga0068859_100000291	3300005617	Bacteria	49882
135	Ga0068859_100000301	3300005617	Bacteria	49173
136	Ga0068859_100003956	3300005617	Bacteria	15123
137	Ga0068859_100004810	3300005617	Bacteria	13749
138	Ga0068859_100013254	3300005617	Bacteria	8273
139	Ga0068859_100015017	3300005617	Bacteria	7774
140	Ga0068859_100045625	3300005617	Bacteria	4402
141	Ga0068864_100001934	3300005618	Bacteria	17015
142	Ga0068864_100109298	3300005618	Bacteria	2461
143	Ga0068864_100261526	3300005618	Bacteria	1610
144	Ga0068866_10000435	3300005718	Bacteria	19346
145	Ga0068866_10007493	3300005718	Bacteria	4570
146	Ga0068861_100002086	3300005719	Bacteria	12955
147	Ga0068861_100018749	3300005719	Bacteria	4932
148	Ga0068861_100042769	3300005719	Bacteria	3397
149	Ga0068861_100090221	3300005719	Bacteria	2417
150	Ga0068863_100000163	3300005841	Bacteria	71286
151	Ga0068863_100000179	3300005841	Bacteria	67666
152	Ga0068863_100000580	3300005841	Bacteria	37264
153	Ga0068863_100001505	3300005841	Bacteria	23071
154	Ga0068863_100006453	3300005841	Bacteria	11503
155	Ga0068863_100057846	3300005841	Bacteria	3669
156	Ga0068863_100089506	3300005841	Bacteria	2919
157	Ga0068858_100000010	3300005842	Bacteria	234748
158	Ga0068858_100000071	3300005842	Bacteria	105192
159	Ga0068858_100000362	3300005842	Bacteria	47914
160	Ga0068858_100009793	3300005842	Bacteria	9122
161	Ga0068858_100020931	3300005842	Bacteria	6112
162	Ga0068858_100053123	3300005842	Bacteria	3749
163	Ga0068858_100099585	3300005842	Bacteria	2710
164	Ga0068858_100288793	3300005842	Bacteria	1563
165	Ga0068860_100000020	3300005843	Bacteria	283324
166	Ga0068860_100000345	3300005843	Bacteria	62383
167	Ga0068860_100016544	3300005843	Bacteria	7193
168	Ga0068860_100052772	3300005843	Bacteria	3866
169	Ga0068860_100060595	3300005843	Bacteria	3597
170	Ga0068862_100000013	3300005844	Bacteria	263115
171	Ga0068862_100000049	3300005844	Bacteria	149792
172	Ga0068862_100005089	3300005844	Bacteria	11065
173	Ga0068862_100057251	3300005844	Bacteria	3342
174	Ga0068862_100255275	3300005844	Bacteria	1599
175	Ga0081455_10000288	3300005937	Bacteria	66686
176	Ga0081455_10000436	3300005937	Bacteria	54915
177	Ga0081455_10009880	3300005937	Bacteria	9763
178	Ga0081455_10010864	3300005937	Bacteria	9189
179	Ga0081455_10039401	3300005937	Bacteria	4176
180	Ga0081538_10005232	3300005981	Bacteria	11726
181	Ga0081540_1000602	3300005983	Bacteria	34290
182	Ga0081540_1000710	3300005983	Bacteria	30907
183	Ga0081540_1051424	3300005983	Bacteria	2037
184	Ga0081539_10000094	3300005985	Bacteria	206102
185	Ga0081539_10000882	3300005985	Bacteria	57376
186	Ga0070717_10001308	3300006028	Bacteria	17047
187	Ga0070717_10072787	3300006028	Bacteria	2870
188	Ga0075365_10019566	3300006038	Bacteria	4182
189	Ga0075365_10023310	3300006038	Bacteria	3892
190	Ga0075365_10028336	3300006038	Bacteria	3572
191	Ga0075363_100000409	3300006048	Bacteria	13240
192	Ga0075363_100004494	3300006048	Bacteria	6113
193	Ga0075363_100014025	3300006048	Bacteria	3903
194	Ga0075363_100014723	3300006048	Bacteria	3830
195	Ga0075363_100073713	3300006048	Bacteria	1858
196	Ga0075364_10001494	3300006051	Bacteria	12733
197	Ga0075364_10006497	3300006051	Bacteria	6873
198	Ga0075364_10010332	3300006051	Bacteria	5634
199	Ga0075364_10017355	3300006051	Bacteria	4495
200	Ga0075432_10010849	3300006058	Bacteria	3096
201	Ga0070716_100001095	3300006173	Bacteria	11898
202	Ga0070716_100105017	3300006173	Bacteria	1740
203	Ga0070712_100003765	3300006175	Bacteria	9344
204	Ga0070712_100005974	3300006175	Bacteria	7527
205	Ga0075369_10004499	3300006186	Bacteria	5155
206	Ga0075369_10024999	3300006186	Bacteria	2480
207	Ga0075369_10034936	3300006186	Bacteria	2135
208	Ga0075366_10147537	3300006195	Bacteria	1424
209	Ga0097621_100009134	3300006237	Bacteria	7184
210	Ga0097621_100025930	3300006237	Bacteria	4592
211	Ga0075370_10022693	3300006353	Bacteria	3449
212	Ga0075370_10027158	3300006353	Bacteria	3175
213	Ga0075370_10031037	3300006353	Bacteria	2983
214	Ga0075428_100001458	3300006844	Bacteria	25308
215	Ga0075428_100161048	3300006844	Bacteria	2436
216	Ga0075428_100189572	3300006844	Bacteria	2224
217	Ga0075430_100005427	3300006846	Bacteria	10772
218	Ga0075430_100022533	3300006846	Bacteria	5360
219	Ga0075431_100074231	3300006847	Bacteria	3509
220	Ga0075433_10106885	3300006852	Bacteria	2481
221	Ga0075434_100015313	3300006871	Bacteria	7350
222	Ga0075434_100019371	3300006871	Bacteria	6585
223	Ga0075429_100033163	3300006880	Bacteria	4486
224	Ga0075429_100121583	3300006880	Bacteria	2282
225	Ga0068865_100006274	3300006881	Bacteria	7238
226	Ga0068865_100069746	3300006881	Bacteria	2488
227	Ga0075436_100007851	3300006914	Bacteria	7300
228	Ga0075436_100072828	3300006914	Bacteria	2377
229	Ga0097620_100000291	3300006931	Bacteria	49882
230	Ga0097620_100000301	3300006931	Bacteria	49173
231	Ga0097620_100003956	3300006931	Bacteria	15123
232	Ga0097620_100004810	3300006931	Bacteria	13749
233	Ga0097620_100013254	3300006931	Bacteria	8273
234	Ga0097620_100015017	3300006931	Bacteria	7774
235	Ga0097620_100045625	3300006931	Bacteria	4402
236	Ga0075435_100002890	3300007076	Bacteria	11524
237	Ga0075435_100007664	3300007076	Bacteria	7710
238	Ga0099795_10040891	3300007788	Bacteria	1649
239	Ga0105250_10049852	3300009092	Bacteria	1680
240	Ga0105240_10119840	3300009093	Bacteria	3169
241	Ga0105240_10122665	3300009093	Bacteria	3127
242	Ga0105240_10236659	3300009093	Bacteria	2119
243	Ga0111539_10000482	3300009094	Bacteria	50429
244	Ga0111539_10004560	3300009094	Bacteria	18110
245	Ga0111539_10387616	3300009094	Bacteria	1627
246	Ga0105245_10001247	3300009098	Bacteria	22970
247	Ga0105245_10080568	3300009098	Bacteria	2975
248	Ga0105245_10090761	3300009098	Bacteria	2811
249	Ga0105245_10217265	3300009098	Bacteria	1843
250	Ga0105247_10000009	3300009101	Bacteria	385991
251	Ga0105247_10000111	3300009101	Bacteria	83418
252	Ga0105247_10000834	3300009101	Bacteria	23420
253	Ga0105247_10002038	3300009101	Bacteria	13982
254	Ga0105247_10007205	3300009101	Bacteria	6826
255	Ga0114129_10000114	3300009147	Bacteria	80730
256	Ga0114129_10000585	3300009147	Bacteria	44984
257	Ga0114129_10021079	3300009147	Bacteria	9254
258	Ga0114129_10054519	3300009147	Bacteria	5605
259	Ga0114129_10230478	3300009147	Bacteria	2494
260	Ga0114129_10363980	3300009147	Bacteria	1913
261	Ga0105243_10001881	3300009148	Bacteria	17882
262	Ga0105243_10043836	3300009148	Bacteria	3507
263	Ga0105243_10149133	3300009148	Bacteria	2004
264	Ga0105241_10001137	3300009174	Bacteria	20251
265	Ga0105242_10000766	3300009176	Bacteria	24993
266	Ga0105242_10062239	3300009176	Bacteria	3071
267	Ga0105248_10000147	3300009177	Bacteria	81699
268	Ga0105248_10000207	3300009177	Bacteria	67863
269	Ga0105248_10000377	3300009177	Bacteria	52002
270	Ga0105248_10000450	3300009177	Bacteria	46809
271	Ga0105248_10004117	3300009177	Bacteria	16088
272	Ga0105248_10018906	3300009177	Bacteria	7618
273	Ga0105248_10028235	3300009177	Bacteria	6250
274	Ga0105248_10069913	3300009177	Bacteria	3942
275	Ga0105248_10133451	3300009177	Bacteria	2801
276	Ga0105248_10285059	3300009177	Bacteria	1860
277	Ga0105248_10401555	3300009177	Bacteria	1543
278	Ga0105237_10006936	3300009545	Bacteria	12486
279	Ga0105237_10042790	3300009545	Bacteria	4565
280	Ga0105237_10302090	3300009545	Bacteria	1604
281	Ga0105237_10374459	3300009545	Bacteria	1429
282	Ga0105238_10008912	3300009551	Bacteria	10041
283	Ga0105238_10032836	3300009551	Bacteria	5283
284	Ga0105238_10109655	3300009551	Bacteria	2741
285	Ga0105249_10000057	3300009553	Bacteria	159358
286	Ga0105249_10004171	3300009553	Bacteria	12481
287	Ga0105249_10011423	3300009553	Bacteria	7800
288	Ga0105249_10022525	3300009553	Bacteria	5644
289	Ga0105249_10129991	3300009553	Bacteria	2403
290	Ga0105249_10143452	3300009553	Bacteria	2292
291	Ga0105239_10001572	3300010375	Bacteria	30160
292	Ga0105239_10050445	3300010375	Bacteria	4564
293	Ga0105239_10053915	3300010375	Bacteria	4409
294	Ga0105239_10073274	3300010375	Bacteria	3765
295	Ga0105239_10144029	3300010375	Bacteria	2657
296	Ga0105239_10307076	3300010375	Bacteria	1787
297	Ga0105246_10016685	3300011119	Bacteria	4654
298	Ga0105246_10018512	3300011119	Bacteria	4441
299	Ga0157371_10007484	3300013102	Bacteria	8837
300	Ga0157370_10002735	3300013104	Bacteria	21092
301	Ga0157370_10018215	3300013104	Bacteria	7066
302	Ga0157370_10064903	3300013104	Bacteria	3455
303	Ga0157369_10014338	3300013105	Bacteria	8950
304	Ga0157369_10019224	3300013105	Bacteria	7644
305	Ga0157374_10030500	3300013296	Bacteria	4896
306	Ga0157374_10123689	3300013296	Bacteria	2499
307	Ga0157378_10000831	3300013297	Bacteria	28691
308	Ga0157378_10076761	3300013297	Bacteria	3011
309	Ga0163162_10062818	3300013306	Bacteria	3755
310	Ga0163162_10066269	3300013306	Bacteria	3660
311	Ga0163162_10086860	3300013306	Bacteria	3206
312	Ga0157372_10000023	3300013307	Bacteria	198536
313	Ga0157372_10008689	3300013307	Bacteria	10787
314	Ga0157372_10631504	3300013307	Bacteria	1248
315	Ga0157375_10034872	3300013308	Bacteria	4797
316	Ga0157375_10044455	3300013308	Bacteria	4316
317	Ga0163163_10005277	3300014325	Bacteria	11151
318	Ga0163163_10039757	3300014325	Bacteria	4592
319	Ga0163163_10179325	3300014325	Bacteria	2165
320	Ga0157380_10001997	3300014326	Bacteria	13587
321	Ga0157377_10000649	3300014745	Bacteria	14517
322	Ga0157377_10005999	3300014745	Bacteria	5756
323	Ga0157379_10000015	3300014968	Bacteria	104289
324	Ga0157379_10000149	3300014968	Bacteria	51280
325	Ga0157379_10007816	3300014968	Bacteria	9260
326	Ga0157379_10058232	3300014968	Bacteria	3454
327	Ga0157379_10132060	3300014968	Bacteria	2248
328	Ga0157376_10028847	3300014969	Bacteria	4415
329	Ga0163161_10000872	3300017792	Bacteria	23503
330	Ga0163161_10005938	3300017792	Bacteria	8463
331	Ga0197907_10161669	3300020069	Bacteria	2116
332	Ga0206356_10255926	3300020070	Bacteria	1444
333	Ga0206356_10857683	3300020070	Bacteria	1335
334	Ga0206353_11500815	3300020082	Bacteria	3132
335	Ga0154015_1696953	3300020610	Bacteria	1560
336	Ga0213873_10000086	3300021358	Bacteria	19214
337	Ga0213876_10001258	3300021384	Bacteria	15988
338	Ga0213876_10012466	3300021384	Bacteria	4525
339	Ga0213875_10000111	3300021388	Bacteria	92836
340	Ga0213875_10018826	3300021388	Bacteria	3325
341	Ga0224712_10050376	3300022467	Bacteria	1617
342	Ga0224712_10056534	3300022467	Bacteria	1547
343	Ga0209673_1007257	3300025273	Bacteria	5149
344	Ga0209051_1000011	3300025303	Bacteria	610828
345	Ga0209051_1006016	3300025303	Bacteria	6934
346	Ga0209051_1013644	3300025303	Bacteria	3850
347	Ga0209051_1016811	3300025303	Bacteria	3289
348	Ga0207692_10000457	3300025898	Bacteria	14468
349	Ga0207692_10012087	3300025898	Bacteria	3697
350	Ga0207642_10001854	3300025899	Bacteria	6522
351	Ga0207710_10000014	3300025900	Bacteria	408072
352	Ga0207710_10000107	3300025900	Bacteria	105449
353	Ga0207710_10000144	3300025900	Bacteria	82093
354	Ga0207710_10004379	3300025900	Bacteria	6167
355	Ga0207710_10010119	3300025900	Bacteria	3968
356	Ga0207688_10000698	3300025901	Bacteria	16565
357	Ga0207688_10000946	3300025901	Bacteria	14709
358	Ga0207688_10001700	3300025901	Bacteria	11678
359	Ga0207688_10008927	3300025901	Bacteria	5455
360	Ga0207647_10043676	3300025904	Bacteria	2803
361	Ga0207647_10100957	3300025904	Bacteria	1712
362	Ga0207645_10015307	3300025907	Bacteria	5100
363	Ga0207643_10000326	3300025908	Bacteria	32686
364	Ga0207705_10014614	3300025909	Bacteria	5649
365	Ga0207705_10015019	3300025909	Bacteria	5567
366	Ga0207705_10016235	3300025909	Bacteria	5339
367	Ga0207654_10003544	3300025911	Bacteria	7893
368	Ga0207707_10001022	3300025912	Bacteria	26886
369	Ga0207707_10033830	3300025912	Bacteria	4473
370	Ga0207695_10027320	3300025913	Bacteria	6356
371	Ga0207671_10040499	3300025914	Bacteria	3449
372	Ga0207693_10000949	3300025915	Bacteria	25987
373	Ga0207693_10001079	3300025915	Bacteria	24466
374	Ga0207693_10007135	3300025915	Bacteria	9218
375	Ga0207663_10000777	3300025916	Bacteria	14291
376	Ga0207663_10116149	3300025916	Bacteria	1824
377	Ga0207660_10000404	3300025917	Bacteria	28485
378	Ga0207660_10001049	3300025917	Bacteria	18301
379	Ga0207660_10038877	3300025917	Bacteria	3324
380	Ga0207662_10212455	3300025918	Bacteria	1256
381	Ga0207657_10001506	3300025919	Bacteria	24916
382	Ga0207657_10038718	3300025919	Bacteria	4241
383	Ga0207657_10045558	3300025919	Bacteria	3848
384	Ga0207657_10070030	3300025919	Bacteria	2974
385	Ga0207649_10005345	3300025920	Bacteria	6953
386	Ga0207649_10036106	3300025920	Bacteria	2974
387	Ga0207652_10000717	3300025921	Bacteria	32120
388	Ga0207652_10027502	3300025921	Bacteria	4739
389	Ga0207650_10004876	3300025925	Bacteria	9168
390	Ga0207659_10000900	3300025926	Bacteria	17696
391	Ga0207659_10001150	3300025926	Bacteria	15753
392	Ga0207659_10099159	3300025926	Bacteria	2193
393	Ga0207687_10001698	3300025927	Bacteria	15171
394	Ga0207687_10007403	3300025927	Bacteria	7227
395	Ga0207687_10013866	3300025927	Bacteria	5264
396	Ga0207687_10016988	3300025927	Bacteria	4783
397	Ga0207687_10114634	3300025927	Bacteria	2006
398	Ga0207700_10120108	3300025928	Bacteria	2130
399	Ga0207664_10000002	3300025929	Bacteria	657053
400	Ga0207664_10000641	3300025929	Bacteria	24306
401	Ga0207644_10001436	3300025931	Bacteria	15349
402	Ga0207644_10012147	3300025931	Bacteria	5714
403	Ga0207644_10058447	3300025931	Bacteria	2787
404	Ga0207690_10149025	3300025932	Bacteria	1733
405	Ga0207706_10002283	3300025933	Bacteria	18697
406	Ga0207706_10024221	3300025933	Bacteria	5442
407	Ga0207706_10099658	3300025933	Bacteria	2556
408	Ga0207686_10004275	3300025934	Bacteria	7657
409	Ga0207686_10015402	3300025934	Bacteria	4275
410	Ga0207709_10008902	3300025935	Bacteria	5542
411	Ga0207709_10022088	3300025935	Bacteria	3607
412	Ga0207669_10000486	3300025937	Bacteria	17262
413	Ga0207704_10008655	3300025938	Bacteria	4878
414	Ga0207665_10001059	3300025939	Bacteria	18515
415	Ga0207665_10001980	3300025939	Bacteria	13800
416	Ga0207665_10002449	3300025939	Bacteria	12529
417	Ga0207691_10042385	3300025940	Bacteria	4196
418	Ga0207691_10053103	3300025940	Bacteria	3701
419	Ga0207711_10000056	3300025941	Bacteria	135485
420	Ga0207711_10000242	3300025941	Bacteria	58458
421	Ga0207711_10000967	3300025941	Bacteria	27498
422	Ga0207711_10010080	3300025941	Bacteria	7856
423	Ga0207711_10011062	3300025941	Bacteria	7500
424	Ga0207711_10042651	3300025941	Bacteria	3866
425	Ga0207689_10021188	3300025942	Bacteria	5465
426	Ga0207689_10034419	3300025942	Bacteria	4208
427	Ga0207689_10058656	3300025942	Bacteria	3166
428	Ga0207689_10083825	3300025942	Bacteria	2621
429	Ga0207689_10119121	3300025942	Bacteria	2172
430	Ga0207661_10007868	3300025944	Bacteria	7597
431	Ga0207661_10025555	3300025944	Bacteria	4490
432	Ga0207679_10000518	3300025945	Bacteria	26169
433	Ga0207679_10001380	3300025945	Bacteria	15313
434	Ga0207679_10145844	3300025945	Bacteria	1919
435	Ga0207667_10018101	3300025949	Bacteria	7909
436	Ga0207667_10052382	3300025949	Bacteria	4298
437	Ga0207712_10000050	3300025961	Bacteria	159469
438	Ga0207712_10005038	3300025961	Bacteria	8360
439	Ga0207712_10012050	3300025961	Bacteria	5521
440	Ga0207712_10042846	3300025961	Bacteria	3120
441	Ga0207668_10000733	3300025972	Bacteria	20083
442	Ga0207668_10001475	3300025972	Bacteria	13792
443	Ga0207668_10008379	3300025972	Bacteria	6159
444	Ga0207668_10262669	3300025972	Bacteria	1407
445	Ga0207640_10002229	3300025981	Bacteria	10431
446	Ga0207640_10002522	3300025981	Bacteria	9819
447	Ga0207658_10000065	3300025986	Bacteria	117079
448	Ga0207658_10002834	3300025986	Bacteria	12422
449	Ga0207658_10003413	3300025986	Bacteria	11248
450	Ga0207658_10041531	3300025986	Bacteria	3331
451	Ga0207658_10053391	3300025986	Bacteria	2986
452	Ga0207677_10004713	3300026023	Bacteria	7347
453	Ga0207677_10027108	3300026023	Bacteria	3603
454	Ga0207703_10000002	3300026035	Bacteria	600711
455	Ga0207703_10000094	3300026035	Bacteria	104297
456	Ga0207703_10006889	3300026035	Bacteria	9050
457	Ga0207703_10026958	3300026035	Bacteria	4526
458	Ga0207703_10056971	3300026035	Bacteria	3185
459	Ga0207703_10080017	3300026035	Bacteria	2721
460	Ga0207703_10104289	3300026035	Bacteria	2409
461	Ga0207639_10043174	3300026041	Bacteria	3383
462	Ga0207639_10055464	3300026041	Bacteria	3033
463	Ga0207678_10000377	3300026067	Bacteria	40712
464	Ga0207678_10003800	3300026067	Bacteria	13579
465	Ga0207678_10006924	3300026067	Bacteria	10061
466	Ga0207678_10042150	3300026067	Bacteria	3956
467	Ga0207678_10046245	3300026067	Bacteria	3763
468	Ga0207708_10000046	3300026075	Bacteria	116515
469	Ga0207708_10002058	3300026075	Bacteria	14815
470	Ga0207708_10004173	3300026075	Bacteria	10619
471	Ga0207708_10019544	3300026075	Bacteria	5108
472	Ga0207708_10027529	3300026075	Bacteria	4304
473	Ga0207702_10000541	3300026078	Bacteria	42221
474	Ga0207702_10429416	3300026078	Bacteria	1279
475	Ga0207641_10000562	3300026088	Bacteria	41565
476	Ga0207641_10000740	3300026088	Bacteria	35113
477	Ga0207641_10014236	3300026088	Bacteria	6517
478	Ga0207641_10019865	3300026088	Bacteria	5512
479	Ga0207641_10038076	3300026088	Bacteria	4020
480	Ga0207641_10170786	3300026088	Bacteria	1984
481	Ga0207648_10002377	3300026089	Bacteria	20269
482	Ga0207648_10077267	3300026089	Bacteria	2902
483	Ga0207676_10002174	3300026095	Bacteria	14145
484	Ga0207676_10111309	3300026095	Bacteria	2291
485	Ga0207674_10001847	3300026116	Bacteria	26995
486	Ga0207674_10006778	3300026116	Bacteria	13439
487	Ga0207674_10019724	3300026116	Bacteria	7298
488	Ga0207674_10064844	3300026116	Bacteria	3684
489	Ga0207674_10077418	3300026116	Bacteria	3331
490	Ga0207674_10177825	3300026116	Bacteria	2080
491	Ga0207675_100001291	3300026118	Bacteria	25101
492	Ga0207675_100045219	3300026118	Bacteria	4114
493	Ga0207675_100110916	3300026118	Bacteria	2588
494	Ga0207683_10000634	3300026121	Bacteria	32125
495	Ga0207683_10000738	3300026121	Bacteria	29767
496	Ga0207683_10003326	3300026121	Bacteria	14009
497	Ga0207683_10009633	3300026121	Bacteria	8232
498	Ga0207698_10008276	3300026142	Bacteria	6567
499	Ga0207698_10052324	3300026142	Bacteria	3128
500	Ga0207698_10135667	3300026142	Bacteria	2111
501	Ga0207698_10187647	3300026142	Bacteria	1838
502	Ga0207428_10002331	3300027907	Bacteria	19015
503	Ga0207428_10088600	3300027907	Bacteria	2407
504	Ga0268266_10010107	3300028379	Bacteria	8273
505	Ga0268266_10016725	3300028379	Bacteria	6271
506	Ga0268266_10062421	3300028379	Bacteria	3216
507	Ga0268266_10110017	3300028379	Bacteria	2440
508	Ga0268266_10285149	3300028379	Bacteria	1537
509	Ga0268265_10000004	3300028380	Bacteria	648376
510	Ga0268265_10000017	3300028380	Bacteria	293875
511	Ga0268265_10005435	3300028380	Bacteria	8709
512	Ga0268264_10000024	3300028381	Bacteria	470081
513	Ga0268264_10000257	3300028381	Bacteria	96251
514	Ga0268264_10002508	3300028381	Bacteria	16141
515	Ga0268264_10003187	3300028381	Bacteria	14212
516	Ga0268264_10081549	3300028381	Bacteria	2765
517	Ga0265319_1011896	3300028563	Bacteria	3540
518	Ga0265336_10005066	3300028666	Bacteria	4903
519	Ga0307515_10008569	3300028794	Bacteria	19910
520	Ga0307515_10099199	3300028794	Bacteria	3538
521	Ga0307515_10170971	3300028794	Bacteria	2166
522	Ga0265338_10000745	3300028800	Bacteria	55424
523	Ga0307511_10027297	3300030521	Bacteria	5217
524	Ga0307511_10147330	3300030521	Bacteria	1363
525	Ga0307512_10036831	3300030522	Bacteria	4142
526	Ga0316177_1052337	3300030731	Bacteria	3726
527	Ga0314311_1180288	3300030733	Bacteria	4550
528	Ga0265327_10009371	3300031251	Bacteria	7075
529	Ga0307513_10013296	3300031456	Bacteria	10107
530	Ga0307513_10057511	3300031456	Bacteria	4142
531	Ga0307509_10261448	3300031507	Bacteria	1506
532	Ga0307408_100077423	3300031548	Bacteria	2476
533	Ga0307508_10093651	3300031616	Bacteria	2594
534	Ga0316578_10043764	3300031728	Bacteria	2602
535	Ga0307516_10000999	3300031730	Bacteria	39119
536	Ga0307405_10019059	3300031731	Bacteria	3801
537	Ga0307413_10000893	3300031824	Bacteria	10543
538	Ga0307413_10039074	3300031824	Bacteria	2756
539	Ga0307518_10000618	3300031838	Bacteria	26718
540	Ga0307518_10014471	3300031838	Bacteria	5640
541	Ga0307410_10008087	3300031852	Bacteria	5810
542	Ga0307406_10013548	3300031901	Bacteria	4673
543	Ga0307406_10122790	3300031901	Bacteria	1809
544	Ga0307412_10042207	3300031911	Bacteria	2962
545	Ga0307409_100000369	3300031995	Bacteria	18914
546	Ga0307409_100218696	3300031995	Bacteria	1718
547	Ga0307416_100001881	3300032002	Bacteria	11711
548	Ga0307416_100011301	3300032002	Bacteria	5941
549	Ga0307416_100025892	3300032002	Bacteria	4312
550	Ga0307416_100088103	3300032002	Bacteria	2653
551	Ga0307416_100132268	3300032002	Bacteria	2249
552	Ga0307414_10070978	3300032004	Bacteria	2510
553	Ga0307411_10018384	3300032005	Bacteria	4008
554	Ga0307411_10033278	3300032005	Bacteria	3196
555	Ga0307415_100000012	3300032126	Bacteria	84249
556	Ga0307415_100077551	3300032126	Bacteria	2360
557	Ga0307507_10004395	3300033179	Bacteria	25121
558	Ga0307507_10055651	3300033179	Bacteria	3746
559	Ga0307510_10022164	3300033180	Bacteria	7383
560	Ga0373929_0006036	3300035085	Bacteria	2188
561	Ga0373940_0001450	3300035088	Bacteria	4296
562	Ga0373936_0024454	3300035113	Bacteria	2358
563	Ga0373956_0000258	3300035119	Bacteria	21190
564	Ga0373957_0019558	3300035120	Bacteria	2384
565	Ga0373960_0016902	3300035121	Bacteria	1883
566	Ga0373931_0006845	3300035691	Bacteria	5362
567	Ga0373931_0019651	3300035691	Bacteria	3374
568	Ga0373931_0119669	3300035691	Bacteria	1504
569	Ga0373927_0039947	3300035695	Bacteria	3044
570	Ga0373937_0131387	3300036401	Bacteria	2338
571	Ga0373925_0089855	3300037068	Bacteria	2347
572	Ga0373925_0229357	3300037068	Bacteria	1484
573	Ga0395900_0048293	3300037418	Bacteria	4384
574	Ga0395898_0026569	3300037466	Bacteria	5822
575	Ga0395905_0020862	3300037471	Bacteria	6204
576	Ga0436364_0155073	3300037853	Bacteria	2064
577	Ga0436364_0284917	3300037853	Bacteria	21290
578	Ga0436364_0296067	3300037853	Bacteria	138817
579	Ga0436364_1031907	3300037853	Bacteria	102112
580	Ga0436364_1038490	3300037853	Bacteria	8940
581	Ga0436364_1406310	3300037853	Bacteria	13026
582	Ga0436364_1554479	3300037853	Bacteria	21396
583	Ga0395901_0028510	3300038443	Bacteria	5741
584	Ga0395901_0147327	3300038443	Bacteria	2474
585	Ga0436365_1354167	3300039437	Bacteria	9239
586	Ga0436365_1453781	3300039437	Bacteria	4885
587	Ga0436365_1605762	3300039437	Bacteria	5318
588	Ga0436365_1607916	3300039437	Bacteria	4808
589	Ga0436365_1889369	3300039437	Bacteria	169293
590	Ga0436363_0578534	3300039450	Bacteria	3342
591	Ga0436363_1446743	3300039450	Bacteria	1534
592	Ga0436362_0218630	3300039453	Bacteria	40774
593	Ga0439465_0018051	3300041413	Bacteria	2204
594	Ga0451789_0707078	3300041443	Bacteria	1911
595	Ga0451853_3429478	3300041512	Bacteria	5980
596	Ga0439445_0004151	3300042004	Bacteria	3273
597	Ga0439448_0028867	3300042005	Bacteria	1754
598	Ga0439463_001998	3300042016	Bacteria	5304
599	Ga0439434_0002590	3300042435	Bacteria	5265
600	Ga0439435_0003483	3300042436	Bacteria	3280
601	Ga0451577_0300822	3300042876	Bacteria	1454
602	Ga0466969_0002252	3300044656	Bacteria	10314
603	Ga0466969_0003530	3300044656	Bacteria	8315
604	Ga0466972_0002059	3300044658	Bacteria	9850
605	Ga0466972_0002859	3300044658	Bacteria	8548
606	Ga0466972_0015337	3300044658	Bacteria	3830
607	Ga0466972_0036989	3300044658	Bacteria	2386
608	Ga0466965_0003251	3300044683	Bacteria	7106
609	Ga0466965_0006273	3300044683	Bacteria	5383
610	Ga0466965_0025222	3300044683	Bacteria	2878
611	Ga0466965_0026947	3300044683	Bacteria	2787
612	Ga0466966_0002064	3300044684	Bacteria	13030
613	Ga0466966_0002131	3300044684	Bacteria	12832
614	Ga0466966_0018665	3300044684	Bacteria	4571
615	Ga0466966_0033312	3300044684	Bacteria	3336
616	Ga0466966_0046838	3300044684	Bacteria	2759
617	Ga0466966_0058740	3300044684	Bacteria	2430
618	Ga0466961_0001303	3300044693	Bacteria	15391
619	Ga0466961_0018032	3300044693	Bacteria	4539
620	Ga0466961_0039915	3300044693	Bacteria	3009
621	Ga0466961_0050049	3300044693	Bacteria	2669
622	Ga0466961_0069587	3300044693	Bacteria	2234
623	Ga0466961_0117862	3300044693	Bacteria	1668
624	Ga0466963_0000288	3300044694	Bacteria	22679
625	Ga0466963_0002774	3300044694	Bacteria	9872
626	Ga0466963_0004890	3300044694	Bacteria	7812
627	Ga0466963_0011650	3300044694	Bacteria	5357
628	Ga0466963_0026683	3300044694	Bacteria	3695
629	Ga0466963_0066325	3300044694	Bacteria	2421
630	Ga0466963_0187237	3300044694	Bacteria	1446
631	Ga0466964_0033655	3300044706	Bacteria	2042
632	Ga0466971_0004672	3300044719	Bacteria	5918
633	Ga0466971_0005045	3300044719	Bacteria	5715
634	Ga0466968_0001581	3300044735	Bacteria	8203
635	Ga0466968_0024051	3300044735	Bacteria	2487
636	Ga0466970_0036670	3300044765	Bacteria	2598
637	Ga0466957_0001403	3300044842	Bacteria	12553
638	Ga0466957_0006143	3300044842	Bacteria	6779
639	Ga0466957_0027046	3300044842	Bacteria	3407
640	Ga0466957_0061434	3300044842	Bacteria	2306
641	Ga0466957_0080003	3300044842	Bacteria	2034
642	Ga0466957_0300468	3300044842	Bacteria	1078
643	Ga0466960_0001002	3300044901	Bacteria	10082
644	Ga0466960_0001087	3300044901	Bacteria	9771
645	Ga0466960_0002372	3300044901	Bacteria	7089
646	Ga0466959_0000897	3300045049	Bacteria	17554
647	Ga0466959_0001476	3300045049	Bacteria	14417
648	Ga0466959_0001547	3300045049	Bacteria	14146
649	Ga0466959_0017877	3300045049	Bacteria	5200
650	Ga0466959_0027589	3300045049	Bacteria	4210
651	Ga0466959_0037300	3300045049	Bacteria	3591
652	Ga0466959_0068273	3300045049	Bacteria	2576
653	Ga0466959_0129690	3300045049	Bacteria	1787
654	Ga0466958_0005151	3300045836	Bacteria	6988
655	Ga0466958_0006888	3300045836	Bacteria	6215
656	Ga0466958_0039394	3300045836	Bacteria	2839
657	Ga0466958_0040735	3300045836	Bacteria	2792
658	Ga0466958_0041381	3300045836	Bacteria	2771
659	Ga0466958_0050560	3300045836	Bacteria	2516
660	Ga0466958_0110713	3300045836	Bacteria	1714
661	Ga0466967_0003546	3300045976	Bacteria	10219
662	Ga0466967_0011765	3300045976	Bacteria	6653
663	Ga0466967_0011960	3300045976	Bacteria	6613
664	Ga0466967_0016973	3300045976	Bacteria	5759
665	Ga0466967_0026318	3300045976	Bacteria	4817
666	Ga0466967_0036386	3300045976	Bacteria	4202
667	Ga0466967_0036918	3300045976	Bacteria	4176
668	Ga0466967_0041552	3300045976	Bacteria	3966
669	Ga0466967_0051161	3300045976	Bacteria	3619
670	Ga0466967_0076612	3300045976	Bacteria	3009
671	Ga0466967_0121806	3300045976	Bacteria	2411
672	Ga0466967_0178777	3300045976	Bacteria	2000
673	Ga0466967_0182264	3300045976	Bacteria	1981
674	Ga0466967_0186768	3300045976	Bacteria	1957
675	Ga0466967_0188129	3300045976	Bacteria	1950
676	Ga0466967_0341518	3300045976	Bacteria	1448
677	Ga0495603_0107818	3300046455	Bacteria	1625
678	Ga0495629_0185365	3300046459	Bacteria	1441
679	Ga0495638_0000563	3300046460	Bacteria	42248
680	Ga0495638_0058022	3300046460	Bacteria	2399
681	Ga0495641_0041725	3300046461	Bacteria	2130
682	Ga0495653_0108174	3300046463	Bacteria	2002
683	Ga0495650_0027022	3300046471	Bacteria	2659
684	Ga0495582_0120994	3300046473	Bacteria	1475
685	Ga0495639_0020463	3300046475	Bacteria	2892
686	Ga0495662_0052534	3300046476	Bacteria	1967
687	Ga0495662_0068307	3300046476	Bacteria	1721
688	Ga0495664_0089469	3300046477	Bacteria	1850
689	Ga0495594_0002125	3300046499	Bacteria	10318
690	Ga0495594_0016140	3300046499	Bacteria	3931
691	Ga0495594_0029099	3300046499	Bacteria	2985
692	Ga0495594_0125002	3300046499	Bacteria	1455
693	Ga0495606_0002365	3300046507	Bacteria	22146
694	Ga0495648_0004975	3300046524	Bacteria	11167
695	Ga0495648_0014101	3300046524	Bacteria	5871
696	Ga0495652_0102062	3300046529	Bacteria	2324
697	Ga0495665_0020854	3300046531	Bacteria	3520
698	Ga0495665_0059379	3300046531	Bacteria	2018
699	Ga0495640_0073786	3300046533	Bacteria	2283
700	Ga0495640_0082893	3300046533	Bacteria	2128
701	Ga0495667_0158278	3300046559	Bacteria	1457
702	Ga0495656_0054210	3300046615	Bacteria	1725
703	Ga0495668_0000169	3300046616	Bacteria	97150
704	Ga0495634_0116644	3300046642	Bacteria	1712
705	Ga0495625_0002435	3300046660	Bacteria	20135
706	Ga0495635_0107726	3300046663	Bacteria	1903
707	Ga0495635_0126535	3300046663	Bacteria	1742
708	Ga0495588_0035197	3300046674	Bacteria	2537
709	Ga0495669_0005418	3300046684	Bacteria	5324
710	Ga0495613_0054572	3300046689	Bacteria	2937
711	Ga0495624_0105330	3300046690	Bacteria	1735
712	Ga0495604_0069356	3300047317	Bacteria	2672
713	Ga0495674_0052692	3300047319	Bacteria	3579
714	Ga0495674_0125381	3300047319	Bacteria	2167
715	Ga0495672_0023054	3300047320	Bacteria	4036
716	Ga0495672_0083267	3300047320	Bacteria	1777
717	Ga0495672_0103428	3300047320	Bacteria	1541
718	Ga0495676_0045519	3300047321	Bacteria	3571
719	Ga0495680_0028397	3300047322	Bacteria	4586
720	Ga0495680_0141162	3300047322	Bacteria	1762
721	Ga0495683_0066124	3300047323	Bacteria	1782
722	Ga0495673_0001489	3300047469	Bacteria	18531
723	Ga0495686_0005660	3300047472	Bacteria	9780
724	Ga0495593_0031677	3300047673	Bacteria	2886
725	Ga0495626_0000312	3300048091	Bacteria	51412
726	Ga0496100_0000076	3300048903	Bacteria	54910
727	Ga0496100_0001035	3300048903	Bacteria	13427
728	Ga0496100_0001268	3300048903	Bacteria	12329
729	Ga0496100_0002861	3300048903	Bacteria	8840
730	Ga0496100_0023093	3300048903	Bacteria	3773
731	Ga0496101_0000084	3300048904	Bacteria	104071
732	Ga0496101_0000094	3300048904	Bacteria	95577
733	Ga0496101_0024663	3300048904	Bacteria	4165
734	Ga0496101_0054318	3300048904	Bacteria	2892
735	Ga0496101_0062230	3300048904	Bacteria	2713
736	Ga0496101_0124461	3300048904	Bacteria	1952
737	Ga0496102_0000014	3300048905	Bacteria	310241
738	Ga0496102_0000718	3300048905	Bacteria	32794
739	Ga0496102_0000923	3300048905	Bacteria	27676
740	Ga0496102_0001481	3300048905	Bacteria	20733
741	Ga0496102_0002467	3300048905	Bacteria	15780
742	Ga0496102_0003991	3300048905	Bacteria	12497
743	Ga0496102_0008831	3300048905	Bacteria	8645
744	Ga0496102_0012499	3300048905	Bacteria	7350
745	Ga0496102_0016217	3300048905	Bacteria	6511
746	Ga0496102_0174766	3300048905	Bacteria	2022
747	Ga0496102_0269201	3300048905	Bacteria	1606
748	Ga0496102_0430437	3300048905	Bacteria	1239
749	Ga0496103_0000004	3300048906	Bacteria	510080
750	Ga0496103_0000030	3300048906	Bacteria	211729
751	Ga0496103_0000630	3300048906	Bacteria	26992
752	Ga0496103_0001260	3300048906	Bacteria	17289
753	Ga0496103_0033606	3300048906	Bacteria	3133
754	Ga0496103_0105726	3300048906	Bacteria	1785
755	Ga0496103_0143998	3300048906	Bacteria	1525
756	Ga0496104_0002885	3300048907	Bacteria	14814
757	Ga0496104_0004329	3300048907	Bacteria	12358
758	Ga0496104_0005253	3300048907	Bacteria	11319
759	Ga0496104_0210252	3300048907	Bacteria	1857
760	Ga0496104_0244539	3300048907	Bacteria	1707
761	Ga0496105_0001491	3300048908	Bacteria	16529
762	Ga0496105_0012144	3300048908	Bacteria	6820
763	Ga0496105_0016809	3300048908	Bacteria	5849
764	Ga0496105_0058452	3300048908	Bacteria	3183
765	Ga0496105_0122311	3300048908	Bacteria	2145
766	Ga0496105_0394156	3300048908	Bacteria	1100
767	Ga0496106_0002103	3300048909	Bacteria	14917
768	Ga0496106_0002972	3300048909	Bacteria	12619
769	Ga0496106_0012998	3300048909	Bacteria	6142
770	Ga0496106_0044746	3300048909	Bacteria	3324
771	Ga0496107_0000270	3300048910	Bacteria	27582
772	Ga0496107_0001773	3300048910	Bacteria	13595
773	Ga0496107_0002556	3300048910	Bacteria	11864
774	Ga0496107_0028257	3300048910	Bacteria	3985
775	Ga0496107_0044087	3300048910	Bacteria	3206
776	Ga0496107_0127549	3300048910	Bacteria	1877
777	Ga0496107_0151894	3300048910	Bacteria	1713
778	Ga0496108_0001463	3300048911	Bacteria	18677
779	Ga0496108_0002468	3300048911	Bacteria	14806
780	Ga0496108_0004287	3300048911	Bacteria	11482
781	Ga0496108_0006483	3300048911	Bacteria	9493
782	Ga0496108_0032843	3300048911	Bacteria	4310
783	Ga0496109_0000344	3300048912	Bacteria	43282
784	Ga0496109_0010406	3300048912	Bacteria	7944
785	Ga0496109_0017263	3300048912	Bacteria	6323
786	Ga0496109_0054926	3300048912	Bacteria	3633
787	Ga0496110_0014435	3300048913	Bacteria	6559
788	Ga0496110_0037507	3300048913	Bacteria	4213
789	Ga0496110_0093651	3300048913	Bacteria	2689
790	Ga0496110_0115056	3300048913	Bacteria	2421
791	Ga0496110_0172554	3300048913	Bacteria	1962
792	Ga0496111_0001016	3300048914	Bacteria	15409
793	Ga0496111_0015472	3300048914	Bacteria	5238
794	Ga0496111_0027683	3300048914	Bacteria	4013
795	Ga0496111_0096564	3300048914	Bacteria	2169
796	Ga0496111_0140049	3300048914	Bacteria	1792
797	Ga0496112_0007119	3300048915	Bacteria	9895
798	Ga0496112_0032493	3300048915	Bacteria	5068
799	Ga0496112_0036248	3300048915	Bacteria	4811
800	Ga0496112_0040073	3300048915	Bacteria	4579
801	Ga0496112_0088623	3300048915	Bacteria	3062
802	Ga0496112_0095801	3300048915	Bacteria	2938
803	Ga0496112_0096870	3300048915	Bacteria	2920
804	Ga0496112_0203459	3300048915	Bacteria	1938
805	Ga0496112_0261377	3300048915	Bacteria	1680
806	Ga0496113_0014747	3300048916	Bacteria	5345
807	Ga0496113_0017750	3300048916	Bacteria	4947
808	Ga0496114_0000842	3300048917	Bacteria	22978
809	Ga0496114_0001102	3300048917	Bacteria	20408
810	Ga0496114_0029191	3300048917	Bacteria	4531
811	Ga0496114_0127872	3300048917	Bacteria	2192
812	Ga0496114_0149915	3300048917	Bacteria	2023
813	Ga0496115_0007651	3300048918	Bacteria	7961
814	Ga0496115_0018123	3300048918	Bacteria	5398
815	Ga0496115_0079646	3300048918	Bacteria	2666
816	Ga0496115_0147233	3300048918	Bacteria	1944
817	Ga0496115_0234302	3300048918	Bacteria	1513
818	Ga0496116_0000069	3300048919	Bacteria	252643
819	Ga0496116_0000578	3300048919	Bacteria	48938
820	Ga0496116_0002811	3300048919	Bacteria	17874
821	Ga0496117_0000003	3300048920	Bacteria	1881097
822	Ga0496117_0001462	3300048920	Bacteria	34041
823	Ga0496117_0019905	3300048920	Bacteria	5491
824	Ga0496117_0021310	3300048920	Bacteria	5248
825	Ga0496117_0028936	3300048920	Bacteria	4281
826	Ga0496118_0000001	3300048921	Bacteria	1881100
827	Ga0496118_0000236	3300048921	Bacteria	97321
828	Ga0496118_0002249	3300048921	Bacteria	26504
829	Ga0496118_0012121	3300048921	Bacteria	8321
830	Ga0496118_0086760	3300048921	Bacteria	2173
831	Ga0496119_0000549	3300048922	Bacteria	51126
832	Ga0496119_0000803	3300048922	Bacteria	42034
833	Ga0496119_0003615	3300048922	Bacteria	15913
834	Ga0496119_0005467	3300048922	Bacteria	12159
835	Ga0496119_0007110	3300048922	Bacteria	10173
836	Ga0496119_0008226	3300048922	Bacteria	9220
837	Ga0496120_0000085	3300048923	Bacteria	155343
838	Ga0496120_0000250	3300048923	Bacteria	90632
839	Ga0496120_0004382	3300048923	Bacteria	11881
840	Ga0496120_0018927	3300048923	Bacteria	4422
841	Ga0496120_0044947	3300048923	Bacteria	2562
842	Ga0496121_0000016	3300048924	Bacteria	562911
843	Ga0496121_0000032	3300048924	Bacteria	378997
844	Ga0496121_0002393	3300048924	Bacteria	28754
845	Ga0496121_0032516	3300048924	Bacteria	4740
846	Ga0496121_0058018	3300048924	Bacteria	3204
847	Ga0496122_0000526	3300048925	Bacteria	79269
848	Ga0496123_0004458	3300048926	Bacteria	14696
849	Ga0496123_0050772	3300048926	Bacteria	2768
850	Ga0496124_0000015	3300048927	Bacteria	460700
851	Ga0496125_0000021	3300048928	Bacteria	460688
852	Ga0496126_0000015	3300048929	Bacteria	663212
853	Ga0496126_0000035	3300048929	Bacteria	361590
854	Ga0496126_0000067	3300048929	Bacteria	249091
855	Ga0496126_0000208	3300048929	Bacteria	131604
856	Ga0496126_0005873	3300048929	Bacteria	13845
857	Ga0496126_0037045	3300048929	Bacteria	4555
858	Ga0496126_0058610	3300048929	Bacteria	3470
859	Ga0496126_0087310	3300048929	Bacteria	2748
860	Ga0501032_0000706	3300049569	Bacteria	27189
861	Ga0501032_0006930	3300049569	Bacteria	8308
862	Ga0501032_0012122	3300049569	Bacteria	6171
863	Ga0501033_0009060	3300049570	Bacteria	7678
864	Ga0501033_0037516	3300049570	Bacteria	3627
865	Ga0501034_0005030	3300049571	Bacteria	14530
866	Ga0501034_0013263	3300049571	Bacteria	8490
867	Ga0501034_0037652	3300049571	Bacteria	4899
868	Ga0501034_0076278	3300049571	Bacteria	3359
869	Ga0501034_0088737	3300049571	Bacteria	3090
870	Ga0501036_0038851	3300049572	Bacteria	4029
871	Ga0501036_0144342	3300049572	Bacteria	2008
872	Ga0501037_0001277	3300049573	Bacteria	18552
873	Ga0501037_0001845	3300049573	Bacteria	15371
874	Ga0501037_0054026	3300049573	Bacteria	2938
875	Ga0501038_0000620	3300049574	Bacteria	31614
876	Ga0501038_0013687	3300049574	Bacteria	7393
877	Ga0501038_0014050	3300049574	Bacteria	7296
878	Ga0501039_0000909	3300049575	Bacteria	21583
879	Ga0501039_0022360	3300049575	Bacteria	4854
880	Ga0501039_0178776	3300049575	Bacteria	1669
881	Ga0501040_0042780	3300049576	Bacteria	3086
882	Ga0501041_0029441	3300049577	Bacteria	3312
883	Ga0501041_0122404	3300049577	Bacteria	1617
884	Ga0501042_0019941	3300049578	Bacteria	4663
885	Ga0501042_0025668	3300049578	Bacteria	4140
886	Ga0501043_0001657	3300049579	Bacteria	19328
887	Ga0501043_0041148	3300049579	Bacteria	3631
888	Ga0501043_0222802	3300049579	Bacteria	1458
889	Ga0501046_0019678	3300049580	Bacteria	5594
890	Ga0501047_0004744	3300049581	Bacteria	12783
891	Ga0501047_0006713	3300049581	Bacteria	10820
892	Ga0501047_0010437	3300049581	Bacteria	8790
893	Ga0501047_0068897	3300049581	Bacteria	3407
894	Ga0501048_0008553	3300049582	Bacteria	7731
895	Ga0501048_0008968	3300049582	Bacteria	7530
896	Ga0501048_0051146	3300049582	Bacteria	2942
897	Ga0501068_0181903	3300049584	Bacteria	1329
898	Ga0501069_0178003	3300049585	Bacteria	1229
899	Ga0501070_0000213	3300049586	Bacteria	55004
900	Ga0501070_0000386	3300049586	Bacteria	40434
901	Ga0501071_0001758	3300049587	Bacteria	12768
902	Ga0501071_0111275	3300049587	Bacteria	2024
903	Ga0501072_0011692	3300049588	Bacteria	6707
904	Ga0501074_0002345	3300049590	Bacteria	13178
905	Ga0501074_0090606	3300049590	Bacteria	2190
906	Ga0501077_0063682	3300049593	Bacteria	2339
907	Ga0501077_0101867	3300049593	Bacteria	1820
908	Ga0501081_0028586	3300049743	Bacteria	3763
909	Ga0501035_0000340	3300049822	Bacteria	54226
910	Ga0501035_0008647	3300049822	Bacteria	9478
911	Ga0501044_0000380	3300049823	Bacteria	55272
912	Ga0501044_0028696	3300049823	Bacteria	5871
913	Ga0501044_0082871	3300049823	Bacteria	3244
914	Ga0501044_0104258	3300049823	Bacteria	2850
915	Ga0501044_0213532	3300049823	Bacteria	1883
916	Ga0501045_0007214	3300049824	Bacteria	7714
917	Ga0501045_0050949	3300049824	Bacteria	3021
918	nmdc:mga03n38_1427_c1	3300050490	Bacteria	6826
919	nmdc:mga03n38_1511_c1	3300050490	Bacteria	6716
920	nmdc:mga00v17_1138_c1	3300050491	Bacteria	13972
921	nmdc:mga00v17_44455_c1	3300050491	Bacteria	2678
922	nmdc:mga00v17_60940_c1	3300050491	Bacteria	2319
923	nmdc:mga00v17_6740_c1	3300050491	Bacteria	6102
924	nmdc:mga00v17_8771_c1	3300050491	Bacteria	5445
925	nmdc:mga00v17_96380_c1	3300050491	Bacteria	1863
926	nmdc:mga0yw44_24337_c1	3300050492	Bacteria	3425
927	nmdc:mga0yw44_780_c1	3300050492	Bacteria	11811
928	nmdc:mga07m45_13392_c1	3300050496	Bacteria	4351
929	nmdc:mga07m45_21555_c1	3300050496	Bacteria	3509
930	nmdc:mga07m45_27168_c1	3300050496	Bacteria	3150
931	nmdc:mga07m45_337_c1	3300050496	Bacteria	19051
932	nmdc:mga07m45_84550_c1	3300050496	Bacteria	1814
933	nmdc:mga05p37_16765_c1	3300050507	Bacteria	8832
934	nmdc:mga05p37_181377_c1	3300050507	Bacteria	2561
935	nmdc:mga05p37_26114_c1	3300050507	Bacteria	7102
936	nmdc:mga05p37_9074_c1	3300050507	Bacteria	11755
937	nmdc:mga09592_16810_c1	3300050508	Bacteria	5988
938	nmdc:mga09592_62_c1	3300050508	Bacteria	60818
939	nmdc:mga0qj67_10555_c1	3300050509	Bacteria	6899
940	nmdc:mga0qj67_106_c2	3300050509	Bacteria	34014
941	nmdc:mga0qj67_13793_c1	3300050509	Bacteria	6098
942	nmdc:mga0qj67_21963_c1	3300050509	Bacteria	4897
943	nmdc:mga06r32_1375_c1	3300050510	Bacteria	21993
944	nmdc:mga06r32_25_c7	3300050510	Bacteria	11552
945	nmdc:mga06r32_77325_c1	3300050510	Bacteria	3233
946	nmdc:mga06r32_9570_c1	3300050510	Bacteria	8752
947	nmdc:mga08y16_19132_c1	3300050511	Bacteria	7216
948	nmdc:mga08y16_309796_c1	3300050511	Bacteria	1626
949	nmdc:mga0n895_119551_c1	3300050512	Bacteria	2656
950	nmdc:mga0n895_3029_c1	3300050512	Bacteria	13368
951	nmdc:mga08x19_8640_c1	3300050514	Bacteria	6071
952	nmdc:mga0a205_10838_c1	3300050515	Bacteria	8386
953	nmdc:mga0a205_70823_c1	3300050515	Bacteria	3367
954	nmdc:mga0sz30_3286_c1	3300050516	Bacteria	5813
955	nmdc:mga0sz30_36543_c1	3300050516	Bacteria	2053
956	nmdc:mga0sz30_927_c1	3300050516	Bacteria	10562
957	Ga0495601_0015871	3300053077	Bacteria	4558
958	Ga0500635_0003696	3300053080	Bacteria	3871
959	Ga0495595_0090115	3300053084	Bacteria	1470
960	Ga0495619_0225913	3300053085	Bacteria	1297
961	Ga0500643_000240	3300053087	Bacteria	50980
962	Ga0500643_003897	3300053087	Bacteria	6930
963	Ga0500644_0008807	3300053088	Bacteria	2676
964	Ga0500646_0003381	3300053090	Bacteria	4095
965	Ga0500583_0083104	3300053092	Bacteria	1550
966	Ga0500562_004337	3300053108	Bacteria	3589
967	Ga0500652_000479	3300053131	Bacteria	14179
968	Ga0500652_035905	3300053131	Bacteria	1971
969	Ga0500588_0000341	3300053146	Bacteria	7098
970	Ga0500616_0007655	3300053153	Bacteria	6823
971	Ga0500645_000123	3300053730	Bacteria	61404
972	Ga0500645_009049	3300053730	Bacteria	3363
973	Ga0501084_0202597	3300054114	Bacteria	1674
974	Ga0501082_0143043	3300060353	Bacteria	2076
975	Ga0466962_0010071	3300061719	Bacteria	4536
976	Ga0466962_0022948	3300061719	Bacteria	2999
977	Ga0530510_0103344	3300061734	Bacteria	2084
978	Ga0530510_0168046	3300061734	Bacteria	1624

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300044842	Ga0466957_0300468	Ga0466957_0300468_99_1064	319
2	3300050507	nmdc:mga05p37_181377_c1	nmdc:mga05p37_181377_c1_18_998	324
3	3300048908	Ga0496105_0394156	Ga0496105_0394156_67_1086	337
4	3300048905	Ga0496102_0430437	Ga0496102_0430437_15_1064	345
5	3300025934	Ga0207686_10015402	Ga0207686_100154022	347
6	3300045836	Ga0466958_0050560	Ga0466958_0050560_1444_2490	348
7	iso_pu_bacteria	2671180195	2671840324	360
8	iso_pu_bacteria	2773857922	2774858480	360
9	3300049590	Ga0501074_0002345	Ga0501074_0002345_11890_12984	364
10	3300049585	Ga0501069_0178003	Ga0501069_0178003_13_1128	369
11	iso_pu_bacteria	2855020534	2855021844	371
12	3300048929	Ga0496126_0087310	Ga0496126_0087310_514_1713	375
13	iso_pu_bacteria	2899370129	2899376835	375
14	3300005937	Ga0081455_10000288	Ga0081455_1000028861	376
15	3300030521	Ga0307511_10147330	Ga0307511_101473302	376
16	3300032005	Ga0307411_10018384	Ga0307411_100183845	380
17	3300045976	Ga0466967_0121806	Ga0466967_0121806_472_1665	381
18	3300005435	Ga0070714_100000701	Ga0070714_10000070117	383
19	3300006028	Ga0070717_10001308	Ga0070717_100013086	383
20	3300025929	Ga0207664_10000641	Ga0207664_100006416	383
21	3300033179	Ga0307507_10055651	Ga0307507_100556513	383
22	iso_pu_bacteria	2887478801	2887483707	383
23	3300005334	Ga0068869_100014710	Ga0068869_1000147103	384
24	3300005338	Ga0068868_100008435	Ga0068868_1000084358	384
25	3300005354	Ga0070675_100005371	Ga0070675_1000053719	384
26	3300005441	Ga0070700_100001352	Ga0070700_10000135210	384
27	3300005455	Ga0070663_100003006	Ga0070663_1000030064	384
28	3300005457	Ga0070662_100015433	Ga0070662_1000154334	384
29	3300005564	Ga0070664_100009850	Ga0070664_1000098504	384
30	3300005577	Ga0068857_100089002	Ga0068857_1000890022	384
31	3300005719	Ga0068861_100090221	Ga0068861_1000902213	384
32	3300005842	Ga0068858_100053123	Ga0068858_1000531232	384
33	3300009098	Ga0105245_10090761	Ga0105245_100907612	384
34	3300025919	Ga0207657_10070030	Ga0207657_100700302	384
35	3300025926	Ga0207659_10000900	Ga0207659_1000090019	384
36	3300025927	Ga0207687_10114634	Ga0207687_101146342	384
37	3300025933	Ga0207706_10024221	Ga0207706_100242215	384
38	3300025942	Ga0207689_10021188	Ga0207689_100211883	384
39	3300025945	Ga0207679_10001380	Ga0207679_1000138010	384
40	3300026023	Ga0207677_10004713	Ga0207677_100047132	384
41	3300026035	Ga0207703_10104289	Ga0207703_101042892	384
42	3300026067	Ga0207678_10003800	Ga0207678_100038004	384
43	3300026116	Ga0207674_10006778	Ga0207674_1000677812	384
44	3300026118	Ga0207675_100045219	Ga0207675_1000452194	384
45	3300026142	Ga0207698_10187647	Ga0207698_101876472	384
46	3300028380	Ga0268265_10005435	Ga0268265_100054359	384
47	3300030731	Ga0316177_1052337	Ga0316177_10523372	384
48	3300030733	Ga0314311_1180288	Ga0314311_11802883	384
49	3300048905	Ga0496102_0269201	Ga0496102_0269201_181_1377	384
50	3300009094	Ga0111539_10000482	Ga0111539_1000048228	385
51	3300025920	Ga0207649_10036106	Ga0207649_100361062	385
52	3300014745	Ga0157377_10000649	Ga0157377_100006498	387
53	iso_pu_bacteria	2895880812	2895882363	387
54	3300005437	Ga0070710_10000110	Ga0070710_1000011042	388
55	3300025898	Ga0207692_10000457	Ga0207692_100004574	388
56	3300044658	Ga0466972_0015337	Ga0466972_0015337_1263_2459	388
57	3300044683	Ga0466965_0026947	Ga0466965_0026947_1275_2471	388
58	3300044901	Ga0466960_0002372	Ga0466960_0002372_4807_6003	388
59	iso_pu_bacteria	3002998708	3003008800	388
60	3300035113	Ga0373936_0024454	Ga0373936_0024454_630_1832	390
61	3300035695	Ga0373927_0039947	Ga0373927_0039947_171_1373	390
62	3300046459	Ga0495629_0185365	Ga0495629_0185365_39_1241	390
63	3300046476	Ga0495662_0052534	Ga0495662_0052534_671_1873	390
64	3300046533	Ga0495640_0082893	Ga0495640_0082893_762_1964	390
65	3300046663	Ga0495635_0126535	Ga0495635_0126535_197_1399	390
66	3300046689	Ga0495613_0054572	Ga0495613_0054572_1392_2594	390
67	3300047319	Ga0495674_0052692	Ga0495674_0052692_1571_2773	390
68	3300048903	Ga0496100_0023093	Ga0496100_0023093_1000_2196	390
69	3300048904	Ga0496101_0124461	Ga0496101_0124461_223_1419	390
70	3300048908	Ga0496105_0122311	Ga0496105_0122311_384_1580	390
71	3300048909	Ga0496106_0044746	Ga0496106_0044746_958_2154	390
72	3300048916	Ga0496113_0017750	Ga0496113_0017750_1187_2383	390
73	3300048918	Ga0496115_0007651	Ga0496115_0007651_6668_7864	390
74	3300053084	Ga0495595_0090115	Ga0495595_0090115_164_1366	390
75	iso_pu_bacteria	8057568493	8057568883	390
76	3300005329	Ga0070683_100009730	Ga0070683_1000097305	391
77	3300005535	Ga0070684_100010145	Ga0070684_1000101456	391
78	3300025944	Ga0207661_10007868	Ga0207661_100078688	391
79	3300026116	Ga0207674_10077418	Ga0207674_100774182	391
80	3300049593	Ga0501077_0063682	Ga0501077_0063682_592_1767	391
81	iso_pu_bacteria	2508501039	2508672362	391
82	iso_pu_bacteria	2515154129	2515720617	391
83	iso_pu_bacteria	2515154202	2516086759	391
84	iso_pu_bacteria	2622736626	2623586433	391
85	iso_pu_bacteria	2643221687	2644486648	391
86	iso_pu_bacteria	2643221715	2644636053	391
87	iso_pu_bacteria	2675902999	2676198229	391
88	iso_pu_bacteria	2687453737	2689959501	391
89	iso_pu_bacteria	2738541264	2738665279	391
90	iso_pu_bacteria	2738541274	2738706286	391
91	iso_pu_bacteria	2738541356	2739144413	391
92	iso_pu_bacteria	2738543028	2739328775	391
93	iso_pu_bacteria	2772190715	2772641670	391
94	iso_pu_bacteria	2773857921	2774842807	391
95	iso_pu_bacteria	2842134933	2842138692	391
96	iso_pu_bacteria	2855676851	2855678865	391
97	iso_pu_bacteria	2855683550	2855685291	391
98	iso_pu_bacteria	2856858025	2856860351	391
99	iso_pu_bacteria	2857288857	2857295162	391
100	iso_pu_bacteria	2858848962	2858854533	391
101	iso_pu_bacteria	2858868258	2858874076	391
102	iso_pu_bacteria	2858888857	2858890759	391
103	iso_pu_bacteria	2858895516	2858898553	391
104	iso_pu_bacteria	2858902515	2858905641	391
105	iso_pu_bacteria	2867302475	2867303805	391
106	iso_pu_bacteria	2867312974	2867313357	391
107	iso_pu_bacteria	2867319477	2867322824	391
108	iso_pu_bacteria	2869048445	2869054255	391
109	iso_pu_bacteria	2869061728	2869065822	391
110	iso_pu_bacteria	2869068681	2869070626	391
111	iso_pu_bacteria	2880489317	2880493748	391
112	iso_pu_bacteria	2880495981	2880498574	391
113	iso_pu_bacteria	2902582711	2902586396	391
114	iso_pu_bacteria	2902792274	2902793196	391
115	iso_pu_bacteria	2902799365	2902804063	391
116	iso_pu_bacteria	2929212328	2929214578	391
117	iso_pu_bacteria	2929219909	2929220566	391
118	iso_pu_bacteria	2929226422	2929227153	391
119	iso_pu_bacteria	2939582691	2939587838	391
120	iso_pu_bacteria	2996221748	2996224794	391
121	iso_pu_bacteria	649633069	649811090	391
122	iso_pu_bacteria	8003830390	8003835336	391
123	iso_pu_bacteria	8003856774	8003857203	391
124	iso_pu_bacteria	8003870546	8003873523	391
125	iso_pu_bacteria	8054727385	8054730990	391
126	iso_pu_bacteria	8055412473	8055414775	391
127	3300010375	Ga0105239_10144029	Ga0105239_101440292	392
128	3300045976	Ga0466967_0178777	Ga0466967_0178777_593_1786	392
129	iso_pu_bacteria	2506783011	2506865430	392
130	iso_pu_bacteria	2517572101	2517760699	392
131	iso_pu_bacteria	2523231044	2523384642	392
132	iso_pu_bacteria	2527291627	2528204833	392
133	iso_pu_bacteria	2527291629	2528216273	392
134	iso_pu_bacteria	2546825537	2546950180	392
135	iso_pu_bacteria	2576861822	2579750781	392
136	iso_pu_bacteria	2579778521	2579852809	392
137	iso_pu_bacteria	2619618881	2619856604	392
138	iso_pu_bacteria	2619619003	2620348830	392
139	iso_pu_bacteria	2626541554	2626636124	392
140	iso_pu_bacteria	2684623035	2686537433	392
141	iso_pu_bacteria	2684623036	2686543239	392
142	iso_pu_bacteria	2710264753	2710606209	392
143	iso_pu_bacteria	2773857924	2774865980	392
144	iso_pu_bacteria	2773857933	2774901233	392
145	iso_pu_bacteria	2861520306	2861520750	392
146	iso_pu_bacteria	2917736166	2917737472	392
147	iso_pu_bacteria	637000116	637879500	392
148	iso_pu_bacteria	8001781756	8001782513	392
149	iso_pu_bacteria	8002775197	8002782596	392
150	iso_pu_bacteria	8002784119	8002789205	392
151	iso_pu_bacteria	8054913762	8054918306	392
152	iso_pu_bacteria	8054920844	8054922262	392
153	iso_pu_bacteria	8055157932	8055159745	392
154	3300047320	Ga0495672_0023054	Ga0495672_0023054_2234_3424	393
155	iso_pu_bacteria	2515154088	2515493923	393
156	iso_pu_bacteria	2515154137	2515755299	393
157	iso_pu_bacteria	2515154203	2516092345	393
158	iso_pu_bacteria	2558860112	2558909285	393
159	iso_pu_bacteria	2622736605	2623502299	393
160	iso_pu_bacteria	2816332139	2816511542	393
161	iso_pu_bacteria	2870782633	2870783488	393
162	iso_pu_bacteria	2917736166	2917738066	393
163	iso_pu_bacteria	8054472261	8054475476	393
164	3300005339	Ga0070660_100085916	Ga0070660_1000859162	394
165	3300005564	Ga0070664_100151040	Ga0070664_1001510402	394
166	3300005618	Ga0068864_100001934	Ga0068864_10000193411	394
167	3300005841	Ga0068863_100057846	Ga0068863_1000578463	394
168	3300006846	Ga0075430_100005427	Ga0075430_10000542710	394
169	3300009177	Ga0105248_10028235	Ga0105248_100282355	394
170	3300013105	Ga0157369_10019224	Ga0157369_100192243	394
171	3300013296	Ga0157374_10123689	Ga0157374_101236892	394
172	3300025919	Ga0207657_10045558	Ga0207657_100455582	394
173	3300025941	Ga0207711_10042651	Ga0207711_100426514	394
174	3300025945	Ga0207679_10145844	Ga0207679_101458441	394
175	3300026078	Ga0207702_10429416	Ga0207702_104294161	394
176	3300026088	Ga0207641_10019865	Ga0207641_100198651	394
177	3300026095	Ga0207676_10111309	Ga0207676_101113091	394
178	3300026116	Ga0207674_10019724	Ga0207674_100197241	394
179	3300032002	Ga0307416_100132268	Ga0307416_1001322682	394
180	3300046615	Ga0495656_0054210	Ga0495656_0054210_515_1705	394
181	3300048907	Ga0496104_0002885	Ga0496104_0002885_8022_9218	394
182	3300048908	Ga0496105_0058452	Ga0496105_0058452_1695_2891	394
183	3300048911	Ga0496108_0001463	Ga0496108_0001463_264_1460	394
184	3300048912	Ga0496109_0017263	Ga0496109_0017263_3023_4219	394
185	3300048914	Ga0496111_0140049	Ga0496111_0140049_368_1564	394
186	3300048916	Ga0496113_0014747	Ga0496113_0014747_246_1442	394
187	3300048929	Ga0496126_0000035	Ga0496126_0000035_77790_78992	394
188	3300050509	nmdc:mga0qj67_21963_c1	nmdc:mga0qj67_21963_c1_2515_3711	394
189	iso_pu_bacteria	2558860280	2559426958	394
190	iso_pu_bacteria	2582580736	2583151582	394
191	iso_pu_bacteria	2585427649	2586064139	394
192	iso_pu_bacteria	2675903059	2676484870	394
193	iso_pu_bacteria	2751185734	2753073314	394
194	iso_pu_bacteria	2791354901	2791914036	394
195	iso_pu_bacteria	2795385472	2795791485	394
196	iso_pu_bacteria	2808606522	2809586616	394
197	iso_pu_bacteria	2866612099	2866618724	394
198	iso_pu_bacteria	2870721527	2870729141	394
199	iso_pu_bacteria	2891326441	2891327121	394
200	iso_pu_bacteria	2899359706	2899360234	394
201	iso_pu_bacteria	2915768154	2915772438	394
202	iso_pu_bacteria	8003314358	8003320399	394
203	iso_pu_bacteria	8047710418	8047715081	394
204	iso_pu_bacteria	8054913762	8054915208	394
205	3300001991	JGI24743J22301_10001350	JGI24743J22301_100013503	395
206	3300002067	JGI24735J21928_10007384	JGI24735J21928_100073842	395
207	3300002077	JGI24744J21845_10002473	JGI24744J21845_100024733	395
208	3300002155	JGI24033J26618_1005562	JGI24033J26618_10055622	395
209	3300002239	JGI24034J26672_10001418	JGI24034J26672_100014181	395
210	3300002244	JGI24742J22300_10000583	JGI24742J22300_100005834	395
211	3300003203	JGI25406J46586_10024529	JGI25406J46586_100245291	395
212	3300003792	Ga0055540_1000003	Ga0055540_1000003276	395
213	3300003792	Ga0055540_1000261	Ga0055540_100026129	395
214	3300003792	Ga0055540_1002970	Ga0055540_10029703	395
215	3300003792	Ga0055540_1016606	Ga0055540_10166062	395
216	3300003911	JGI25405J52794_10009820	JGI25405J52794_100098201	395
217	3300005327	Ga0070658_10003430	Ga0070658_100034304	395
218	3300005328	Ga0070676_10021409	Ga0070676_100214092	395
219	3300005330	Ga0070690_100071686	Ga0070690_1000716862	395
220	3300005331	Ga0070670_100001154	Ga0070670_10000115420	395
221	3300005334	Ga0068869_100002993	Ga0068869_1000029934	395
222	3300005334	Ga0068869_100114859	Ga0068869_1001148592	395
223	3300005335	Ga0070666_10025034	Ga0070666_100250343	395
224	3300005336	Ga0070680_100112545	Ga0070680_1001125452	395
225	3300005337	Ga0070682_100000335	Ga0070682_10000033511	395
226	3300005337	Ga0070682_100054424	Ga0070682_1000544242	395
227	3300005338	Ga0068868_100004268	Ga0068868_1000042682	395
228	3300005338	Ga0068868_100008450	Ga0068868_1000084504	395
229	3300005338	Ga0068868_100064065	Ga0068868_1000640652	395
230	3300005339	Ga0070660_100001969	Ga0070660_10000196913	395
231	3300005340	Ga0070689_100067656	Ga0070689_1000676562	395
232	3300005340	Ga0070689_100089896	Ga0070689_1000898961	395
233	3300005341	Ga0070691_10003837	Ga0070691_100038372	395
234	3300005341	Ga0070691_10015402	Ga0070691_100154023	395
235	3300005345	Ga0070692_10000043	Ga0070692_100000432	395
236	3300005347	Ga0070668_100001102	Ga0070668_1000011024	395
237	3300005347	Ga0070668_100031527	Ga0070668_1000315273	395
238	3300005347	Ga0070668_100194534	Ga0070668_1001945342	395
239	3300005353	Ga0070669_100172314	Ga0070669_1001723141	395
240	3300005354	Ga0070675_100000578	Ga0070675_1000005782	395
241	3300005355	Ga0070671_100001349	Ga0070671_10000134915	395
242	3300005356	Ga0070674_100021522	Ga0070674_1000215222	395
243	3300005364	Ga0070673_100029092	Ga0070673_1000290922	395
244	3300005365	Ga0070688_100010150	Ga0070688_1000101502	395
245	3300005366	Ga0070659_100048536	Ga0070659_1000485362	395
246	3300005366	Ga0070659_100060152	Ga0070659_1000601523	395
247	3300005367	Ga0070667_100000087	Ga0070667_10000008786	395
248	3300005367	Ga0070667_100004630	Ga0070667_1000046303	395
249	3300005367	Ga0070667_100007753	Ga0070667_1000077538	395
250	3300005367	Ga0070667_100038520	Ga0070667_1000385202	395
251	3300005367	Ga0070667_100047658	Ga0070667_1000476583	395
252	3300005406	Ga0070703_10024660	Ga0070703_100246602	395
253	3300005434	Ga0070709_10061429	Ga0070709_100614292	395
254	3300005435	Ga0070714_100000057	Ga0070714_10000005732	395
255	3300005435	Ga0070714_100232497	Ga0070714_1002324972	395
256	3300005437	Ga0070710_10002992	Ga0070710_100029923	395
257	3300005438	Ga0070701_10002400	Ga0070701_100024004	395
258	3300005439	Ga0070711_100001653	Ga0070711_1000016538	395
259	3300005439	Ga0070711_100002316	Ga0070711_1000023163	395
260	3300005439	Ga0070711_100002351	Ga0070711_10000235111	395
261	3300005440	Ga0070705_100005450	Ga0070705_1000054505	395
262	3300005441	Ga0070700_100000031	Ga0070700_10000003163	395
263	3300005441	Ga0070700_100003917	Ga0070700_1000039174	395
264	3300005441	Ga0070700_100006150	Ga0070700_1000061504	395
265	3300005444	Ga0070694_100018471	Ga0070694_1000184713	395
266	3300005455	Ga0070663_100016296	Ga0070663_1000162964	395
267	3300005455	Ga0070663_100048175	Ga0070663_1000481752	395
268	3300005455	Ga0070663_100170063	Ga0070663_1001700632	395
269	3300005455	Ga0070663_100271223	Ga0070663_1002712231	395
270	3300005456	Ga0070678_100000372	Ga0070678_10000037218	395
271	3300005456	Ga0070678_100003411	Ga0070678_1000034115	395
272	3300005458	Ga0070681_10001041	Ga0070681_1000104122	395
273	3300005458	Ga0070681_10056346	Ga0070681_100563463	395
274	3300005466	Ga0070685_10177846	Ga0070685_101778461	395
275	3300005530	Ga0070679_100086354	Ga0070679_1000863543	395
276	3300005539	Ga0068853_100016915	Ga0068853_1000169152	395
277	3300005539	Ga0068853_100018399	Ga0068853_1000183995	395
278	3300005539	Ga0068853_100073150	Ga0068853_1000731503	395
279	3300005539	Ga0068853_100078561	Ga0068853_1000785612	395
280	3300005543	Ga0070672_100095272	Ga0070672_1000952722	395
281	3300005543	Ga0070672_100141087	Ga0070672_1001410872	395
282	3300005543	Ga0070672_100240741	Ga0070672_1002407412	395
283	3300005544	Ga0070686_100144858	Ga0070686_1001448581	395
284	3300005545	Ga0070695_100127130	Ga0070695_1001271302	395
285	3300005546	Ga0070696_100002982	Ga0070696_1000029826	395
286	3300005546	Ga0070696_100061054	Ga0070696_1000610542	395
287	3300005546	Ga0070696_100178864	Ga0070696_1001788642	395
288	3300005547	Ga0070693_100000246	Ga0070693_10000024626	395
289	3300005548	Ga0070665_100002158	Ga0070665_10000215810	395
290	3300005548	Ga0070665_100003039	Ga0070665_10000303912	395
291	3300005548	Ga0070665_100031876	Ga0070665_1000318762	395
292	3300005548	Ga0070665_100045698	Ga0070665_1000456984	395
293	3300005549	Ga0070704_100000113	Ga0070704_1000001138	395
294	3300005563	Ga0068855_100029171	Ga0068855_1000291714	395
295	3300005563	Ga0068855_100032959	Ga0068855_1000329595	395
296	3300005578	Ga0068854_100000637	Ga0068854_1000006377	395
297	3300005578	Ga0068854_100029847	Ga0068854_1000298472	395
298	3300005578	Ga0068854_100057853	Ga0068854_1000578532	395
299	3300005615	Ga0070702_100000639	Ga0070702_1000006396	395
300	3300005615	Ga0070702_100050915	Ga0070702_1000509152	395
301	3300005616	Ga0068852_100012774	Ga0068852_1000127745	395
302	3300005616	Ga0068852_100019689	Ga0068852_1000196895	395
303	3300005616	Ga0068852_100039518	Ga0068852_1000395182	395
304	3300005616	Ga0068852_100058283	Ga0068852_1000582833	395
305	3300005617	Ga0068859_100000291	Ga0068859_10000029124	395
306	3300005617	Ga0068859_100013254	Ga0068859_1000132543	395
307	3300005617	Ga0068859_100015017	Ga0068859_1000150172	395
308	3300005617	Ga0068859_100045625	Ga0068859_1000456252	395
309	3300005618	Ga0068864_100109298	Ga0068864_1001092982	395
310	3300005618	Ga0068864_100261526	Ga0068864_1002615261	395
311	3300005718	Ga0068866_10000435	Ga0068866_1000043515	395
312	3300005718	Ga0068866_10007493	Ga0068866_100074934	395
313	3300005719	Ga0068861_100002086	Ga0068861_1000020867	395
314	3300005719	Ga0068861_100018749	Ga0068861_1000187493	395
315	3300005719	Ga0068861_100042769	Ga0068861_1000427693	395
316	3300005841	Ga0068863_100000179	Ga0068863_1000001797	395
317	3300005841	Ga0068863_100000580	Ga0068863_10000058010	395
318	3300005841	Ga0068863_100006453	Ga0068863_1000064537	395
319	3300005841	Ga0068863_100089506	Ga0068863_1000895062	395
320	3300005842	Ga0068858_100000071	Ga0068858_10000007165	395
321	3300005842	Ga0068858_100000362	Ga0068858_10000036243	395
322	3300005842	Ga0068858_100020931	Ga0068858_1000209313	395
323	3300005842	Ga0068858_100099585	Ga0068858_1000995852	395
324	3300005842	Ga0068858_100288793	Ga0068858_1002887932	395
325	3300005843	Ga0068860_100000020	Ga0068860_100000020241	395
326	3300005843	Ga0068860_100000345	Ga0068860_10000034510	395
327	3300005843	Ga0068860_100016544	Ga0068860_1000165445	395
328	3300005843	Ga0068860_100052772	Ga0068860_1000527723	395
329	3300005844	Ga0068862_100000013	Ga0068862_100000013225	395
330	3300005844	Ga0068862_100005089	Ga0068862_1000050896	395
331	3300005844	Ga0068862_100057251	Ga0068862_1000572512	395
332	3300005937	Ga0081455_10000436	Ga0081455_1000043641	395
333	3300005937	Ga0081455_10009880	Ga0081455_1000988011	395
334	3300005937	Ga0081455_10039401	Ga0081455_100394013	395
335	3300005983	Ga0081540_1000602	Ga0081540_100060219	395
336	3300005983	Ga0081540_1000710	Ga0081540_100071011	395
337	3300005985	Ga0081539_10000094	Ga0081539_1000009494	395
338	3300006028	Ga0070717_10072787	Ga0070717_100727872	395
339	3300006038	Ga0075365_10019566	Ga0075365_100195664	395
340	3300006038	Ga0075365_10023310	Ga0075365_100233101	395
341	3300006038	Ga0075365_10028336	Ga0075365_100283363	395
342	3300006048	Ga0075363_100000409	Ga0075363_1000004095	395
343	3300006048	Ga0075363_100004494	Ga0075363_1000044944	395
344	3300006048	Ga0075363_100014025	Ga0075363_1000140253	395
345	3300006048	Ga0075363_100014723	Ga0075363_1000147233	395
346	3300006048	Ga0075363_100073713	Ga0075363_1000737132	395
347	3300006051	Ga0075364_10001494	Ga0075364_100014947	395
348	3300006051	Ga0075364_10006497	Ga0075364_100064976	395
349	3300006051	Ga0075364_10010332	Ga0075364_100103325	395
350	3300006051	Ga0075364_10017355	Ga0075364_100173554	395
351	3300006058	Ga0075432_10010849	Ga0075432_100108492	395
352	3300006173	Ga0070716_100001095	Ga0070716_1000010952	395
353	3300006173	Ga0070716_100105017	Ga0070716_1001050172	395
354	3300006175	Ga0070712_100003765	Ga0070712_1000037652	395
355	3300006175	Ga0070712_100005974	Ga0070712_1000059743	395
356	3300006186	Ga0075369_10004499	Ga0075369_100044995	395
357	3300006186	Ga0075369_10024999	Ga0075369_100249992	395
358	3300006186	Ga0075369_10034936	Ga0075369_100349362	395
359	3300006195	Ga0075366_10147537	Ga0075366_101475372	395
360	3300006237	Ga0097621_100009134	Ga0097621_1000091343	395
361	3300006237	Ga0097621_100025930	Ga0097621_1000259303	395
362	3300006353	Ga0075370_10022693	Ga0075370_100226933	395
363	3300006353	Ga0075370_10027158	Ga0075370_100271582	395
364	3300006353	Ga0075370_10031037	Ga0075370_100310372	395
365	3300006844	Ga0075428_100001458	Ga0075428_1000014586	395
366	3300006844	Ga0075428_100161048	Ga0075428_1001610482	395
367	3300006844	Ga0075428_100189572	Ga0075428_1001895722	395
368	3300006846	Ga0075430_100022533	Ga0075430_1000225333	395
369	3300006852	Ga0075433_10106885	Ga0075433_101068852	395
370	3300006871	Ga0075434_100015313	Ga0075434_1000153135	395
371	3300006871	Ga0075434_100019371	Ga0075434_1000193714	395
372	3300006880	Ga0075429_100033163	Ga0075429_1000331635	395
373	3300006880	Ga0075429_100121583	Ga0075429_1001215831	395
374	3300006881	Ga0068865_100006274	Ga0068865_1000062743	395
375	3300006881	Ga0068865_100069746	Ga0068865_1000697462	395
376	3300006914	Ga0075436_100007851	Ga0075436_1000078517	395
377	3300006931	Ga0097620_100000291	Ga0097620_10000029124	395
378	3300006931	Ga0097620_100013254	Ga0097620_1000132547	395
379	3300006931	Ga0097620_100015017	Ga0097620_1000150172	395
380	3300006931	Ga0097620_100045625	Ga0097620_1000456252	395
381	3300007076	Ga0075435_100002890	Ga0075435_10000289012	395
382	3300007076	Ga0075435_100007664	Ga0075435_1000076642	395
383	3300009092	Ga0105250_10049852	Ga0105250_100498522	395
384	3300009093	Ga0105240_10119840	Ga0105240_101198401	395
385	3300009093	Ga0105240_10122665	Ga0105240_101226652	395
386	3300009093	Ga0105240_10236659	Ga0105240_102366592	395
387	3300009094	Ga0111539_10004560	Ga0111539_100045604	395
388	3300009094	Ga0111539_10387616	Ga0111539_103876162	395
389	3300009098	Ga0105245_10001247	Ga0105245_1000124710	395
390	3300009098	Ga0105245_10217265	Ga0105245_102172652	395
391	3300009101	Ga0105247_10000009	Ga0105247_10000009344	395
392	3300009101	Ga0105247_10002038	Ga0105247_100020383	395
393	3300009147	Ga0114129_10000114	Ga0114129_1000011489	395
394	3300009147	Ga0114129_10000585	Ga0114129_1000058543	395
395	3300009147	Ga0114129_10021079	Ga0114129_100210799	395
396	3300009147	Ga0114129_10363980	Ga0114129_103639802	395
397	3300009148	Ga0105243_10001881	Ga0105243_100018816	395
398	3300009148	Ga0105243_10043836	Ga0105243_100438363	395
399	3300009148	Ga0105243_10149133	Ga0105243_101491332	395
400	3300009174	Ga0105241_10001137	Ga0105241_100011372	395
401	3300009176	Ga0105242_10000766	Ga0105242_100007664	395
402	3300009176	Ga0105242_10062239	Ga0105242_100622393	395
403	3300009177	Ga0105248_10000147	Ga0105248_1000014711	395
404	3300009177	Ga0105248_10000207	Ga0105248_1000020740	395
405	3300009177	Ga0105248_10000450	Ga0105248_1000045038	395
406	3300009177	Ga0105248_10004117	Ga0105248_100041177	395
407	3300009177	Ga0105248_10018906	Ga0105248_100189066	395
408	3300009177	Ga0105248_10069913	Ga0105248_100699132	395
409	3300009177	Ga0105248_10133451	Ga0105248_101334512	395
410	3300009545	Ga0105237_10006936	Ga0105237_100069361	395
411	3300009545	Ga0105237_10042790	Ga0105237_100427905	395
412	3300009545	Ga0105237_10302090	Ga0105237_103020902	395
413	3300009551	Ga0105238_10032836	Ga0105238_100328364	395
414	3300009551	Ga0105238_10109655	Ga0105238_101096552	395
415	3300009553	Ga0105249_10000057	Ga0105249_10000057127	395
416	3300009553	Ga0105249_10004171	Ga0105249_1000417112	395
417	3300009553	Ga0105249_10011423	Ga0105249_100114238	395
418	3300009553	Ga0105249_10129991	Ga0105249_101299912	395
419	3300009553	Ga0105249_10143452	Ga0105249_101434522	395
420	3300010375	Ga0105239_10001572	Ga0105239_1000157217	395
421	3300010375	Ga0105239_10050445	Ga0105239_100504452	395
422	3300010375	Ga0105239_10053915	Ga0105239_100539154	395
423	3300010375	Ga0105239_10073274	Ga0105239_100732742	395
424	3300011119	Ga0105246_10016685	Ga0105246_100166852	395
425	3300011119	Ga0105246_10018512	Ga0105246_100185122	395
426	3300013102	Ga0157371_10007484	Ga0157371_100074846	395
427	3300013104	Ga0157370_10002735	Ga0157370_100027352	395
428	3300013104	Ga0157370_10018215	Ga0157370_100182156	395
429	3300013104	Ga0157370_10064903	Ga0157370_100649032	395
430	3300013105	Ga0157369_10014338	Ga0157369_100143385	395
431	3300013296	Ga0157374_10030500	Ga0157374_100305004	395
432	3300013297	Ga0157378_10000831	Ga0157378_1000083123	395
433	3300013297	Ga0157378_10076761	Ga0157378_100767612	395
434	3300013306	Ga0163162_10062818	Ga0163162_100628183	395
435	3300013306	Ga0163162_10066269	Ga0163162_100662693	395
436	3300013306	Ga0163162_10086860	Ga0163162_100868602	395
437	3300013307	Ga0157372_10000023	Ga0157372_10000023151	395
438	3300013307	Ga0157372_10008689	Ga0157372_100086893	395
439	3300013307	Ga0157372_10631504	Ga0157372_106315041	395
440	3300013308	Ga0157375_10034872	Ga0157375_100348724	395
441	3300013308	Ga0157375_10044455	Ga0157375_100444553	395
442	3300014325	Ga0163163_10005277	Ga0163163_100052772	395
443	3300014325	Ga0163163_10039757	Ga0163163_100397574	395
444	3300014325	Ga0163163_10179325	Ga0163163_101793252	395
445	3300014326	Ga0157380_10001997	Ga0157380_100019978	395
446	3300014745	Ga0157377_10005999	Ga0157377_100059994	395
447	3300014968	Ga0157379_10000015	Ga0157379_1000001565	395
448	3300014968	Ga0157379_10007816	Ga0157379_100078169	395
449	3300014968	Ga0157379_10058232	Ga0157379_100582322	395
450	3300014968	Ga0157379_10132060	Ga0157379_101320601	395
451	3300014969	Ga0157376_10028847	Ga0157376_100288472	395
452	3300017792	Ga0163161_10000872	Ga0163161_1000087211	395
453	3300017792	Ga0163161_10005938	Ga0163161_100059388	395
454	3300020070	Ga0206356_10857683	Ga0206356_108576831	395
455	3300020610	Ga0154015_1696953	Ga0154015_16969532	395
456	3300021384	Ga0213876_10001258	Ga0213876_100012586	395
457	3300021384	Ga0213876_10012466	Ga0213876_100124664	395
458	3300022467	Ga0224712_10050376	Ga0224712_100503761	395
459	3300025273	Ga0209673_1007257	Ga0209673_10072573	395
460	3300025303	Ga0209051_1000011	Ga0209051_1000011320	395
461	3300025303	Ga0209051_1006016	Ga0209051_10060162	395
462	3300025303	Ga0209051_1013644	Ga0209051_10136444	395
463	3300025303	Ga0209051_1016811	Ga0209051_10168114	395
464	3300025898	Ga0207692_10012087	Ga0207692_100120873	395
465	3300025899	Ga0207642_10001854	Ga0207642_100018543	395
466	3300025900	Ga0207710_10000014	Ga0207710_10000014360	395
467	3300025900	Ga0207710_10010119	Ga0207710_100101192	395
468	3300025901	Ga0207688_10000698	Ga0207688_1000069811	395
469	3300025901	Ga0207688_10000946	Ga0207688_100009466	395
470	3300025901	Ga0207688_10001700	Ga0207688_100017004	395
471	3300025904	Ga0207647_10043676	Ga0207647_100436762	395
472	3300025904	Ga0207647_10100957	Ga0207647_101009572	395
473	3300025907	Ga0207645_10015307	Ga0207645_100153074	395
474	3300025908	Ga0207643_10000326	Ga0207643_100003264	395
475	3300025909	Ga0207705_10016235	Ga0207705_100162353	395
476	3300025911	Ga0207654_10003544	Ga0207654_100035447	395
477	3300025912	Ga0207707_10033830	Ga0207707_100338303	395
478	3300025913	Ga0207695_10027320	Ga0207695_100273205	395
479	3300025914	Ga0207671_10040499	Ga0207671_100404992	395
480	3300025915	Ga0207693_10000949	Ga0207693_100009499	395
481	3300025915	Ga0207693_10001079	Ga0207693_100010798	395
482	3300025915	Ga0207693_10007135	Ga0207693_100071355	395
483	3300025916	Ga0207663_10000777	Ga0207663_100007779	395
484	3300025916	Ga0207663_10116149	Ga0207663_101161492	395
485	3300025917	Ga0207660_10001049	Ga0207660_100010493	395
486	3300025917	Ga0207660_10038877	Ga0207660_100388773	395
487	3300025918	Ga0207662_10212455	Ga0207662_102124551	395
488	3300025919	Ga0207657_10001506	Ga0207657_1000150619	395
489	3300025919	Ga0207657_10038718	Ga0207657_100387182	395
490	3300025920	Ga0207649_10005345	Ga0207649_100053454	395
491	3300025921	Ga0207652_10027502	Ga0207652_100275021	395
492	3300025925	Ga0207650_10004876	Ga0207650_100048764	395
493	3300025926	Ga0207659_10001150	Ga0207659_100011508	395
494	3300025926	Ga0207659_10099159	Ga0207659_100991592	395
495	3300025927	Ga0207687_10001698	Ga0207687_100016986	395
496	3300025927	Ga0207687_10007403	Ga0207687_100074036	395
497	3300025927	Ga0207687_10013866	Ga0207687_100138662	395
498	3300025927	Ga0207687_10016988	Ga0207687_100169884	395
499	3300025928	Ga0207700_10120108	Ga0207700_101201082	395
500	3300025929	Ga0207664_10000002	Ga0207664_10000002470	395
501	3300025931	Ga0207644_10012147	Ga0207644_100121473	395
502	3300025931	Ga0207644_10058447	Ga0207644_100584473	395
503	3300025933	Ga0207706_10002283	Ga0207706_1000228318	395
504	3300025933	Ga0207706_10099658	Ga0207706_100996581	395
505	3300025934	Ga0207686_10004275	Ga0207686_100042757	395
506	3300025935	Ga0207709_10008902	Ga0207709_100089023	395
507	3300025935	Ga0207709_10022088	Ga0207709_100220883	395
508	3300025937	Ga0207669_10000486	Ga0207669_1000048615	395
509	3300025938	Ga0207704_10008655	Ga0207704_100086553	395
510	3300025939	Ga0207665_10001059	Ga0207665_1000105918	395
511	3300025939	Ga0207665_10001980	Ga0207665_100019807	395
512	3300025939	Ga0207665_10002449	Ga0207665_100024492	395
513	3300025940	Ga0207691_10042385	Ga0207691_100423853	395
514	3300025940	Ga0207691_10053103	Ga0207691_100531032	395
515	3300025941	Ga0207711_10000056	Ga0207711_1000005610	395
516	3300025941	Ga0207711_10000242	Ga0207711_1000024237	395
517	3300025941	Ga0207711_10000967	Ga0207711_1000096719	395
518	3300025941	Ga0207711_10011062	Ga0207711_100110628	395
519	3300025942	Ga0207689_10058656	Ga0207689_100586562	395
520	3300025942	Ga0207689_10083825	Ga0207689_100838252	395
521	3300025944	Ga0207661_10025555	Ga0207661_100255553	395
522	3300025945	Ga0207679_10000518	Ga0207679_1000051825	395
523	3300025949	Ga0207667_10052382	Ga0207667_100523824	395
524	3300025961	Ga0207712_10000050	Ga0207712_1000005030	395
525	3300025961	Ga0207712_10005038	Ga0207712_100050383	395
526	3300025961	Ga0207712_10042846	Ga0207712_100428462	395
527	3300025972	Ga0207668_10000733	Ga0207668_100007333	395
528	3300025972	Ga0207668_10001475	Ga0207668_100014756	395
529	3300025972	Ga0207668_10008379	Ga0207668_100083797	395
530	3300025972	Ga0207668_10262669	Ga0207668_102626692	395
531	3300025981	Ga0207640_10002229	Ga0207640_100022296	395
532	3300025981	Ga0207640_10002522	Ga0207640_100025222	395
533	3300025986	Ga0207658_10000065	Ga0207658_1000006585	395
534	3300025986	Ga0207658_10002834	Ga0207658_1000283411	395
535	3300025986	Ga0207658_10003413	Ga0207658_100034133	395
536	3300025986	Ga0207658_10041531	Ga0207658_100415312	395
537	3300025986	Ga0207658_10053391	Ga0207658_100533912	395
538	3300026023	Ga0207677_10027108	Ga0207677_100271083	395
539	3300026035	Ga0207703_10000094	Ga0207703_1000009465	395
540	3300026035	Ga0207703_10006889	Ga0207703_100068898	395
541	3300026035	Ga0207703_10026958	Ga0207703_100269584	395
542	3300026035	Ga0207703_10056971	Ga0207703_100569713	395
543	3300026035	Ga0207703_10080017	Ga0207703_100800172	395
544	3300026041	Ga0207639_10043174	Ga0207639_100431742	395
545	3300026041	Ga0207639_10055464	Ga0207639_100554641	395
546	3300026067	Ga0207678_10006924	Ga0207678_100069249	395
547	3300026067	Ga0207678_10042150	Ga0207678_100421503	395
548	3300026067	Ga0207678_10046245	Ga0207678_100462452	395
549	3300026075	Ga0207708_10000046	Ga0207708_1000004663	395
550	3300026075	Ga0207708_10002058	Ga0207708_100020583	395
551	3300026075	Ga0207708_10004173	Ga0207708_100041738	395
552	3300026075	Ga0207708_10019544	Ga0207708_100195445	395
553	3300026078	Ga0207702_10000541	Ga0207702_1000054136	395
554	3300026088	Ga0207641_10000562	Ga0207641_1000056237	395
555	3300026088	Ga0207641_10000740	Ga0207641_1000074020	395
556	3300026088	Ga0207641_10014236	Ga0207641_100142367	395
557	3300026088	Ga0207641_10038076	Ga0207641_100380763	395
558	3300026089	Ga0207648_10002377	Ga0207648_1000237710	395
559	3300026089	Ga0207648_10077267	Ga0207648_100772671	395
560	3300026095	Ga0207676_10002174	Ga0207676_100021745	395
561	3300026116	Ga0207674_10001847	Ga0207674_100018472	395
562	3300026116	Ga0207674_10064844	Ga0207674_100648442	395
563	3300026118	Ga0207675_100001291	Ga0207675_1000012918	395
564	3300026118	Ga0207675_100110916	Ga0207675_1001109163	395
565	3300026121	Ga0207683_10000634	Ga0207683_1000063426	395
566	3300026121	Ga0207683_10000738	Ga0207683_100007389	395
567	3300026121	Ga0207683_10003326	Ga0207683_1000332613	395
568	3300026121	Ga0207683_10009633	Ga0207683_100096333	395
569	3300026142	Ga0207698_10008276	Ga0207698_100082762	395
570	3300026142	Ga0207698_10052324	Ga0207698_100523242	395
571	3300026142	Ga0207698_10135667	Ga0207698_101356672	395
572	3300027907	Ga0207428_10002331	Ga0207428_1000233118	395
573	3300027907	Ga0207428_10088600	Ga0207428_100886002	395
574	3300028379	Ga0268266_10010107	Ga0268266_100101071	395
575	3300028379	Ga0268266_10062421	Ga0268266_100624212	395
576	3300028379	Ga0268266_10110017	Ga0268266_101100172	395
577	3300028379	Ga0268266_10285149	Ga0268266_102851492	395
578	3300028380	Ga0268265_10000004	Ga0268265_1000000428	395
579	3300028381	Ga0268264_10000024	Ga0268264_1000002429	395
580	3300028381	Ga0268264_10000257	Ga0268264_1000025754	395
581	3300028381	Ga0268264_10002508	Ga0268264_1000250813	395
582	3300028381	Ga0268264_10081549	Ga0268264_100815493	395
583	3300028794	Ga0307515_10008569	Ga0307515_100085696	395
584	3300031251	Ga0265327_10009371	Ga0265327_100093718	395
585	3300031456	Ga0307513_10057511	Ga0307513_100575112	395
586	3300031728	Ga0316578_10043764	Ga0316578_100437642	395
587	3300031730	Ga0307516_10000999	Ga0307516_1000099932	395
588	3300031731	Ga0307405_10019059	Ga0307405_100190591	395
589	3300031852	Ga0307410_10008087	Ga0307410_100080872	395
590	3300031901	Ga0307406_10122790	Ga0307406_101227901	395
591	3300031911	Ga0307412_10042207	Ga0307412_100422072	395
592	3300031995	Ga0307409_100000369	Ga0307409_10000036913	395
593	3300032002	Ga0307416_100001881	Ga0307416_10000188114	395
594	3300032002	Ga0307416_100025892	Ga0307416_1000258924	395
595	3300032126	Ga0307415_100000012	Ga0307415_10000001266	395
596	3300035085	Ga0373929_0006036	Ga0373929_0006036_108_1304	395
597	3300035088	Ga0373940_0001450	Ga0373940_0001450_2961_4157	395
598	3300035121	Ga0373960_0016902	Ga0373960_0016902_67_1263	395
599	3300035691	Ga0373931_0006845	Ga0373931_0006845_346_1539	395
600	3300035691	Ga0373931_0019651	Ga0373931_0019651_987_2180	395
601	3300037418	Ga0395900_0048293	Ga0395900_0048293_856_2058	395
602	3300037466	Ga0395898_0026569	Ga0395898_0026569_2194_3396	395
603	3300037471	Ga0395905_0020862	Ga0395905_0020862_760_1962	395
604	3300037853	Ga0436364_1031907	Ga0436364_1031907_99664_100857	395
605	3300037853	Ga0436364_1038490	Ga0436364_1038490_5880_7073	395
606	3300037853	Ga0436364_1406310	Ga0436364_1406310_6494_7687	395
607	3300038443	Ga0395901_0028510	Ga0395901_0028510_4236_5438	395
608	3300039437	Ga0436365_1354167	Ga0436365_1354167_2805_3998	395
609	3300039437	Ga0436365_1605762	Ga0436365_1605762_1714_2907	395
610	3300039437	Ga0436365_1607916	Ga0436365_1607916_3509_4702	395
611	3300039437	Ga0436365_1889369	Ga0436365_1889369_18170_19363	395
612	3300039450	Ga0436363_1446743	Ga0436363_1446743_301_1494	395
613	3300041413	Ga0439465_0018051	Ga0439465_0018051_464_1657	395
614	3300041443	Ga0451789_0707078	Ga0451789_0707078_470_1663	395
615	3300041512	Ga0451853_3429478	Ga0451853_3429478_2969_4162	395
616	3300042004	Ga0439445_0004151	Ga0439445_0004151_1490_2683	395
617	3300042005	Ga0439448_0028867	Ga0439448_0028867_468_1661	395
618	3300042016	Ga0439463_001998	Ga0439463_001998_877_2067	395
619	3300042435	Ga0439434_0002590	Ga0439434_0002590_147_1340	395
620	3300042436	Ga0439435_0003483	Ga0439435_0003483_790_1983	395
621	3300044658	Ga0466972_0002859	Ga0466972_0002859_2135_3328	395
622	3300044658	Ga0466972_0036989	Ga0466972_0036989_744_1937	395
623	3300044683	Ga0466965_0003251	Ga0466965_0003251_4236_5429	395
624	3300044683	Ga0466965_0025222	Ga0466965_0025222_502_1695	395
625	3300044684	Ga0466966_0002131	Ga0466966_0002131_10323_11516	395
626	3300044693	Ga0466961_0039915	Ga0466961_0039915_660_1853	395
627	3300044694	Ga0466963_0004890	Ga0466963_0004890_4411_5604	395
628	3300044694	Ga0466963_0026683	Ga0466963_0026683_1976_3172	395
629	3300044694	Ga0466963_0187237	Ga0466963_0187237_226_1422	395
630	3300044706	Ga0466964_0033655	Ga0466964_0033655_212_1408	395
631	3300044719	Ga0466971_0005045	Ga0466971_0005045_3960_5153	395
632	3300044735	Ga0466968_0001581	Ga0466968_0001581_2533_3726	395
633	3300044735	Ga0466968_0024051	Ga0466968_0024051_951_2144	395
634	3300044765	Ga0466970_0036670	Ga0466970_0036670_1365_2558	395
635	3300044842	Ga0466957_0001403	Ga0466957_0001403_9043_10236	395
636	3300044842	Ga0466957_0080003	Ga0466957_0080003_569_1762	395
637	3300044901	Ga0466960_0001002	Ga0466960_0001002_1812_3005	395
638	3300044901	Ga0466960_0001087	Ga0466960_0001087_4318_5511	395
639	3300045049	Ga0466959_0000897	Ga0466959_0000897_7945_9138	395
640	3300045049	Ga0466959_0001476	Ga0466959_0001476_7712_8905	395
641	3300045049	Ga0466959_0017877	Ga0466959_0017877_430_1623	395
642	3300045049	Ga0466959_0027589	Ga0466959_0027589_2412_3605	395
643	3300045049	Ga0466959_0068273	Ga0466959_0068273_1088_2308	395
644	3300045836	Ga0466958_0040735	Ga0466958_0040735_639_1835	395
645	3300045836	Ga0466958_0110713	Ga0466958_0110713_441_1634	395
646	3300045976	Ga0466967_0003546	Ga0466967_0003546_5777_6970	395
647	3300045976	Ga0466967_0016973	Ga0466967_0016973_183_1379	395
648	3300045976	Ga0466967_0036918	Ga0466967_0036918_588_1781	395
649	3300045976	Ga0466967_0051161	Ga0466967_0051161_1395_2591	395
650	3300045976	Ga0466967_0188129	Ga0466967_0188129_361_1554	395
651	3300046460	Ga0495638_0000563	Ga0495638_0000563_4290_5483	395
652	3300046460	Ga0495638_0058022	Ga0495638_0058022_770_1963	395
653	3300046473	Ga0495582_0120994	Ga0495582_0120994_16_1209	395
654	3300046475	Ga0495639_0020463	Ga0495639_0020463_1154_2344	395
655	3300046476	Ga0495662_0068307	Ga0495662_0068307_157_1350	395
656	3300046499	Ga0495594_0002125	Ga0495594_0002125_4294_5490	395
657	3300046524	Ga0495648_0004975	Ga0495648_0004975_5201_6394	395
658	3300047320	Ga0495672_0083267	Ga0495672_0083267_58_1251	395
659	3300047320	Ga0495672_0103428	Ga0495672_0103428_166_1359	395
660	3300047321	Ga0495676_0045519	Ga0495676_0045519_1835_3028	395
661	3300047469	Ga0495673_0001489	Ga0495673_0001489_4702_5895	395
662	3300047472	Ga0495686_0005660	Ga0495686_0005660_897_2090	395
663	3300047673	Ga0495593_0031677	Ga0495593_0031677_596_1789	395
664	3300048903	Ga0496100_0000076	Ga0496100_0000076_32722_33915	395
665	3300048903	Ga0496100_0001035	Ga0496100_0001035_8538_9731	395
666	3300048903	Ga0496100_0001268	Ga0496100_0001268_2940_4133	395
667	3300048903	Ga0496100_0002861	Ga0496100_0002861_6502_7695	395
668	3300048904	Ga0496101_0000084	Ga0496101_0000084_25728_26921	395
669	3300048904	Ga0496101_0000094	Ga0496101_0000094_8411_9604	395
670	3300048904	Ga0496101_0024663	Ga0496101_0024663_2909_4099	395
671	3300048904	Ga0496101_0054318	Ga0496101_0054318_240_1433	395
672	3300048905	Ga0496102_0000014	Ga0496102_0000014_127582_128775	395
673	3300048905	Ga0496102_0000718	Ga0496102_0000718_24842_26035	395
674	3300048905	Ga0496102_0001481	Ga0496102_0001481_6607_7800	395
675	3300048905	Ga0496102_0003991	Ga0496102_0003991_3416_4606	395
676	3300048905	Ga0496102_0008831	Ga0496102_0008831_7080_8273	395
677	3300048905	Ga0496102_0012499	Ga0496102_0012499_5051_6244	395
678	3300048905	Ga0496102_0016217	Ga0496102_0016217_4495_5688	395
679	3300048905	Ga0496102_0174766	Ga0496102_0174766_222_1418	395
680	3300048906	Ga0496103_0000004	Ga0496103_0000004_128088_129281	395
681	3300048906	Ga0496103_0000630	Ga0496103_0000630_13651_14844	395
682	3300048906	Ga0496103_0001260	Ga0496103_0001260_10265_11458	395
683	3300048906	Ga0496103_0033606	Ga0496103_0033606_803_1996	395
684	3300048906	Ga0496103_0105726	Ga0496103_0105726_533_1726	395
685	3300048907	Ga0496104_0004329	Ga0496104_0004329_8503_9693	395
686	3300048907	Ga0496104_0005253	Ga0496104_0005253_3348_4541	395
687	3300048907	Ga0496104_0210252	Ga0496104_0210252_48_1244	395
688	3300048908	Ga0496105_0001491	Ga0496105_0001491_11909_13099	395
689	3300048908	Ga0496105_0012144	Ga0496105_0012144_4742_5935	395
690	3300048908	Ga0496105_0016809	Ga0496105_0016809_3109_4305	395
691	3300048909	Ga0496106_0002103	Ga0496106_0002103_7778_8968	395
692	3300048909	Ga0496106_0002972	Ga0496106_0002972_2024_3217	395
693	3300048909	Ga0496106_0012998	Ga0496106_0012998_1778_2971	395
694	3300048910	Ga0496107_0000270	Ga0496107_0000270_20966_22159	395
695	3300048910	Ga0496107_0001773	Ga0496107_0001773_11247_12437	395
696	3300048910	Ga0496107_0002556	Ga0496107_0002556_4812_6005	395
697	3300048910	Ga0496107_0028257	Ga0496107_0028257_2049_3242	395
698	3300048910	Ga0496107_0044087	Ga0496107_0044087_441_1634	395
699	3300048910	Ga0496107_0127549	Ga0496107_0127549_275_1468	395
700	3300048910	Ga0496107_0151894	Ga0496107_0151894_409_1602	395
701	3300048911	Ga0496108_0002468	Ga0496108_0002468_4875_6068	395
702	3300048911	Ga0496108_0004287	Ga0496108_0004287_68_1258	395
703	3300048911	Ga0496108_0006483	Ga0496108_0006483_1513_2706	395
704	3300048911	Ga0496108_0032843	Ga0496108_0032843_2787_3983	395
705	3300048912	Ga0496109_0000344	Ga0496109_0000344_20992_22185	395
706	3300048912	Ga0496109_0010406	Ga0496109_0010406_2895_4088	395
707	3300048912	Ga0496109_0054926	Ga0496109_0054926_514_1710	395
708	3300048913	Ga0496110_0014435	Ga0496110_0014435_2511_3704	395
709	3300048913	Ga0496110_0037507	Ga0496110_0037507_639_1832	395
710	3300048913	Ga0496110_0172554	Ga0496110_0172554_425_1618	395
711	3300048914	Ga0496111_0001016	Ga0496111_0001016_2475_3665	395
712	3300048914	Ga0496111_0015472	Ga0496111_0015472_1218_2411	395
713	3300048914	Ga0496111_0027683	Ga0496111_0027683_1847_3043	395
714	3300048914	Ga0496111_0096564	Ga0496111_0096564_804_2000	395
715	3300048915	Ga0496112_0032493	Ga0496112_0032493_1945_3138	395
716	3300048915	Ga0496112_0036248	Ga0496112_0036248_3576_4772	395
717	3300048915	Ga0496112_0040073	Ga0496112_0040073_1004_2197	395
718	3300048915	Ga0496112_0088623	Ga0496112_0088623_1460_2653	395
719	3300048915	Ga0496112_0095801	Ga0496112_0095801_1556_2749	395
720	3300048915	Ga0496112_0203459	Ga0496112_0203459_201_1394	395
721	3300048915	Ga0496112_0261377	Ga0496112_0261377_42_1334	395
722	3300048917	Ga0496114_0000842	Ga0496114_0000842_5663_6856	395
723	3300048917	Ga0496114_0001102	Ga0496114_0001102_6677_7870	395
724	3300048917	Ga0496114_0029191	Ga0496114_0029191_1157_2353	395
725	3300048917	Ga0496114_0127872	Ga0496114_0127872_460_1650	395
726	3300048917	Ga0496114_0149915	Ga0496114_0149915_46_1239	395
727	3300048918	Ga0496115_0018123	Ga0496115_0018123_608_1801	395
728	3300048918	Ga0496115_0079646	Ga0496115_0079646_197_1393	395
729	3300048918	Ga0496115_0147233	Ga0496115_0147233_439_1629	395
730	3300048919	Ga0496116_0000069	Ga0496116_0000069_129039_130232	395
731	3300048919	Ga0496116_0002811	Ga0496116_0002811_14632_15825	395
732	3300048920	Ga0496117_0000003	Ga0496117_0000003_1326491_1327684	395
733	3300048920	Ga0496117_0001462	Ga0496117_0001462_7982_9175	395
734	3300048920	Ga0496117_0019905	Ga0496117_0019905_2608_3801	395
735	3300048920	Ga0496117_0028936	Ga0496117_0028936_2451_3647	395
736	3300048921	Ga0496118_0000001	Ga0496118_0000001_1326494_1327687	395
737	3300048921	Ga0496118_0000236	Ga0496118_0000236_58577_59770	395
738	3300048921	Ga0496118_0012121	Ga0496118_0012121_5810_7006	395
739	3300048921	Ga0496118_0086760	Ga0496118_0086760_50_1243	395
740	3300048922	Ga0496119_0000549	Ga0496119_0000549_23127_24323	395
741	3300048922	Ga0496119_0000803	Ga0496119_0000803_35622_36815	395
742	3300048922	Ga0496119_0003615	Ga0496119_0003615_14034_15227	395
743	3300048922	Ga0496119_0005467	Ga0496119_0005467_9812_11005	395
744	3300048923	Ga0496120_0000085	Ga0496120_0000085_26449_27642	395
745	3300048923	Ga0496120_0004382	Ga0496120_0004382_9033_10229	395
746	3300048923	Ga0496120_0018927	Ga0496120_0018927_965_2158	395
747	3300048923	Ga0496120_0044947	Ga0496120_0044947_276_1469	395
748	3300048924	Ga0496121_0000016	Ga0496121_0000016_238149_239342	395
749	3300048924	Ga0496121_0000032	Ga0496121_0000032_216880_218073	395
750	3300048924	Ga0496121_0002393	Ga0496121_0002393_2619_3812	395
751	3300048925	Ga0496122_0000526	Ga0496122_0000526_57127_58320	395
752	3300048926	Ga0496123_0004458	Ga0496123_0004458_4445_5638	395
753	3300048926	Ga0496123_0050772	Ga0496123_0050772_544_1737	395
754	3300048927	Ga0496124_0000015	Ga0496124_0000015_139048_140241	395
755	3300048928	Ga0496125_0000021	Ga0496125_0000021_320460_321653	395
756	3300048929	Ga0496126_0000015	Ga0496126_0000015_320460_321653	395
757	3300048929	Ga0496126_0000067	Ga0496126_0000067_183724_184917	395
758	3300048929	Ga0496126_0005873	Ga0496126_0005873_11503_12696	395
759	3300048929	Ga0496126_0058610	Ga0496126_0058610_2172_3365	395
760	3300049569	Ga0501032_0000706	Ga0501032_0000706_24138_25331	395
761	3300049569	Ga0501032_0006930	Ga0501032_0006930_1226_2419	395
762	3300049570	Ga0501033_0009060	Ga0501033_0009060_6008_7201	395
763	3300049570	Ga0501033_0037516	Ga0501033_0037516_1611_2804	395
764	3300049571	Ga0501034_0005030	Ga0501034_0005030_6747_7940	395
765	3300049571	Ga0501034_0013263	Ga0501034_0013263_6228_7421	395
766	3300049571	Ga0501034_0076278	Ga0501034_0076278_1563_2756	395
767	3300049571	Ga0501034_0088737	Ga0501034_0088737_421_1614	395
768	3300049572	Ga0501036_0038851	Ga0501036_0038851_2725_3918	395
769	3300049573	Ga0501037_0001277	Ga0501037_0001277_5890_7083	395
770	3300049573	Ga0501037_0001845	Ga0501037_0001845_10643_11836	395
771	3300049574	Ga0501038_0000620	Ga0501038_0000620_971_2161	395
772	3300049574	Ga0501038_0013687	Ga0501038_0013687_5890_7083	395
773	3300049575	Ga0501039_0000909	Ga0501039_0000909_20080_21273	395
774	3300049575	Ga0501039_0022360	Ga0501039_0022360_3367_4560	395
775	3300049577	Ga0501041_0029441	Ga0501041_0029441_1949_3142	395
776	3300049578	Ga0501042_0019941	Ga0501042_0019941_1512_2702	395
777	3300049578	Ga0501042_0025668	Ga0501042_0025668_2732_3925	395
778	3300049579	Ga0501043_0001657	Ga0501043_0001657_1354_2547	395
779	3300049579	Ga0501043_0222802	Ga0501043_0222802_150_1340	395
780	3300049580	Ga0501046_0019678	Ga0501046_0019678_3409_4602	395
781	3300049581	Ga0501047_0004744	Ga0501047_0004744_2997_4190	395
782	3300049581	Ga0501047_0010437	Ga0501047_0010437_4660_5853	395
783	3300049581	Ga0501047_0068897	Ga0501047_0068897_120_1310	395
784	3300049582	Ga0501048_0008553	Ga0501048_0008553_4022_5212	395
785	3300049582	Ga0501048_0008968	Ga0501048_0008968_5456_6649	395
786	3300049584	Ga0501068_0181903	Ga0501068_0181903_47_1240	395
787	3300049586	Ga0501070_0000213	Ga0501070_0000213_5472_6665	395
788	3300049586	Ga0501070_0000386	Ga0501070_0000386_9570_10763	395
789	3300049587	Ga0501071_0001758	Ga0501071_0001758_4798_5991	395
790	3300049588	Ga0501072_0011692	Ga0501072_0011692_1964_3157	395
791	3300049590	Ga0501074_0090606	Ga0501074_0090606_922_2115	395
792	3300049593	Ga0501077_0101867	Ga0501077_0101867_500_1693	395
793	3300049743	Ga0501081_0028586	Ga0501081_0028586_2088_3281	395
794	3300049822	Ga0501035_0000340	Ga0501035_0000340_17013_18206	395
795	3300049822	Ga0501035_0008647	Ga0501035_0008647_6363_7556	395
796	3300049823	Ga0501044_0000380	Ga0501044_0000380_37067_38260	395
797	3300049823	Ga0501044_0082871	Ga0501044_0082871_361_1554	395
798	3300049823	Ga0501044_0104258	Ga0501044_0104258_713_1903	395
799	3300049823	Ga0501044_0213532	Ga0501044_0213532_181_1371	395
800	3300049824	Ga0501045_0007214	Ga0501045_0007214_2022_3215	395
801	3300050490	nmdc:mga03n38_1427_c1	nmdc:mga03n38_1427_c1_4548_5741	395
802	3300050490	nmdc:mga03n38_1511_c1	nmdc:mga03n38_1511_c1_1284_2477	395
803	3300050491	nmdc:mga00v17_1138_c1	nmdc:mga00v17_1138_c1_11775_12968	395
804	3300050491	nmdc:mga00v17_44455_c1	nmdc:mga00v17_44455_c1_24_1217	395
805	3300050491	nmdc:mga00v17_60940_c1	nmdc:mga00v17_60940_c1_206_1399	395
806	3300050491	nmdc:mga00v17_6740_c1	nmdc:mga00v17_6740_c1_1437_2630	395
807	3300050491	nmdc:mga00v17_8771_c1	nmdc:mga00v17_8771_c1_2045_3238	395
808	3300050491	nmdc:mga00v17_96380_c1	nmdc:mga00v17_96380_c1_369_1562	395
809	3300050492	nmdc:mga0yw44_24337_c1	nmdc:mga0yw44_24337_c1_643_1836	395
810	3300050492	nmdc:mga0yw44_780_c1	nmdc:mga0yw44_780_c1_7964_9157	395
811	3300050496	nmdc:mga07m45_13392_c1	nmdc:mga07m45_13392_c1_98_1291	395
812	3300050496	nmdc:mga07m45_21555_c1	nmdc:mga07m45_21555_c1_468_1664	395
813	3300050496	nmdc:mga07m45_27168_c1	nmdc:mga07m45_27168_c1_1245_2438	395
814	3300050496	nmdc:mga07m45_337_c1	nmdc:mga07m45_337_c1_10927_12120	395
815	3300050496	nmdc:mga07m45_84550_c1	nmdc:mga07m45_84550_c1_173_1366	395
816	3300050507	nmdc:mga05p37_16765_c1	nmdc:mga05p37_16765_c1_6851_8041	395
817	3300050507	nmdc:mga05p37_26114_c1	nmdc:mga05p37_26114_c1_2001_3200	395
818	3300050507	nmdc:mga05p37_9074_c1	nmdc:mga05p37_9074_c1_4385_5584	395
819	3300050508	nmdc:mga09592_16810_c1	nmdc:mga09592_16810_c1_76_1275	395
820	3300050508	nmdc:mga09592_62_c1	nmdc:mga09592_62_c1_58686_59885	395
821	3300050509	nmdc:mga0qj67_10555_c1	nmdc:mga0qj67_10555_c1_3126_4319	395
822	3300050509	nmdc:mga0qj67_106_c2	nmdc:mga0qj67_106_c2_4108_5307	395
823	3300050509	nmdc:mga0qj67_13793_c1	nmdc:mga0qj67_13793_c1_3383_4576	395
824	3300050510	nmdc:mga06r32_1375_c1	nmdc:mga06r32_1375_c1_19978_21177	395
825	3300050510	nmdc:mga06r32_77325_c1	nmdc:mga06r32_77325_c1_104_1303	395
826	3300050511	nmdc:mga08y16_19132_c1	nmdc:mga08y16_19132_c1_3491_4681	395
827	3300050511	nmdc:mga08y16_309796_c1	nmdc:mga08y16_309796_c1_223_1416	395
828	3300050512	nmdc:mga0n895_119551_c1	nmdc:mga0n895_119551_c1_703_1899	395
829	3300050512	nmdc:mga0n895_3029_c1	nmdc:mga0n895_3029_c1_9426_10616	395
830	3300050514	nmdc:mga08x19_8640_c1	nmdc:mga08x19_8640_c1_2475_3665	395
831	3300050515	nmdc:mga0a205_10838_c1	nmdc:mga0a205_10838_c1_2138_3328	395
832	3300050515	nmdc:mga0a205_70823_c1	nmdc:mga0a205_70823_c1_1130_2326	395
833	3300050516	nmdc:mga0sz30_3286_c1	nmdc:mga0sz30_3286_c1_3420_4613	395
834	3300050516	nmdc:mga0sz30_36543_c1	nmdc:mga0sz30_36543_c1_455_1651	395
835	3300050516	nmdc:mga0sz30_927_c1	nmdc:mga0sz30_927_c1_1207_2400	395
836	3300053080	Ga0500635_0003696	Ga0500635_0003696_548_1741	395
837	3300053087	Ga0500643_003897	Ga0500643_003897_410_1603	395
838	3300053088	Ga0500644_0008807	Ga0500644_0008807_1320_2516	395
839	3300053090	Ga0500646_0003381	Ga0500646_0003381_365_1564	395
840	3300053092	Ga0500583_0083104	Ga0500583_0083104_315_1511	395
841	3300053108	Ga0500562_004337	Ga0500562_004337_1764_2957	395
842	3300053131	Ga0500652_000479	Ga0500652_000479_11073_12266	395
843	3300053131	Ga0500652_035905	Ga0500652_035905_730_1923	395
844	3300053146	Ga0500588_0000341	Ga0500588_0000341_5350_6549	395
845	3300053153	Ga0500616_0007655	Ga0500616_0007655_5119_6312	395
846	3300053730	Ga0500645_000123	Ga0500645_000123_9209_10402	395
847	3300053730	Ga0500645_009049	Ga0500645_009049_853_2046	395
848	3300054114	Ga0501084_0202597	Ga0501084_0202597_175_1368	395
849	3300061719	Ga0466962_0010071	Ga0466962_0010071_2945_4138	395
850	iso_pu_bacteria	2501939600	2501941842	395
851	iso_pu_bacteria	2855670206	2855672226	395
852	iso_pu_bacteria	2858882152	2858888535	395
853	iso_pu_bacteria	8054704163	8054708087	395
854	iso_pu_bacteria	8054734606	8054735121	395
855	3300005435	Ga0070714_100198913	Ga0070714_1001989132	396
856	3300005617	Ga0068859_100000301	Ga0068859_10000030119	396
857	3300005617	Ga0068859_100003956	Ga0068859_1000039566	396
858	3300005841	Ga0068863_100000163	Ga0068863_10000016355	396
859	3300005842	Ga0068858_100000010	Ga0068858_100000010230	396
860	3300005842	Ga0068858_100009793	Ga0068858_1000097936	396
861	3300005844	Ga0068862_100000049	Ga0068862_10000004921	396
862	3300005937	Ga0081455_10010864	Ga0081455_100108644	396
863	3300005981	Ga0081538_10005232	Ga0081538_100052328	396
864	3300005983	Ga0081540_1051424	Ga0081540_10514242	396
865	3300006847	Ga0075431_100074231	Ga0075431_1000742313	396
866	3300006931	Ga0097620_100000301	Ga0097620_10000030132	396
867	3300006931	Ga0097620_100003956	Ga0097620_10000395611	396
868	3300009101	Ga0105247_10000111	Ga0105247_1000011110	396
869	3300009101	Ga0105247_10000834	Ga0105247_100008344	396
870	3300009147	Ga0114129_10230478	Ga0114129_102304783	396
871	3300009177	Ga0105248_10000377	Ga0105248_1000037735	396
872	3300009553	Ga0105249_10022525	Ga0105249_100225254	396
873	3300014968	Ga0157379_10000149	Ga0157379_1000014944	396
874	3300022467	Ga0224712_10056534	Ga0224712_100565342	396
875	3300025900	Ga0207710_10000107	Ga0207710_100001079	396
876	3300025900	Ga0207710_10000144	Ga0207710_1000014422	396
877	3300025941	Ga0207711_10010080	Ga0207711_100100805	396
878	3300025942	Ga0207689_10119121	Ga0207689_101191213	396
879	3300025961	Ga0207712_10012050	Ga0207712_100120502	396
880	3300026035	Ga0207703_10000002	Ga0207703_1000000245	396
881	3300028380	Ga0268265_10000017	Ga0268265_10000017127	396
882	3300028563	Ga0265319_1011896	Ga0265319_10118963	396
883	3300028666	Ga0265336_10005066	Ga0265336_100050663	396
884	3300028800	Ga0265338_10000745	Ga0265338_1000074533	396
885	3300031616	Ga0307508_10093651	Ga0307508_100936511	396
886	3300037853	Ga0436364_1554479	Ga0436364_1554479_19095_20306	396
887	3300042876	Ga0451577_0300822	Ga0451577_0300822_60_1262	396
888	3300044694	Ga0466963_0066325	Ga0466963_0066325_206_1405	396
889	3300044842	Ga0466957_0061434	Ga0466957_0061434_623_1828	396
890	3300045976	Ga0466967_0026318	Ga0466967_0026318_2085_3284	396
891	3300046471	Ga0495650_0027022	Ga0495650_0027022_58_1254	396
892	3300046499	Ga0495594_0029099	Ga0495594_0029099_829_2034	396
893	3300046499	Ga0495594_0125002	Ga0495594_0125002_50_1255	396
894	3300046507	Ga0495606_0002365	Ga0495606_0002365_17528_18727	396
895	3300046524	Ga0495648_0014101	Ga0495648_0014101_3594_4793	396
896	3300046559	Ga0495667_0158278	Ga0495667_0158278_84_1277	396
897	3300046616	Ga0495668_0000169	Ga0495668_0000169_71175_72374	396
898	3300046660	Ga0495625_0002435	Ga0495625_0002435_17439_18638	396
899	3300047323	Ga0495683_0066124	Ga0495683_0066124_404_1603	396
900	3300048091	Ga0495626_0000312	Ga0495626_0000312_25404_26603	396
901	3300048906	Ga0496103_0143998	Ga0496103_0143998_240_1439	396
902	3300048907	Ga0496104_0244539	Ga0496104_0244539_448_1641	396
903	3300048913	Ga0496110_0115056	Ga0496110_0115056_330_1523	396
904	3300048918	Ga0496115_0234302	Ga0496115_0234302_170_1363	396
905	3300048919	Ga0496116_0000578	Ga0496116_0000578_16745_17944	396
906	3300048920	Ga0496117_0021310	Ga0496117_0021310_2010_3209	396
907	3300048921	Ga0496118_0002249	Ga0496118_0002249_14820_16019	396
908	3300048922	Ga0496119_0007110	Ga0496119_0007110_8185_9384	396
909	3300048922	Ga0496119_0008226	Ga0496119_0008226_5183_6382	396
910	3300048923	Ga0496120_0000250	Ga0496120_0000250_54519_55718	396
911	3300048924	Ga0496121_0032516	Ga0496121_0032516_1040_2302	396
912	3300048924	Ga0496121_0058018	Ga0496121_0058018_452_1651	396
913	3300048929	Ga0496126_0000208	Ga0496126_0000208_42057_43256	396
914	3300048929	Ga0496126_0037045	Ga0496126_0037045_1348_2541	396
915	3300050510	nmdc:mga06r32_9570_c1	nmdc:mga06r32_9570_c1_2145_3344	396
916	3300053077	Ga0495601_0015871	Ga0495601_0015871_3293_4498	396
917	3300001989	JGI24739J22299_10039237	JGI24739J22299_100392372	397
918	3300001990	JGI24737J22298_10025874	JGI24737J22298_100258742	397
919	3300003203	JGI25406J46586_10002477	JGI25406J46586_100024772	397
920	3300005327	Ga0070658_10001192	Ga0070658_1000119211	397
921	3300005334	Ga0068869_100108312	Ga0068869_1001083121	397
922	3300005336	Ga0070680_100000297	Ga0070680_10000029726	397
923	3300005355	Ga0070671_100001748	Ga0070671_10000174816	397
924	3300005366	Ga0070659_100179378	Ga0070659_1001793781	397
925	3300005441	Ga0070700_100005474	Ga0070700_1000054744	397
926	3300005458	Ga0070681_10025473	Ga0070681_100254734	397
927	3300005530	Ga0070679_100006559	Ga0070679_1000065597	397
928	3300005548	Ga0070665_100011089	Ga0070665_1000110893	397
929	3300005548	Ga0070665_100054609	Ga0070665_1000546093	397
930	3300005563	Ga0068855_100006282	Ga0068855_10000628212	397
931	3300005614	Ga0068856_100047641	Ga0068856_1000476412	397
932	3300005617	Ga0068859_100004810	Ga0068859_10000481013	397
933	3300005841	Ga0068863_100001505	Ga0068863_10000150521	397
934	3300005843	Ga0068860_100060595	Ga0068860_1000605954	397
935	3300005844	Ga0068862_100255275	Ga0068862_1002552752	397
936	3300005985	Ga0081539_10000882	Ga0081539_1000088222	397
937	3300006914	Ga0075436_100072828	Ga0075436_1000728282	397
938	3300006931	Ga0097620_100004810	Ga0097620_10000481013	397
939	3300007788	Ga0099795_10040891	Ga0099795_100408912	397
940	3300009098	Ga0105245_10080568	Ga0105245_100805681	397
941	3300009101	Ga0105247_10007205	Ga0105247_100072057	397
942	3300009147	Ga0114129_10054519	Ga0114129_100545191	397
943	3300009177	Ga0105248_10285059	Ga0105248_102850592	397
944	3300009177	Ga0105248_10401555	Ga0105248_104015551	397
945	3300009545	Ga0105237_10374459	Ga0105237_103744591	397
946	3300010375	Ga0105239_10307076	Ga0105239_103070762	397
947	3300020069	Ga0197907_10161669	Ga0197907_101616692	397
948	3300020070	Ga0206356_10255926	Ga0206356_102559261	397
949	3300020082	Ga0206353_11500815	Ga0206353_115008151	397
950	3300025900	Ga0207710_10004379	Ga0207710_100043796	397
951	3300025901	Ga0207688_10008927	Ga0207688_100089271	397
952	3300025909	Ga0207705_10014614	Ga0207705_100146146	397
953	3300025909	Ga0207705_10015019	Ga0207705_100150196	397
954	3300025912	Ga0207707_10001022	Ga0207707_1000102222	397
955	3300025917	Ga0207660_10000404	Ga0207660_100004046	397
956	3300025921	Ga0207652_10000717	Ga0207652_1000071726	397
957	3300025931	Ga0207644_10001436	Ga0207644_100014364	397
958	3300025932	Ga0207690_10149025	Ga0207690_101490252	397
959	3300025942	Ga0207689_10034419	Ga0207689_100344195	397
960	3300025949	Ga0207667_10018101	Ga0207667_100181014	397
961	3300026075	Ga0207708_10027529	Ga0207708_100275291	397
962	3300026088	Ga0207641_10170786	Ga0207641_101707862	397
963	3300026116	Ga0207674_10177825	Ga0207674_101778252	397
964	3300028379	Ga0268266_10016725	Ga0268266_100167254	397
965	3300028381	Ga0268264_10003187	Ga0268264_100031874	397
966	3300028794	Ga0307515_10099199	Ga0307515_100991991	397
967	3300030522	Ga0307512_10036831	Ga0307512_100368313	397
968	3300031456	Ga0307513_10013296	Ga0307513_100132964	397
969	3300031548	Ga0307408_100077423	Ga0307408_1000774233	397
970	3300031824	Ga0307413_10039074	Ga0307413_100390743	397
971	3300031838	Ga0307518_10014471	Ga0307518_100144714	397
972	3300031901	Ga0307406_10013548	Ga0307406_100135481	397
973	3300031995	Ga0307409_100218696	Ga0307409_1002186961	397
974	3300032002	Ga0307416_100011301	Ga0307416_1000113013	397
975	3300032002	Ga0307416_100088103	Ga0307416_1000881032	397
976	3300032004	Ga0307414_10070978	Ga0307414_100709782	397
977	3300032005	Ga0307411_10033278	Ga0307411_100332781	397
978	3300032126	Ga0307415_100077551	Ga0307415_1000775513	397
979	3300035119	Ga0373956_0000258	Ga0373956_0000258_17940_19136	397
980	3300035120	Ga0373957_0019558	Ga0373957_0019558_582_1784	397
981	3300035691	Ga0373931_0119669	Ga0373931_0119669_200_1393	397
982	3300036401	Ga0373937_0131387	Ga0373937_0131387_320_1522	397
983	3300037068	Ga0373925_0229357	Ga0373925_0229357_256_1458	397
984	3300038443	Ga0395901_0147327	Ga0395901_0147327_324_1523	397
985	3300039450	Ga0436363_0578534	Ga0436363_0578534_2043_3245	397
986	3300044683	Ga0466965_0006273	Ga0466965_0006273_1599_2792	397
987	3300044684	Ga0466966_0018665	Ga0466966_0018665_2904_4106	397
988	3300044684	Ga0466966_0046838	Ga0466966_0046838_1347_2549	397
989	3300044693	Ga0466961_0018032	Ga0466961_0018032_2901_4103	397
990	3300044693	Ga0466961_0050049	Ga0466961_0050049_670_1872	397
991	3300044693	Ga0466961_0117862	Ga0466961_0117862_390_1592	397
992	3300044694	Ga0466963_0002774	Ga0466963_0002774_2074_3276	397
993	3300044694	Ga0466963_0011650	Ga0466963_0011650_600_1793	397
994	3300044842	Ga0466957_0027046	Ga0466957_0027046_345_1547	397
995	3300045049	Ga0466959_0037300	Ga0466959_0037300_2296_3498	397
996	3300045049	Ga0466959_0129690	Ga0466959_0129690_413_1615	397
997	3300045836	Ga0466958_0006888	Ga0466958_0006888_138_1340	397
998	3300045836	Ga0466958_0039394	Ga0466958_0039394_1613_2809	397
999	3300045836	Ga0466958_0041381	Ga0466958_0041381_1131_2333	397
1000	3300045976	Ga0466967_0011765	Ga0466967_0011765_5144_6346	397
1001	3300045976	Ga0466967_0011960	Ga0466967_0011960_5002_6204	397
1002	3300045976	Ga0466967_0041552	Ga0466967_0041552_1123_2322	397
1003	3300045976	Ga0466967_0076612	Ga0466967_0076612_561_1754	397
1004	3300045976	Ga0466967_0182264	Ga0466967_0182264_187_1380	397
1005	3300045976	Ga0466967_0186768	Ga0466967_0186768_527_1729	397
1006	3300045976	Ga0466967_0341518	Ga0466967_0341518_119_1312	397
1007	3300046455	Ga0495603_0107818	Ga0495603_0107818_344_1546	397
1008	3300046461	Ga0495641_0041725	Ga0495641_0041725_408_1610	397
1009	3300046463	Ga0495653_0108174	Ga0495653_0108174_327_1529	397
1010	3300046477	Ga0495664_0089469	Ga0495664_0089469_318_1520	397
1011	3300046499	Ga0495594_0016140	Ga0495594_0016140_2555_3757	397
1012	3300046529	Ga0495652_0102062	Ga0495652_0102062_316_1518	397
1013	3300046531	Ga0495665_0020854	Ga0495665_0020854_344_1546	397
1014	3300046531	Ga0495665_0059379	Ga0495665_0059379_344_1546	397
1015	3300046533	Ga0495640_0073786	Ga0495640_0073786_817_2019	397
1016	3300046642	Ga0495634_0116644	Ga0495634_0116644_486_1688	397
1017	3300046663	Ga0495635_0107726	Ga0495635_0107726_279_1481	397
1018	3300046674	Ga0495588_0035197	Ga0495588_0035197_899_2101	397
1019	3300046684	Ga0495669_0005418	Ga0495669_0005418_4104_5306	397
1020	3300046690	Ga0495624_0105330	Ga0495624_0105330_190_1392	397
1021	3300047317	Ga0495604_0069356	Ga0495604_0069356_709_1911	397
1022	3300047319	Ga0495674_0125381	Ga0495674_0125381_327_1529	397
1023	3300047322	Ga0495680_0028397	Ga0495680_0028397_1845_3047	397
1024	3300047322	Ga0495680_0141162	Ga0495680_0141162_262_1464	397
1025	3300048904	Ga0496101_0062230	Ga0496101_0062230_1055_2257	397
1026	3300048905	Ga0496102_0000923	Ga0496102_0000923_14052_15254	397
1027	3300048905	Ga0496102_0002467	Ga0496102_0002467_8283_9485	397
1028	3300048906	Ga0496103_0000030	Ga0496103_0000030_5661_6863	397
1029	3300048913	Ga0496110_0093651	Ga0496110_0093651_54_1247	397
1030	3300048915	Ga0496112_0007119	Ga0496112_0007119_554_1756	397
1031	3300048915	Ga0496112_0096870	Ga0496112_0096870_678_1880	397
1032	3300049569	Ga0501032_0012122	Ga0501032_0012122_362_1564	397
1033	3300049571	Ga0501034_0037652	Ga0501034_0037652_1475_2689	397
1034	3300049572	Ga0501036_0144342	Ga0501036_0144342_241_1443	397
1035	3300049573	Ga0501037_0054026	Ga0501037_0054026_899_2113	397
1036	3300049574	Ga0501038_0014050	Ga0501038_0014050_1871_3085	397
1037	3300049575	Ga0501039_0178776	Ga0501039_0178776_327_1526	397
1038	3300049576	Ga0501040_0042780	Ga0501040_0042780_899_2095	397
1039	3300049577	Ga0501041_0122404	Ga0501041_0122404_16_1212	397
1040	3300049579	Ga0501043_0041148	Ga0501043_0041148_2333_3547	397
1041	3300049581	Ga0501047_0006713	Ga0501047_0006713_1468_2682	397
1042	3300049582	Ga0501048_0051146	Ga0501048_0051146_1356_2552	397
1043	3300049587	Ga0501071_0111275	Ga0501071_0111275_470_1666	397
1044	3300049823	Ga0501044_0028696	Ga0501044_0028696_4551_5765	397
1045	3300049824	Ga0501045_0050949	Ga0501045_0050949_1618_2814	397
1046	3300053085	Ga0495619_0225913	Ga0495619_0225913_59_1252	397
1047	3300053087	Ga0500643_000240	Ga0500643_000240_20120_21322	397
1048	3300060353	Ga0501082_0143043	Ga0501082_0143043_779_1972	397
1049	3300061734	Ga0530510_0103344	Ga0530510_0103344_52_1245	397
1050	3300061734	Ga0530510_0168046	Ga0530510_0168046_299_1495	397
1051	3300000549	LJQas_1002727	LJQas_10027271	398
1052	3300005347	Ga0070668_100002458	Ga0070668_1000024584	398
1053	3300005455	Ga0070663_100001468	Ga0070663_1000014688	398
1054	3300009551	Ga0105238_10008912	Ga0105238_100089125	398
1055	3300021358	Ga0213873_10000086	Ga0213873_1000008612	398
1056	3300021388	Ga0213875_10000111	Ga0213875_1000011163	398
1057	3300021388	Ga0213875_10018826	Ga0213875_100188261	398
1058	3300026067	Ga0207678_10000377	Ga0207678_100003778	398
1059	3300028794	Ga0307515_10170971	Ga0307515_101709713	398
1060	3300030521	Ga0307511_10027297	Ga0307511_100272974	398
1061	3300031507	Ga0307509_10261448	Ga0307509_102614481	398
1062	3300031824	Ga0307413_10000893	Ga0307413_100008939	398
1063	3300031838	Ga0307518_10000618	Ga0307518_1000061821	398
1064	3300033179	Ga0307507_10004395	Ga0307507_1000439517	398
1065	3300033180	Ga0307510_10022164	Ga0307510_100221646	398
1066	3300037068	Ga0373925_0089855	Ga0373925_0089855_117_1313	398
1067	3300037853	Ga0436364_0155073	Ga0436364_0155073_802_1998	398
1068	3300037853	Ga0436364_0284917	Ga0436364_0284917_795_1991	398
1069	3300037853	Ga0436364_0296067	Ga0436364_0296067_839_2035	398
1070	3300039437	Ga0436365_1453781	Ga0436365_1453781_227_1423	398
1071	3300039453	Ga0436362_0218630	Ga0436362_0218630_20043_21239	398
1072	3300044656	Ga0466969_0002252	Ga0466969_0002252_3394_4590	398
1073	3300044656	Ga0466969_0003530	Ga0466969_0003530_1634_2830	398
1074	3300044658	Ga0466972_0002059	Ga0466972_0002059_7252_8448	398
1075	3300044684	Ga0466966_0002064	Ga0466966_0002064_7338_8534	398
1076	3300044684	Ga0466966_0033312	Ga0466966_0033312_1532_2728	398
1077	3300044684	Ga0466966_0058740	Ga0466966_0058740_934_2130	398
1078	3300044693	Ga0466961_0001303	Ga0466961_0001303_2574_3770	398
1079	3300044693	Ga0466961_0069587	Ga0466961_0069587_81_1277	398
1080	3300044694	Ga0466963_0000288	Ga0466963_0000288_3269_4465	398
1081	3300044719	Ga0466971_0004672	Ga0466971_0004672_3069_4265	398
1082	3300044842	Ga0466957_0006143	Ga0466957_0006143_3624_4820	398
1083	3300045049	Ga0466959_0001547	Ga0466959_0001547_3298_4494	398
1084	3300045836	Ga0466958_0005151	Ga0466958_0005151_398_1594	398
1085	3300045976	Ga0466967_0036386	Ga0466967_0036386_468_1664	398
1086	3300050510	nmdc:mga06r32_25_c7	nmdc:mga06r32_25_c7_3996_5198	398
1087	3300061719	Ga0466962_0022948	Ga0466962_0022948_729_1925	398

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

276

425

0.99 PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

43

154

0.97 PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

291

408

0.97 PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

158

261

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2vig-assembly2.cif.gz_H	crystal structure of human short-chain acyl coa dehydrogenase	0.9735	10	395
2vig-assembly1.cif.gz_D	crystal structure of human short-chain acyl coa dehydrogenase	0.9734	10	395
2vig-assembly2.cif.gz_F	crystal structure of human short-chain acyl coa dehydrogenase	0.9724	10	395
2dvl-assembly1.cif.gz_A	crystal structure of project tt0160 from thermus thermophilus hb8	0.9714	10	390
2vig-assembly1.cif.gz_A	crystal structure of human short-chain acyl coa dehydrogenase	0.9707	10	395

ID	Description	Score	Start	End	Superfamily
af_A0A0K3AQR2_269_362_1.20.140.10	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3	0.9815	249	336	1.20.140.10
4iv6A01	Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain	0.978	10	124	1.10.540.10
af_Q9VDT1_256_405_1.20.140.10	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3	0.9767	249	395	1.20.140.10
1jqiB03	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3	0.9767	253	391	1.20.140.10
1jqiA03	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3	0.9764	253	391	1.20.140.10

ID	Description	Score	Start	End	GO Terms
AF-A0A399XYP2-F1-model_v4	deleted	0.9812	7	317
AF-A0A519UGP9-F1-model_v4	Acyl-CoA dehydrogenase	0.9787	227	391	GO:0003995
AF-A0A4Q3UBN6-F1-model_v4	Acyl-CoA dehydrogenase	0.9777	225	391	GO:0003995
AF-A0A2R6LVG2-F1-model_v4	Acyl-CoA dehydrogenase	0.9771	252	391	GO:0003995
AF-A0A6N8W020-F1-model_v4	Acyl-CoA dehydrogenase	0.9769	7	307	GO:0003995 GO:0050660

Feature Viewer

pLDDT	pTM	Quality
95.02	0.93	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F489803

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

276

425

0.99

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

43

154

0.97

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

291

408

0.97

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

158

261

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map