F489668
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1080 | 413 | 2158 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300048911|Ga0496108_0029045|Ga0496108_0029045_772_1185 |
| Length | 137 |
| Sequence | MPQTPRRKTRIILELGSGNDLHGSDYTKAAIRAVQDALHHSSLSFIRSLGIDKKTLDVEVTVGVQQPDRVDLEKVKASLPVGNITAKAVKGGLDIAGADGHDTAVIASAAVAVRVDLARLPAPTVEARPARPNVDHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 137 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 138 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 139 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 140 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 141 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 222 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 223 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 224 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 225 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 227 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 228 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 229 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 234 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 240 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 244 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 249 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 256 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 257 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 260 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 261 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 262 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 265 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 266 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 267 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 268 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 269 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 270 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 271 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 272 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 273 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 275 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 276 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 277 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 278 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 279 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 280 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 281 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 282 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 283 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 284 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 285 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 286 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 346 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 347 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 348 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 349 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 350 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 351 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 353 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 354 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 355 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 356 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 357 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 358 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 359 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 360 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 361 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 388 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 389 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 390 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 391 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 392 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 393 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 406 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 407 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 408 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 409 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 410 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 411 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.54 |
| Metatranscriptomes | 0.46 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.07 |
| Nodule | 0 |
| Rhizoplane | 8.7 |
| Rhizosphere | 83.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496108_0029045 | 3300048911 | Bacteria | 4576 |
| 2 | MBSR1b_contig_4260219 | 2162886012 | Unclassified | 947 |
| 3 | JGI24743J22301_10044734 | 3300001991 | Bacteria | 894 |
| 4 | JGI24744J21845_10109838 | 3300002077 | Bacteria | 512 |
| 5 | JGI24751J29686_10069609 | 3300002459 | Bacteria | 725 |
| 6 | JGI24751J29686_10109143 | 3300002459 | Bacteria | 579 |
| 7 | JGI25404J52841_10057163 | 3300003659 | Bacteria | 818 |
| 8 | Ga0065715_10356881 | 3300005293 | Unclassified | 942 |
| 9 | Ga0065715_10383872 | 3300005293 | Bacteria | 903 |
| 10 | Ga0065715_10404322 | 3300005293 | Bacteria | 877 |
| 11 | Ga0070658_10682941 | 3300005327 | Bacteria | 891 |
| 12 | Ga0070676_10041880 | 3300005328 | Bacteria | 2657 |
| 13 | Ga0070676_10097071 | 3300005328 | Bacteria | 1815 |
| 14 | Ga0070676_10379393 | 3300005328 | Bacteria | 979 |
| 15 | Ga0070683_100158931 | 3300005329 | Bacteria | 2144 |
| 16 | Ga0070683_101190931 | 3300005329 | Bacteria | 732 |
| 17 | Ga0070683_101593270 | 3300005329 | Bacteria | 628 |
| 18 | Ga0070690_100061985 | 3300005330 | Bacteria | 2411 |
| 19 | Ga0070690_100152708 | 3300005330 | Bacteria | 1577 |
| 20 | Ga0070690_100956809 | 3300005330 | Unclassified | 673 |
| 21 | Ga0070690_101667147 | 3300005330 | Unclassified | 518 |
| 22 | Ga0070670_100300985 | 3300005331 | Bacteria | 1403 |
| 23 | Ga0070670_100363148 | 3300005331 | Bacteria | 1273 |
| 24 | Ga0070670_100469826 | 3300005331 | Bacteria | 1116 |
| 25 | Ga0070670_100854178 | 3300005331 | Bacteria | 824 |
| 26 | Ga0070677_10018331 | 3300005333 | Bacteria | 2519 |
| 27 | Ga0068869_101167091 | 3300005334 | Bacteria | 676 |
| 28 | Ga0068869_101555409 | 3300005334 | Bacteria | 588 |
| 29 | Ga0068869_101973285 | 3300005334 | Bacteria | 524 |
| 30 | Ga0070666_10280718 | 3300005335 | Bacteria | 1184 |
| 31 | Ga0070666_10918396 | 3300005335 | Unclassified | 647 |
| 32 | Ga0070666_11121544 | 3300005335 | Bacteria | 585 |
| 33 | Ga0070680_100139963 | 3300005336 | Bacteria | 2029 |
| 34 | Ga0070682_100100892 | 3300005337 | Bacteria | 1905 |
| 35 | Ga0070682_100697237 | 3300005337 | Bacteria | 814 |
| 36 | Ga0068868_100071958 | 3300005338 | Bacteria | 2758 |
| 37 | Ga0068868_102050174 | 3300005338 | Bacteria | 543 |
| 38 | Ga0070660_100481935 | 3300005339 | Unclassified | 1031 |
| 39 | Ga0070689_100008245 | 3300005340 | Bacteria | 7329 |
| 40 | Ga0070689_101203294 | 3300005340 | Bacteria | 680 |
| 41 | Ga0070689_101231098 | 3300005340 | Bacteria | 673 |
| 42 | Ga0070689_101610806 | 3300005340 | Bacteria | 590 |
| 43 | Ga0070691_10297925 | 3300005341 | Bacteria | 880 |
| 44 | Ga0070691_10528737 | 3300005341 | Archaea | 686 |
| 45 | Ga0070687_100430502 | 3300005343 | Bacteria | 873 |
| 46 | Ga0070687_100604930 | 3300005343 | Bacteria | 754 |
| 47 | Ga0070692_10900467 | 3300005345 | Bacteria | 612 |
| 48 | Ga0070668_100331153 | 3300005347 | Bacteria | 1284 |
| 49 | Ga0070668_101239593 | 3300005347 | Bacteria | 677 |
| 50 | Ga0070669_100196560 | 3300005353 | Bacteria | 1585 |
| 51 | Ga0070669_100232123 | 3300005353 | Bacteria | 1463 |
| 52 | Ga0070669_100694827 | 3300005353 | Bacteria | 858 |
| 53 | Ga0070675_100437783 | 3300005354 | Bacteria | 1171 |
| 54 | Ga0070675_100966760 | 3300005354 | Bacteria | 781 |
| 55 | Ga0070675_101191680 | 3300005354 | Bacteria | 701 |
| 56 | Ga0070671_100021982 | 3300005355 | Bacteria | 5211 |
| 57 | Ga0070671_100097205 | 3300005355 | Bacteria | 2469 |
| 58 | Ga0070671_100293912 | 3300005355 | Bacteria | 1383 |
| 59 | Ga0070671_100494973 | 3300005355 | Bacteria | 1051 |
| 60 | Ga0070671_101082714 | 3300005355 | Bacteria | 704 |
| 61 | Ga0070674_100010635 | 3300005356 | Bacteria | 5573 |
| 62 | Ga0070674_100091041 | 3300005356 | Bacteria | 2201 |
| 63 | Ga0070674_100112052 | 3300005356 | Unclassified | 2005 |
| 64 | Ga0070674_101190419 | 3300005356 | Bacteria | 676 |
| 65 | Ga0070673_100137809 | 3300005364 | Bacteria | 2056 |
| 66 | Ga0070673_100376553 | 3300005364 | Bacteria | 1265 |
| 67 | Ga0070673_100714197 | 3300005364 | Bacteria | 921 |
| 68 | Ga0070673_101037365 | 3300005364 | Bacteria | 764 |
| 69 | Ga0070673_101275581 | 3300005364 | Bacteria | 689 |
| 70 | Ga0070688_100012110 | 3300005365 | Bacteria | 4820 |
| 71 | Ga0070688_100166754 | 3300005365 | Bacteria | 1517 |
| 72 | Ga0070688_100232401 | 3300005365 | Bacteria | 1305 |
| 73 | Ga0070688_100308013 | 3300005365 | Bacteria | 1147 |
| 74 | Ga0070667_100265825 | 3300005367 | Bacteria | 1537 |
| 75 | Ga0070667_100488528 | 3300005367 | Bacteria | 1128 |
| 76 | Ga0070667_100492452 | 3300005367 | Bacteria | 1123 |
| 77 | Ga0070667_101554231 | 3300005367 | Unclassified | 622 |
| 78 | Ga0070667_102198403 | 3300005367 | Bacteria | 520 |
| 79 | Ga0070709_10508899 | 3300005434 | Bacteria | 916 |
| 80 | Ga0070714_100018088 | 3300005435 | Bacteria | 5717 |
| 81 | Ga0070714_100411091 | 3300005435 | Bacteria | 1281 |
| 82 | Ga0070713_100006041 | 3300005436 | Bacteria | 8342 |
| 83 | Ga0070713_102305919 | 3300005436 | Unclassified | 521 |
| 84 | Ga0070710_10012582 | 3300005437 | Bacteria | 4207 |
| 85 | Ga0070710_10324158 | 3300005437 | Bacteria | 1012 |
| 86 | Ga0070710_10683561 | 3300005437 | Bacteria | 723 |
| 87 | Ga0070701_10567818 | 3300005438 | Archaea | 747 |
| 88 | Ga0070711_100073767 | 3300005439 | Bacteria | 2412 |
| 89 | Ga0070711_100087500 | 3300005439 | Bacteria | 2237 |
| 90 | Ga0070711_100470358 | 3300005439 | Bacteria | 1032 |
| 91 | Ga0070711_100481843 | 3300005439 | Bacteria | 1020 |
| 92 | Ga0070711_101811001 | 3300005439 | Bacteria | 536 |
| 93 | Ga0070705_100358165 | 3300005440 | Bacteria | 1066 |
| 94 | Ga0070700_100141999 | 3300005441 | Unclassified | 1633 |
| 95 | Ga0070700_100278901 | 3300005441 | Bacteria | 1211 |
| 96 | Ga0070694_100453665 | 3300005444 | Bacteria | 1013 |
| 97 | Ga0070694_100619898 | 3300005444 | Bacteria | 873 |
| 98 | Ga0070694_100856879 | 3300005444 | Unclassified | 748 |
| 99 | Ga0070694_101133831 | 3300005444 | Bacteria | 653 |
| 100 | Ga0070708_100616377 | 3300005445 | Bacteria | 1023 |
| 101 | Ga0070663_100740158 | 3300005455 | Bacteria | 839 |
| 102 | Ga0070663_101227116 | 3300005455 | Unclassified | 660 |
| 103 | Ga0070678_100013179 | 3300005456 | Bacteria | 5173 |
| 104 | Ga0070678_100367278 | 3300005456 | Bacteria | 1242 |
| 105 | Ga0070678_100370336 | 3300005456 | Bacteria | 1237 |
| 106 | Ga0070678_101196087 | 3300005456 | Bacteria | 705 |
| 107 | Ga0070678_101396088 | 3300005456 | Bacteria | 654 |
| 108 | Ga0070678_102122325 | 3300005456 | Unclassified | 532 |
| 109 | Ga0070662_100448392 | 3300005457 | Archaea | 1071 |
| 110 | Ga0070662_100814667 | 3300005457 | Bacteria | 794 |
| 111 | Ga0070662_101492525 | 3300005457 | Bacteria | 583 |
| 112 | Ga0070681_10053270 | 3300005458 | Bacteria | 4032 |
| 113 | Ga0070681_10175294 | 3300005458 | Bacteria | 2066 |
| 114 | Ga0070681_11384432 | 3300005458 | Bacteria | 627 |
| 115 | Ga0068867_100065628 | 3300005459 | Bacteria | 2701 |
| 116 | Ga0068867_100094632 | 3300005459 | Unclassified | 2272 |
| 117 | Ga0068867_100112116 | 3300005459 | Unclassified | 2097 |
| 118 | Ga0068867_102112168 | 3300005459 | Bacteria | 534 |
| 119 | Ga0070685_10114736 | 3300005466 | Bacteria | 1665 |
| 120 | Ga0070685_10714875 | 3300005466 | Bacteria | 732 |
| 121 | Ga0070706_101718838 | 3300005467 | Bacteria | 571 |
| 122 | Ga0070698_102155933 | 3300005471 | Bacteria | 511 |
| 123 | Ga0070699_101320493 | 3300005518 | Bacteria | 662 |
| 124 | Ga0070679_102192723 | 3300005530 | Bacteria | 502 |
| 125 | Ga0070684_101511778 | 3300005535 | Bacteria | 633 |
| 126 | Ga0070697_100047862 | 3300005536 | Bacteria | 3467 |
| 127 | Ga0068853_100288390 | 3300005539 | Unclassified | 1514 |
| 128 | Ga0070672_100033169 | 3300005543 | Bacteria | 3907 |
| 129 | Ga0070672_100877263 | 3300005543 | Bacteria | 792 |
| 130 | Ga0070686_100037537 | 3300005544 | Bacteria | 3006 |
| 131 | Ga0070686_100147549 | 3300005544 | Bacteria | 1644 |
| 132 | Ga0070686_100218993 | 3300005544 | Bacteria | 1375 |
| 133 | Ga0070686_100518435 | 3300005544 | Unclassified | 928 |
| 134 | Ga0070686_100822709 | 3300005544 | Bacteria | 750 |
| 135 | Ga0070695_101835909 | 3300005545 | Bacteria | 509 |
| 136 | Ga0070696_101876089 | 3300005546 | Bacteria | 519 |
| 137 | Ga0070665_100144680 | 3300005548 | Bacteria | 2381 |
| 138 | Ga0070665_100160208 | 3300005548 | Bacteria | 2252 |
| 139 | Ga0070704_101234262 | 3300005549 | Bacteria | 682 |
| 140 | Ga0070704_101572878 | 3300005549 | Bacteria | 606 |
| 141 | Ga0068855_101547442 | 3300005563 | Bacteria | 680 |
| 142 | Ga0070664_101617644 | 3300005564 | Bacteria | 614 |
| 143 | Ga0068857_100615154 | 3300005577 | Bacteria | 1028 |
| 144 | Ga0068854_100148929 | 3300005578 | Unclassified | 1803 |
| 145 | Ga0068856_100442780 | 3300005614 | Bacteria | 1320 |
| 146 | Ga0068856_101397198 | 3300005614 | Unclassified | 714 |
| 147 | Ga0070702_100188070 | 3300005615 | Bacteria | 1356 |
| 148 | Ga0070702_100442140 | 3300005615 | Bacteria | 941 |
| 149 | Ga0068852_100478820 | 3300005616 | Bacteria | 1237 |
| 150 | Ga0068859_100242826 | 3300005617 | Bacteria | 1890 |
| 151 | Ga0068859_100643854 | 3300005617 | Bacteria | 1152 |
| 152 | Ga0068859_100948072 | 3300005617 | Bacteria | 944 |
| 153 | Ga0068859_102333693 | 3300005617 | Unclassified | 590 |
| 154 | Ga0068864_100034477 | 3300005618 | Bacteria | 4306 |
| 155 | Ga0068864_100607863 | 3300005618 | Bacteria | 1061 |
| 156 | Ga0068864_101830320 | 3300005618 | Bacteria | 612 |
| 157 | Ga0068866_10204868 | 3300005718 | Bacteria | 1181 |
| 158 | Ga0068866_10416197 | 3300005718 | Unclassified | 871 |
| 159 | Ga0068866_11055735 | 3300005718 | Bacteria | 580 |
| 160 | Ga0068861_100048984 | 3300005719 | Bacteria | 3197 |
| 161 | Ga0068861_100416674 | 3300005719 | Bacteria | 1196 |
| 162 | Ga0068851_10537218 | 3300005834 | Unclassified | 705 |
| 163 | Ga0068863_100147772 | 3300005841 | Bacteria | 2248 |
| 164 | Ga0068863_101499723 | 3300005841 | Bacteria | 683 |
| 165 | Ga0068863_102561503 | 3300005841 | Bacteria | 519 |
| 166 | Ga0068858_100169996 | 3300005842 | Bacteria | 2055 |
| 167 | Ga0068858_100711146 | 3300005842 | Bacteria | 978 |
| 168 | Ga0068858_101110737 | 3300005842 | Bacteria | 776 |
| 169 | Ga0068858_101568770 | 3300005842 | Unclassified | 650 |
| 170 | Ga0068860_100113245 | 3300005843 | Unclassified | 2594 |
| 171 | Ga0068860_100466935 | 3300005843 | Bacteria | 1256 |
| 172 | Ga0068862_101845648 | 3300005844 | Bacteria | 614 |
| 173 | Ga0081455_10119563 | 3300005937 | Bacteria | 2077 |
| 174 | Ga0081455_10218615 | 3300005937 | Bacteria | 1414 |
| 175 | Ga0081540_1014265 | 3300005983 | Bacteria | 5102 |
| 176 | Ga0081539_10074035 | 3300005985 | Bacteria | 1815 |
| 177 | Ga0070717_10087937 | 3300006028 | Bacteria | 2618 |
| 178 | Ga0070717_10296143 | 3300006028 | Bacteria | 1437 |
| 179 | Ga0075365_10233260 | 3300006038 | Bacteria | 1292 |
| 180 | Ga0075365_10408238 | 3300006038 | Unclassified | 959 |
| 181 | Ga0075368_10001548 | 3300006042 | Bacteria | 7378 |
| 182 | Ga0075368_10053941 | 3300006042 | Bacteria | 1601 |
| 183 | Ga0075368_10105989 | 3300006042 | Bacteria | 1156 |
| 184 | Ga0075363_100019332 | 3300006048 | Bacteria | 3405 |
| 185 | Ga0075363_100022989 | 3300006048 | Bacteria | 3155 |
| 186 | Ga0075363_100166982 | 3300006048 | Bacteria | 1248 |
| 187 | Ga0075363_100477305 | 3300006048 | Bacteria | 739 |
| 188 | Ga0075363_100668681 | 3300006048 | Bacteria | 626 |
| 189 | Ga0075364_10039954 | 3300006051 | Bacteria | 3042 |
| 190 | Ga0075364_10784424 | 3300006051 | Unclassified | 650 |
| 191 | Ga0075364_10901095 | 3300006051 | Unclassified | 602 |
| 192 | Ga0075432_10269375 | 3300006058 | Bacteria | 697 |
| 193 | Ga0070715_10066757 | 3300006163 | Bacteria | 1596 |
| 194 | Ga0070715_10543114 | 3300006163 | Bacteria | 672 |
| 195 | Ga0070716_100184837 | 3300006173 | Unclassified | 1372 |
| 196 | Ga0070712_100010216 | 3300006175 | Bacteria | 5919 |
| 197 | Ga0070712_100021390 | 3300006175 | Bacteria | 4249 |
| 198 | Ga0070712_100067347 | 3300006175 | Bacteria | 2547 |
| 199 | Ga0070712_100774946 | 3300006175 | Bacteria | 822 |
| 200 | Ga0075367_10008400 | 3300006178 | Bacteria | 5348 |
| 201 | Ga0075367_10023684 | 3300006178 | Bacteria | 3457 |
| 202 | Ga0075367_10043891 | 3300006178 | Unclassified | 2618 |
| 203 | Ga0075367_10128513 | 3300006178 | Bacteria | 1565 |
| 204 | Ga0075367_10550572 | 3300006178 | Bacteria | 732 |
| 205 | Ga0075367_10604826 | 3300006178 | Unclassified | 697 |
| 206 | Ga0097621_100139994 | 3300006237 | Bacteria | 2067 |
| 207 | Ga0097621_100285398 | 3300006237 | Unclassified | 1454 |
| 208 | Ga0097621_100299593 | 3300006237 | Bacteria | 1420 |
| 209 | Ga0097621_100388902 | 3300006237 | Bacteria | 1247 |
| 210 | Ga0097621_100498479 | 3300006237 | Bacteria | 1103 |
| 211 | Ga0097621_100528984 | 3300006237 | Bacteria | 1071 |
| 212 | Ga0075370_10713067 | 3300006353 | Bacteria | 610 |
| 213 | Ga0068871_100514203 | 3300006358 | Unclassified | 1081 |
| 214 | Ga0068871_100577021 | 3300006358 | Unclassified | 1021 |
| 215 | Ga0075428_100009365 | 3300006844 | Bacteria | 10864 |
| 216 | Ga0075428_100054709 | 3300006844 | Bacteria | 4373 |
| 217 | Ga0075428_100693178 | 3300006844 | Unclassified | 1085 |
| 218 | Ga0075428_101482434 | 3300006844 | Bacteria | 711 |
| 219 | Ga0075430_100000105 | 3300006846 | Bacteria | 50527 |
| 220 | Ga0075430_100046813 | 3300006846 | Bacteria | 3652 |
| 221 | Ga0075430_100109845 | 3300006846 | Bacteria | 2300 |
| 222 | Ga0075430_100116692 | 3300006846 | Bacteria | 2225 |
| 223 | Ga0075430_100665115 | 3300006846 | Bacteria | 859 |
| 224 | Ga0075430_100733270 | 3300006846 | Bacteria | 815 |
| 225 | Ga0075431_100004380 | 3300006847 | Bacteria | 13852 |
| 226 | Ga0075431_100105157 | 3300006847 | Bacteria | 2913 |
| 227 | Ga0075433_10079299 | 3300006852 | Bacteria | 2893 |
| 228 | Ga0075433_10700635 | 3300006852 | Bacteria | 887 |
| 229 | Ga0075433_11097365 | 3300006852 | Unclassified | 692 |
| 230 | Ga0075434_100043527 | 3300006871 | Bacteria | 4453 |
| 231 | Ga0075434_100113136 | 3300006871 | Bacteria | 2726 |
| 232 | Ga0075434_101256234 | 3300006871 | Bacteria | 752 |
| 233 | Ga0075429_100061691 | 3300006880 | Bacteria | 3267 |
| 234 | Ga0075429_100064657 | 3300006880 | Bacteria | 3186 |
| 235 | Ga0075429_101803075 | 3300006880 | Bacteria | 531 |
| 236 | Ga0068865_100109949 | 3300006881 | Unclassified | 2032 |
| 237 | Ga0068865_101343345 | 3300006881 | Bacteria | 637 |
| 238 | Ga0097620_100242823 | 3300006931 | Bacteria | 1890 |
| 239 | Ga0097620_100643893 | 3300006931 | Bacteria | 1152 |
| 240 | Ga0097620_100947842 | 3300006931 | Bacteria | 944 |
| 241 | Ga0097620_102332526 | 3300006931 | Unclassified | 590 |
| 242 | Ga0075435_100012196 | 3300007076 | Bacteria | 6357 |
| 243 | Ga0075435_100122123 | 3300007076 | Unclassified | 2174 |
| 244 | Ga0075435_100355429 | 3300007076 | Bacteria | 1256 |
| 245 | Ga0075435_100627976 | 3300007076 | Bacteria | 932 |
| 246 | Ga0075435_100816392 | 3300007076 | Bacteria | 812 |
| 247 | Ga0099795_10000237 | 3300007788 | Bacteria | 9757 |
| 248 | Ga0099795_10248490 | 3300007788 | Bacteria | 766 |
| 249 | Ga0099795_10484262 | 3300007788 | Unclassified | 574 |
| 250 | Ga0099795_10643165 | 3300007788 | Bacteria | 507 |
| 251 | Ga0099795_10644003 | 3300007788 | Unclassified | 507 |
| 252 | Ga0105240_11760675 | 3300009093 | Bacteria | 646 |
| 253 | Ga0105240_12480408 | 3300009093 | Bacteria | 536 |
| 254 | Ga0111539_10046741 | 3300009094 | Bacteria | 5176 |
| 255 | Ga0111539_10088535 | 3300009094 | Bacteria | 3637 |
| 256 | Ga0111539_10343691 | 3300009094 | Bacteria | 1737 |
| 257 | Ga0111539_10815619 | 3300009094 | Bacteria | 1086 |
| 258 | Ga0111539_11487694 | 3300009094 | Unclassified | 785 |
| 259 | Ga0111539_11526924 | 3300009094 | Bacteria | 775 |
| 260 | Ga0111539_11815332 | 3300009094 | Bacteria | 707 |
| 261 | Ga0111539_11946921 | 3300009094 | Bacteria | 682 |
| 262 | Ga0111539_12212921 | 3300009094 | Bacteria | 638 |
| 263 | Ga0105245_10144669 | 3300009098 | Unclassified | 2242 |
| 264 | Ga0105245_10404063 | 3300009098 | Bacteria | 1366 |
| 265 | Ga0105245_11127963 | 3300009098 | Bacteria | 831 |
| 266 | Ga0105247_10394013 | 3300009101 | Bacteria | 985 |
| 267 | Ga0114129_10722934 | 3300009147 | Bacteria | 1277 |
| 268 | Ga0114129_13279537 | 3300009147 | Unclassified | 524 |
| 269 | Ga0105243_10232403 | 3300009148 | Unclassified | 1636 |
| 270 | Ga0105243_10267665 | 3300009148 | Bacteria | 1533 |
| 271 | Ga0105243_10532913 | 3300009148 | Bacteria | 1119 |
| 272 | Ga0105243_10999231 | 3300009148 | Bacteria | 839 |
| 273 | Ga0105241_10574815 | 3300009174 | Unclassified | 1015 |
| 274 | Ga0105242_10134234 | 3300009176 | Unclassified | 2140 |
| 275 | Ga0105242_10565481 | 3300009176 | Bacteria | 1093 |
| 276 | Ga0105242_10594238 | 3300009176 | Bacteria | 1068 |
| 277 | Ga0105242_11785344 | 3300009176 | Bacteria | 653 |
| 278 | Ga0105242_12276754 | 3300009176 | Archaea | 588 |
| 279 | Ga0105242_12515596 | 3300009176 | Unclassified | 563 |
| 280 | Ga0105248_10126790 | 3300009177 | Bacteria | 2879 |
| 281 | Ga0105248_10273984 | 3300009177 | Bacteria | 1900 |
| 282 | Ga0105248_10644158 | 3300009177 | Bacteria | 1196 |
| 283 | Ga0105237_10314451 | 3300009545 | Bacteria | 1569 |
| 284 | Ga0105238_10447867 | 3300009551 | Bacteria | 1288 |
| 285 | Ga0105238_10528541 | 3300009551 | Bacteria | 1183 |
| 286 | Ga0105238_10594881 | 3300009551 | Bacteria | 1114 |
| 287 | Ga0105238_11402622 | 3300009551 | Bacteria | 726 |
| 288 | Ga0105238_12209374 | 3300009551 | Unclassified | 585 |
| 289 | Ga0105249_10240746 | 3300009553 | Bacteria | 1789 |
| 290 | Ga0105249_10308415 | 3300009553 | Bacteria | 1590 |
| 291 | Ga0105249_10890360 | 3300009553 | Bacteria | 957 |
| 292 | Ga0099796_10004441 | 3300010159 | Bacteria | 3394 |
| 293 | Ga0099796_10076049 | 3300010159 | Bacteria | 1222 |
| 294 | Ga0099796_10118829 | 3300010159 | Bacteria | 1014 |
| 295 | Ga0099796_10149455 | 3300010159 | Bacteria | 919 |
| 296 | Ga0099796_10168623 | 3300010159 | Unclassified | 872 |
| 297 | Ga0105239_10147530 | 3300010375 | Bacteria | 2625 |
| 298 | Ga0105239_10182724 | 3300010375 | Bacteria | 2346 |
| 299 | Ga0105239_12043410 | 3300010375 | Bacteria | 666 |
| 300 | Ga0105239_12150132 | 3300010375 | Bacteria | 649 |
| 301 | Ga0105239_12922085 | 3300010375 | Bacteria | 557 |
| 302 | Ga0105246_10713859 | 3300011119 | Bacteria | 880 |
| 303 | Ga0105246_10765221 | 3300011119 | Bacteria | 853 |
| 304 | Ga0105246_11773253 | 3300011119 | Bacteria | 589 |
| 305 | Ga0105246_12162528 | 3300011119 | Unclassified | 541 |
| 306 | Ga0157345_1056034 | 3300012498 | Bacteria | 513 |
| 307 | Ga0157371_10988402 | 3300013102 | Bacteria | 641 |
| 308 | Ga0157370_10208658 | 3300013104 | Bacteria | 1811 |
| 309 | Ga0157369_10191125 | 3300013105 | Bacteria | 2151 |
| 310 | Ga0157369_10752931 | 3300013105 | Bacteria | 1002 |
| 311 | Ga0157374_11148317 | 3300013296 | Unclassified | 798 |
| 312 | Ga0157374_12927407 | 3300013296 | Bacteria | 504 |
| 313 | Ga0157378_10078036 | 3300013297 | Bacteria | 2986 |
| 314 | Ga0157378_10613782 | 3300013297 | Bacteria | 1100 |
| 315 | Ga0157378_11006540 | 3300013297 | Bacteria | 868 |
| 316 | Ga0163162_10234757 | 3300013306 | Unclassified | 1965 |
| 317 | Ga0163162_10983445 | 3300013306 | Bacteria | 954 |
| 318 | Ga0163162_10996651 | 3300013306 | Bacteria | 947 |
| 319 | Ga0163162_11003511 | 3300013306 | Bacteria | 944 |
| 320 | Ga0163162_11034772 | 3300013306 | Bacteria | 929 |
| 321 | Ga0163162_11143001 | 3300013306 | Bacteria | 883 |
| 322 | Ga0163162_11454237 | 3300013306 | Bacteria | 780 |
| 323 | Ga0157372_11513476 | 3300013307 | Unclassified | 773 |
| 324 | Ga0157375_10141049 | 3300013308 | Unclassified | 2537 |
| 325 | Ga0157375_10143093 | 3300013308 | Bacteria | 2520 |
| 326 | Ga0157375_11048789 | 3300013308 | Bacteria | 953 |
| 327 | Ga0157375_11116970 | 3300013308 | Bacteria | 923 |
| 328 | Ga0157375_12358974 | 3300013308 | Bacteria | 635 |
| 329 | Ga0163163_10039996 | 3300014325 | Bacteria | 4578 |
| 330 | Ga0163163_10040918 | 3300014325 | Bacteria | 4529 |
| 331 | Ga0163163_10141456 | 3300014325 | Bacteria | 2449 |
| 332 | Ga0163163_10500627 | 3300014325 | Bacteria | 1277 |
| 333 | Ga0163163_12308736 | 3300014325 | Bacteria | 597 |
| 334 | Ga0157380_10212170 | 3300014326 | Bacteria | 1726 |
| 335 | Ga0157380_10430760 | 3300014326 | Unclassified | 1261 |
| 336 | Ga0157380_10808699 | 3300014326 | Bacteria | 955 |
| 337 | Ga0157380_11869191 | 3300014326 | Bacteria | 660 |
| 338 | Ga0157380_12513720 | 3300014326 | Bacteria | 581 |
| 339 | Ga0157380_12720900 | 3300014326 | Bacteria | 561 |
| 340 | Ga0182008_10037470 | 3300014497 | Bacteria | 2426 |
| 341 | Ga0157377_10597083 | 3300014745 | Unclassified | 787 |
| 342 | Ga0157379_10061238 | 3300014968 | Bacteria | 3365 |
| 343 | Ga0157379_10080970 | 3300014968 | Bacteria | 2909 |
| 344 | Ga0157379_10180526 | 3300014968 | Bacteria | 1907 |
| 345 | Ga0157379_10182635 | 3300014968 | Bacteria | 1895 |
| 346 | Ga0157379_10190041 | 3300014968 | Unclassified | 1856 |
| 347 | Ga0157379_10574467 | 3300014968 | Bacteria | 1050 |
| 348 | Ga0157379_10741184 | 3300014968 | Bacteria | 924 |
| 349 | Ga0157379_11476544 | 3300014968 | Bacteria | 661 |
| 350 | Ga0157376_10362786 | 3300014969 | Bacteria | 1390 |
| 351 | Ga0157376_10656299 | 3300014969 | Bacteria | 1050 |
| 352 | Ga0157376_10712069 | 3300014969 | Bacteria | 1010 |
| 353 | Ga0157376_11592567 | 3300014969 | Unclassified | 687 |
| 354 | Ga0157376_12800804 | 3300014969 | Bacteria | 527 |
| 355 | Ga0157376_12861717 | 3300014969 | Bacteria | 522 |
| 356 | Ga0163161_10559249 | 3300017792 | Bacteria | 938 |
| 357 | Ga0163161_10626706 | 3300017792 | Bacteria | 889 |
| 358 | Ga0163161_10674193 | 3300017792 | Bacteria | 859 |
| 359 | Ga0163161_11091070 | 3300017792 | Bacteria | 686 |
| 360 | Ga0197907_10097918 | 3300020069 | Bacteria | 697 |
| 361 | Ga0206356_11050782 | 3300020070 | Bacteria | 905 |
| 362 | Ga0213873_10218981 | 3300021358 | Unclassified | 595 |
| 363 | Ga0213873_10287380 | 3300021358 | Unclassified | 528 |
| 364 | Ga0213874_10036744 | 3300021377 | Bacteria | 1445 |
| 365 | Ga0213876_10311092 | 3300021384 | Bacteria | 837 |
| 366 | Ga0213876_10430208 | 3300021384 | Bacteria | 702 |
| 367 | Ga0213876_10637348 | 3300021384 | Bacteria | 567 |
| 368 | Ga0213875_10033053 | 3300021388 | Bacteria | 2443 |
| 369 | Ga0213875_10075842 | 3300021388 | Bacteria | 1569 |
| 370 | Ga0213875_10181207 | 3300021388 | Bacteria | 990 |
| 371 | Ga0213875_10253154 | 3300021388 | Bacteria | 831 |
| 372 | Ga0213875_10610117 | 3300021388 | Bacteria | 527 |
| 373 | Ga0213871_10038002 | 3300021441 | Bacteria | 1284 |
| 374 | Ga0213871_10224737 | 3300021441 | Bacteria | 591 |
| 375 | Ga0224712_10282220 | 3300022467 | Bacteria | 773 |
| 376 | Ga0207697_10051203 | 3300025315 | Bacteria | 1706 |
| 377 | Ga0207697_10212777 | 3300025315 | Bacteria | 852 |
| 378 | Ga0207656_10412852 | 3300025321 | Archaea | 679 |
| 379 | Ga0207682_10002121 | 3300025893 | Bacteria | 8985 |
| 380 | Ga0207692_10019780 | 3300025898 | Bacteria | 3049 |
| 381 | Ga0207692_10074755 | 3300025898 | Bacteria | 1796 |
| 382 | Ga0207692_10142181 | 3300025898 | Bacteria | 1366 |
| 383 | Ga0207692_10918782 | 3300025898 | Bacteria | 576 |
| 384 | Ga0207642_10062410 | 3300025899 | Bacteria | 1738 |
| 385 | Ga0207642_10113498 | 3300025899 | Bacteria | 1384 |
| 386 | Ga0207710_10103719 | 3300025900 | Bacteria | 1344 |
| 387 | Ga0207710_10265117 | 3300025900 | Unclassified | 862 |
| 388 | Ga0207710_10375025 | 3300025900 | Bacteria | 727 |
| 389 | Ga0207688_10002666 | 3300025901 | Bacteria | 9666 |
| 390 | Ga0207688_10119204 | 3300025901 | Bacteria | 1538 |
| 391 | Ga0207680_10597418 | 3300025903 | Bacteria | 789 |
| 392 | Ga0207680_10718056 | 3300025903 | Bacteria | 716 |
| 393 | Ga0207647_10143742 | 3300025904 | Bacteria | 1397 |
| 394 | Ga0207685_10202433 | 3300025905 | Bacteria | 933 |
| 395 | Ga0207699_10018475 | 3300025906 | Bacteria | 3695 |
| 396 | Ga0207699_10031241 | 3300025906 | Bacteria | 2988 |
| 397 | Ga0207645_10072434 | 3300025907 | Unclassified | 2205 |
| 398 | Ga0207645_10297726 | 3300025907 | Archaea | 1074 |
| 399 | Ga0207643_10001626 | 3300025908 | Bacteria | 12666 |
| 400 | Ga0207654_10227211 | 3300025911 | Bacteria | 1241 |
| 401 | Ga0207707_10041293 | 3300025912 | Bacteria | 4029 |
| 402 | Ga0207707_10239271 | 3300025912 | Bacteria | 1578 |
| 403 | Ga0207695_10818353 | 3300025913 | Bacteria | 811 |
| 404 | Ga0207671_10581599 | 3300025914 | Unclassified | 893 |
| 405 | Ga0207693_10002165 | 3300025915 | Bacteria | 17116 |
| 406 | Ga0207693_10019034 | 3300025915 | Bacteria | 5465 |
| 407 | Ga0207693_10020506 | 3300025915 | Bacteria | 5257 |
| 408 | Ga0207693_10059066 | 3300025915 | Bacteria | 3004 |
| 409 | Ga0207693_10118265 | 3300025915 | Bacteria | 2081 |
| 410 | Ga0207693_10825551 | 3300025915 | Bacteria | 714 |
| 411 | Ga0207663_10096820 | 3300025916 | Bacteria | 1972 |
| 412 | Ga0207663_10160863 | 3300025916 | Bacteria | 1585 |
| 413 | Ga0207663_10324986 | 3300025916 | Bacteria | 1157 |
| 414 | Ga0207663_10391016 | 3300025916 | Unclassified | 1061 |
| 415 | Ga0207660_11179160 | 3300025917 | Unclassified | 623 |
| 416 | Ga0207662_10018906 | 3300025918 | Bacteria | 3913 |
| 417 | Ga0207662_10055750 | 3300025918 | Bacteria | 2359 |
| 418 | Ga0207662_10298923 | 3300025918 | Bacteria | 1069 |
| 419 | Ga0207662_10318072 | 3300025918 | Bacteria | 1038 |
| 420 | Ga0207657_11063039 | 3300025919 | Unclassified | 619 |
| 421 | Ga0207649_10269993 | 3300025920 | Unclassified | 1232 |
| 422 | Ga0207681_10139159 | 3300025923 | Bacteria | 1806 |
| 423 | Ga0207681_10546994 | 3300025923 | Bacteria | 952 |
| 424 | Ga0207681_10811169 | 3300025923 | Bacteria | 782 |
| 425 | Ga0207694_10159945 | 3300025924 | Bacteria | 1819 |
| 426 | Ga0207694_10357405 | 3300025924 | Bacteria | 1210 |
| 427 | Ga0207694_11570724 | 3300025924 | Bacteria | 555 |
| 428 | Ga0207650_10535049 | 3300025925 | Bacteria | 981 |
| 429 | Ga0207650_11707555 | 3300025925 | Bacteria | 533 |
| 430 | Ga0207659_10114491 | 3300025926 | Bacteria | 2056 |
| 431 | Ga0207659_10304725 | 3300025926 | Bacteria | 1310 |
| 432 | Ga0207659_10686868 | 3300025926 | Bacteria | 876 |
| 433 | Ga0207659_11398385 | 3300025926 | Bacteria | 600 |
| 434 | Ga0207687_10251508 | 3300025927 | Bacteria | 1405 |
| 435 | Ga0207687_10583043 | 3300025927 | Bacteria | 941 |
| 436 | Ga0207687_10862949 | 3300025927 | Archaea | 774 |
| 437 | Ga0207687_11051871 | 3300025927 | Bacteria | 698 |
| 438 | Ga0207700_10043243 | 3300025928 | Bacteria | 3308 |
| 439 | Ga0207700_10062858 | 3300025928 | Bacteria | 2821 |
| 440 | Ga0207700_10200541 | 3300025928 | Bacteria | 1681 |
| 441 | Ga0207664_10045279 | 3300025929 | Bacteria | 3450 |
| 442 | Ga0207664_10141638 | 3300025929 | Bacteria | 2035 |
| 443 | Ga0207664_11038804 | 3300025929 | Bacteria | 734 |
| 444 | Ga0207644_10022359 | 3300025931 | Bacteria | 4320 |
| 445 | Ga0207644_10164837 | 3300025931 | Unclassified | 1726 |
| 446 | Ga0207644_10371102 | 3300025931 | Bacteria | 1166 |
| 447 | Ga0207644_10420522 | 3300025931 | Bacteria | 1095 |
| 448 | Ga0207644_10974366 | 3300025931 | Unclassified | 711 |
| 449 | Ga0207644_11696951 | 3300025931 | Bacteria | 529 |
| 450 | Ga0207706_10450313 | 3300025933 | Archaea | 1113 |
| 451 | Ga0207706_10624228 | 3300025933 | Bacteria | 924 |
| 452 | Ga0207706_10703844 | 3300025933 | Bacteria | 863 |
| 453 | Ga0207706_11146315 | 3300025933 | Bacteria | 648 |
| 454 | Ga0207686_10220929 | 3300025934 | Bacteria | 1368 |
| 455 | Ga0207709_10095854 | 3300025935 | Unclassified | 1950 |
| 456 | Ga0207709_10435668 | 3300025935 | Bacteria | 1010 |
| 457 | Ga0207709_10515850 | 3300025935 | Bacteria | 935 |
| 458 | Ga0207670_10008201 | 3300025936 | Bacteria | 5881 |
| 459 | Ga0207670_10091586 | 3300025936 | Bacteria | 2150 |
| 460 | Ga0207670_10323300 | 3300025936 | Bacteria | 1214 |
| 461 | Ga0207670_10506007 | 3300025936 | Bacteria | 981 |
| 462 | Ga0207670_10561950 | 3300025936 | Bacteria | 933 |
| 463 | Ga0207670_11435635 | 3300025936 | Bacteria | 586 |
| 464 | Ga0207669_10021845 | 3300025937 | Bacteria | 3387 |
| 465 | Ga0207669_11140088 | 3300025937 | Bacteria | 659 |
| 466 | Ga0207704_10150491 | 3300025938 | Bacteria | 1641 |
| 467 | Ga0207704_11223383 | 3300025938 | Unclassified | 641 |
| 468 | Ga0207665_10109139 | 3300025939 | Unclassified | 1942 |
| 469 | Ga0207691_10004008 | 3300025940 | Bacteria | 14283 |
| 470 | Ga0207691_10036729 | 3300025940 | Bacteria | 4539 |
| 471 | Ga0207691_10236149 | 3300025940 | Bacteria | 1582 |
| 472 | Ga0207711_10003717 | 3300025941 | Bacteria | 13152 |
| 473 | Ga0207711_10155377 | 3300025941 | Bacteria | 2067 |
| 474 | Ga0207689_10551476 | 3300025942 | Bacteria | 968 |
| 475 | Ga0207689_11349224 | 3300025942 | Bacteria | 598 |
| 476 | Ga0207661_11013620 | 3300025944 | Bacteria | 765 |
| 477 | Ga0207679_11776202 | 3300025945 | Bacteria | 564 |
| 478 | Ga0207679_11832032 | 3300025945 | Bacteria | 554 |
| 479 | Ga0207679_11930206 | 3300025945 | Bacteria | 538 |
| 480 | Ga0207667_11577902 | 3300025949 | Bacteria | 626 |
| 481 | Ga0207651_10352725 | 3300025960 | Bacteria | 1239 |
| 482 | Ga0207651_10542013 | 3300025960 | Bacteria | 1011 |
| 483 | Ga0207651_10796262 | 3300025960 | Bacteria | 838 |
| 484 | Ga0207651_11024628 | 3300025960 | Bacteria | 738 |
| 485 | Ga0207651_11046904 | 3300025960 | Bacteria | 730 |
| 486 | Ga0207651_11128646 | 3300025960 | Bacteria | 703 |
| 487 | Ga0207712_11038858 | 3300025961 | Bacteria | 728 |
| 488 | Ga0207668_10139663 | 3300025972 | Bacteria | 1861 |
| 489 | Ga0207668_10188695 | 3300025972 | Bacteria | 1632 |
| 490 | Ga0207668_10411773 | 3300025972 | Bacteria | 1145 |
| 491 | Ga0207640_11129625 | 3300025981 | Archaea | 694 |
| 492 | Ga0207658_10229899 | 3300025986 | Bacteria | 1565 |
| 493 | Ga0207658_10558407 | 3300025986 | Bacteria | 1025 |
| 494 | Ga0207658_11251445 | 3300025986 | Bacteria | 678 |
| 495 | Ga0207658_11330805 | 3300025986 | Archaea | 657 |
| 496 | Ga0207658_11427099 | 3300025986 | Archaea | 633 |
| 497 | Ga0207677_10055208 | 3300026023 | Unclassified | 2715 |
| 498 | Ga0207677_10287169 | 3300026023 | Bacteria | 1353 |
| 499 | Ga0207677_11331870 | 3300026023 | Bacteria | 660 |
| 500 | Ga0207703_10216705 | 3300026035 | Unclassified | 1710 |
| 501 | Ga0207703_10243704 | 3300026035 | Bacteria | 1617 |
| 502 | Ga0207703_11119382 | 3300026035 | Bacteria | 756 |
| 503 | Ga0207703_11662429 | 3300026035 | Archaea | 614 |
| 504 | Ga0207639_10367097 | 3300026041 | Bacteria | 1290 |
| 505 | Ga0207639_10420398 | 3300026041 | Bacteria | 1208 |
| 506 | Ga0207678_10176275 | 3300026067 | Bacteria | 1825 |
| 507 | Ga0207708_10077368 | 3300026075 | Bacteria | 2553 |
| 508 | Ga0207708_10080367 | 3300026075 | Unclassified | 2505 |
| 509 | Ga0207708_10364784 | 3300026075 | Bacteria | 1188 |
| 510 | Ga0207702_10143852 | 3300026078 | Bacteria | 2161 |
| 511 | Ga0207702_10352266 | 3300026078 | Bacteria | 1409 |
| 512 | Ga0207702_11513657 | 3300026078 | Unclassified | 664 |
| 513 | Ga0207641_10176979 | 3300026088 | Bacteria | 1951 |
| 514 | Ga0207641_10360506 | 3300026088 | Bacteria | 1388 |
| 515 | Ga0207648_10051810 | 3300026089 | Unclassified | 3587 |
| 516 | Ga0207648_10089803 | 3300026089 | Bacteria | 2685 |
| 517 | Ga0207648_10118096 | 3300026089 | Bacteria | 2331 |
| 518 | Ga0207648_11187522 | 3300026089 | Bacteria | 716 |
| 519 | Ga0207676_10035299 | 3300026095 | Bacteria | 3794 |
| 520 | Ga0207676_10417399 | 3300026095 | Bacteria | 1258 |
| 521 | Ga0207674_10952016 | 3300026116 | Bacteria | 827 |
| 522 | Ga0207674_11684355 | 3300026116 | Bacteria | 602 |
| 523 | Ga0207675_100004996 | 3300026118 | Bacteria | 12776 |
| 524 | Ga0207675_100053730 | 3300026118 | Bacteria | 3758 |
| 525 | Ga0207675_100065085 | 3300026118 | Bacteria | 3407 |
| 526 | Ga0207675_100191830 | 3300026118 | Bacteria | 1960 |
| 527 | Ga0207675_100432745 | 3300026118 | Bacteria | 1301 |
| 528 | Ga0207683_10011410 | 3300026121 | Bacteria | 7582 |
| 529 | Ga0207683_10074150 | 3300026121 | Bacteria | 3011 |
| 530 | Ga0207683_10097598 | 3300026121 | Bacteria | 2621 |
| 531 | Ga0207683_10913120 | 3300026121 | Bacteria | 815 |
| 532 | Ga0207683_10978883 | 3300026121 | Bacteria | 785 |
| 533 | Ga0207683_11025366 | 3300026121 | Bacteria | 766 |
| 534 | Ga0207683_11974257 | 3300026121 | Unclassified | 532 |
| 535 | Ga0207698_10560554 | 3300026142 | Bacteria | 1121 |
| 536 | Ga0207698_10903400 | 3300026142 | Bacteria | 890 |
| 537 | Ga0209969_1008743 | 3300027360 | Bacteria | 1440 |
| 538 | Ga0209981_1052609 | 3300027378 | Bacteria | 618 |
| 539 | Ga0209996_1044478 | 3300027395 | Bacteria | 665 |
| 540 | Ga0210000_1001244 | 3300027462 | Bacteria | 3584 |
| 541 | Ga0209995_1063794 | 3300027471 | Bacteria | 628 |
| 542 | Ga0209179_1004897 | 3300027512 | Bacteria | 2057 |
| 543 | Ga0209968_1022969 | 3300027526 | Bacteria | 1019 |
| 544 | Ga0209970_1006451 | 3300027614 | Bacteria | 1924 |
| 545 | Ga0209998_10045644 | 3300027717 | Bacteria | 1004 |
| 546 | Ga0209998_10074803 | 3300027717 | Bacteria | 813 |
| 547 | Ga0209813_10001472 | 3300027866 | Bacteria | 5291 |
| 548 | Ga0209813_10088531 | 3300027866 | Bacteria | 1035 |
| 549 | Ga0209974_10047324 | 3300027876 | Bacteria | 1440 |
| 550 | Ga0209974_10324863 | 3300027876 | Bacteria | 593 |
| 551 | Ga0207428_10022319 | 3300027907 | Bacteria | 5344 |
| 552 | Ga0207428_10226536 | 3300027907 | Bacteria | 1400 |
| 553 | Ga0207428_10271223 | 3300027907 | Bacteria | 1261 |
| 554 | Ga0207428_10454564 | 3300027907 | Unclassified | 933 |
| 555 | Ga0207428_10604411 | 3300027907 | Bacteria | 790 |
| 556 | Ga0268266_10107980 | 3300028379 | Bacteria | 2462 |
| 557 | Ga0268266_10475158 | 3300028379 | Bacteria | 1191 |
| 558 | Ga0268266_11508653 | 3300028379 | Bacteria | 648 |
| 559 | Ga0268265_10102216 | 3300028380 | Bacteria | 2318 |
| 560 | Ga0268265_10169505 | 3300028380 | Bacteria | 1864 |
| 561 | Ga0268264_10148943 | 3300028381 | Bacteria | 2096 |
| 562 | Ga0268264_10630079 | 3300028381 | Bacteria | 1059 |
| 563 | Ga0268264_10846845 | 3300028381 | Bacteria | 916 |
| 564 | Ga0265338_11085225 | 3300028800 | Bacteria | 540 |
| 565 | Ga0265320_10113003 | 3300031240 | Bacteria | 1243 |
| 566 | Ga0265325_10001561 | 3300031241 | Bacteria | 15970 |
| 567 | Ga0265325_10071089 | 3300031241 | Bacteria | 1747 |
| 568 | Ga0307513_10129091 | 3300031456 | Bacteria | 2477 |
| 569 | Ga0307513_10141461 | 3300031456 | Bacteria | 2332 |
| 570 | Ga0307408_100084100 | 3300031548 | Bacteria | 2386 |
| 571 | Ga0307408_100239410 | 3300031548 | Bacteria | 1491 |
| 572 | Ga0265342_10447970 | 3300031712 | Unclassified | 663 |
| 573 | Ga0307405_10096315 | 3300031731 | Bacteria | 1973 |
| 574 | Ga0307405_10158387 | 3300031731 | Bacteria | 1601 |
| 575 | Ga0307413_10590571 | 3300031824 | Bacteria | 907 |
| 576 | Ga0307410_10373883 | 3300031852 | Bacteria | 1145 |
| 577 | Ga0307410_11522191 | 3300031852 | Bacteria | 590 |
| 578 | Ga0307406_10542464 | 3300031901 | Bacteria | 950 |
| 579 | Ga0307407_10189684 | 3300031903 | Bacteria | 1369 |
| 580 | Ga0307416_100075944 | 3300032002 | Bacteria | 2814 |
| 581 | Ga0307416_101183455 | 3300032002 | Bacteria | 870 |
| 582 | Ga0307416_101404945 | 3300032002 | Bacteria | 804 |
| 583 | Ga0307414_10023092 | 3300032004 | Bacteria | 3937 |
| 584 | Ga0307414_11283889 | 3300032004 | Bacteria | 679 |
| 585 | Ga0307411_12006050 | 3300032005 | Bacteria | 540 |
| 586 | Ga0373958_0114118 | 3300034819 | Bacteria | 646 |
| 587 | Ga0373959_0055766 | 3300034820 | Bacteria | 864 |
| 588 | Ga0373959_0086555 | 3300034820 | Unclassified | 729 |
| 589 | Ga0373934_0004028 | 3300035086 | Bacteria | 5410 |
| 590 | Ga0373940_0039246 | 3300035088 | Unclassified | 1295 |
| 591 | Ga0373944_0087370 | 3300035089 | Unclassified | 1038 |
| 592 | Ga0373944_0120396 | 3300035089 | Bacteria | 904 |
| 593 | Ga0373944_0195323 | 3300035089 | Bacteria | 731 |
| 594 | Ga0373949_0047362 | 3300035090 | Bacteria | 1074 |
| 595 | Ga0373952_0216174 | 3300035092 | Bacteria | 567 |
| 596 | Ga0373923_0042492 | 3300035111 | Bacteria | 1878 |
| 597 | Ga0373923_0052094 | 3300035111 | Bacteria | 1719 |
| 598 | Ga0373923_0066352 | 3300035111 | Bacteria | 1542 |
| 599 | Ga0373923_0193084 | 3300035111 | Bacteria | 939 |
| 600 | Ga0373932_0019668 | 3300035112 | Bacteria | 1763 |
| 601 | Ga0373932_0098324 | 3300035112 | Bacteria | 949 |
| 602 | Ga0373936_0192065 | 3300035113 | Bacteria | 899 |
| 603 | Ga0373936_0223675 | 3300035113 | Bacteria | 835 |
| 604 | Ga0373939_0168042 | 3300035114 | Bacteria | 810 |
| 605 | Ga0373939_0270678 | 3300035114 | Bacteria | 667 |
| 606 | Ga0373945_0237625 | 3300035116 | Bacteria | 766 |
| 607 | Ga0373945_0348772 | 3300035116 | Archaea | 642 |
| 608 | Ga0373945_0456245 | 3300035116 | Bacteria | 566 |
| 609 | Ga0373953_0042164 | 3300035117 | Bacteria | 1818 |
| 610 | Ga0373953_0225441 | 3300035117 | Bacteria | 812 |
| 611 | Ga0373954_0028973 | 3300035118 | Bacteria | 2548 |
| 612 | Ga0373954_0055660 | 3300035118 | Bacteria | 1861 |
| 613 | Ga0373956_0018048 | 3300035119 | Bacteria | 2984 |
| 614 | Ga0373956_0052648 | 3300035119 | Bacteria | 1831 |
| 615 | Ga0373957_0316598 | 3300035120 | Bacteria | 663 |
| 616 | Ga0373960_0056480 | 3300035121 | Bacteria | 1179 |
| 617 | Ga0373943_0111803 | 3300035170 | Bacteria | 1442 |
| 618 | Ga0373943_0649682 | 3300035170 | Bacteria | 623 |
| 619 | Ga0373943_0650915 | 3300035170 | Unclassified | 623 |
| 620 | Ga0373946_0024327 | 3300035171 | Bacteria | 2373 |
| 621 | Ga0373946_0131635 | 3300035171 | Unclassified | 1151 |
| 622 | Ga0373955_0003869 | 3300035172 | Bacteria | 6603 |
| 623 | Ga0373955_0035900 | 3300035172 | Bacteria | 2628 |
| 624 | Ga0373942_0223436 | 3300035207 | Unclassified | 632 |
| 625 | Ga0373942_0225546 | 3300035207 | Bacteria | 629 |
| 626 | Ga0373961_0067400 | 3300035241 | Bacteria | 1100 |
| 627 | Ga0373961_0392525 | 3300035241 | Bacteria | 531 |
| 628 | Ga0373962_0183036 | 3300035242 | Unclassified | 701 |
| 629 | Ga0373962_0230964 | 3300035242 | Unclassified | 636 |
| 630 | Ga0373924_0056580 | 3300035410 | Bacteria | 1634 |
| 631 | Ga0373924_0066002 | 3300035410 | Unclassified | 1520 |
| 632 | Ga0373924_0171450 | 3300035410 | Bacteria | 954 |
| 633 | Ga0373924_0213733 | 3300035410 | Bacteria | 851 |
| 634 | Ga0373931_0005698 | 3300035691 | Bacteria | 5786 |
| 635 | Ga0373931_0039898 | 3300035691 | Bacteria | 2461 |
| 636 | Ga0373931_0212666 | 3300035691 | Bacteria | 1160 |
| 637 | Ga0373931_0266164 | 3300035691 | Bacteria | 1048 |
| 638 | Ga0373931_0623467 | 3300035691 | Unclassified | 707 |
| 639 | Ga0373931_0678489 | 3300035691 | Unclassified | 679 |
| 640 | Ga0373935_0091253 | 3300035692 | Unclassified | 1995 |
| 641 | Ga0373935_0126352 | 3300035692 | Bacteria | 1714 |
| 642 | Ga0373935_0132319 | 3300035692 | Bacteria | 1677 |
| 643 | Ga0373935_0154422 | 3300035692 | Bacteria | 1560 |
| 644 | Ga0373935_0157631 | 3300035692 | Bacteria | 1545 |
| 645 | Ga0373935_0169812 | 3300035692 | Unclassified | 1491 |
| 646 | Ga0373935_0407691 | 3300035692 | Bacteria | 977 |
| 647 | Ga0373935_0535644 | 3300035692 | Bacteria | 853 |
| 648 | Ga0373935_0573908 | 3300035692 | Bacteria | 823 |
| 649 | Ga0373927_0099605 | 3300035695 | Bacteria | 1890 |
| 650 | Ga0373927_0219964 | 3300035695 | Bacteria | 1247 |
| 651 | Ga0373927_0318478 | 3300035695 | Bacteria | 1024 |
| 652 | Ga0373927_0435138 | 3300035695 | Bacteria | 866 |
| 653 | Ga0373927_0438949 | 3300035695 | Bacteria | 862 |
| 654 | Ga0373927_0565791 | 3300035695 | Unclassified | 751 |
| 655 | Ga0373933_0002335 | 3300035724 | Bacteria | 10762 |
| 656 | Ga0373933_0019411 | 3300035724 | Bacteria | 3840 |
| 657 | Ga0373933_0155912 | 3300035724 | Unclassified | 1448 |
| 658 | Ga0373933_0433515 | 3300035724 | Bacteria | 859 |
| 659 | Ga0373947_0016135 | 3300035725 | Bacteria | 4292 |
| 660 | Ga0373947_0413828 | 3300035725 | Bacteria | 910 |
| 661 | Ga0373947_0434812 | 3300035725 | Bacteria | 888 |
| 662 | Ga0373947_0476578 | 3300035725 | Bacteria | 847 |
| 663 | Ga0373947_0773474 | 3300035725 | Bacteria | 655 |
| 664 | Ga0373947_1163844 | 3300035725 | Unclassified | 525 |
| 665 | Ga0373937_0002181 | 3300036401 | Bacteria | 16395 |
| 666 | Ga0373937_0010322 | 3300036401 | Bacteria | 8153 |
| 667 | Ga0373937_0011572 | 3300036401 | Bacteria | 7744 |
| 668 | Ga0373937_0042211 | 3300036401 | Bacteria | 4161 |
| 669 | Ga0373937_0151436 | 3300036401 | Bacteria | 2173 |
| 670 | Ga0373937_0454609 | 3300036401 | Bacteria | 1216 |
| 671 | Ga0373937_1303993 | 3300036401 | Bacteria | 674 |
| 672 | Ga0373937_1771286 | 3300036401 | Bacteria | 564 |
| 673 | Ga0373925_0011071 | 3300037068 | Bacteria | 6551 |
| 674 | Ga0373925_0042225 | 3300037068 | Bacteria | 3383 |
| 675 | Ga0373925_0159821 | 3300037068 | Unclassified | 1774 |
| 676 | Ga0373925_0339535 | 3300037068 | Bacteria | 1218 |
| 677 | Ga0373925_0536599 | 3300037068 | Bacteria | 962 |
| 678 | Ga0373925_0866219 | 3300037068 | Bacteria | 745 |
| 679 | Ga0436364_0175691 | 3300037853 | Bacteria | 1625 |
| 680 | Ga0436364_0356133 | 3300037853 | Bacteria | 4365 |
| 681 | Ga0436364_0379074 | 3300037853 | Bacteria | 1585 |
| 682 | Ga0436364_0463051 | 3300037853 | Bacteria | 716 |
| 683 | Ga0436364_0576040 | 3300037853 | Bacteria | 815 |
| 684 | Ga0436364_1088149 | 3300037853 | Bacteria | 546 |
| 685 | Ga0436364_1237915 | 3300037853 | Unclassified | 511 |
| 686 | Ga0436364_1391844 | 3300037853 | Bacteria | 628 |
| 687 | Ga0436364_1425830 | 3300037853 | Bacteria | 555 |
| 688 | Ga0395901_0186301 | 3300038443 | Bacteria | 2177 |
| 689 | Ga0395901_1295264 | 3300038443 | Bacteria | 691 |
| 690 | Ga0400483_178540 | 3300039062 | Bacteria | 1658 |
| 691 | Ga0436365_0149800 | 3300039437 | Bacteria | 774 |
| 692 | Ga0436365_0432208 | 3300039437 | Bacteria | 1009 |
| 693 | Ga0436365_0460313 | 3300039437 | Bacteria | 2282 |
| 694 | Ga0436365_0596609 | 3300039437 | Bacteria | 1133 |
| 695 | Ga0436365_0843728 | 3300039437 | Bacteria | 1963 |
| 696 | Ga0436365_1449407 | 3300039437 | Unclassified | 1070 |
| 697 | Ga0436365_1548316 | 3300039437 | Bacteria | 904 |
| 698 | Ga0436365_1737897 | 3300039437 | Bacteria | 707 |
| 699 | Ga0436360_0079681 | 3300039438 | Bacteria | 942 |
| 700 | Ga0436360_0133873 | 3300039438 | Bacteria | 574 |
| 701 | Ga0436360_0180394 | 3300039438 | Bacteria | 2538 |
| 702 | Ga0436360_0315425 | 3300039438 | Bacteria | 1984 |
| 703 | Ga0436360_0677589 | 3300039438 | Bacteria | 544 |
| 704 | Ga0436360_0824795 | 3300039438 | Bacteria | 2428 |
| 705 | Ga0436360_0908614 | 3300039438 | Bacteria | 791 |
| 706 | Ga0436360_1039402 | 3300039438 | Bacteria | 1665 |
| 707 | Ga0436360_1055705 | 3300039438 | Bacteria | 2070 |
| 708 | Ga0436360_1166351 | 3300039438 | Bacteria | 813 |
| 709 | Ga0436360_1335565 | 3300039438 | Bacteria | 1779 |
| 710 | Ga0436361_0096846 | 3300039447 | Bacteria | 888 |
| 711 | Ga0436361_0145041 | 3300039447 | Bacteria | 2253 |
| 712 | Ga0436361_0392029 | 3300039447 | Bacteria | 1644 |
| 713 | Ga0436361_0479904 | 3300039447 | Bacteria | 948 |
| 714 | Ga0436361_1186265 | 3300039447 | Bacteria | 872 |
| 715 | Ga0436363_0139467 | 3300039450 | Bacteria | 534 |
| 716 | Ga0436363_0599352 | 3300039450 | Bacteria | 4263 |
| 717 | Ga0436363_0706903 | 3300039450 | Bacteria | 2037 |
| 718 | Ga0436363_0790125 | 3300039450 | Bacteria | 680 |
| 719 | Ga0436363_0882087 | 3300039450 | Bacteria | 566 |
| 720 | Ga0436363_1136144 | 3300039450 | Bacteria | 1928 |
| 721 | Ga0436363_1238825 | 3300039450 | Bacteria | 896 |
| 722 | Ga0436362_0081622 | 3300039453 | Unclassified | 791 |
| 723 | Ga0436362_0382911 | 3300039453 | Bacteria | 2229 |
| 724 | Ga0436362_0438110 | 3300039453 | Bacteria | 515 |
| 725 | Ga0436362_0630427 | 3300039453 | Bacteria | 794 |
| 726 | Ga0436362_0703322 | 3300039453 | Bacteria | 1303 |
| 727 | Ga0436362_0839840 | 3300039453 | Bacteria | 2623 |
| 728 | Ga0436362_0859630 | 3300039453 | Bacteria | 2063 |
| 729 | Ga0439453_0000261 | 3300041408 | Bacteria | 5359 |
| 730 | Ga0451807_1683586 | 3300041486 | Unclassified | 546 |
| 731 | Ga0439431_0092706 | 3300041997 | Bacteria | 824 |
| 732 | Ga0439443_109671 | 3300042003 | Bacteria | 534 |
| 733 | Ga0439455_0066350 | 3300042012 | Bacteria | 964 |
| 734 | Ga0439435_0194581 | 3300042436 | Unclassified | 666 |
| 735 | Ga0439460_0273971 | 3300042461 | Bacteria | 586 |
| 736 | Ga0450916_025212 | 3300042530 | Bacteria | 839 |
| 737 | Ga0451577_1012585 | 3300042876 | Bacteria | 746 |
| 738 | Ga0439440_0009988 | 3300042993 | Bacteria | 1974 |
| 739 | Ga0466965_0706775 | 3300044683 | Bacteria | 579 |
| 740 | Ga0466963_0221902 | 3300044694 | Bacteria | 1324 |
| 741 | Ga0466963_0705545 | 3300044694 | Bacteria | 712 |
| 742 | Ga0466963_1082508 | 3300044694 | Unclassified | 564 |
| 743 | Ga0466960_0089059 | 3300044901 | Bacteria | 1570 |
| 744 | Ga0466967_0328347 | 3300045976 | Bacteria | 1477 |
| 745 | Ga0466967_0392450 | 3300045976 | Unclassified | 1349 |
| 746 | Ga0466967_0814996 | 3300045976 | Bacteria | 927 |
| 747 | Ga0466967_1703984 | 3300045976 | Bacteria | 628 |
| 748 | Ga0495592_0179253 | 3300046454 | Bacteria | 1444 |
| 749 | Ga0495592_0230892 | 3300046454 | Bacteria | 1232 |
| 750 | Ga0495603_0065542 | 3300046455 | Unclassified | 2141 |
| 751 | Ga0495603_0297910 | 3300046455 | Unclassified | 926 |
| 752 | Ga0495629_0121489 | 3300046459 | Bacteria | 1820 |
| 753 | Ga0495638_0005322 | 3300046460 | Bacteria | 9598 |
| 754 | Ga0495638_0023899 | 3300046460 | Bacteria | 3992 |
| 755 | Ga0495641_0055308 | 3300046461 | Unclassified | 1802 |
| 756 | Ga0495641_0159479 | 3300046461 | Bacteria | 1009 |
| 757 | Ga0495651_0019063 | 3300046462 | Bacteria | 5316 |
| 758 | Ga0495651_0163740 | 3300046462 | Bacteria | 1591 |
| 759 | Ga0495653_0214955 | 3300046463 | Bacteria | 1296 |
| 760 | Ga0495653_0363417 | 3300046463 | Bacteria | 928 |
| 761 | Ga0495580_0175190 | 3300046472 | Bacteria | 1482 |
| 762 | Ga0495580_0663978 | 3300046472 | Bacteria | 685 |
| 763 | Ga0495582_0019353 | 3300046473 | Bacteria | 3722 |
| 764 | Ga0495582_0489596 | 3300046473 | Bacteria | 711 |
| 765 | Ga0495639_0703293 | 3300046475 | Bacteria | 522 |
| 766 | Ga0495664_0000446 | 3300046477 | Bacteria | 20340 |
| 767 | Ga0495664_0224496 | 3300046477 | Bacteria | 1137 |
| 768 | Ga0495584_0015860 | 3300046491 | Bacteria | 3844 |
| 769 | Ga0495584_0309512 | 3300046491 | Unclassified | 802 |
| 770 | Ga0495584_0520368 | 3300046491 | Bacteria | 606 |
| 771 | Ga0495585_0175122 | 3300046492 | Unclassified | 1106 |
| 772 | Ga0495585_0280541 | 3300046492 | Bacteria | 824 |
| 773 | Ga0495594_0631654 | 3300046499 | Bacteria | 607 |
| 774 | Ga0495596_0128015 | 3300046500 | Unclassified | 986 |
| 775 | Ga0495608_0030865 | 3300046511 | Bacteria | 3625 |
| 776 | Ga0495608_0167506 | 3300046511 | Unclassified | 1395 |
| 777 | Ga0495608_0558529 | 3300046511 | Bacteria | 689 |
| 778 | Ga0495608_0566601 | 3300046511 | Unclassified | 684 |
| 779 | Ga0495616_0198159 | 3300046513 | Bacteria | 884 |
| 780 | Ga0495616_0230514 | 3300046513 | Archaea | 803 |
| 781 | Ga0495618_0223931 | 3300046514 | Bacteria | 1186 |
| 782 | Ga0495620_0133636 | 3300046515 | Bacteria | 973 |
| 783 | Ga0495628_0044634 | 3300046516 | Bacteria | 3525 |
| 784 | Ga0495628_0089536 | 3300046516 | Bacteria | 2383 |
| 785 | Ga0495630_0354366 | 3300046517 | Bacteria | 1123 |
| 786 | Ga0495637_0070705 | 3300046520 | Bacteria | 1409 |
| 787 | Ga0495637_0281032 | 3300046520 | Archaea | 594 |
| 788 | Ga0495663_0225568 | 3300046525 | Unclassified | 660 |
| 789 | Ga0495666_0209221 | 3300046526 | Archaea | 895 |
| 790 | Ga0495652_0140559 | 3300046529 | Bacteria | 1899 |
| 791 | Ga0495665_0041929 | 3300046531 | Bacteria | 2437 |
| 792 | Ga0495665_0431843 | 3300046531 | Bacteria | 667 |
| 793 | Ga0495640_0090123 | 3300046533 | Bacteria | 2025 |
| 794 | Ga0495640_0102202 | 3300046533 | Bacteria | 1881 |
| 795 | Ga0495640_0306113 | 3300046533 | Bacteria | 986 |
| 796 | Ga0495640_0470852 | 3300046533 | Unclassified | 766 |
| 797 | Ga0495598_0413522 | 3300046537 | Bacteria | 529 |
| 798 | Ga0495621_0430628 | 3300046539 | Bacteria | 563 |
| 799 | Ga0495645_0008204 | 3300046543 | Bacteria | 7283 |
| 800 | Ga0495645_0735150 | 3300046543 | Unclassified | 596 |
| 801 | Ga0495667_0005255 | 3300046559 | Bacteria | 8751 |
| 802 | Ga0495667_0023798 | 3300046559 | Bacteria | 4125 |
| 803 | Ga0495667_0229606 | 3300046559 | Bacteria | 1183 |
| 804 | Ga0495667_0453845 | 3300046559 | Bacteria | 805 |
| 805 | Ga0495656_0204346 | 3300046615 | Bacteria | 981 |
| 806 | Ga0495656_0432227 | 3300046615 | Archaea | 692 |
| 807 | Ga0495668_0071749 | 3300046616 | Bacteria | 1903 |
| 808 | Ga0495634_0215917 | 3300046642 | Bacteria | 1186 |
| 809 | Ga0495634_0315863 | 3300046642 | Bacteria | 942 |
| 810 | Ga0495611_0527224 | 3300046648 | Unclassified | 536 |
| 811 | Ga0495635_0005845 | 3300046663 | Bacteria | 8574 |
| 812 | Ga0495635_0172712 | 3300046663 | Bacteria | 1470 |
| 813 | Ga0495635_0292016 | 3300046663 | Bacteria | 1094 |
| 814 | Ga0495659_0223406 | 3300046664 | Bacteria | 778 |
| 815 | Ga0495657_0131459 | 3300046675 | Bacteria | 1567 |
| 816 | Ga0495657_0199719 | 3300046675 | Bacteria | 1219 |
| 817 | Ga0495657_0289480 | 3300046675 | Bacteria | 979 |
| 818 | Ga0495657_0876493 | 3300046675 | Unclassified | 511 |
| 819 | Ga0495599_0007396 | 3300046678 | Bacteria | 6658 |
| 820 | Ga0495599_0056282 | 3300046678 | Bacteria | 2461 |
| 821 | Ga0495599_0634561 | 3300046678 | Unclassified | 620 |
| 822 | Ga0495599_0718541 | 3300046678 | Unclassified | 575 |
| 823 | Ga0495646_0014797 | 3300046680 | Bacteria | 4959 |
| 824 | Ga0495646_0122527 | 3300046680 | Bacteria | 1470 |
| 825 | Ga0495658_0493680 | 3300046683 | Bacteria | 783 |
| 826 | Ga0495613_0118298 | 3300046689 | Bacteria | 1905 |
| 827 | Ga0495613_1013958 | 3300046689 | Bacteria | 533 |
| 828 | Ga0495670_0344890 | 3300046691 | Unclassified | 801 |
| 829 | Ga0495670_0498434 | 3300046691 | Unclassified | 661 |
| 830 | Ga0495589_0221069 | 3300046794 | Bacteria | 890 |
| 831 | Ga0495600_0178042 | 3300046809 | Bacteria | 1371 |
| 832 | Ga0495604_0205734 | 3300047317 | Bacteria | 1362 |
| 833 | Ga0495604_0291156 | 3300047317 | Bacteria | 1100 |
| 834 | Ga0495604_0364756 | 3300047317 | Unclassified | 957 |
| 835 | Ga0495674_0070100 | 3300047319 | Bacteria | 3030 |
| 836 | Ga0495674_0339676 | 3300047319 | Bacteria | 1221 |
| 837 | Ga0495674_0342550 | 3300047319 | Bacteria | 1215 |
| 838 | Ga0495674_0418559 | 3300047319 | Bacteria | 1080 |
| 839 | Ga0495674_0694393 | 3300047319 | Bacteria | 799 |
| 840 | Ga0495674_1134336 | 3300047319 | Bacteria | 594 |
| 841 | Ga0495674_1177692 | 3300047319 | Bacteria | 580 |
| 842 | Ga0495672_0238603 | 3300047320 | Unclassified | 889 |
| 843 | Ga0495672_0376534 | 3300047320 | Unclassified | 654 |
| 844 | Ga0495676_0449081 | 3300047321 | Bacteria | 851 |
| 845 | Ga0495680_0115796 | 3300047322 | Bacteria | 1983 |
| 846 | Ga0495680_0247350 | 3300047322 | Bacteria | 1265 |
| 847 | Ga0495680_0378499 | 3300047322 | Unclassified | 981 |
| 848 | Ga0495680_0861261 | 3300047322 | Bacteria | 588 |
| 849 | Ga0495675_0014060 | 3300047444 | Bacteria | 5059 |
| 850 | Ga0495675_0716702 | 3300047444 | Unclassified | 559 |
| 851 | Ga0495675_0724607 | 3300047444 | Bacteria | 555 |
| 852 | Ga0495677_0154978 | 3300047445 | Archaea | 883 |
| 853 | Ga0495679_090200 | 3300047446 | Bacteria | 861 |
| 854 | Ga0495684_0057347 | 3300047471 | Bacteria | 2968 |
| 855 | Ga0495684_0126792 | 3300047471 | Bacteria | 1920 |
| 856 | Ga0495684_0489509 | 3300047471 | Bacteria | 848 |
| 857 | Ga0495686_0729907 | 3300047472 | Unclassified | 503 |
| 858 | Ga0495602_0000599 | 3300048088 | Bacteria | 33832 |
| 859 | Ga0495602_0030436 | 3300048088 | Bacteria | 5119 |
| 860 | Ga0495602_0058529 | 3300048088 | Bacteria | 3372 |
| 861 | Ga0495602_0292534 | 3300048088 | Unclassified | 1195 |
| 862 | Ga0495626_0399915 | 3300048091 | Unclassified | 531 |
| 863 | Ga0496100_0022252 | 3300048903 | Bacteria | 3834 |
| 864 | Ga0496100_0112976 | 3300048903 | Bacteria | 1890 |
| 865 | Ga0496100_0182693 | 3300048903 | Bacteria | 1517 |
| 866 | Ga0496100_0457509 | 3300048903 | Unclassified | 979 |
| 867 | Ga0496101_0181217 | 3300048904 | Bacteria | 1622 |
| 868 | Ga0496101_0287948 | 3300048904 | Bacteria | 1285 |
| 869 | Ga0496101_0357290 | 3300048904 | Unclassified | 1148 |
| 870 | Ga0496101_0454929 | 3300048904 | Unclassified | 1010 |
| 871 | Ga0496102_0089407 | 3300048905 | Bacteria | 2849 |
| 872 | Ga0496102_0106489 | 3300048905 | Bacteria | 2610 |
| 873 | Ga0496102_0237896 | 3300048905 | Bacteria | 1717 |
| 874 | Ga0496102_1216927 | 3300048905 | Bacteria | 673 |
| 875 | Ga0496102_1712586 | 3300048905 | Unclassified | 546 |
| 876 | Ga0496103_0114042 | 3300048906 | Bacteria | 1718 |
| 877 | Ga0496103_0198823 | 3300048906 | Bacteria | 1289 |
| 878 | Ga0496104_0001104 | 3300048907 | Bacteria | 23081 |
| 879 | Ga0496104_0005126 | 3300048907 | Bacteria | 11438 |
| 880 | Ga0496104_0046168 | 3300048907 | Bacteria | 4101 |
| 881 | Ga0496104_0061053 | 3300048907 | Bacteria | 3572 |
| 882 | Ga0496104_0218259 | 3300048907 | Bacteria | 1819 |
| 883 | Ga0496104_0405603 | 3300048907 | Bacteria | 1275 |
| 884 | Ga0496104_0635572 | 3300048907 | Bacteria | 976 |
| 885 | Ga0496104_0992729 | 3300048907 | Unclassified | 744 |
| 886 | Ga0496105_0017200 | 3300048908 | Bacteria | 5792 |
| 887 | Ga0496105_0024151 | 3300048908 | Bacteria | 4937 |
| 888 | Ga0496105_0087536 | 3300048908 | Bacteria | 2573 |
| 889 | Ga0496105_0145898 | 3300048908 | Bacteria | 1946 |
| 890 | Ga0496105_0181150 | 3300048908 | Bacteria | 1725 |
| 891 | Ga0496105_0269703 | 3300048908 | Bacteria | 1375 |
| 892 | Ga0496105_0312684 | 3300048908 | Bacteria | 1261 |
| 893 | Ga0496105_0669455 | 3300048908 | Bacteria | 799 |
| 894 | Ga0496106_0034132 | 3300048909 | Bacteria | 3799 |
| 895 | Ga0496106_0092248 | 3300048909 | Unclassified | 2339 |
| 896 | Ga0496106_0092679 | 3300048909 | Unclassified | 2334 |
| 897 | Ga0496106_0227285 | 3300048909 | Bacteria | 1489 |
| 898 | Ga0496106_0233267 | 3300048909 | Bacteria | 1470 |
| 899 | Ga0496106_0509950 | 3300048909 | Bacteria | 966 |
| 900 | Ga0496106_0827563 | 3300048909 | Bacteria | 733 |
| 901 | Ga0496107_0042424 | 3300048910 | Unclassified | 3267 |
| 902 | Ga0496107_0077830 | 3300048910 | Bacteria | 2416 |
| 903 | Ga0496107_0346062 | 3300048910 | Bacteria | 1106 |
| 904 | Ga0496107_0379519 | 3300048910 | Bacteria | 1051 |
| 905 | Ga0496108_0083883 | 3300048911 | Unclassified | 2703 |
| 906 | Ga0496108_0106853 | 3300048911 | Bacteria | 2390 |
| 907 | Ga0496108_0275392 | 3300048911 | Bacteria | 1465 |
| 908 | Ga0496108_0363861 | 3300048911 | Bacteria | 1263 |
| 909 | Ga0496108_0382737 | 3300048911 | Bacteria | 1228 |
| 910 | Ga0496108_0476726 | 3300048911 | Bacteria | 1090 |
| 911 | Ga0496108_0547226 | 3300048911 | Bacteria | 1010 |
| 912 | Ga0496108_1127560 | 3300048911 | Bacteria | 665 |
| 913 | Ga0496108_1347490 | 3300048911 | Bacteria | 599 |
| 914 | Ga0496109_0011205 | 3300048912 | Bacteria | 7695 |
| 915 | Ga0496109_0103048 | 3300048912 | Bacteria | 2648 |
| 916 | Ga0496109_0141905 | 3300048912 | Bacteria | 2246 |
| 917 | Ga0496109_0287522 | 3300048912 | Bacteria | 1550 |
| 918 | Ga0496109_0964831 | 3300048912 | Bacteria | 790 |
| 919 | Ga0496110_0008353 | 3300048913 | Bacteria | 8331 |
| 920 | Ga0496110_0053884 | 3300048913 | Bacteria | 3537 |
| 921 | Ga0496110_0367130 | 3300048913 | Bacteria | 1311 |
| 922 | Ga0496110_0450101 | 3300048913 | Bacteria | 1173 |
| 923 | Ga0496110_1146640 | 3300048913 | Bacteria | 686 |
| 924 | Ga0496110_1532970 | 3300048913 | Bacteria | 576 |
| 925 | Ga0496110_1694021 | 3300048913 | Unclassified | 542 |
| 926 | Ga0496111_0004033 | 3300048914 | Bacteria | 9219 |
| 927 | Ga0496111_0114041 | 3300048914 | Bacteria | 1992 |
| 928 | Ga0496111_0178722 | 3300048914 | Bacteria | 1577 |
| 929 | Ga0496111_0282139 | 3300048914 | Bacteria | 1232 |
| 930 | Ga0496111_0366169 | 3300048914 | Bacteria | 1066 |
| 931 | Ga0496111_0976365 | 3300048914 | Bacteria | 608 |
| 932 | Ga0496111_0978811 | 3300048914 | Bacteria | 607 |
| 933 | Ga0496112_0092849 | 3300048915 | Bacteria | 2988 |
| 934 | Ga0496112_0099383 | 3300048915 | Bacteria | 2879 |
| 935 | Ga0496112_0366001 | 3300048915 | Bacteria | 1383 |
| 936 | Ga0496112_0455199 | 3300048915 | Bacteria | 1217 |
| 937 | Ga0496112_0484024 | 3300048915 | Bacteria | 1174 |
| 938 | Ga0496112_0630946 | 3300048915 | Bacteria | 1002 |
| 939 | Ga0496113_0025785 | 3300048916 | Bacteria | 4195 |
| 940 | Ga0496113_0146944 | 3300048916 | Unclassified | 1858 |
| 941 | Ga0496113_0156960 | 3300048916 | Bacteria | 1797 |
| 942 | Ga0496113_0551873 | 3300048916 | Bacteria | 924 |
| 943 | Ga0496113_0605370 | 3300048916 | Bacteria | 877 |
| 944 | Ga0496113_1047202 | 3300048916 | Bacteria | 641 |
| 945 | Ga0496114_0020588 | 3300048917 | Bacteria | 5355 |
| 946 | Ga0496114_0120975 | 3300048917 | Bacteria | 2251 |
| 947 | Ga0496114_0148548 | 3300048917 | Unclassified | 2032 |
| 948 | Ga0496114_0163640 | 3300048917 | Bacteria | 1936 |
| 949 | Ga0496114_0252679 | 3300048917 | Bacteria | 1551 |
| 950 | Ga0496114_0469587 | 3300048917 | Bacteria | 1113 |
| 951 | Ga0496114_1264943 | 3300048917 | Unclassified | 624 |
| 952 | Ga0496115_0021674 | 3300048918 | Bacteria | 4966 |
| 953 | Ga0496115_0212611 | 3300048918 | Unclassified | 1597 |
| 954 | Ga0496115_0225716 | 3300048918 | Bacteria | 1545 |
| 955 | Ga0496119_0075291 | 3300048922 | Bacteria | 1962 |
| 956 | Ga0496120_0016883 | 3300048923 | Bacteria | 4753 |
| 957 | Ga0501298_024594 | 3300049521 | Bacteria | 1149 |
| 958 | Ga0501031_0369623 | 3300049568 | Bacteria | 928 |
| 959 | Ga0501033_0030233 | 3300049570 | Bacteria | 4070 |
| 960 | Ga0501033_0422753 | 3300049570 | Bacteria | 928 |
| 961 | Ga0501034_0138934 | 3300049571 | Bacteria | 2410 |
| 962 | Ga0501034_0457306 | 3300049571 | Bacteria | 1194 |
| 963 | Ga0501034_0713371 | 3300049571 | Unclassified | 901 |
| 964 | Ga0501036_0648665 | 3300049572 | Bacteria | 874 |
| 965 | Ga0501036_1363107 | 3300049572 | Bacteria | 576 |
| 966 | Ga0501037_0014364 | 3300049573 | Bacteria | 5831 |
| 967 | Ga0501038_0047819 | 3300049574 | Bacteria | 3705 |
| 968 | Ga0501038_0528552 | 3300049574 | Bacteria | 899 |
| 969 | Ga0501038_1025854 | 3300049574 | Bacteria | 605 |
| 970 | Ga0501039_0223854 | 3300049575 | Bacteria | 1479 |
| 971 | Ga0501039_1569173 | 3300049575 | Bacteria | 506 |
| 972 | Ga0501041_0024249 | 3300049577 | Bacteria | 3641 |
| 973 | Ga0501041_0627895 | 3300049577 | Bacteria | 686 |
| 974 | Ga0501043_0438851 | 3300049579 | Bacteria | 983 |
| 975 | Ga0501043_1090770 | 3300049579 | Bacteria | 565 |
| 976 | Ga0501046_0496201 | 3300049580 | Bacteria | 875 |
| 977 | Ga0501047_0127351 | 3300049581 | Bacteria | 2427 |
| 978 | Ga0501047_0129823 | 3300049581 | Bacteria | 2401 |
| 979 | Ga0501047_1160851 | 3300049581 | Bacteria | 586 |
| 980 | Ga0501067_0145857 | 3300049583 | Unclassified | 1319 |
| 981 | Ga0501068_0877576 | 3300049584 | Bacteria | 590 |
| 982 | Ga0501069_0042491 | 3300049585 | Bacteria | 2515 |
| 983 | Ga0501069_0551447 | 3300049585 | Bacteria | 690 |
| 984 | Ga0501070_0233215 | 3300049586 | Bacteria | 1508 |
| 985 | Ga0501070_0377246 | 3300049586 | Bacteria | 1149 |
| 986 | Ga0501070_0800964 | 3300049586 | Unclassified | 740 |
| 987 | Ga0501070_1079820 | 3300049586 | Bacteria | 620 |
| 988 | Ga0501071_0495719 | 3300049587 | Unclassified | 937 |
| 989 | Ga0501071_0898074 | 3300049587 | Bacteria | 684 |
| 990 | Ga0501073_0359322 | 3300049589 | Bacteria | 1006 |
| 991 | Ga0501073_0443546 | 3300049589 | Bacteria | 897 |
| 992 | Ga0501073_1050036 | 3300049589 | Bacteria | 560 |
| 993 | Ga0501074_0956967 | 3300049590 | Bacteria | 602 |
| 994 | Ga0501074_1185758 | 3300049590 | Bacteria | 536 |
| 995 | Ga0501075_0236956 | 3300049591 | Bacteria | 1391 |
| 996 | Ga0501076_0035663 | 3300049592 | Bacteria | 3892 |
| 997 | Ga0501076_0826681 | 3300049592 | Bacteria | 764 |
| 998 | Ga0501077_0288904 | 3300049593 | Bacteria | 1044 |
| 999 | Ga0501077_0450948 | 3300049593 | Bacteria | 824 |
| 1000 | Ga0501080_0331543 | 3300049742 | Bacteria | 1376 |
| 1001 | Ga0501080_1402968 | 3300049742 | Bacteria | 596 |
| 1002 | Ga0501080_1767151 | 3300049742 | Bacteria | 520 |
| 1003 | Ga0501081_0313759 | 3300049743 | Bacteria | 1152 |
| 1004 | Ga0501083_0883423 | 3300049744 | Bacteria | 582 |
| 1005 | Ga0501035_0092116 | 3300049822 | Bacteria | 2667 |
| 1006 | Ga0501035_0688211 | 3300049822 | Bacteria | 826 |
| 1007 | Ga0501044_0071231 | 3300049823 | Bacteria | 3535 |
| 1008 | Ga0501044_0203380 | 3300049823 | Bacteria | 1938 |
| 1009 | nmdc:mga03n38_14547_c1 | 3300050490 | Bacteria | 3018 |
| 1010 | nmdc:mga03n38_24423_c1 | 3300050490 | Bacteria | 2471 |
| 1011 | nmdc:mga03n38_49021_c1 | 3300050490 | Bacteria | 1248 |
| 1012 | nmdc:mga00v17_553656_c1 | 3300050491 | Bacteria | 744 |
| 1013 | nmdc:mga00v17_745679_c1 | 3300050491 | Unclassified | 626 |
| 1014 | nmdc:mga00v17_93927_c1 | 3300050491 | Bacteria | 1887 |
| 1015 | nmdc:mga0yw44_35986_c2 | 3300050492 | Bacteria | 2043 |
| 1016 | nmdc:mga0yw44_52299_c1 | 3300050492 | Bacteria | 2476 |
| 1017 | nmdc:mga0yw44_85227_c1 | 3300050492 | Bacteria | 1988 |
| 1018 | nmdc:mga06z11_299_c1 | 3300050494 | Bacteria | 19034 |
| 1019 | nmdc:mga06z11_3349_c1 | 3300050494 | Bacteria | 6202 |
| 1020 | nmdc:mga06z11_755718_c1 | 3300050494 | Bacteria | 592 |
| 1021 | nmdc:mga06z11_93252_c1 | 3300050494 | Unclassified | 1639 |
| 1022 | nmdc:mga04h51_117127_c1 | 3300050495 | Bacteria | 989 |
| 1023 | nmdc:mga04h51_22862_c1 | 3300050495 | Bacteria | 1897 |
| 1024 | nmdc:mga07m45_298215_c1 | 3300050496 | Bacteria | 624 |
| 1025 | nmdc:mga05p37_1019249_c1 | 3300050507 | Bacteria | 877 |
| 1026 | nmdc:mga05p37_1403109_c1 | 3300050507 | Bacteria | 703 |
| 1027 | nmdc:mga09592_73506_c1 | 3300050508 | Bacteria | 2905 |
| 1028 | nmdc:mga09592_91201_c1 | 3300050508 | Bacteria | 2604 |
| 1029 | nmdc:mga0qj67_1379074_c1 | 3300050509 | Bacteria | 544 |
| 1030 | nmdc:mga0qj67_146531_c1 | 3300050509 | Bacteria | 1914 |
| 1031 | nmdc:mga0qj67_166450_c1 | 3300050509 | Bacteria | 1790 |
| 1032 | nmdc:mga0qj67_19_c1 | 3300050509 | Bacteria | 112208 |
| 1033 | nmdc:mga0qj67_314274_c1 | 3300050509 | Bacteria | 1268 |
| 1034 | nmdc:mga0qj67_650567_c1 | 3300050509 | Bacteria | 841 |
| 1035 | nmdc:mga0qj67_702658_c1 | 3300050509 | Bacteria | 804 |
| 1036 | nmdc:mga06r32_1198818_c1 | 3300050510 | Bacteria | 705 |
| 1037 | nmdc:mga06r32_569924_c1 | 3300050510 | Bacteria | 1105 |
| 1038 | nmdc:mga06r32_597543_c1 | 3300050510 | Bacteria | 1075 |
| 1039 | nmdc:mga06r32_847899_c1 | 3300050510 | Bacteria | 872 |
| 1040 | nmdc:mga08y16_144281_c1 | 3300050511 | Bacteria | 2475 |
| 1041 | nmdc:mga08y16_39769_c1 | 3300050511 | Bacteria | 4932 |
| 1042 | nmdc:mga08y16_465984_c1 | 3300050511 | Bacteria | 1287 |
| 1043 | nmdc:mga08y16_480461_c1 | 3300050511 | Bacteria | 1264 |
| 1044 | nmdc:mga08y16_679007_c1 | 3300050511 | Bacteria | 1032 |
| 1045 | nmdc:mga08y16_960156_c1 | 3300050511 | Bacteria | 837 |
| 1046 | nmdc:mga08y16_97469_c1 | 3300050511 | Bacteria | 3062 |
| 1047 | nmdc:mga0n895_190687_c1 | 3300050512 | Bacteria | 2081 |
| 1048 | nmdc:mga0n895_31442_c1 | 3300050512 | Bacteria | 5083 |
| 1049 | nmdc:mga0n895_401851_c1 | 3300050512 | Bacteria | 1385 |
| 1050 | nmdc:mga0n895_847914_c1 | 3300050512 | Bacteria | 902 |
| 1051 | nmdc:mga0rr50_129390_c1 | 3300050513 | Unclassified | 2019 |
| 1052 | nmdc:mga0rr50_1611308_c1 | 3300050513 | Bacteria | 548 |
| 1053 | nmdc:mga0rr50_471688_c1 | 3300050513 | Unclassified | 1065 |
| 1054 | nmdc:mga0rr50_506045_c1 | 3300050513 | Bacteria | 1027 |
| 1055 | nmdc:mga0rr50_61467_c1 | 3300050513 | Bacteria | 2830 |
| 1056 | nmdc:mga0a205_77713_c1 | 3300050515 | Bacteria | 3207 |
| 1057 | nmdc:mga0a205_936368_c1 | 3300050515 | Bacteria | 713 |
| 1058 | Ga0495601_0000349 | 3300053077 | Bacteria | 24294 |
| 1059 | Ga0495601_0219352 | 3300053077 | Unclassified | 1242 |
| 1060 | Ga0495601_0392072 | 3300053077 | Archaea | 901 |
| 1061 | Ga0495612_0001007 | 3300053078 | Bacteria | 11601 |
| 1062 | Ga0495595_0031067 | 3300053084 | Bacteria | 2399 |
| 1063 | Ga0495595_0047423 | 3300053084 | Bacteria | 1982 |
| 1064 | Ga0495595_0731968 | 3300053084 | Unclassified | 507 |
| 1065 | Ga0495619_0036885 | 3300053085 | Bacteria | 3184 |
| 1066 | Ga0495619_0126078 | 3300053085 | Bacteria | 1757 |
| 1067 | Ga0495619_0225951 | 3300053085 | Bacteria | 1297 |
| 1068 | Ga0495619_0245629 | 3300053085 | Bacteria | 1240 |
| 1069 | Ga0500646_0037115 | 3300053090 | Unclassified | 1360 |
| 1070 | Ga0500583_0275066 | 3300053092 | Bacteria | 828 |
| 1071 | Ga0500641_0263360 | 3300053096 | Bacteria | 719 |
| 1072 | Ga0500658_0025615 | 3300053134 | Bacteria | 2268 |
| 1073 | Ga0500604_0023105 | 3300053151 | Bacteria | 1771 |
| 1074 | Ga0500616_0031547 | 3300053153 | Bacteria | 2902 |
| 1075 | Ga0587077_130732 | 3300059493 | Bacteria | 637 |
| 1076 | Ga0587094_016708 | 3300059513 | Bacteria | 1025 |
| 1077 | Ga0501082_0507008 | 3300060353 | Bacteria | 1055 |
| 1078 | Ga0501082_0781212 | 3300060353 | Bacteria | 835 |
| 1079 | Ga0501082_1995408 | 3300060353 | Bacteria | 506 |
| 1080 | Ga0496108_0029045 | |||
| 1081 | MBSR1b_contig_4260219 | |||
| 1082 | JGI24743J22301_10044734 | |||
| 1083 | JGI24744J21845_10109838 | |||
| 1084 | JGI24751J29686_10069609 | |||
| 1085 | JGI24751J29686_10109143 | |||
| 1086 | JGI25404J52841_10057163 | |||
| 1087 | Ga0065715_10356881 | |||
| 1088 | Ga0065715_10383872 | |||
| 1089 | Ga0065715_10404322 | |||
| 1090 | Ga0070658_10682941 | |||
| 1091 | Ga0070676_10041880 | |||
| 1092 | Ga0070676_10097071 | |||
| 1093 | Ga0070676_10379393 | |||
| 1094 | Ga0070683_100158931 | |||
| 1095 | Ga0070683_101190931 | |||
| 1096 | Ga0070683_101593270 | |||
| 1097 | Ga0070690_100061985 | |||
| 1098 | Ga0070690_100152708 | |||
| 1099 | Ga0070690_100956809 | |||
| 1100 | Ga0070690_101667147 | |||
| 1101 | Ga0070670_100300985 | |||
| 1102 | Ga0070670_100363148 | |||
| 1103 | Ga0070670_100469826 | |||
| 1104 | Ga0070670_100854178 | |||
| 1105 | Ga0070677_10018331 | |||
| 1106 | Ga0068869_101167091 | |||
| 1107 | Ga0068869_101555409 | |||
| 1108 | Ga0068869_101973285 | |||
| 1109 | Ga0070666_10280718 | |||
| 1110 | Ga0070666_10918396 | |||
| 1111 | Ga0070666_11121544 | |||
| 1112 | Ga0070680_100139963 | |||
| 1113 | Ga0070682_100100892 | |||
| 1114 | Ga0070682_100697237 | |||
| 1115 | Ga0068868_100071958 | |||
| 1116 | Ga0068868_102050174 | |||
| 1117 | Ga0070660_100481935 | |||
| 1118 | Ga0070689_100008245 | |||
| 1119 | Ga0070689_101203294 | |||
| 1120 | Ga0070689_101231098 | |||
| 1121 | Ga0070689_101610806 | |||
| 1122 | Ga0070691_10297925 | |||
| 1123 | Ga0070691_10528737 | |||
| 1124 | Ga0070687_100430502 | |||
| 1125 | Ga0070687_100604930 | |||
| 1126 | Ga0070692_10900467 | |||
| 1127 | Ga0070668_100331153 | |||
| 1128 | Ga0070668_101239593 | |||
| 1129 | Ga0070669_100196560 | |||
| 1130 | Ga0070669_100232123 | |||
| 1131 | Ga0070669_100694827 | |||
| 1132 | Ga0070675_100437783 | |||
| 1133 | Ga0070675_100966760 | |||
| 1134 | Ga0070675_101191680 | |||
| 1135 | Ga0070671_100021982 | |||
| 1136 | Ga0070671_100097205 | |||
| 1137 | Ga0070671_100293912 | |||
| 1138 | Ga0070671_100494973 | |||
| 1139 | Ga0070671_101082714 | |||
| 1140 | Ga0070674_100010635 | |||
| 1141 | Ga0070674_100091041 | |||
| 1142 | Ga0070674_100112052 | |||
| 1143 | Ga0070674_101190419 | |||
| 1144 | Ga0070673_100137809 | |||
| 1145 | Ga0070673_100376553 | |||
| 1146 | Ga0070673_100714197 | |||
| 1147 | Ga0070673_101037365 | |||
| 1148 | Ga0070673_101275581 | |||
| 1149 | Ga0070688_100012110 | |||
| 1150 | Ga0070688_100166754 | |||
| 1151 | Ga0070688_100232401 | |||
| 1152 | Ga0070688_100308013 | |||
| 1153 | Ga0070667_100265825 | |||
| 1154 | Ga0070667_100488528 | |||
| 1155 | Ga0070667_100492452 | |||
| 1156 | Ga0070667_101554231 | |||
| 1157 | Ga0070667_102198403 | |||
| 1158 | Ga0070709_10508899 | |||
| 1159 | Ga0070714_100018088 | |||
| 1160 | Ga0070714_100411091 | |||
| 1161 | Ga0070713_100006041 | |||
| 1162 | Ga0070713_102305919 | |||
| 1163 | Ga0070710_10012582 | |||
| 1164 | Ga0070710_10324158 | |||
| 1165 | Ga0070710_10683561 | |||
| 1166 | Ga0070701_10567818 | |||
| 1167 | Ga0070711_100073767 | |||
| 1168 | Ga0070711_100087500 | |||
| 1169 | Ga0070711_100470358 | |||
| 1170 | Ga0070711_100481843 | |||
| 1171 | Ga0070711_101811001 | |||
| 1172 | Ga0070705_100358165 | |||
| 1173 | Ga0070700_100141999 | |||
| 1174 | Ga0070700_100278901 | |||
| 1175 | Ga0070694_100453665 | |||
| 1176 | Ga0070694_100619898 | |||
| 1177 | Ga0070694_100856879 | |||
| 1178 | Ga0070694_101133831 | |||
| 1179 | Ga0070708_100616377 | |||
| 1180 | Ga0070663_100740158 | |||
| 1181 | Ga0070663_101227116 | |||
| 1182 | Ga0070678_100013179 | |||
| 1183 | Ga0070678_100367278 | |||
| 1184 | Ga0070678_100370336 | |||
| 1185 | Ga0070678_101196087 | |||
| 1186 | Ga0070678_101396088 | |||
| 1187 | Ga0070678_102122325 | |||
| 1188 | Ga0070662_100448392 | |||
| 1189 | Ga0070662_100814667 | |||
| 1190 | Ga0070662_101492525 | |||
| 1191 | Ga0070681_10053270 | |||
| 1192 | Ga0070681_10175294 | |||
| 1193 | Ga0070681_11384432 | |||
| 1194 | Ga0068867_100065628 | |||
| 1195 | Ga0068867_100094632 | |||
| 1196 | Ga0068867_100112116 | |||
| 1197 | Ga0068867_102112168 | |||
| 1198 | Ga0070685_10114736 | |||
| 1199 | Ga0070685_10714875 | |||
| 1200 | Ga0070706_101718838 | |||
| 1201 | Ga0070698_102155933 | |||
| 1202 | Ga0070699_101320493 | |||
| 1203 | Ga0070679_102192723 | |||
| 1204 | Ga0070684_101511778 | |||
| 1205 | Ga0070697_100047862 | |||
| 1206 | Ga0068853_100288390 | |||
| 1207 | Ga0070672_100033169 | |||
| 1208 | Ga0070672_100877263 | |||
| 1209 | Ga0070686_100037537 | |||
| 1210 | Ga0070686_100147549 | |||
| 1211 | Ga0070686_100218993 | |||
| 1212 | Ga0070686_100518435 | |||
| 1213 | Ga0070686_100822709 | |||
| 1214 | Ga0070695_101835909 | |||
| 1215 | Ga0070696_101876089 | |||
| 1216 | Ga0070665_100144680 | |||
| 1217 | Ga0070665_100160208 | |||
| 1218 | Ga0070704_101234262 | |||
| 1219 | Ga0070704_101572878 | |||
| 1220 | Ga0068855_101547442 | |||
| 1221 | Ga0070664_101617644 | |||
| 1222 | Ga0068857_100615154 | |||
| 1223 | Ga0068854_100148929 | |||
| 1224 | Ga0068856_100442780 | |||
| 1225 | Ga0068856_101397198 | |||
| 1226 | Ga0070702_100188070 | |||
| 1227 | Ga0070702_100442140 | |||
| 1228 | Ga0068852_100478820 | |||
| 1229 | Ga0068859_100242826 | |||
| 1230 | Ga0068859_100643854 | |||
| 1231 | Ga0068859_100948072 | |||
| 1232 | Ga0068859_102333693 | |||
| 1233 | Ga0068864_100034477 | |||
| 1234 | Ga0068864_100607863 | |||
| 1235 | Ga0068864_101830320 | |||
| 1236 | Ga0068866_10204868 | |||
| 1237 | Ga0068866_10416197 | |||
| 1238 | Ga0068866_11055735 | |||
| 1239 | Ga0068861_100048984 | |||
| 1240 | Ga0068861_100416674 | |||
| 1241 | Ga0068851_10537218 | |||
| 1242 | Ga0068863_100147772 | |||
| 1243 | Ga0068863_101499723 | |||
| 1244 | Ga0068863_102561503 | |||
| 1245 | Ga0068858_100169996 | |||
| 1246 | Ga0068858_100711146 | |||
| 1247 | Ga0068858_101110737 | |||
| 1248 | Ga0068858_101568770 | |||
| 1249 | Ga0068860_100113245 | |||
| 1250 | Ga0068860_100466935 | |||
| 1251 | Ga0068862_101845648 | |||
| 1252 | Ga0081455_10119563 | |||
| 1253 | Ga0081455_10218615 | |||
| 1254 | Ga0081540_1014265 | |||
| 1255 | Ga0081539_10074035 | |||
| 1256 | Ga0070717_10087937 | |||
| 1257 | Ga0070717_10296143 | |||
| 1258 | Ga0075365_10233260 | |||
| 1259 | Ga0075365_10408238 | |||
| 1260 | Ga0075368_10001548 | |||
| 1261 | Ga0075368_10053941 | |||
| 1262 | Ga0075368_10105989 | |||
| 1263 | Ga0075363_100019332 | |||
| 1264 | Ga0075363_100022989 | |||
| 1265 | Ga0075363_100166982 | |||
| 1266 | Ga0075363_100477305 | |||
| 1267 | Ga0075363_100668681 | |||
| 1268 | Ga0075364_10039954 | |||
| 1269 | Ga0075364_10784424 | |||
| 1270 | Ga0075364_10901095 | |||
| 1271 | Ga0075432_10269375 | |||
| 1272 | Ga0070715_10066757 | |||
| 1273 | Ga0070715_10543114 | |||
| 1274 | Ga0070716_100184837 | |||
| 1275 | Ga0070712_100010216 | |||
| 1276 | Ga0070712_100021390 | |||
| 1277 | Ga0070712_100067347 | |||
| 1278 | Ga0070712_100774946 | |||
| 1279 | Ga0075367_10008400 | |||
| 1280 | Ga0075367_10023684 | |||
| 1281 | Ga0075367_10043891 | |||
| 1282 | Ga0075367_10128513 | |||
| 1283 | Ga0075367_10550572 | |||
| 1284 | Ga0075367_10604826 | |||
| 1285 | Ga0097621_100139994 | |||
| 1286 | Ga0097621_100285398 | |||
| 1287 | Ga0097621_100299593 | |||
| 1288 | Ga0097621_100388902 | |||
| 1289 | Ga0097621_100498479 | |||
| 1290 | Ga0097621_100528984 | |||
| 1291 | Ga0075370_10713067 | |||
| 1292 | Ga0068871_100514203 | |||
| 1293 | Ga0068871_100577021 | |||
| 1294 | Ga0075428_100009365 | |||
| 1295 | Ga0075428_100054709 | |||
| 1296 | Ga0075428_100693178 | |||
| 1297 | Ga0075428_101482434 | |||
| 1298 | Ga0075430_100000105 | |||
| 1299 | Ga0075430_100046813 | |||
| 1300 | Ga0075430_100109845 | |||
| 1301 | Ga0075430_100116692 | |||
| 1302 | Ga0075430_100665115 | |||
| 1303 | Ga0075430_100733270 | |||
| 1304 | Ga0075431_100004380 | |||
| 1305 | Ga0075431_100105157 | |||
| 1306 | Ga0075433_10079299 | |||
| 1307 | Ga0075433_10700635 | |||
| 1308 | Ga0075433_11097365 | |||
| 1309 | Ga0075434_100043527 | |||
| 1310 | Ga0075434_100113136 | |||
| 1311 | Ga0075434_101256234 | |||
| 1312 | Ga0075429_100061691 | |||
| 1313 | Ga0075429_100064657 | |||
| 1314 | Ga0075429_101803075 | |||
| 1315 | Ga0068865_100109949 | |||
| 1316 | Ga0068865_101343345 | |||
| 1317 | Ga0097620_100242823 | |||
| 1318 | Ga0097620_100643893 | |||
| 1319 | Ga0097620_100947842 | |||
| 1320 | Ga0097620_102332526 | |||
| 1321 | Ga0075435_100012196 | |||
| 1322 | Ga0075435_100122123 | |||
| 1323 | Ga0075435_100355429 | |||
| 1324 | Ga0075435_100627976 | |||
| 1325 | Ga0075435_100816392 | |||
| 1326 | Ga0099795_10000237 | |||
| 1327 | Ga0099795_10248490 | |||
| 1328 | Ga0099795_10484262 | |||
| 1329 | Ga0099795_10643165 | |||
| 1330 | Ga0099795_10644003 | |||
| 1331 | Ga0105240_11760675 | |||
| 1332 | Ga0105240_12480408 | |||
| 1333 | Ga0111539_10046741 | |||
| 1334 | Ga0111539_10088535 | |||
| 1335 | Ga0111539_10343691 | |||
| 1336 | Ga0111539_10815619 | |||
| 1337 | Ga0111539_11487694 | |||
| 1338 | Ga0111539_11526924 | |||
| 1339 | Ga0111539_11815332 | |||
| 1340 | Ga0111539_11946921 | |||
| 1341 | Ga0111539_12212921 | |||
| 1342 | Ga0105245_10144669 | |||
| 1343 | Ga0105245_10404063 | |||
| 1344 | Ga0105245_11127963 | |||
| 1345 | Ga0105247_10394013 | |||
| 1346 | Ga0114129_10722934 | |||
| 1347 | Ga0114129_13279537 | |||
| 1348 | Ga0105243_10232403 | |||
| 1349 | Ga0105243_10267665 | |||
| 1350 | Ga0105243_10532913 | |||
| 1351 | Ga0105243_10999231 | |||
| 1352 | Ga0105241_10574815 | |||
| 1353 | Ga0105242_10134234 | |||
| 1354 | Ga0105242_10565481 | |||
| 1355 | Ga0105242_10594238 | |||
| 1356 | Ga0105242_11785344 | |||
| 1357 | Ga0105242_12276754 | |||
| 1358 | Ga0105242_12515596 | |||
| 1359 | Ga0105248_10126790 | |||
| 1360 | Ga0105248_10273984 | |||
| 1361 | Ga0105248_10644158 | |||
| 1362 | Ga0105237_10314451 | |||
| 1363 | Ga0105238_10447867 | |||
| 1364 | Ga0105238_10528541 | |||
| 1365 | Ga0105238_10594881 | |||
| 1366 | Ga0105238_11402622 | |||
| 1367 | Ga0105238_12209374 | |||
| 1368 | Ga0105249_10240746 | |||
| 1369 | Ga0105249_10308415 | |||
| 1370 | Ga0105249_10890360 | |||
| 1371 | Ga0099796_10004441 | |||
| 1372 | Ga0099796_10076049 | |||
| 1373 | Ga0099796_10118829 | |||
| 1374 | Ga0099796_10149455 | |||
| 1375 | Ga0099796_10168623 | |||
| 1376 | Ga0105239_10147530 | |||
| 1377 | Ga0105239_10182724 | |||
| 1378 | Ga0105239_12043410 | |||
| 1379 | Ga0105239_12150132 | |||
| 1380 | Ga0105239_12922085 | |||
| 1381 | Ga0105246_10713859 | |||
| 1382 | Ga0105246_10765221 | |||
| 1383 | Ga0105246_11773253 | |||
| 1384 | Ga0105246_12162528 | |||
| 1385 | Ga0157345_1056034 | |||
| 1386 | Ga0157371_10988402 | |||
| 1387 | Ga0157370_10208658 | |||
| 1388 | Ga0157369_10191125 | |||
| 1389 | Ga0157369_10752931 | |||
| 1390 | Ga0157374_11148317 | |||
| 1391 | Ga0157374_12927407 | |||
| 1392 | Ga0157378_10078036 | |||
| 1393 | Ga0157378_10613782 | |||
| 1394 | Ga0157378_11006540 | |||
| 1395 | Ga0163162_10234757 | |||
| 1396 | Ga0163162_10983445 | |||
| 1397 | Ga0163162_10996651 | |||
| 1398 | Ga0163162_11003511 | |||
| 1399 | Ga0163162_11034772 | |||
| 1400 | Ga0163162_11143001 | |||
| 1401 | Ga0163162_11454237 | |||
| 1402 | Ga0157372_11513476 | |||
| 1403 | Ga0157375_10141049 | |||
| 1404 | Ga0157375_10143093 | |||
| 1405 | Ga0157375_11048789 | |||
| 1406 | Ga0157375_11116970 | |||
| 1407 | Ga0157375_12358974 | |||
| 1408 | Ga0163163_10039996 | |||
| 1409 | Ga0163163_10040918 | |||
| 1410 | Ga0163163_10141456 | |||
| 1411 | Ga0163163_10500627 | |||
| 1412 | Ga0163163_12308736 | |||
| 1413 | Ga0157380_10212170 | |||
| 1414 | Ga0157380_10430760 | |||
| 1415 | Ga0157380_10808699 | |||
| 1416 | Ga0157380_11869191 | |||
| 1417 | Ga0157380_12513720 | |||
| 1418 | Ga0157380_12720900 | |||
| 1419 | Ga0182008_10037470 | |||
| 1420 | Ga0157377_10597083 | |||
| 1421 | Ga0157379_10061238 | |||
| 1422 | Ga0157379_10080970 | |||
| 1423 | Ga0157379_10180526 | |||
| 1424 | Ga0157379_10182635 | |||
| 1425 | Ga0157379_10190041 | |||
| 1426 | Ga0157379_10574467 | |||
| 1427 | Ga0157379_10741184 | |||
| 1428 | Ga0157379_11476544 | |||
| 1429 | Ga0157376_10362786 | |||
| 1430 | Ga0157376_10656299 | |||
| 1431 | Ga0157376_10712069 | |||
| 1432 | Ga0157376_11592567 | |||
| 1433 | Ga0157376_12800804 | |||
| 1434 | Ga0157376_12861717 | |||
| 1435 | Ga0163161_10559249 | |||
| 1436 | Ga0163161_10626706 | |||
| 1437 | Ga0163161_10674193 | |||
| 1438 | Ga0163161_11091070 | |||
| 1439 | Ga0197907_10097918 | |||
| 1440 | Ga0206356_11050782 | |||
| 1441 | Ga0213873_10218981 | |||
| 1442 | Ga0213873_10287380 | |||
| 1443 | Ga0213874_10036744 | |||
| 1444 | Ga0213876_10311092 | |||
| 1445 | Ga0213876_10430208 | |||
| 1446 | Ga0213876_10637348 | |||
| 1447 | Ga0213875_10033053 | |||
| 1448 | Ga0213875_10075842 | |||
| 1449 | Ga0213875_10181207 | |||
| 1450 | Ga0213875_10253154 | |||
| 1451 | Ga0213875_10610117 | |||
| 1452 | Ga0213871_10038002 | |||
| 1453 | Ga0213871_10224737 | |||
| 1454 | Ga0224712_10282220 | |||
| 1455 | Ga0207697_10051203 | |||
| 1456 | Ga0207697_10212777 | |||
| 1457 | Ga0207656_10412852 | |||
| 1458 | Ga0207682_10002121 | |||
| 1459 | Ga0207692_10019780 | |||
| 1460 | Ga0207692_10074755 | |||
| 1461 | Ga0207692_10142181 | |||
| 1462 | Ga0207692_10918782 | |||
| 1463 | Ga0207642_10062410 | |||
| 1464 | Ga0207642_10113498 | |||
| 1465 | Ga0207710_10103719 | |||
| 1466 | Ga0207710_10265117 | |||
| 1467 | Ga0207710_10375025 | |||
| 1468 | Ga0207688_10002666 | |||
| 1469 | Ga0207688_10119204 | |||
| 1470 | Ga0207680_10597418 | |||
| 1471 | Ga0207680_10718056 | |||
| 1472 | Ga0207647_10143742 | |||
| 1473 | Ga0207685_10202433 | |||
| 1474 | Ga0207699_10018475 | |||
| 1475 | Ga0207699_10031241 | |||
| 1476 | Ga0207645_10072434 | |||
| 1477 | Ga0207645_10297726 | |||
| 1478 | Ga0207643_10001626 | |||
| 1479 | Ga0207654_10227211 | |||
| 1480 | Ga0207707_10041293 | |||
| 1481 | Ga0207707_10239271 | |||
| 1482 | Ga0207695_10818353 | |||
| 1483 | Ga0207671_10581599 | |||
| 1484 | Ga0207693_10002165 | |||
| 1485 | Ga0207693_10019034 | |||
| 1486 | Ga0207693_10020506 | |||
| 1487 | Ga0207693_10059066 | |||
| 1488 | Ga0207693_10118265 | |||
| 1489 | Ga0207693_10825551 | |||
| 1490 | Ga0207663_10096820 | |||
| 1491 | Ga0207663_10160863 | |||
| 1492 | Ga0207663_10324986 | |||
| 1493 | Ga0207663_10391016 | |||
| 1494 | Ga0207660_11179160 | |||
| 1495 | Ga0207662_10018906 | |||
| 1496 | Ga0207662_10055750 | |||
| 1497 | Ga0207662_10298923 | |||
| 1498 | Ga0207662_10318072 | |||
| 1499 | Ga0207657_11063039 | |||
| 1500 | Ga0207649_10269993 | |||
| 1501 | Ga0207681_10139159 | |||
| 1502 | Ga0207681_10546994 | |||
| 1503 | Ga0207681_10811169 | |||
| 1504 | Ga0207694_10159945 | |||
| 1505 | Ga0207694_10357405 | |||
| 1506 | Ga0207694_11570724 | |||
| 1507 | Ga0207650_10535049 | |||
| 1508 | Ga0207650_11707555 | |||
| 1509 | Ga0207659_10114491 | |||
| 1510 | Ga0207659_10304725 | |||
| 1511 | Ga0207659_10686868 | |||
| 1512 | Ga0207659_11398385 | |||
| 1513 | Ga0207687_10251508 | |||
| 1514 | Ga0207687_10583043 | |||
| 1515 | Ga0207687_10862949 | |||
| 1516 | Ga0207687_11051871 | |||
| 1517 | Ga0207700_10043243 | |||
| 1518 | Ga0207700_10062858 | |||
| 1519 | Ga0207700_10200541 | |||
| 1520 | Ga0207664_10045279 | |||
| 1521 | Ga0207664_10141638 | |||
| 1522 | Ga0207664_11038804 | |||
| 1523 | Ga0207644_10022359 | |||
| 1524 | Ga0207644_10164837 | |||
| 1525 | Ga0207644_10371102 | |||
| 1526 | Ga0207644_10420522 | |||
| 1527 | Ga0207644_10974366 | |||
| 1528 | Ga0207644_11696951 | |||
| 1529 | Ga0207706_10450313 | |||
| 1530 | Ga0207706_10624228 | |||
| 1531 | Ga0207706_10703844 | |||
| 1532 | Ga0207706_11146315 | |||
| 1533 | Ga0207686_10220929 | |||
| 1534 | Ga0207709_10095854 | |||
| 1535 | Ga0207709_10435668 | |||
| 1536 | Ga0207709_10515850 | |||
| 1537 | Ga0207670_10008201 | |||
| 1538 | Ga0207670_10091586 | |||
| 1539 | Ga0207670_10323300 | |||
| 1540 | Ga0207670_10506007 | |||
| 1541 | Ga0207670_10561950 | |||
| 1542 | Ga0207670_11435635 | |||
| 1543 | Ga0207669_10021845 | |||
| 1544 | Ga0207669_11140088 | |||
| 1545 | Ga0207704_10150491 | |||
| 1546 | Ga0207704_11223383 | |||
| 1547 | Ga0207665_10109139 | |||
| 1548 | Ga0207691_10004008 | |||
| 1549 | Ga0207691_10036729 | |||
| 1550 | Ga0207691_10236149 | |||
| 1551 | Ga0207711_10003717 | |||
| 1552 | Ga0207711_10155377 | |||
| 1553 | Ga0207689_10551476 | |||
| 1554 | Ga0207689_11349224 | |||
| 1555 | Ga0207661_11013620 | |||
| 1556 | Ga0207679_11776202 | |||
| 1557 | Ga0207679_11832032 | |||
| 1558 | Ga0207679_11930206 | |||
| 1559 | Ga0207667_11577902 | |||
| 1560 | Ga0207651_10352725 | |||
| 1561 | Ga0207651_10542013 | |||
| 1562 | Ga0207651_10796262 | |||
| 1563 | Ga0207651_11024628 | |||
| 1564 | Ga0207651_11046904 | |||
| 1565 | Ga0207651_11128646 | |||
| 1566 | Ga0207712_11038858 | |||
| 1567 | Ga0207668_10139663 | |||
| 1568 | Ga0207668_10188695 | |||
| 1569 | Ga0207668_10411773 | |||
| 1570 | Ga0207640_11129625 | |||
| 1571 | Ga0207658_10229899 | |||
| 1572 | Ga0207658_10558407 | |||
| 1573 | Ga0207658_11251445 | |||
| 1574 | Ga0207658_11330805 | |||
| 1575 | Ga0207658_11427099 | |||
| 1576 | Ga0207677_10055208 | |||
| 1577 | Ga0207677_10287169 | |||
| 1578 | Ga0207677_11331870 | |||
| 1579 | Ga0207703_10216705 | |||
| 1580 | Ga0207703_10243704 | |||
| 1581 | Ga0207703_11119382 | |||
| 1582 | Ga0207703_11662429 | |||
| 1583 | Ga0207639_10367097 | |||
| 1584 | Ga0207639_10420398 | |||
| 1585 | Ga0207678_10176275 | |||
| 1586 | Ga0207708_10077368 | |||
| 1587 | Ga0207708_10080367 | |||
| 1588 | Ga0207708_10364784 | |||
| 1589 | Ga0207702_10143852 | |||
| 1590 | Ga0207702_10352266 | |||
| 1591 | Ga0207702_11513657 | |||
| 1592 | Ga0207641_10176979 | |||
| 1593 | Ga0207641_10360506 | |||
| 1594 | Ga0207648_10051810 | |||
| 1595 | Ga0207648_10089803 | |||
| 1596 | Ga0207648_10118096 | |||
| 1597 | Ga0207648_11187522 | |||
| 1598 | Ga0207676_10035299 | |||
| 1599 | Ga0207676_10417399 | |||
| 1600 | Ga0207674_10952016 | |||
| 1601 | Ga0207674_11684355 | |||
| 1602 | Ga0207675_100004996 | |||
| 1603 | Ga0207675_100053730 | |||
| 1604 | Ga0207675_100065085 | |||
| 1605 | Ga0207675_100191830 | |||
| 1606 | Ga0207675_100432745 | |||
| 1607 | Ga0207683_10011410 | |||
| 1608 | Ga0207683_10074150 | |||
| 1609 | Ga0207683_10097598 | |||
| 1610 | Ga0207683_10913120 | |||
| 1611 | Ga0207683_10978883 | |||
| 1612 | Ga0207683_11025366 | |||
| 1613 | Ga0207683_11974257 | |||
| 1614 | Ga0207698_10560554 | |||
| 1615 | Ga0207698_10903400 | |||
| 1616 | Ga0209969_1008743 | |||
| 1617 | Ga0209981_1052609 | |||
| 1618 | Ga0209996_1044478 | |||
| 1619 | Ga0210000_1001244 | |||
| 1620 | Ga0209995_1063794 | |||
| 1621 | Ga0209179_1004897 | |||
| 1622 | Ga0209968_1022969 | |||
| 1623 | Ga0209970_1006451 | |||
| 1624 | Ga0209998_10045644 | |||
| 1625 | Ga0209998_10074803 | |||
| 1626 | Ga0209813_10001472 | |||
| 1627 | Ga0209813_10088531 | |||
| 1628 | Ga0209974_10047324 | |||
| 1629 | Ga0209974_10324863 | |||
| 1630 | Ga0207428_10022319 | |||
| 1631 | Ga0207428_10226536 | |||
| 1632 | Ga0207428_10271223 | |||
| 1633 | Ga0207428_10454564 | |||
| 1634 | Ga0207428_10604411 | |||
| 1635 | Ga0268266_10107980 | |||
| 1636 | Ga0268266_10475158 | |||
| 1637 | Ga0268266_11508653 | |||
| 1638 | Ga0268265_10102216 | |||
| 1639 | Ga0268265_10169505 | |||
| 1640 | Ga0268264_10148943 | |||
| 1641 | Ga0268264_10630079 | |||
| 1642 | Ga0268264_10846845 | |||
| 1643 | Ga0265338_11085225 | |||
| 1644 | Ga0265320_10113003 | |||
| 1645 | Ga0265325_10001561 | |||
| 1646 | Ga0265325_10071089 | |||
| 1647 | Ga0307513_10129091 | |||
| 1648 | Ga0307513_10141461 | |||
| 1649 | Ga0307408_100084100 | |||
| 1650 | Ga0307408_100239410 | |||
| 1651 | Ga0265342_10447970 | |||
| 1652 | Ga0307405_10096315 | |||
| 1653 | Ga0307405_10158387 | |||
| 1654 | Ga0307413_10590571 | |||
| 1655 | Ga0307410_10373883 | |||
| 1656 | Ga0307410_11522191 | |||
| 1657 | Ga0307406_10542464 | |||
| 1658 | Ga0307407_10189684 | |||
| 1659 | Ga0307416_100075944 | |||
| 1660 | Ga0307416_101183455 | |||
| 1661 | Ga0307416_101404945 | |||
| 1662 | Ga0307414_10023092 | |||
| 1663 | Ga0307414_11283889 | |||
| 1664 | Ga0307411_12006050 | |||
| 1665 | Ga0373958_0114118 | |||
| 1666 | Ga0373959_0055766 | |||
| 1667 | Ga0373959_0086555 | |||
| 1668 | Ga0373934_0004028 | |||
| 1669 | Ga0373940_0039246 | |||
| 1670 | Ga0373944_0087370 | |||
| 1671 | Ga0373944_0120396 | |||
| 1672 | Ga0373944_0195323 | |||
| 1673 | Ga0373949_0047362 | |||
| 1674 | Ga0373952_0216174 | |||
| 1675 | Ga0373923_0042492 | |||
| 1676 | Ga0373923_0052094 | |||
| 1677 | Ga0373923_0066352 | |||
| 1678 | Ga0373923_0193084 | |||
| 1679 | Ga0373932_0019668 | |||
| 1680 | Ga0373932_0098324 | |||
| 1681 | Ga0373936_0192065 | |||
| 1682 | Ga0373936_0223675 | |||
| 1683 | Ga0373939_0168042 | |||
| 1684 | Ga0373939_0270678 | |||
| 1685 | Ga0373945_0237625 | |||
| 1686 | Ga0373945_0348772 | |||
| 1687 | Ga0373945_0456245 | |||
| 1688 | Ga0373953_0042164 | |||
| 1689 | Ga0373953_0225441 | |||
| 1690 | Ga0373954_0028973 | |||
| 1691 | Ga0373954_0055660 | |||
| 1692 | Ga0373956_0018048 | |||
| 1693 | Ga0373956_0052648 | |||
| 1694 | Ga0373957_0316598 | |||
| 1695 | Ga0373960_0056480 | |||
| 1696 | Ga0373943_0111803 | |||
| 1697 | Ga0373943_0649682 | |||
| 1698 | Ga0373943_0650915 | |||
| 1699 | Ga0373946_0024327 | |||
| 1700 | Ga0373946_0131635 | |||
| 1701 | Ga0373955_0003869 | |||
| 1702 | Ga0373955_0035900 | |||
| 1703 | Ga0373942_0223436 | |||
| 1704 | Ga0373942_0225546 | |||
| 1705 | Ga0373961_0067400 | |||
| 1706 | Ga0373961_0392525 | |||
| 1707 | Ga0373962_0183036 | |||
| 1708 | Ga0373962_0230964 | |||
| 1709 | Ga0373924_0056580 | |||
| 1710 | Ga0373924_0066002 | |||
| 1711 | Ga0373924_0171450 | |||
| 1712 | Ga0373924_0213733 | |||
| 1713 | Ga0373931_0005698 | |||
| 1714 | Ga0373931_0039898 | |||
| 1715 | Ga0373931_0212666 | |||
| 1716 | Ga0373931_0266164 | |||
| 1717 | Ga0373931_0623467 | |||
| 1718 | Ga0373931_0678489 | |||
| 1719 | Ga0373935_0091253 | |||
| 1720 | Ga0373935_0126352 | |||
| 1721 | Ga0373935_0132319 | |||
| 1722 | Ga0373935_0154422 | |||
| 1723 | Ga0373935_0157631 | |||
| 1724 | Ga0373935_0169812 | |||
| 1725 | Ga0373935_0407691 | |||
| 1726 | Ga0373935_0535644 | |||
| 1727 | Ga0373935_0573908 | |||
| 1728 | Ga0373927_0099605 | |||
| 1729 | Ga0373927_0219964 | |||
| 1730 | Ga0373927_0318478 | |||
| 1731 | Ga0373927_0435138 | |||
| 1732 | Ga0373927_0438949 | |||
| 1733 | Ga0373927_0565791 | |||
| 1734 | Ga0373933_0002335 | |||
| 1735 | Ga0373933_0019411 | |||
| 1736 | Ga0373933_0155912 | |||
| 1737 | Ga0373933_0433515 | |||
| 1738 | Ga0373947_0016135 | |||
| 1739 | Ga0373947_0413828 | |||
| 1740 | Ga0373947_0434812 | |||
| 1741 | Ga0373947_0476578 | |||
| 1742 | Ga0373947_0773474 | |||
| 1743 | Ga0373947_1163844 | |||
| 1744 | Ga0373937_0002181 | |||
| 1745 | Ga0373937_0010322 | |||
| 1746 | Ga0373937_0011572 | |||
| 1747 | Ga0373937_0042211 | |||
| 1748 | Ga0373937_0151436 | |||
| 1749 | Ga0373937_0454609 | |||
| 1750 | Ga0373937_1303993 | |||
| 1751 | Ga0373937_1771286 | |||
| 1752 | Ga0373925_0011071 | |||
| 1753 | Ga0373925_0042225 | |||
| 1754 | Ga0373925_0159821 | |||
| 1755 | Ga0373925_0339535 | |||
| 1756 | Ga0373925_0536599 | |||
| 1757 | Ga0373925_0866219 | |||
| 1758 | Ga0436364_0175691 | |||
| 1759 | Ga0436364_0356133 | |||
| 1760 | Ga0436364_0379074 | |||
| 1761 | Ga0436364_0463051 | |||
| 1762 | Ga0436364_0576040 | |||
| 1763 | Ga0436364_1088149 | |||
| 1764 | Ga0436364_1237915 | |||
| 1765 | Ga0436364_1391844 | |||
| 1766 | Ga0436364_1425830 | |||
| 1767 | Ga0395901_0186301 | |||
| 1768 | Ga0395901_1295264 | |||
| 1769 | Ga0400483_178540 | |||
| 1770 | Ga0436365_0149800 | |||
| 1771 | Ga0436365_0432208 | |||
| 1772 | Ga0436365_0460313 | |||
| 1773 | Ga0436365_0596609 | |||
| 1774 | Ga0436365_0843728 | |||
| 1775 | Ga0436365_1449407 | |||
| 1776 | Ga0436365_1548316 | |||
| 1777 | Ga0436365_1737897 | |||
| 1778 | Ga0436360_0079681 | |||
| 1779 | Ga0436360_0133873 | |||
| 1780 | Ga0436360_0180394 | |||
| 1781 | Ga0436360_0315425 | |||
| 1782 | Ga0436360_0677589 | |||
| 1783 | Ga0436360_0824795 | |||
| 1784 | Ga0436360_0908614 | |||
| 1785 | Ga0436360_1039402 | |||
| 1786 | Ga0436360_1055705 | |||
| 1787 | Ga0436360_1166351 | |||
| 1788 | Ga0436360_1335565 | |||
| 1789 | Ga0436361_0096846 | |||
| 1790 | Ga0436361_0145041 | |||
| 1791 | Ga0436361_0392029 | |||
| 1792 | Ga0436361_0479904 | |||
| 1793 | Ga0436361_1186265 | |||
| 1794 | Ga0436363_0139467 | |||
| 1795 | Ga0436363_0599352 | |||
| 1796 | Ga0436363_0706903 | |||
| 1797 | Ga0436363_0790125 | |||
| 1798 | Ga0436363_0882087 | |||
| 1799 | Ga0436363_1136144 | |||
| 1800 | Ga0436363_1238825 | |||
| 1801 | Ga0436362_0081622 | |||
| 1802 | Ga0436362_0382911 | |||
| 1803 | Ga0436362_0438110 | |||
| 1804 | Ga0436362_0630427 | |||
| 1805 | Ga0436362_0703322 | |||
| 1806 | Ga0436362_0839840 | |||
| 1807 | Ga0436362_0859630 | |||
| 1808 | Ga0439453_0000261 | |||
| 1809 | Ga0451807_1683586 | |||
| 1810 | Ga0439431_0092706 | |||
| 1811 | Ga0439443_109671 | |||
| 1812 | Ga0439455_0066350 | |||
| 1813 | Ga0439435_0194581 | |||
| 1814 | Ga0439460_0273971 | |||
| 1815 | Ga0450916_025212 | |||
| 1816 | Ga0451577_1012585 | |||
| 1817 | Ga0439440_0009988 | |||
| 1818 | Ga0466965_0706775 | |||
| 1819 | Ga0466963_0221902 | |||
| 1820 | Ga0466963_0705545 | |||
| 1821 | Ga0466963_1082508 | |||
| 1822 | Ga0466960_0089059 | |||
| 1823 | Ga0466967_0328347 | |||
| 1824 | Ga0466967_0392450 | |||
| 1825 | Ga0466967_0814996 | |||
| 1826 | Ga0466967_1703984 | |||
| 1827 | Ga0495592_0179253 | |||
| 1828 | Ga0495592_0230892 | |||
| 1829 | Ga0495603_0065542 | |||
| 1830 | Ga0495603_0297910 | |||
| 1831 | Ga0495629_0121489 | |||
| 1832 | Ga0495638_0005322 | |||
| 1833 | Ga0495638_0023899 | |||
| 1834 | Ga0495641_0055308 | |||
| 1835 | Ga0495641_0159479 | |||
| 1836 | Ga0495651_0019063 | |||
| 1837 | Ga0495651_0163740 | |||
| 1838 | Ga0495653_0214955 | |||
| 1839 | Ga0495653_0363417 | |||
| 1840 | Ga0495580_0175190 | |||
| 1841 | Ga0495580_0663978 | |||
| 1842 | Ga0495582_0019353 | |||
| 1843 | Ga0495582_0489596 | |||
| 1844 | Ga0495639_0703293 | |||
| 1845 | Ga0495664_0000446 | |||
| 1846 | Ga0495664_0224496 | |||
| 1847 | Ga0495584_0015860 | |||
| 1848 | Ga0495584_0309512 | |||
| 1849 | Ga0495584_0520368 | |||
| 1850 | Ga0495585_0175122 | |||
| 1851 | Ga0495585_0280541 | |||
| 1852 | Ga0495594_0631654 | |||
| 1853 | Ga0495596_0128015 | |||
| 1854 | Ga0495608_0030865 | |||
| 1855 | Ga0495608_0167506 | |||
| 1856 | Ga0495608_0558529 | |||
| 1857 | Ga0495608_0566601 | |||
| 1858 | Ga0495616_0198159 | |||
| 1859 | Ga0495616_0230514 | |||
| 1860 | Ga0495618_0223931 | |||
| 1861 | Ga0495620_0133636 | |||
| 1862 | Ga0495628_0044634 | |||
| 1863 | Ga0495628_0089536 | |||
| 1864 | Ga0495630_0354366 | |||
| 1865 | Ga0495637_0070705 | |||
| 1866 | Ga0495637_0281032 | |||
| 1867 | Ga0495663_0225568 | |||
| 1868 | Ga0495666_0209221 | |||
| 1869 | Ga0495652_0140559 | |||
| 1870 | Ga0495665_0041929 | |||
| 1871 | Ga0495665_0431843 | |||
| 1872 | Ga0495640_0090123 | |||
| 1873 | Ga0495640_0102202 | |||
| 1874 | Ga0495640_0306113 | |||
| 1875 | Ga0495640_0470852 | |||
| 1876 | Ga0495598_0413522 | |||
| 1877 | Ga0495621_0430628 | |||
| 1878 | Ga0495645_0008204 | |||
| 1879 | Ga0495645_0735150 | |||
| 1880 | Ga0495667_0005255 | |||
| 1881 | Ga0495667_0023798 | |||
| 1882 | Ga0495667_0229606 | |||
| 1883 | Ga0495667_0453845 | |||
| 1884 | Ga0495656_0204346 | |||
| 1885 | Ga0495656_0432227 | |||
| 1886 | Ga0495668_0071749 | |||
| 1887 | Ga0495634_0215917 | |||
| 1888 | Ga0495634_0315863 | |||
| 1889 | Ga0495611_0527224 | |||
| 1890 | Ga0495635_0005845 | |||
| 1891 | Ga0495635_0172712 | |||
| 1892 | Ga0495635_0292016 | |||
| 1893 | Ga0495659_0223406 | |||
| 1894 | Ga0495657_0131459 | |||
| 1895 | Ga0495657_0199719 | |||
| 1896 | Ga0495657_0289480 | |||
| 1897 | Ga0495657_0876493 | |||
| 1898 | Ga0495599_0007396 | |||
| 1899 | Ga0495599_0056282 | |||
| 1900 | Ga0495599_0634561 | |||
| 1901 | Ga0495599_0718541 | |||
| 1902 | Ga0495646_0014797 | |||
| 1903 | Ga0495646_0122527 | |||
| 1904 | Ga0495658_0493680 | |||
| 1905 | Ga0495613_0118298 | |||
| 1906 | Ga0495613_1013958 | |||
| 1907 | Ga0495670_0344890 | |||
| 1908 | Ga0495670_0498434 | |||
| 1909 | Ga0495589_0221069 | |||
| 1910 | Ga0495600_0178042 | |||
| 1911 | Ga0495604_0205734 | |||
| 1912 | Ga0495604_0291156 | |||
| 1913 | Ga0495604_0364756 | |||
| 1914 | Ga0495674_0070100 | |||
| 1915 | Ga0495674_0339676 | |||
| 1916 | Ga0495674_0342550 | |||
| 1917 | Ga0495674_0418559 | |||
| 1918 | Ga0495674_0694393 | |||
| 1919 | Ga0495674_1134336 | |||
| 1920 | Ga0495674_1177692 | |||
| 1921 | Ga0495672_0238603 | |||
| 1922 | Ga0495672_0376534 | |||
| 1923 | Ga0495676_0449081 | |||
| 1924 | Ga0495680_0115796 | |||
| 1925 | Ga0495680_0247350 | |||
| 1926 | Ga0495680_0378499 | |||
| 1927 | Ga0495680_0861261 | |||
| 1928 | Ga0495675_0014060 | |||
| 1929 | Ga0495675_0716702 | |||
| 1930 | Ga0495675_0724607 | |||
| 1931 | Ga0495677_0154978 | |||
| 1932 | Ga0495679_090200 | |||
| 1933 | Ga0495684_0057347 | |||
| 1934 | Ga0495684_0126792 | |||
| 1935 | Ga0495684_0489509 | |||
| 1936 | Ga0495686_0729907 | |||
| 1937 | Ga0495602_0000599 | |||
| 1938 | Ga0495602_0030436 | |||
| 1939 | Ga0495602_0058529 | |||
| 1940 | Ga0495602_0292534 | |||
| 1941 | Ga0495626_0399915 | |||
| 1942 | Ga0496100_0022252 | |||
| 1943 | Ga0496100_0112976 | |||
| 1944 | Ga0496100_0182693 | |||
| 1945 | Ga0496100_0457509 | |||
| 1946 | Ga0496101_0181217 | |||
| 1947 | Ga0496101_0287948 | |||
| 1948 | Ga0496101_0357290 | |||
| 1949 | Ga0496101_0454929 | |||
| 1950 | Ga0496102_0089407 | |||
| 1951 | Ga0496102_0106489 | |||
| 1952 | Ga0496102_0237896 | |||
| 1953 | Ga0496102_1216927 | |||
| 1954 | Ga0496102_1712586 | |||
| 1955 | Ga0496103_0114042 | |||
| 1956 | Ga0496103_0198823 | |||
| 1957 | Ga0496104_0001104 | |||
| 1958 | Ga0496104_0005126 | |||
| 1959 | Ga0496104_0046168 | |||
| 1960 | Ga0496104_0061053 | |||
| 1961 | Ga0496104_0218259 | |||
| 1962 | Ga0496104_0405603 | |||
| 1963 | Ga0496104_0635572 | |||
| 1964 | Ga0496104_0992729 | |||
| 1965 | Ga0496105_0017200 | |||
| 1966 | Ga0496105_0024151 | |||
| 1967 | Ga0496105_0087536 | |||
| 1968 | Ga0496105_0145898 | |||
| 1969 | Ga0496105_0181150 | |||
| 1970 | Ga0496105_0269703 | |||
| 1971 | Ga0496105_0312684 | |||
| 1972 | Ga0496105_0669455 | |||
| 1973 | Ga0496106_0034132 | |||
| 1974 | Ga0496106_0092248 | |||
| 1975 | Ga0496106_0092679 | |||
| 1976 | Ga0496106_0227285 | |||
| 1977 | Ga0496106_0233267 | |||
| 1978 | Ga0496106_0509950 | |||
| 1979 | Ga0496106_0827563 | |||
| 1980 | Ga0496107_0042424 | |||
| 1981 | Ga0496107_0077830 | |||
| 1982 | Ga0496107_0346062 | |||
| 1983 | Ga0496107_0379519 | |||
| 1984 | Ga0496108_0083883 | |||
| 1985 | Ga0496108_0106853 | |||
| 1986 | Ga0496108_0275392 | |||
| 1987 | Ga0496108_0363861 | |||
| 1988 | Ga0496108_0382737 | |||
| 1989 | Ga0496108_0476726 | |||
| 1990 | Ga0496108_0547226 | |||
| 1991 | Ga0496108_1127560 | |||
| 1992 | Ga0496108_1347490 | |||
| 1993 | Ga0496109_0011205 | |||
| 1994 | Ga0496109_0103048 | |||
| 1995 | Ga0496109_0141905 | |||
| 1996 | Ga0496109_0287522 | |||
| 1997 | Ga0496109_0964831 | |||
| 1998 | Ga0496110_0008353 | |||
| 1999 | Ga0496110_0053884 | |||
| 2000 | Ga0496110_0367130 | |||
| 2001 | Ga0496110_0450101 | |||
| 2002 | Ga0496110_1146640 | |||
| 2003 | Ga0496110_1532970 | |||
| 2004 | Ga0496110_1694021 | |||
| 2005 | Ga0496111_0004033 | |||
| 2006 | Ga0496111_0114041 | |||
| 2007 | Ga0496111_0178722 | |||
| 2008 | Ga0496111_0282139 | |||
| 2009 | Ga0496111_0366169 | |||
| 2010 | Ga0496111_0976365 | |||
| 2011 | Ga0496111_0978811 | |||
| 2012 | Ga0496112_0092849 | |||
| 2013 | Ga0496112_0099383 | |||
| 2014 | Ga0496112_0366001 | |||
| 2015 | Ga0496112_0455199 | |||
| 2016 | Ga0496112_0484024 | |||
| 2017 | Ga0496112_0630946 | |||
| 2018 | Ga0496113_0025785 | |||
| 2019 | Ga0496113_0146944 | |||
| 2020 | Ga0496113_0156960 | |||
| 2021 | Ga0496113_0551873 | |||
| 2022 | Ga0496113_0605370 | |||
| 2023 | Ga0496113_1047202 | |||
| 2024 | Ga0496114_0020588 | |||
| 2025 | Ga0496114_0120975 | |||
| 2026 | Ga0496114_0148548 | |||
| 2027 | Ga0496114_0163640 | |||
| 2028 | Ga0496114_0252679 | |||
| 2029 | Ga0496114_0469587 | |||
| 2030 | Ga0496114_1264943 | |||
| 2031 | Ga0496115_0021674 | |||
| 2032 | Ga0496115_0212611 | |||
| 2033 | Ga0496115_0225716 | |||
| 2034 | Ga0496119_0075291 | |||
| 2035 | Ga0496120_0016883 | |||
| 2036 | Ga0501298_024594 | |||
| 2037 | Ga0501031_0369623 | |||
| 2038 | Ga0501033_0030233 | |||
| 2039 | Ga0501033_0422753 | |||
| 2040 | Ga0501034_0138934 | |||
| 2041 | Ga0501034_0457306 | |||
| 2042 | Ga0501034_0713371 | |||
| 2043 | Ga0501036_0648665 | |||
| 2044 | Ga0501036_1363107 | |||
| 2045 | Ga0501037_0014364 | |||
| 2046 | Ga0501038_0047819 | |||
| 2047 | Ga0501038_0528552 | |||
| 2048 | Ga0501038_1025854 | |||
| 2049 | Ga0501039_0223854 | |||
| 2050 | Ga0501039_1569173 | |||
| 2051 | Ga0501041_0024249 | |||
| 2052 | Ga0501041_0627895 | |||
| 2053 | Ga0501043_0438851 | |||
| 2054 | Ga0501043_1090770 | |||
| 2055 | Ga0501046_0496201 | |||
| 2056 | Ga0501047_0127351 | |||
| 2057 | Ga0501047_0129823 | |||
| 2058 | Ga0501047_1160851 | |||
| 2059 | Ga0501067_0145857 | |||
| 2060 | Ga0501068_0877576 | |||
| 2061 | Ga0501069_0042491 | |||
| 2062 | Ga0501069_0551447 | |||
| 2063 | Ga0501070_0233215 | |||
| 2064 | Ga0501070_0377246 | |||
| 2065 | Ga0501070_0800964 | |||
| 2066 | Ga0501070_1079820 | |||
| 2067 | Ga0501071_0495719 | |||
| 2068 | Ga0501071_0898074 | |||
| 2069 | Ga0501073_0359322 | |||
| 2070 | Ga0501073_0443546 | |||
| 2071 | Ga0501073_1050036 | |||
| 2072 | Ga0501074_0956967 | |||
| 2073 | Ga0501074_1185758 | |||
| 2074 | Ga0501075_0236956 | |||
| 2075 | Ga0501076_0035663 | |||
| 2076 | Ga0501076_0826681 | |||
| 2077 | Ga0501077_0288904 | |||
| 2078 | Ga0501077_0450948 | |||
| 2079 | Ga0501080_0331543 | |||
| 2080 | Ga0501080_1402968 | |||
| 2081 | Ga0501080_1767151 | |||
| 2082 | Ga0501081_0313759 | |||
| 2083 | Ga0501083_0883423 | |||
| 2084 | Ga0501035_0092116 | |||
| 2085 | Ga0501035_0688211 | |||
| 2086 | Ga0501044_0071231 | |||
| 2087 | Ga0501044_0203380 | |||
| 2088 | nmdc:mga03n38_14547_c1 | |||
| 2089 | nmdc:mga03n38_24423_c1 | |||
| 2090 | nmdc:mga03n38_49021_c1 | |||
| 2091 | nmdc:mga00v17_553656_c1 | |||
| 2092 | nmdc:mga00v17_745679_c1 | |||
| 2093 | nmdc:mga00v17_93927_c1 | |||
| 2094 | nmdc:mga0yw44_35986_c2 | |||
| 2095 | nmdc:mga0yw44_52299_c1 | |||
| 2096 | nmdc:mga0yw44_85227_c1 | |||
| 2097 | nmdc:mga06z11_299_c1 | |||
| 2098 | nmdc:mga06z11_3349_c1 | |||
| 2099 | nmdc:mga06z11_755718_c1 | |||
| 2100 | nmdc:mga06z11_93252_c1 | |||
| 2101 | nmdc:mga04h51_117127_c1 | |||
| 2102 | nmdc:mga04h51_22862_c1 | |||
| 2103 | nmdc:mga07m45_298215_c1 | |||
| 2104 | nmdc:mga05p37_1019249_c1 | |||
| 2105 | nmdc:mga05p37_1403109_c1 | |||
| 2106 | nmdc:mga09592_73506_c1 | |||
| 2107 | nmdc:mga09592_91201_c1 | |||
| 2108 | nmdc:mga0qj67_1379074_c1 | |||
| 2109 | nmdc:mga0qj67_146531_c1 | |||
| 2110 | nmdc:mga0qj67_166450_c1 | |||
| 2111 | nmdc:mga0qj67_19_c1 | |||
| 2112 | nmdc:mga0qj67_314274_c1 | |||
| 2113 | nmdc:mga0qj67_650567_c1 | |||
| 2114 | nmdc:mga0qj67_702658_c1 | |||
| 2115 | nmdc:mga06r32_1198818_c1 | |||
| 2116 | nmdc:mga06r32_569924_c1 | |||
| 2117 | nmdc:mga06r32_597543_c1 | |||
| 2118 | nmdc:mga06r32_847899_c1 | |||
| 2119 | nmdc:mga08y16_144281_c1 | |||
| 2120 | nmdc:mga08y16_39769_c1 | |||
| 2121 | nmdc:mga08y16_465984_c1 | |||
| 2122 | nmdc:mga08y16_480461_c1 | |||
| 2123 | nmdc:mga08y16_679007_c1 | |||
| 2124 | nmdc:mga08y16_960156_c1 | |||
| 2125 | nmdc:mga08y16_97469_c1 | |||
| 2126 | nmdc:mga0n895_190687_c1 | |||
| 2127 | nmdc:mga0n895_31442_c1 | |||
| 2128 | nmdc:mga0n895_401851_c1 | |||
| 2129 | nmdc:mga0n895_847914_c1 | |||
| 2130 | nmdc:mga0rr50_129390_c1 | |||
| 2131 | nmdc:mga0rr50_1611308_c1 | |||
| 2132 | nmdc:mga0rr50_471688_c1 | |||
| 2133 | nmdc:mga0rr50_506045_c1 | |||
| 2134 | nmdc:mga0rr50_61467_c1 | |||
| 2135 | nmdc:mga0a205_77713_c1 | |||
| 2136 | nmdc:mga0a205_936368_c1 | |||
| 2137 | Ga0495601_0000349 | |||
| 2138 | Ga0495601_0219352 | |||
| 2139 | Ga0495601_0392072 | |||
| 2140 | Ga0495612_0001007 | |||
| 2141 | Ga0495595_0031067 | |||
| 2142 | Ga0495595_0047423 | |||
| 2143 | Ga0495595_0731968 | |||
| 2144 | Ga0495619_0036885 | |||
| 2145 | Ga0495619_0126078 | |||
| 2146 | Ga0495619_0225951 | |||
| 2147 | Ga0495619_0245629 | |||
| 2148 | Ga0500646_0037115 | |||
| 2149 | Ga0500583_0275066 | |||
| 2150 | Ga0500641_0263360 | |||
| 2151 | Ga0500658_0025615 | |||
| 2152 | Ga0500604_0023105 | |||
| 2153 | Ga0500616_0031547 | |||
| 2154 | Ga0587077_130732 | |||
| 2155 | Ga0587094_016708 | |||
| 2156 | Ga0501082_0507008 | |||
| 2157 | Ga0501082_0781212 | |||
| 2158 | Ga0501082_1995408 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3c8l-assembly1.cif.gz_A | crystal structure of a ftsz-like protein of unknown function (npun_r1471) from nostoc punctiforme pcc 73102 at 1.22 a resolution | 0.86 | 1 | 111 |
| 3c8l-assembly1.cif.gz_A | crystal structure of a ftsz-like protein of unknown function (npun_r1471) from nostoc punctiforme pcc 73102 at 1.22 a resolution | 0.8387 | 1 | 111 |
| 6ym1-assembly1.cif.gz_A | mycobacterium tuberculosis ftsz in complex with gdp | 0.5728 | 8 | 110 |
| 2r75-assembly1.cif.gz_1 | aquifex aeolicus ftsz with 8-morpholino-gtp | 0.5726 | 6 | 113 |
| 4kwe-assembly3.cif.gz_C | gdp-bound, double-stranded, curved ftsz protofilament structure | 0.57 | 8 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0KCY4_1_112_3.30.1330.20 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Tubulin/FtsZ, C-terminal domain | 0.7925 | 8 | 110 | 3.30.1330.20 |
| 3c8lB00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Tubulin/FtsZ, C-terminal domain | 0.7847 | 3 | 110 | 3.30.1330.20 |
| af_A0A0R0KCY4_1_112_3.30.1330.20 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Tubulin/FtsZ, C-terminal domain | 0.7287 | 8 | 110 | 3.30.1330.20 |
| 2r75102 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Tubulin/FtsZ, C-terminal domain | 0.5585 | 7 | 113 | 3.30.1330.20 |
| af_I6X7X3_52_151_3.30.70.2970 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 | 0.5429 | 2 | 112 | 3.30.70.2970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D4UM75-F1-model_v4 | Uncharacterized protein | 0.9537 | 52 | 106 |
GO:0005525
|
| AF-A0A6V6ZR18-F1-model_v4 | Uncharacterized protein | 0.945 | 52 | 106 |
GO:0005525
|
| AF-A0A2E7DIA3-F1-model_v4 | Uncharacterized protein | 0.9401 | 7 | 113 |
GO:0005525
|
| AF-A0A058ZLW1-F1-model_v4 | Lin0512 family protein | 0.9396 | 7 | 111 |
GO:0005525
|
| AF-A0A0L1JRL0-F1-model_v4 | Uncharacterized protein | 0.9342 | 7 | 108 |
GO:0005525
|