F489607
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1077 | 400 | 2112 | 116 |
Family's Representative Sequence
| Representative Sequence | 3300044735|Ga0466968_0103734|Ga0466968_0103734_90_488 |
| Length | 132 |
| Sequence | MTAGENTRREMMAQANVTMSVRTVGDTVSIVDVQGDVTAFAENALMDAYTRASAAGARAIILNFSEMEYMNSGGIGLLVTLLIRVNRQKQRLLTYGLSEHYRHIFDITRLNEAIGVYDAEAEALNAARASAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 54 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 80 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 81 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 82 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 101 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 102 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 131 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 132 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 133 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 135 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 136 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 139 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 143 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 144 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 145 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 146 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 153 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 158 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 168 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 169 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 170 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 171 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 172 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 179 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 185 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 191 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 195 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 199 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 207 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 208 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 209 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 210 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 211 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 212 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 213 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 214 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 215 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 216 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 217 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 218 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 219 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 220 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 221 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 222 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 223 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 224 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 225 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 226 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 227 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 228 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 229 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 230 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 231 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 232 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 233 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 234 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 235 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 236 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 237 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 238 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 239 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 240 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 241 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 242 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 243 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 244 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 245 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 246 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 247 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 248 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 249 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 250 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 251 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 252 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 253 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 254 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 255 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 256 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 257 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 258 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 259 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 260 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 333 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 380 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 381 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 382 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 383 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 384 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 385 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 387 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 388 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 389 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 400 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.24 |
| Metatranscriptomes | 1.67 |
| Isolates | 0.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.74 |
| Nodule | 0 |
| Rhizoplane | 3.06 |
| Rhizosphere | 95.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466968_0103734 | 3300044735 | Bacteria | 1272 |
| 2 | JGI25407J50210_10014190 | 3300003373 | Bacteria | 2053 |
| 3 | JGI25407J50210_10015536 | 3300003373 | Bacteria | 1967 |
| 4 | JGI25407J50210_10021814 | 3300003373 | Bacteria | 1664 |
| 5 | JGI25407J50210_10114121 | 3300003373 | Bacteria | 666 |
| 6 | Ga0006562J51391_1127962 | 3300003578 | Bacteria | 7160 |
| 7 | Ga0065707_10838498 | 3300005295 | Bacteria | 586 |
| 8 | Ga0070690_101462189 | 3300005330 | Bacteria | 551 |
| 9 | Ga0068869_100930246 | 3300005334 | Bacteria | 754 |
| 10 | Ga0070682_100061080 | 3300005337 | Bacteria | 2385 |
| 11 | Ga0070689_101764000 | 3300005340 | Bacteria | 564 |
| 12 | Ga0070668_100008110 | 3300005347 | Bacteria | 7802 |
| 13 | Ga0070668_100634040 | 3300005347 | Bacteria | 938 |
| 14 | Ga0070675_100144304 | 3300005354 | Unclassified | 2037 |
| 15 | Ga0070674_100328860 | 3300005356 | Bacteria | 1228 |
| 16 | Ga0070673_102321984 | 3300005364 | Bacteria | 510 |
| 17 | Ga0070667_100681042 | 3300005367 | Bacteria | 950 |
| 18 | Ga0070703_10021940 | 3300005406 | Unclassified | 1870 |
| 19 | Ga0070709_10000983 | 3300005434 | Bacteria | 15764 |
| 20 | Ga0070714_100077832 | 3300005435 | Bacteria | 2881 |
| 21 | Ga0070714_100149009 | 3300005435 | Bacteria | 2106 |
| 22 | Ga0070714_100180610 | 3300005435 | Bacteria | 1920 |
| 23 | Ga0070714_100468400 | 3300005435 | Unclassified | 1198 |
| 24 | Ga0070714_100522977 | 3300005435 | Bacteria | 1133 |
| 25 | Ga0070714_100816647 | 3300005435 | Unclassified | 903 |
| 26 | Ga0070713_100503201 | 3300005436 | Bacteria | 1143 |
| 27 | Ga0070713_101480246 | 3300005436 | Bacteria | 659 |
| 28 | Ga0070713_102443580 | 3300005436 | Unclassified | 505 |
| 29 | Ga0070710_10000983 | 3300005437 | Bacteria | 13558 |
| 30 | Ga0070710_10026704 | 3300005437 | Bacteria | 3071 |
| 31 | Ga0070710_10198192 | 3300005437 | Bacteria | 1266 |
| 32 | Ga0070711_100004101 | 3300005439 | Bacteria | 8563 |
| 33 | Ga0070711_100038046 | 3300005439 | Bacteria | 3232 |
| 34 | Ga0070711_100400901 | 3300005439 | Unclassified | 1113 |
| 35 | Ga0070705_100173662 | 3300005440 | Bacteria | 1453 |
| 36 | Ga0070700_100612158 | 3300005441 | Bacteria | 855 |
| 37 | Ga0070700_101767562 | 3300005441 | Bacteria | 532 |
| 38 | Ga0070708_100013286 | 3300005445 | Bacteria | 6738 |
| 39 | Ga0070708_100163195 | 3300005445 | Bacteria | 2077 |
| 40 | Ga0070708_100505557 | 3300005445 | Bacteria | 1140 |
| 41 | Ga0070708_100639503 | 3300005445 | Unclassified | 1003 |
| 42 | Ga0070708_100665263 | 3300005445 | Unclassified | 981 |
| 43 | Ga0070663_100026395 | 3300005455 | Bacteria | 3934 |
| 44 | Ga0070662_100005719 | 3300005457 | Bacteria | 7964 |
| 45 | Ga0070681_10733058 | 3300005458 | Bacteria | 904 |
| 46 | Ga0068867_101709257 | 3300005459 | Bacteria | 590 |
| 47 | Ga0070685_11603975 | 3300005466 | Bacteria | 503 |
| 48 | Ga0070706_100000142 | 3300005467 | Bacteria | 90715 |
| 49 | Ga0070706_100003391 | 3300005467 | Bacteria | 15711 |
| 50 | Ga0070706_100009953 | 3300005467 | Bacteria | 8831 |
| 51 | Ga0070706_100011275 | 3300005467 | Bacteria | 8302 |
| 52 | Ga0070706_100056179 | 3300005467 | Bacteria | 3633 |
| 53 | Ga0070706_100067400 | 3300005467 | Bacteria | 3310 |
| 54 | Ga0070706_100069270 | 3300005467 | Bacteria | 3263 |
| 55 | Ga0070706_100965217 | 3300005467 | Bacteria | 786 |
| 56 | Ga0070707_100003832 | 3300005468 | Bacteria | 14172 |
| 57 | Ga0070707_100006360 | 3300005468 | Bacteria | 10984 |
| 58 | Ga0070707_100019230 | 3300005468 | Bacteria | 6434 |
| 59 | Ga0070707_100026258 | 3300005468 | Bacteria | 5528 |
| 60 | Ga0070707_100185242 | 3300005468 | Bacteria | 2030 |
| 61 | Ga0070707_100412246 | 3300005468 | Unclassified | 1311 |
| 62 | Ga0070698_100001643 | 3300005471 | Bacteria | 24933 |
| 63 | Ga0070698_100012817 | 3300005471 | Bacteria | 8878 |
| 64 | Ga0070698_100024464 | 3300005471 | Bacteria | 6302 |
| 65 | Ga0070698_100038466 | 3300005471 | Bacteria | 4929 |
| 66 | Ga0070698_100113874 | 3300005471 | Bacteria | 2670 |
| 67 | Ga0070698_100744224 | 3300005471 | Unclassified | 923 |
| 68 | Ga0070698_101267085 | 3300005471 | Bacteria | 687 |
| 69 | Ga0070698_101382324 | 3300005471 | Bacteria | 655 |
| 70 | Ga0070699_100015884 | 3300005518 | Bacteria | 6464 |
| 71 | Ga0070699_100062035 | 3300005518 | Unclassified | 3239 |
| 72 | Ga0070699_100615888 | 3300005518 | Bacteria | 990 |
| 73 | Ga0070699_101024858 | 3300005518 | Bacteria | 757 |
| 74 | Ga0070699_101469240 | 3300005518 | Unclassified | 625 |
| 75 | Ga0070699_101640087 | 3300005518 | Unclassified | 589 |
| 76 | Ga0070699_101865993 | 3300005518 | Bacteria | 550 |
| 77 | Ga0070679_100060908 | 3300005530 | Bacteria | 3762 |
| 78 | Ga0070684_101896266 | 3300005535 | Unclassified | 562 |
| 79 | Ga0070697_100011827 | 3300005536 | Bacteria | 6831 |
| 80 | Ga0070697_100064077 | 3300005536 | Bacteria | 3002 |
| 81 | Ga0070697_100094677 | 3300005536 | Bacteria | 2475 |
| 82 | Ga0070686_100678173 | 3300005544 | Bacteria | 820 |
| 83 | Ga0070696_100798237 | 3300005546 | Bacteria | 777 |
| 84 | Ga0070665_100269843 | 3300005548 | Bacteria | 1703 |
| 85 | Ga0068855_100747369 | 3300005563 | Bacteria | 1043 |
| 86 | Ga0068857_100399528 | 3300005577 | Bacteria | 1279 |
| 87 | Ga0068856_101769693 | 3300005614 | Bacteria | 630 |
| 88 | Ga0068852_100872884 | 3300005616 | Bacteria | 916 |
| 89 | Ga0068864_100322233 | 3300005618 | Bacteria | 1452 |
| 90 | Ga0068864_101913771 | 3300005618 | Bacteria | 599 |
| 91 | Ga0068861_100007084 | 3300005719 | Bacteria | 7672 |
| 92 | Ga0068860_101149427 | 3300005843 | Bacteria | 796 |
| 93 | Ga0081455_10053058 | 3300005937 | Bacteria | 3466 |
| 94 | Ga0081455_10090328 | 3300005937 | Bacteria | 2484 |
| 95 | Ga0081455_10203841 | 3300005937 | Bacteria | 1479 |
| 96 | Ga0081538_10000563 | 3300005981 | Bacteria | 41069 |
| 97 | Ga0081538_10001741 | 3300005981 | Bacteria | 22117 |
| 98 | Ga0081538_10004705 | 3300005981 | Bacteria | 12498 |
| 99 | Ga0081538_10015748 | 3300005981 | Bacteria | 5837 |
| 100 | Ga0081538_10031139 | 3300005981 | Bacteria | 3606 |
| 101 | Ga0081538_10031527 | 3300005981 | Bacteria | 3573 |
| 102 | Ga0081538_10055754 | 3300005981 | Bacteria | 2323 |
| 103 | Ga0081538_10164077 | 3300005981 | Unclassified | 982 |
| 104 | Ga0081540_1027783 | 3300005983 | Bacteria | 3195 |
| 105 | Ga0081539_10006760 | 3300005985 | Bacteria | 10768 |
| 106 | Ga0081539_10080116 | 3300005985 | Unclassified | 1719 |
| 107 | Ga0070717_10006582 | 3300006028 | Bacteria | 8560 |
| 108 | Ga0070717_10012456 | 3300006028 | Bacteria | 6486 |
| 109 | Ga0070717_10058391 | 3300006028 | Bacteria | 3190 |
| 110 | Ga0070717_10066609 | 3300006028 | Bacteria | 2995 |
| 111 | Ga0070717_10083863 | 3300006028 | Bacteria | 2680 |
| 112 | Ga0070717_10461554 | 3300006028 | Bacteria | 1145 |
| 113 | Ga0070717_10812110 | 3300006028 | Bacteria | 851 |
| 114 | Ga0075432_10010328 | 3300006058 | Bacteria | 3166 |
| 115 | Ga0070716_100000097 | 3300006173 | Bacteria | 34237 |
| 116 | Ga0070716_100003706 | 3300006173 | Bacteria | 7235 |
| 117 | Ga0070712_100002546 | 3300006175 | Bacteria | 11261 |
| 118 | Ga0070712_100036478 | 3300006175 | Bacteria | 3346 |
| 119 | Ga0070712_100283130 | 3300006175 | Unclassified | 1336 |
| 120 | Ga0070712_100932395 | 3300006175 | Bacteria | 749 |
| 121 | Ga0070712_101472150 | 3300006175 | Bacteria | 595 |
| 122 | Ga0075367_10627241 | 3300006178 | Bacteria | 683 |
| 123 | Ga0075427_10001437 | 3300006194 | Bacteria | 3054 |
| 124 | Ga0075428_100452972 | 3300006844 | Unclassified | 1374 |
| 125 | Ga0075428_100530315 | 3300006844 | Unclassified | 1259 |
| 126 | Ga0075428_100680063 | 3300006844 | Bacteria | 1097 |
| 127 | Ga0075430_100002917 | 3300006846 | Bacteria | 14300 |
| 128 | Ga0075430_100234085 | 3300006846 | Bacteria | 1523 |
| 129 | Ga0075431_100027379 | 3300006847 | Bacteria | 5848 |
| 130 | Ga0075431_100427124 | 3300006847 | Bacteria | 1323 |
| 131 | Ga0075431_102063812 | 3300006847 | Unclassified | 525 |
| 132 | Ga0075433_10016846 | 3300006852 | Bacteria | 6038 |
| 133 | Ga0075433_10547405 | 3300006852 | Unclassified | 1017 |
| 134 | Ga0075434_100155704 | 3300006871 | Bacteria | 2304 |
| 135 | Ga0075434_100383215 | 3300006871 | Bacteria | 1427 |
| 136 | Ga0075434_101082129 | 3300006871 | Bacteria | 815 |
| 137 | Ga0075434_101217600 | 3300006871 | Unclassified | 765 |
| 138 | Ga0075429_100038260 | 3300006880 | Bacteria | 4176 |
| 139 | Ga0075435_100202628 | 3300007076 | Bacteria | 1682 |
| 140 | Ga0099795_10196660 | 3300007788 | Bacteria | 849 |
| 141 | Ga0105251_10032552 | 3300009011 | Bacteria | 2597 |
| 142 | Ga0105244_10593318 | 3300009036 | Bacteria | 508 |
| 143 | Ga0105240_10184076 | 3300009093 | Bacteria | 2462 |
| 144 | Ga0105240_10844138 | 3300009093 | Bacteria | 989 |
| 145 | Ga0111539_10067328 | 3300009094 | Bacteria | 4229 |
| 146 | Ga0111539_10551431 | 3300009094 | Bacteria | 1342 |
| 147 | Ga0111539_12285214 | 3300009094 | Unclassified | 627 |
| 148 | Ga0111539_12822056 | 3300009094 | Unclassified | 563 |
| 149 | Ga0105245_10216326 | 3300009098 | Bacteria | 1846 |
| 150 | Ga0105247_10095875 | 3300009101 | Bacteria | 1890 |
| 151 | Ga0114129_10078357 | 3300009147 | Bacteria | 4596 |
| 152 | Ga0114129_10200404 | 3300009147 | Bacteria | 2704 |
| 153 | Ga0114129_10233930 | 3300009147 | Bacteria | 2474 |
| 154 | Ga0114129_10480397 | 3300009147 | Unclassified | 1626 |
| 155 | Ga0114129_10502069 | 3300009147 | Bacteria | 1584 |
| 156 | Ga0114129_11309428 | 3300009147 | Unclassified | 898 |
| 157 | Ga0105243_10214611 | 3300009148 | Bacteria | 1697 |
| 158 | Ga0105241_11240148 | 3300009174 | Unclassified | 708 |
| 159 | Ga0105242_10070130 | 3300009176 | Bacteria | 2905 |
| 160 | Ga0105248_10503616 | 3300009177 | Bacteria | 1365 |
| 161 | Ga0105248_12209765 | 3300009177 | Unclassified | 626 |
| 162 | Ga0105237_10598666 | 3300009545 | Bacteria | 1109 |
| 163 | Ga0105237_10672161 | 3300009545 | Unclassified | 1042 |
| 164 | Ga0105238_10819334 | 3300009551 | Bacteria | 947 |
| 165 | Ga0105249_10006149 | 3300009553 | Bacteria | 10412 |
| 166 | Ga0105249_11093758 | 3300009553 | Bacteria | 867 |
| 167 | Ga0105249_11541442 | 3300009553 | Bacteria | 737 |
| 168 | Ga0105028_101642 | 3300009993 | Bacteria | 2342 |
| 169 | Ga0105246_10878893 | 3300011119 | Bacteria | 802 |
| 170 | Ga0105246_11227450 | 3300011119 | Bacteria | 691 |
| 171 | Ga0157340_1002342 | 3300012473 | Bacteria | 959 |
| 172 | Ga0157320_1011695 | 3300012481 | Bacteria | 695 |
| 173 | Ga0157345_1006176 | 3300012498 | Bacteria | 947 |
| 174 | Ga0157342_1002222 | 3300012507 | Bacteria | 1551 |
| 175 | Ga0157371_10120671 | 3300013102 | Bacteria | 1864 |
| 176 | Ga0157371_10390303 | 3300013102 | Bacteria | 1017 |
| 177 | Ga0157370_10054257 | 3300013104 | Bacteria | 3820 |
| 178 | Ga0157369_10055792 | 3300013105 | Bacteria | 4264 |
| 179 | Ga0157369_11165213 | 3300013105 | Bacteria | 787 |
| 180 | Ga0163162_10988600 | 3300013306 | Bacteria | 951 |
| 181 | Ga0157372_11990598 | 3300013307 | Unclassified | 668 |
| 182 | Ga0157375_13413879 | 3300013308 | Bacteria | 529 |
| 183 | Ga0163163_10147155 | 3300014325 | Unclassified | 2400 |
| 184 | Ga0163163_11008237 | 3300014325 | Bacteria | 896 |
| 185 | Ga0163163_11936685 | 3300014325 | Bacteria | 649 |
| 186 | Ga0163163_13049253 | 3300014325 | Bacteria | 522 |
| 187 | Ga0157380_10163599 | 3300014326 | Unclassified | 1937 |
| 188 | Ga0157380_12967251 | 3300014326 | Bacteria | 540 |
| 189 | Ga0157377_10103090 | 3300014745 | Bacteria | 1704 |
| 190 | Ga0157379_10399146 | 3300014968 | Bacteria | 1264 |
| 191 | Ga0157379_11107174 | 3300014968 | Bacteria | 759 |
| 192 | Ga0157379_11558184 | 3300014968 | Bacteria | 644 |
| 193 | Ga0157376_10607948 | 3300014969 | Bacteria | 1089 |
| 194 | Ga0157376_12420890 | 3300014969 | Bacteria | 565 |
| 195 | Ga0182005_1140437 | 3300015265 | Unclassified | 698 |
| 196 | Ga0163161_10064674 | 3300017792 | Bacteria | 2669 |
| 197 | Ga0197907_10773823 | 3300020069 | Unclassified | 2072 |
| 198 | Ga0206351_10514377 | 3300020077 | Unclassified | 1928 |
| 199 | Ga0206350_10548992 | 3300020080 | Bacteria | 1085 |
| 200 | Ga0206350_11212143 | 3300020080 | Unclassified | 1756 |
| 201 | Ga0206354_10604926 | 3300020081 | Bacteria | 1293 |
| 202 | Ga0213873_10029940 | 3300021358 | Bacteria | 1345 |
| 203 | Ga0213875_10126330 | 3300021388 | Bacteria | 1195 |
| 204 | Ga0213875_10141583 | 3300021388 | Bacteria | 1126 |
| 205 | Ga0224712_10061078 | 3300022467 | Bacteria | 1502 |
| 206 | Ga0207692_10001316 | 3300025898 | Bacteria | 9249 |
| 207 | Ga0207692_10019012 | 3300025898 | Bacteria | 3096 |
| 208 | Ga0207699_10003023 | 3300025906 | Bacteria | 7992 |
| 209 | Ga0207684_10001073 | 3300025910 | Bacteria | 30613 |
| 210 | Ga0207684_10001870 | 3300025910 | Bacteria | 21930 |
| 211 | Ga0207684_10005449 | 3300025910 | Bacteria | 11728 |
| 212 | Ga0207684_10008146 | 3300025910 | Bacteria | 9341 |
| 213 | Ga0207684_10026481 | 3300025910 | Unclassified | 4943 |
| 214 | Ga0207684_10041337 | 3300025910 | Bacteria | 3910 |
| 215 | Ga0207684_10138132 | 3300025910 | Bacteria | 2094 |
| 216 | Ga0207684_10970528 | 3300025910 | Bacteria | 712 |
| 217 | Ga0207684_11505109 | 3300025910 | Bacteria | 548 |
| 218 | Ga0207693_10000671 | 3300025915 | Bacteria | 30698 |
| 219 | Ga0207693_10010726 | 3300025915 | Bacteria | 7437 |
| 220 | Ga0207693_10275877 | 3300025915 | Bacteria | 1317 |
| 221 | Ga0207693_10633332 | 3300025915 | Bacteria | 831 |
| 222 | Ga0207663_10052328 | 3300025916 | Bacteria | 2546 |
| 223 | Ga0207663_10188636 | 3300025916 | Bacteria | 1479 |
| 224 | Ga0207663_10642136 | 3300025916 | Bacteria | 837 |
| 225 | Ga0207652_10956565 | 3300025921 | Bacteria | 754 |
| 226 | Ga0207646_10001028 | 3300025922 | Bacteria | 35654 |
| 227 | Ga0207646_10001962 | 3300025922 | Bacteria | 24664 |
| 228 | Ga0207646_10024943 | 3300025922 | Bacteria | 5471 |
| 229 | Ga0207646_10040303 | 3300025922 | Unclassified | 4200 |
| 230 | Ga0207646_10098289 | 3300025922 | Bacteria | 2623 |
| 231 | Ga0207646_10099779 | 3300025922 | Bacteria | 2602 |
| 232 | Ga0207646_10104202 | 3300025922 | Unclassified | 2544 |
| 233 | Ga0207646_10353867 | 3300025922 | Unclassified | 1327 |
| 234 | Ga0207659_10114409 | 3300025926 | Unclassified | 2056 |
| 235 | Ga0207700_10001352 | 3300025928 | Bacteria | 13896 |
| 236 | Ga0207700_10002344 | 3300025928 | Bacteria | 10865 |
| 237 | Ga0207700_10003967 | 3300025928 | Bacteria | 8659 |
| 238 | Ga0207700_10290820 | 3300025928 | Unclassified | 1408 |
| 239 | Ga0207700_10299109 | 3300025928 | Bacteria | 1389 |
| 240 | Ga0207700_10382429 | 3300025928 | Bacteria | 1231 |
| 241 | Ga0207700_11657458 | 3300025928 | Unclassified | 565 |
| 242 | Ga0207664_10002013 | 3300025929 | Bacteria | 13392 |
| 243 | Ga0207664_10033085 | 3300025929 | Bacteria | 3969 |
| 244 | Ga0207664_10450786 | 3300025929 | Bacteria | 1148 |
| 245 | Ga0207664_10523795 | 3300025929 | Bacteria | 1062 |
| 246 | Ga0207664_10869465 | 3300025929 | Bacteria | 810 |
| 247 | Ga0207706_10012303 | 3300025933 | Bacteria | 7797 |
| 248 | Ga0207686_11399184 | 3300025934 | Bacteria | 576 |
| 249 | Ga0207669_10353848 | 3300025937 | Bacteria | 1136 |
| 250 | Ga0207665_10000178 | 3300025939 | Bacteria | 42696 |
| 251 | Ga0207665_10005547 | 3300025939 | Bacteria | 8417 |
| 252 | Ga0207711_10357556 | 3300025941 | Unclassified | 1352 |
| 253 | Ga0207689_10457863 | 3300025942 | Bacteria | 1067 |
| 254 | Ga0207667_10356845 | 3300025949 | Bacteria | 1491 |
| 255 | Ga0207712_10055695 | 3300025961 | Bacteria | 2783 |
| 256 | Ga0207712_10515318 | 3300025961 | Bacteria | 1024 |
| 257 | Ga0207668_10105404 | 3300025972 | Bacteria | 2104 |
| 258 | Ga0207678_10004251 | 3300026067 | Bacteria | 12841 |
| 259 | Ga0207708_10386454 | 3300026075 | Bacteria | 1155 |
| 260 | Ga0207708_11653676 | 3300026075 | Bacteria | 562 |
| 261 | Ga0207676_10042843 | 3300026095 | Unclassified | 3482 |
| 262 | Ga0207676_12305740 | 3300026095 | Bacteria | 536 |
| 263 | Ga0207674_10134721 | 3300026116 | Bacteria | 2432 |
| 264 | Ga0207674_10555184 | 3300026116 | Unclassified | 1109 |
| 265 | Ga0207675_100000964 | 3300026118 | Bacteria | 28651 |
| 266 | Ga0207675_100408660 | 3300026118 | Bacteria | 1339 |
| 267 | Ga0207428_10001806 | 3300027907 | Bacteria | 21911 |
| 268 | Ga0207428_10087521 | 3300027907 | Bacteria | 2423 |
| 269 | Ga0207428_10334313 | 3300027907 | Unclassified | 1117 |
| 270 | Ga0268266_10260534 | 3300028379 | Bacteria | 1607 |
| 271 | Ga0268265_10639840 | 3300028380 | Bacteria | 1021 |
| 272 | Ga0265337_1036150 | 3300028556 | Bacteria | 1443 |
| 273 | Ga0265326_10075822 | 3300028558 | Bacteria | 951 |
| 274 | Ga0265319_1000833 | 3300028563 | Bacteria | 19641 |
| 275 | Ga0265319_1035454 | 3300028563 | Bacteria | 1711 |
| 276 | Ga0265319_1160140 | 3300028563 | Bacteria | 695 |
| 277 | Ga0265334_10191905 | 3300028573 | Bacteria | 711 |
| 278 | Ga0265318_10015636 | 3300028577 | Bacteria | 3150 |
| 279 | Ga0265318_10018610 | 3300028577 | Bacteria | 2831 |
| 280 | Ga0265318_10141140 | 3300028577 | Unclassified | 885 |
| 281 | Ga0265322_10038545 | 3300028654 | Bacteria | 1360 |
| 282 | Ga0265336_10015342 | 3300028666 | Bacteria | 2521 |
| 283 | Ga0265336_10069854 | 3300028666 | Bacteria | 1050 |
| 284 | Ga0265338_10006074 | 3300028800 | Bacteria | 15514 |
| 285 | Ga0265338_10007987 | 3300028800 | Bacteria | 12952 |
| 286 | Ga0265338_10069170 | 3300028800 | Bacteria | 3035 |
| 287 | Ga0265338_10378061 | 3300028800 | Bacteria | 1014 |
| 288 | Ga0265324_10001131 | 3300029957 | Bacteria | 15989 |
| 289 | Ga0265768_100661 | 3300030963 | Bacteria | 1411 |
| 290 | Ga0265760_10035068 | 3300031090 | Bacteria | 1485 |
| 291 | Ga0265332_10003991 | 3300031238 | Bacteria | 7027 |
| 292 | Ga0265320_10000154 | 3300031240 | Bacteria | 57386 |
| 293 | Ga0265320_10022913 | 3300031240 | Bacteria | 3334 |
| 294 | Ga0265320_10106596 | 3300031240 | Bacteria | 1287 |
| 295 | Ga0265320_10218361 | 3300031240 | Unclassified | 849 |
| 296 | Ga0265325_10022357 | 3300031241 | Bacteria | 3465 |
| 297 | Ga0265325_10067153 | 3300031241 | Bacteria | 1807 |
| 298 | Ga0265329_10037000 | 3300031242 | Bacteria | 1573 |
| 299 | Ga0265340_10000186 | 3300031247 | Bacteria | 31591 |
| 300 | Ga0265339_10025132 | 3300031249 | Bacteria | 3422 |
| 301 | Ga0265339_10144771 | 3300031249 | Bacteria | 1206 |
| 302 | Ga0265331_10018754 | 3300031250 | Bacteria | 3580 |
| 303 | Ga0265327_10382959 | 3300031251 | Bacteria | 612 |
| 304 | Ga0265316_10016181 | 3300031344 | Bacteria | 6481 |
| 305 | Ga0307408_100017050 | 3300031548 | Bacteria | 4857 |
| 306 | Ga0307408_100029949 | 3300031548 | Bacteria | 3776 |
| 307 | Ga0307408_100246375 | 3300031548 | Bacteria | 1471 |
| 308 | Ga0307408_100446534 | 3300031548 | Bacteria | 1121 |
| 309 | Ga0307408_102087445 | 3300031548 | Unclassified | 546 |
| 310 | Ga0307408_102391716 | 3300031548 | Unclassified | 513 |
| 311 | Ga0265313_10014607 | 3300031595 | Bacteria | 4630 |
| 312 | Ga0316575_10041924 | 3300031665 | Unclassified | 1811 |
| 313 | Ga0265314_10005589 | 3300031711 | Bacteria | 11300 |
| 314 | Ga0265314_10171263 | 3300031711 | Bacteria | 1310 |
| 315 | Ga0265342_10050432 | 3300031712 | Bacteria | 2486 |
| 316 | Ga0316576_10692399 | 3300031727 | Bacteria | 739 |
| 317 | Ga0307405_10002109 | 3300031731 | Bacteria | 8663 |
| 318 | Ga0307405_10002769 | 3300031731 | Bacteria | 7863 |
| 319 | Ga0307405_10012243 | 3300031731 | Bacteria | 4532 |
| 320 | Ga0307405_10111051 | 3300031731 | Unclassified | 1857 |
| 321 | Ga0307405_10418757 | 3300031731 | Unclassified | 1053 |
| 322 | Ga0307405_10428068 | 3300031731 | Bacteria | 1043 |
| 323 | Ga0307405_10865654 | 3300031731 | Bacteria | 762 |
| 324 | Ga0307405_11968542 | 3300031731 | Unclassified | 522 |
| 325 | Ga0307413_10149702 | 3300031824 | Bacteria | 1624 |
| 326 | Ga0307413_10172241 | 3300031824 | Bacteria | 1533 |
| 327 | Ga0307413_10204254 | 3300031824 | Bacteria | 1429 |
| 328 | Ga0307413_10282620 | 3300031824 | Bacteria | 1249 |
| 329 | Ga0307413_10314651 | 3300031824 | Bacteria | 1193 |
| 330 | Ga0307413_10633652 | 3300031824 | Unclassified | 879 |
| 331 | Ga0307413_11168757 | 3300031824 | Unclassified | 668 |
| 332 | Ga0307410_10006583 | 3300031852 | Bacteria | 6282 |
| 333 | Ga0307410_10038627 | 3300031852 | Bacteria | 3128 |
| 334 | Ga0307410_10170004 | 3300031852 | Unclassified | 1641 |
| 335 | Ga0307406_10039438 | 3300031901 | Bacteria | 2930 |
| 336 | Ga0307406_10103878 | 3300031901 | Bacteria | 1941 |
| 337 | Ga0307406_10128701 | 3300031901 | Bacteria | 1773 |
| 338 | Ga0307406_10190638 | 3300031901 | Unclassified | 1500 |
| 339 | Ga0307406_11008636 | 3300031901 | Bacteria | 714 |
| 340 | Ga0307407_10089446 | 3300031903 | Bacteria | 1883 |
| 341 | Ga0307407_10092003 | 3300031903 | Bacteria | 1861 |
| 342 | Ga0307407_10184117 | 3300031903 | Bacteria | 1386 |
| 343 | Ga0307407_10224126 | 3300031903 | Bacteria | 1273 |
| 344 | Ga0307407_10488398 | 3300031903 | Bacteria | 901 |
| 345 | Ga0307412_10073747 | 3300031911 | Bacteria | 2336 |
| 346 | Ga0307412_10099662 | 3300031911 | Bacteria | 2052 |
| 347 | Ga0307412_10124619 | 3300031911 | Bacteria | 1861 |
| 348 | Ga0307412_10564523 | 3300031911 | Bacteria | 958 |
| 349 | Ga0307412_10976321 | 3300031911 | Unclassified | 747 |
| 350 | Ga0307412_11829637 | 3300031911 | Bacteria | 559 |
| 351 | Ga0307409_100005049 | 3300031995 | Bacteria | 7519 |
| 352 | Ga0307409_100067052 | 3300031995 | Bacteria | 2832 |
| 353 | Ga0307409_100292325 | 3300031995 | Bacteria | 1511 |
| 354 | Ga0307409_100382494 | 3300031995 | Unclassified | 1338 |
| 355 | Ga0307409_100503025 | 3300031995 | Unclassified | 1180 |
| 356 | Ga0307409_100581058 | 3300031995 | Bacteria | 1104 |
| 357 | Ga0307409_101353218 | 3300031995 | Bacteria | 738 |
| 358 | Ga0307416_100003396 | 3300032002 | Bacteria | 9337 |
| 359 | Ga0307416_100012312 | 3300032002 | Bacteria | 5757 |
| 360 | Ga0307416_100012406 | 3300032002 | Bacteria | 5741 |
| 361 | Ga0307416_100045709 | 3300032002 | Bacteria | 3449 |
| 362 | Ga0307416_100092966 | 3300032002 | Bacteria | 2596 |
| 363 | Ga0307416_100250439 | 3300032002 | Bacteria | 1723 |
| 364 | Ga0307416_100262378 | 3300032002 | Bacteria | 1689 |
| 365 | Ga0307416_100925928 | 3300032002 | Bacteria | 972 |
| 366 | Ga0307416_103597687 | 3300032002 | Bacteria | 519 |
| 367 | Ga0307414_10044040 | 3300032004 | Bacteria | 3044 |
| 368 | Ga0307414_10046088 | 3300032004 | Bacteria | 2990 |
| 369 | Ga0307414_10512521 | 3300032004 | Bacteria | 1063 |
| 370 | Ga0307414_10954081 | 3300032004 | Bacteria | 788 |
| 371 | Ga0307414_11614583 | 3300032004 | Unclassified | 604 |
| 372 | Ga0307411_10063215 | 3300032005 | Unclassified | 2473 |
| 373 | Ga0307411_10102836 | 3300032005 | Bacteria | 2025 |
| 374 | Ga0307411_10176214 | 3300032005 | Unclassified | 1618 |
| 375 | Ga0307415_100010710 | 3300032126 | Bacteria | 5207 |
| 376 | Ga0307415_100018693 | 3300032126 | Bacteria | 4191 |
| 377 | Ga0307415_100030941 | 3300032126 | Bacteria | 3442 |
| 378 | Ga0307415_100084444 | 3300032126 | Bacteria | 2278 |
| 379 | Ga0307415_100223395 | 3300032126 | Bacteria | 1511 |
| 380 | Ga0307415_100240758 | 3300032126 | Bacteria | 1463 |
| 381 | Ga0307415_100242573 | 3300032126 | Bacteria | 1458 |
| 382 | Ga0307415_100314374 | 3300032126 | Bacteria | 1303 |
| 383 | Ga0307415_100442294 | 3300032126 | Bacteria | 1121 |
| 384 | Ga0307415_101276983 | 3300032126 | Archaea | 694 |
| 385 | Ga0307415_101328545 | 3300032126 | Bacteria | 682 |
| 386 | Ga0307415_101463338 | 3300032126 | Bacteria | 652 |
| 387 | Ga0373950_0029024 | 3300034818 | Bacteria | 1016 |
| 388 | Ga0373958_0021262 | 3300034819 | Bacteria | 1203 |
| 389 | Ga0373938_0010421 | 3300034957 | Bacteria | 1708 |
| 390 | Ga0373928_0005198 | 3300035084 | Bacteria | 2484 |
| 391 | Ga0373929_0006261 | 3300035085 | Bacteria | 2149 |
| 392 | Ga0373934_0000165 | 3300035086 | Bacteria | 24127 |
| 393 | Ga0373934_0075695 | 3300035086 | Bacteria | 1349 |
| 394 | Ga0373934_0180328 | 3300035086 | Bacteria | 868 |
| 395 | Ga0373944_0160641 | 3300035089 | Bacteria | 797 |
| 396 | Ga0373949_0050394 | 3300035090 | Bacteria | 1047 |
| 397 | Ga0373951_0007547 | 3300035091 | Bacteria | 2469 |
| 398 | Ga0373923_0076773 | 3300035111 | Bacteria | 1443 |
| 399 | Ga0373923_0122274 | 3300035111 | Bacteria | 1164 |
| 400 | Ga0373923_0130757 | 3300035111 | Bacteria | 1128 |
| 401 | Ga0373936_0198179 | 3300035113 | Bacteria | 886 |
| 402 | Ga0373936_0354169 | 3300035113 | Bacteria | 669 |
| 403 | Ga0373939_0504969 | 3300035114 | Bacteria | 517 |
| 404 | Ga0373941_0006061 | 3300035115 | Bacteria | 2890 |
| 405 | Ga0373945_0351697 | 3300035116 | Bacteria | 639 |
| 406 | Ga0373953_0000564 | 3300035117 | Bacteria | 10261 |
| 407 | Ga0373953_0039396 | 3300035117 | Bacteria | 1873 |
| 408 | Ga0373954_0005533 | 3300035118 | Bacteria | 5468 |
| 409 | Ga0373954_0019254 | 3300035118 | Bacteria | 3077 |
| 410 | Ga0373954_0031659 | 3300035118 | Bacteria | 2443 |
| 411 | Ga0373956_0000061 | 3300035119 | Bacteria | 37279 |
| 412 | Ga0373956_0286453 | 3300035119 | Unclassified | 784 |
| 413 | Ga0373956_0568220 | 3300035119 | Bacteria | 541 |
| 414 | Ga0373957_0000042 | 3300035120 | Bacteria | 33397 |
| 415 | Ga0373957_0009612 | 3300035120 | Bacteria | 3170 |
| 416 | Ga0373957_0223038 | 3300035120 | Bacteria | 789 |
| 417 | Ga0373960_0039800 | 3300035121 | Bacteria | 1354 |
| 418 | Ga0373943_0135039 | 3300035170 | Unclassified | 1324 |
| 419 | Ga0373943_0878105 | 3300035170 | Bacteria | 535 |
| 420 | Ga0373946_0412891 | 3300035171 | Bacteria | 683 |
| 421 | Ga0373955_0000106 | 3300035172 | Bacteria | 33578 |
| 422 | Ga0373955_0117639 | 3300035172 | Bacteria | 1542 |
| 423 | Ga0373955_0357610 | 3300035172 | Bacteria | 885 |
| 424 | Ga0373962_0103800 | 3300035242 | Bacteria | 889 |
| 425 | Ga0316574_0003632 | 3300035398 | Bacteria | 7977 |
| 426 | Ga0316574_0948873 | 3300035398 | Unclassified | 519 |
| 427 | Ga0316574_1010433 | 3300035398 | Bacteria | 500 |
| 428 | Ga0373924_0007373 | 3300035410 | Bacteria | 3969 |
| 429 | Ga0373931_0035751 | 3300035691 | Bacteria | 2584 |
| 430 | Ga0373931_0887569 | 3300035691 | Bacteria | 598 |
| 431 | Ga0373935_0021181 | 3300035692 | Bacteria | 3979 |
| 432 | Ga0373935_0023504 | 3300035692 | Bacteria | 3788 |
| 433 | Ga0373935_0165840 | 3300035692 | Unclassified | 1508 |
| 434 | Ga0373935_1191092 | 3300035692 | Unclassified | 568 |
| 435 | Ga0373927_0057209 | 3300035695 | Bacteria | 2522 |
| 436 | Ga0373927_0793398 | 3300035695 | Bacteria | 626 |
| 437 | Ga0373933_0000046 | 3300035724 | Bacteria | 76647 |
| 438 | Ga0373933_0223094 | 3300035724 | Bacteria | 1209 |
| 439 | Ga0373933_0702593 | 3300035724 | Unclassified | 665 |
| 440 | Ga0373947_0100388 | 3300035725 | Bacteria | 1818 |
| 441 | Ga0373947_0359772 | 3300035725 | Bacteria | 977 |
| 442 | Ga0373937_0000115 | 3300036401 | Bacteria | 76660 |
| 443 | Ga0373937_0001369 | 3300036401 | Bacteria | 20368 |
| 444 | Ga0373937_0197156 | 3300036401 | Bacteria | 1892 |
| 445 | Ga0373937_0212072 | 3300036401 | Bacteria | 1822 |
| 446 | Ga0316582_0115210 | 3300036647 | Bacteria | 1793 |
| 447 | Ga0373925_0009527 | 3300037068 | Bacteria | 7070 |
| 448 | Ga0373925_0034917 | 3300037068 | Bacteria | 3708 |
| 449 | Ga0373925_0082342 | 3300037068 | Bacteria | 2449 |
| 450 | Ga0373925_0228341 | 3300037068 | Bacteria | 1488 |
| 451 | Ga0373925_1138088 | 3300037068 | Bacteria | 642 |
| 452 | Ga0395899_0031526 | 3300037312 | Bacteria | 3983 |
| 453 | Ga0395899_0169248 | 3300037312 | Bacteria | 1539 |
| 454 | Ga0395899_0254113 | 3300037312 | Bacteria | 1205 |
| 455 | Ga0395899_0276489 | 3300037312 | Bacteria | 1144 |
| 456 | Ga0395900_0130610 | 3300037418 | Bacteria | 2574 |
| 457 | Ga0395900_0147077 | 3300037418 | Bacteria | 2409 |
| 458 | Ga0395900_0158631 | 3300037418 | Unclassified | 2309 |
| 459 | Ga0395900_0292743 | 3300037418 | Bacteria | 1616 |
| 460 | Ga0395900_0504868 | 3300037418 | Bacteria | 1159 |
| 461 | Ga0395898_0031024 | 3300037466 | Bacteria | 5346 |
| 462 | Ga0395898_0048606 | 3300037466 | Bacteria | 4159 |
| 463 | Ga0395898_0086077 | 3300037466 | Bacteria | 3029 |
| 464 | Ga0395898_0138784 | 3300037466 | Bacteria | 2327 |
| 465 | Ga0395898_0145172 | 3300037466 | Bacteria | 2271 |
| 466 | Ga0395898_0147833 | 3300037466 | Unclassified | 2249 |
| 467 | Ga0395898_0571416 | 3300037466 | Bacteria | 1073 |
| 468 | Ga0395898_0747063 | 3300037466 | Bacteria | 920 |
| 469 | Ga0395898_1008093 | 3300037466 | Bacteria | 768 |
| 470 | Ga0395905_0325752 | 3300037471 | Bacteria | 1426 |
| 471 | Ga0395905_0438477 | 3300037471 | Unclassified | 1203 |
| 472 | Ga0395905_0931365 | 3300037471 | Bacteria | 772 |
| 473 | Ga0395905_1345025 | 3300037471 | Unclassified | 618 |
| 474 | Ga0436364_0047891 | 3300037853 | Bacteria | 1725 |
| 475 | Ga0436364_0614465 | 3300037853 | Bacteria | 45940 |
| 476 | Ga0436364_0916892 | 3300037853 | Bacteria | 1059 |
| 477 | Ga0395901_0007066 | 3300038443 | Bacteria | 11348 |
| 478 | Ga0395901_0018585 | 3300038443 | Bacteria | 7099 |
| 479 | Ga0395901_0098852 | 3300038443 | Bacteria | 3060 |
| 480 | Ga0395901_0365707 | 3300038443 | Bacteria | 1487 |
| 481 | Ga0395901_0369577 | 3300038443 | Archaea | 1477 |
| 482 | Ga0395901_0527799 | 3300038443 | Bacteria | 1198 |
| 483 | Ga0395901_0933944 | 3300038443 | Bacteria | 847 |
| 484 | Ga0395901_1125331 | 3300038443 | Bacteria | 754 |
| 485 | Ga0436360_0200064 | 3300039438 | Bacteria | 839 |
| 486 | Ga0436361_0918879 | 3300039447 | Bacteria | 692 |
| 487 | Ga0436363_0597454 | 3300039450 | Bacteria | 1648 |
| 488 | Ga0436363_1167476 | 3300039450 | Unclassified | 537 |
| 489 | Ga0436363_1713516 | 3300039450 | Unclassified | 970 |
| 490 | Ga0436362_1001258 | 3300039453 | Bacteria | 710 |
| 491 | Ga0436362_1085605 | 3300039453 | Bacteria | 1721 |
| 492 | Ga0439447_049602 | 3300041407 | Bacteria | 1005 |
| 493 | Ga0439461_0115627 | 3300041410 | Unclassified | 666 |
| 494 | Ga0439461_0137214 | 3300041410 | Bacteria | 623 |
| 495 | Ga0439466_0020676 | 3300041411 | Unclassified | 2344 |
| 496 | Ga0439465_0031905 | 3300041413 | Bacteria | 1680 |
| 497 | Ga0451853_0337398 | 3300041512 | Bacteria | 1420 |
| 498 | Ga0439433_0108660 | 3300041999 | Bacteria | 693 |
| 499 | Ga0439442_002841 | 3300042002 | Bacteria | 3405 |
| 500 | Ga0439442_090344 | 3300042002 | Bacteria | 658 |
| 501 | Ga0439443_010906 | 3300042003 | Bacteria | 1324 |
| 502 | Ga0439448_0008766 | 3300042005 | Bacteria | 2965 |
| 503 | Ga0439448_0048288 | 3300042005 | Bacteria | 1389 |
| 504 | Ga0439432_116386 | 3300042006 | Bacteria | 793 |
| 505 | Ga0439449_0070824 | 3300042007 | Bacteria | 1285 |
| 506 | Ga0439450_006319 | 3300042008 | Bacteria | 2128 |
| 507 | Ga0439450_015007 | 3300042008 | Unclassified | 1579 |
| 508 | Ga0439450_089151 | 3300042008 | Bacteria | 773 |
| 509 | Ga0439451_007829 | 3300042009 | Bacteria | 2170 |
| 510 | Ga0439451_016207 | 3300042009 | Bacteria | 1502 |
| 511 | Ga0439454_025171 | 3300042011 | Bacteria | 903 |
| 512 | Ga0439455_0020580 | 3300042012 | Bacteria | 1566 |
| 513 | Ga0439455_0023097 | 3300042012 | Unclassified | 1495 |
| 514 | Ga0439455_0032590 | 3300042012 | Bacteria | 1303 |
| 515 | Ga0439455_0049665 | 3300042012 | Bacteria | 1093 |
| 516 | Ga0439456_011321 | 3300042013 | Bacteria | 1844 |
| 517 | Ga0439463_000650 | 3300042016 | Bacteria | 9618 |
| 518 | Ga0439463_028336 | 3300042016 | Bacteria | 1410 |
| 519 | Ga0450911_041637 | 3300042115 | Bacteria | 596 |
| 520 | Ga0450913_018142 | 3300042117 | Bacteria | 627 |
| 521 | Ga0450914_020466 | 3300042118 | Bacteria | 733 |
| 522 | Ga0450917_006870 | 3300042120 | Bacteria | 864 |
| 523 | Ga0450919_015146 | 3300042121 | Bacteria | 871 |
| 524 | Ga0450919_019655 | 3300042121 | Bacteria | 762 |
| 525 | Ga0450920_001765 | 3300042122 | Bacteria | 3627 |
| 526 | Ga0450923_026551 | 3300042125 | Bacteria | 1160 |
| 527 | Ga0450890_017254 | 3300042127 | Bacteria | 960 |
| 528 | Ga0450900_005890 | 3300042136 | Bacteria | 1464 |
| 529 | Ga0450900_022595 | 3300042136 | Bacteria | 884 |
| 530 | Ga0450904_006773 | 3300042139 | Bacteria | 1141 |
| 531 | Ga0450905_010595 | 3300042142 | Bacteria | 1278 |
| 532 | Ga0450905_020166 | 3300042142 | Unclassified | 979 |
| 533 | Ga0450907_000541 | 3300042146 | Bacteria | 10290 |
| 534 | Ga0450910_034248 | 3300042147 | Bacteria | 805 |
| 535 | Ga0439446_0030215 | 3300042156 | Unclassified | 1566 |
| 536 | Ga0450908_017655 | 3300042184 | Bacteria | 1266 |
| 537 | Ga0439434_0000170 | 3300042435 | Bacteria | 17754 |
| 538 | Ga0439434_0139380 | 3300042435 | Bacteria | 799 |
| 539 | Ga0439435_0214560 | 3300042436 | Unclassified | 639 |
| 540 | Ga0439444_0007575 | 3300042437 | Bacteria | 1672 |
| 541 | Ga0439444_0024855 | 3300042437 | Unclassified | 1085 |
| 542 | Ga0439464_0009777 | 3300042439 | Bacteria | 2526 |
| 543 | Ga0439464_0047394 | 3300042439 | Bacteria | 1236 |
| 544 | Ga0439464_0101528 | 3300042439 | Bacteria | 874 |
| 545 | Ga0439460_0007916 | 3300042461 | Bacteria | 2672 |
| 546 | Ga0439460_0008959 | 3300042461 | Bacteria | 2531 |
| 547 | Ga0439460_0067128 | 3300042461 | Bacteria | 1104 |
| 548 | Ga0439460_0326072 | 3300042461 | Unclassified | 539 |
| 549 | Ga0450916_000185 | 3300042530 | Bacteria | 4674 |
| 550 | Ga0450916_009159 | 3300042530 | Bacteria | 1218 |
| 551 | Ga0450916_042941 | 3300042530 | Unclassified | 693 |
| 552 | Ga0450893_0013214 | 3300042532 | Unclassified | 1375 |
| 553 | Ga0451577_0569859 | 3300042876 | Unclassified | 1028 |
| 554 | Ga0439440_0024204 | 3300042993 | Bacteria | 1391 |
| 555 | Ga0439440_0026648 | 3300042993 | Bacteria | 1338 |
| 556 | Ga0439440_0283807 | 3300042993 | Bacteria | 512 |
| 557 | Ga0466969_0435488 | 3300044656 | Bacteria | 596 |
| 558 | Ga0466966_0215467 | 3300044684 | Bacteria | 1160 |
| 559 | Ga0466961_0104837 | 3300044693 | Bacteria | 1780 |
| 560 | Ga0466963_0413527 | 3300044694 | Bacteria | 951 |
| 561 | Ga0466963_0481341 | 3300044694 | Bacteria | 876 |
| 562 | Ga0466963_0556702 | 3300044694 | Bacteria | 810 |
| 563 | Ga0466963_0777521 | 3300044694 | Unclassified | 675 |
| 564 | Ga0453684_0212452 | 3300044712 | Bacteria | 2248 |
| 565 | Ga0466960_0654385 | 3300044901 | Bacteria | 627 |
| 566 | Ga0466959_0183898 | 3300045049 | Bacteria | 1461 |
| 567 | Ga0451576_1260570 | 3300045051 | Unclassified | 771 |
| 568 | Ga0466967_0360074 | 3300045976 | Unclassified | 1409 |
| 569 | Ga0466967_1540381 | 3300045976 | Bacteria | 662 |
| 570 | Ga0495592_0000166 | 3300046454 | Bacteria | 58865 |
| 571 | Ga0495592_0133689 | 3300046454 | Bacteria | 1732 |
| 572 | Ga0495591_107972 | 3300046458 | Unclassified | 685 |
| 573 | Ga0495629_0158714 | 3300046459 | Bacteria | 1571 |
| 574 | Ga0495629_1057892 | 3300046459 | Unclassified | 526 |
| 575 | Ga0495651_0000067 | 3300046462 | Bacteria | 76665 |
| 576 | Ga0495651_0003459 | 3300046462 | Bacteria | 12107 |
| 577 | Ga0495651_0041530 | 3300046462 | Bacteria | 3572 |
| 578 | Ga0495651_0110877 | 3300046462 | Bacteria | 2029 |
| 579 | Ga0495651_0250941 | 3300046462 | Bacteria | 1208 |
| 580 | Ga0495651_0329754 | 3300046462 | Bacteria | 1015 |
| 581 | Ga0495653_0001859 | 3300046463 | Bacteria | 16682 |
| 582 | Ga0495653_0017334 | 3300046463 | Bacteria | 5858 |
| 583 | Ga0495653_0094497 | 3300046463 | Bacteria | 2178 |
| 584 | Ga0495653_0533225 | 3300046463 | Bacteria | 728 |
| 585 | Ga0495582_0765490 | 3300046473 | Bacteria | 559 |
| 586 | Ga0495605_0108658 | 3300046474 | Bacteria | 1268 |
| 587 | Ga0495664_0044501 | 3300046477 | Bacteria | 2631 |
| 588 | Ga0495664_0152527 | 3300046477 | Bacteria | 1401 |
| 589 | Ga0495584_0087377 | 3300046491 | Bacteria | 1571 |
| 590 | Ga0495584_0250637 | 3300046491 | Unclassified | 900 |
| 591 | Ga0495607_0331687 | 3300046501 | Unclassified | 707 |
| 592 | Ga0495608_0000850 | 3300046511 | Bacteria | 21361 |
| 593 | Ga0495608_0010560 | 3300046511 | Bacteria | 6443 |
| 594 | Ga0495608_0213478 | 3300046511 | Bacteria | 1212 |
| 595 | Ga0495616_0352037 | 3300046513 | Bacteria | 613 |
| 596 | Ga0495618_0015144 | 3300046514 | Bacteria | 4704 |
| 597 | Ga0495618_0096053 | 3300046514 | Bacteria | 1895 |
| 598 | Ga0495618_0166303 | 3300046514 | Bacteria | 1404 |
| 599 | Ga0495618_0637070 | 3300046514 | Bacteria | 631 |
| 600 | Ga0495620_0170553 | 3300046515 | Unclassified | 844 |
| 601 | Ga0495628_0000916 | 3300046516 | Bacteria | 27072 |
| 602 | Ga0495628_0017043 | 3300046516 | Bacteria | 6053 |
| 603 | Ga0495628_0077779 | 3300046516 | Bacteria | 2580 |
| 604 | Ga0495628_0105353 | 3300046516 | Bacteria | 2172 |
| 605 | Ga0495628_0244594 | 3300046516 | Unclassified | 1341 |
| 606 | Ga0495628_0307168 | 3300046516 | Bacteria | 1173 |
| 607 | Ga0495628_0515981 | 3300046516 | Bacteria | 861 |
| 608 | Ga0495628_1097499 | 3300046516 | Archaea | 544 |
| 609 | Ga0495630_0032984 | 3300046517 | Bacteria | 3862 |
| 610 | Ga0495630_0112386 | 3300046517 | Unclassified | 2063 |
| 611 | Ga0495630_0260145 | 3300046517 | Bacteria | 1326 |
| 612 | Ga0495631_0065544 | 3300046518 | Bacteria | 1572 |
| 613 | Ga0495637_0099616 | 3300046520 | Bacteria | 1137 |
| 614 | Ga0495642_0544994 | 3300046528 | Unclassified | 514 |
| 615 | Ga0495652_0002074 | 3300046529 | Bacteria | 21194 |
| 616 | Ga0495652_0052165 | 3300046529 | Bacteria | 3489 |
| 617 | Ga0495652_0325285 | 3300046529 | Unclassified | 1109 |
| 618 | Ga0495652_0409199 | 3300046529 | Bacteria | 958 |
| 619 | Ga0495652_0584039 | 3300046529 | Bacteria | 764 |
| 620 | Ga0495652_0926558 | 3300046529 | Bacteria | 573 |
| 621 | Ga0495652_0985238 | 3300046529 | Bacteria | 552 |
| 622 | Ga0495654_0178486 | 3300046530 | Unclassified | 921 |
| 623 | Ga0495665_0616336 | 3300046531 | Bacteria | 542 |
| 624 | Ga0495640_0103617 | 3300046533 | Unclassified | 1865 |
| 625 | Ga0495640_0202826 | 3300046533 | Unclassified | 1256 |
| 626 | Ga0495640_0254209 | 3300046533 | Unclassified | 1099 |
| 627 | Ga0495586_0105439 | 3300046535 | Bacteria | 1567 |
| 628 | Ga0495586_0115771 | 3300046535 | Bacteria | 1495 |
| 629 | Ga0495586_0128010 | 3300046535 | Unclassified | 1421 |
| 630 | Ga0495587_0000078 | 3300046536 | Bacteria | 76639 |
| 631 | Ga0495587_0001751 | 3300046536 | Bacteria | 14503 |
| 632 | Ga0495587_0106505 | 3300046536 | Bacteria | 1612 |
| 633 | Ga0495587_0125339 | 3300046536 | Bacteria | 1470 |
| 634 | Ga0495587_0140602 | 3300046536 | Bacteria | 1378 |
| 635 | Ga0495587_0282159 | 3300046536 | Bacteria | 930 |
| 636 | Ga0495587_0377335 | 3300046536 | Bacteria | 789 |
| 637 | Ga0495598_0022315 | 3300046537 | Unclassified | 1693 |
| 638 | Ga0495609_0043412 | 3300046538 | Bacteria | 2019 |
| 639 | Ga0495621_0025565 | 3300046539 | Bacteria | 1985 |
| 640 | Ga0495597_0282118 | 3300046542 | Bacteria | 647 |
| 641 | Ga0495645_0002489 | 3300046543 | Bacteria | 12503 |
| 642 | Ga0495645_0071469 | 3300046543 | Bacteria | 2502 |
| 643 | Ga0495645_0072004 | 3300046543 | Bacteria | 2491 |
| 644 | Ga0495645_0079545 | 3300046543 | Bacteria | 2354 |
| 645 | Ga0495645_0138895 | 3300046543 | Unclassified | 1697 |
| 646 | Ga0495645_0147933 | 3300046543 | Unclassified | 1634 |
| 647 | Ga0495645_0217912 | 3300046543 | Unclassified | 1285 |
| 648 | Ga0495645_0288623 | 3300046543 | Unclassified | 1076 |
| 649 | Ga0495667_0000122 | 3300046559 | Bacteria | 56141 |
| 650 | Ga0495667_0002167 | 3300046559 | Bacteria | 13102 |
| 651 | Ga0495667_0097586 | 3300046559 | Unclassified | 1903 |
| 652 | Ga0495667_0121344 | 3300046559 | Bacteria | 1687 |
| 653 | Ga0495667_0190455 | 3300046559 | Bacteria | 1314 |
| 654 | Ga0495656_0007250 | 3300046615 | Bacteria | 3914 |
| 655 | Ga0495656_0406663 | 3300046615 | Unclassified | 713 |
| 656 | Ga0495656_0764222 | 3300046615 | Bacteria | 521 |
| 657 | Ga0495668_0569396 | 3300046616 | Unclassified | 625 |
| 658 | Ga0495634_0025904 | 3300046642 | Bacteria | 4096 |
| 659 | Ga0495634_0119751 | 3300046642 | Bacteria | 1686 |
| 660 | Ga0495634_0162815 | 3300046642 | Unclassified | 1406 |
| 661 | Ga0495635_0004377 | 3300046663 | Bacteria | 9780 |
| 662 | Ga0495635_0047164 | 3300046663 | Bacteria | 2972 |
| 663 | Ga0495635_0077003 | 3300046663 | Bacteria | 2285 |
| 664 | Ga0495635_0205637 | 3300046663 | Bacteria | 1334 |
| 665 | Ga0495635_0700641 | 3300046663 | Bacteria | 656 |
| 666 | Ga0495661_0216562 | 3300046665 | Unclassified | 994 |
| 667 | Ga0495657_0000098 | 3300046675 | Bacteria | 76618 |
| 668 | Ga0495657_0001534 | 3300046675 | Bacteria | 19852 |
| 669 | Ga0495599_0000115 | 3300046678 | Bacteria | 53313 |
| 670 | Ga0495599_0011714 | 3300046678 | Bacteria | 5390 |
| 671 | Ga0495599_0051536 | 3300046678 | Bacteria | 2578 |
| 672 | Ga0495599_0159338 | 3300046678 | Unclassified | 1395 |
| 673 | Ga0495599_0188182 | 3300046678 | Bacteria | 1271 |
| 674 | Ga0495599_0259782 | 3300046678 | Unclassified | 1055 |
| 675 | Ga0495623_0001407 | 3300046679 | Bacteria | 16341 |
| 676 | Ga0495623_0026994 | 3300046679 | Bacteria | 3694 |
| 677 | Ga0495623_0060692 | 3300046679 | Bacteria | 2372 |
| 678 | Ga0495623_0444109 | 3300046679 | Bacteria | 692 |
| 679 | Ga0495646_0010628 | 3300046680 | Bacteria | 5846 |
| 680 | Ga0495646_0061862 | 3300046680 | Bacteria | 2228 |
| 681 | Ga0495646_0113043 | 3300046680 | Bacteria | 1544 |
| 682 | Ga0495646_0147395 | 3300046680 | Bacteria | 1311 |
| 683 | Ga0495658_0026431 | 3300046683 | Bacteria | 3111 |
| 684 | Ga0495658_0248892 | 3300046683 | Unclassified | 1117 |
| 685 | Ga0495669_0508383 | 3300046684 | Bacteria | 586 |
| 686 | Ga0495613_0038639 | 3300046689 | Bacteria | 3537 |
| 687 | Ga0495613_0108456 | 3300046689 | Unclassified | 2002 |
| 688 | Ga0495613_0331922 | 3300046689 | Bacteria | 1048 |
| 689 | Ga0495670_0016777 | 3300046691 | Bacteria | 3601 |
| 690 | Ga0495589_0098128 | 3300046794 | Bacteria | 1419 |
| 691 | Ga0495600_0012600 | 3300046809 | Bacteria | 5292 |
| 692 | Ga0495600_0087988 | 3300046809 | Bacteria | 2026 |
| 693 | Ga0495600_0167439 | 3300046809 | Bacteria | 1419 |
| 694 | Ga0495600_0920067 | 3300046809 | Unclassified | 515 |
| 695 | Ga0495604_0000142 | 3300047317 | Bacteria | 61620 |
| 696 | Ga0495604_0062120 | 3300047317 | Bacteria | 2855 |
| 697 | Ga0495604_0127153 | 3300047317 | Bacteria | 1836 |
| 698 | Ga0495604_0188227 | 3300047317 | Bacteria | 1440 |
| 699 | Ga0495604_0384018 | 3300047317 | Bacteria | 927 |
| 700 | Ga0495604_0519204 | 3300047317 | Bacteria | 771 |
| 701 | Ga0495636_0031918 | 3300047318 | Bacteria | 2160 |
| 702 | Ga0495674_0001409 | 3300047319 | Bacteria | 23533 |
| 703 | Ga0495674_0017598 | 3300047319 | Bacteria | 6654 |
| 704 | Ga0495674_0024484 | 3300047319 | Bacteria | 5546 |
| 705 | Ga0495674_0035048 | 3300047319 | Bacteria | 4531 |
| 706 | Ga0495674_0049752 | 3300047319 | Bacteria | 3701 |
| 707 | Ga0495674_0444774 | 3300047319 | Bacteria | 1042 |
| 708 | Ga0495674_1071454 | 3300047319 | Unclassified | 615 |
| 709 | Ga0495674_1380344 | 3300047319 | Unclassified | 526 |
| 710 | Ga0495676_0128478 | 3300047321 | Bacteria | 1833 |
| 711 | Ga0495680_0000111 | 3300047322 | Bacteria | 76638 |
| 712 | Ga0495680_0000651 | 3300047322 | Bacteria | 38967 |
| 713 | Ga0495680_0087236 | 3300047322 | Bacteria | 2347 |
| 714 | Ga0495680_0107165 | 3300047322 | Bacteria | 2075 |
| 715 | Ga0495675_0001226 | 3300047444 | Bacteria | 15537 |
| 716 | Ga0495675_0017394 | 3300047444 | Bacteria | 4557 |
| 717 | Ga0495675_0276495 | 3300047444 | Bacteria | 1002 |
| 718 | Ga0495675_0652660 | 3300047444 | Bacteria | 593 |
| 719 | Ga0495677_0027547 | 3300047445 | Bacteria | 2062 |
| 720 | Ga0495685_180566 | 3300047447 | Bacteria | 680 |
| 721 | Ga0495684_0035474 | 3300047471 | Bacteria | 3825 |
| 722 | Ga0495684_0115746 | 3300047471 | Bacteria | 2021 |
| 723 | Ga0495684_0128112 | 3300047471 | Bacteria | 1908 |
| 724 | Ga0495684_0153244 | 3300047471 | Bacteria | 1722 |
| 725 | Ga0495684_0996950 | 3300047471 | Unclassified | 532 |
| 726 | Ga0495602_0000820 | 3300048088 | Bacteria | 29788 |
| 727 | Ga0495602_0006173 | 3300048088 | Bacteria | 12568 |
| 728 | Ga0495602_0044859 | 3300048088 | Bacteria | 4006 |
| 729 | Ga0495602_0142069 | 3300048088 | Bacteria | 1899 |
| 730 | Ga0495602_0219996 | 3300048088 | Bacteria | 1434 |
| 731 | Ga0495602_0286137 | 3300048088 | Bacteria | 1212 |
| 732 | Ga0496100_0108299 | 3300048903 | Bacteria | 1926 |
| 733 | Ga0496101_0033940 | 3300048904 | Bacteria | 3603 |
| 734 | Ga0496102_1409982 | 3300048905 | Bacteria | 616 |
| 735 | Ga0496103_0012246 | 3300048906 | Bacteria | 5090 |
| 736 | Ga0496104_0037147 | 3300048907 | Bacteria | 4555 |
| 737 | Ga0496104_0040281 | 3300048907 | Bacteria | 4378 |
| 738 | Ga0496104_0353026 | 3300048907 | Bacteria | 1383 |
| 739 | Ga0496105_0108418 | 3300048908 | Unclassified | 2293 |
| 740 | Ga0496105_0271930 | 3300048908 | Bacteria | 1368 |
| 741 | Ga0496105_0278072 | 3300048908 | Bacteria | 1350 |
| 742 | Ga0496106_0027152 | 3300048909 | Bacteria | 4263 |
| 743 | Ga0496106_1377672 | 3300048909 | Unclassified | 546 |
| 744 | Ga0496107_0226926 | 3300048910 | Bacteria | 1389 |
| 745 | Ga0496108_0042772 | 3300048911 | Bacteria | 3783 |
| 746 | Ga0496108_0118788 | 3300048911 | Bacteria | 2266 |
| 747 | Ga0496108_1041739 | 3300048911 | Unclassified | 697 |
| 748 | Ga0496108_1156962 | 3300048911 | Bacteria | 656 |
| 749 | Ga0496109_0025103 | 3300048912 | Bacteria | 5306 |
| 750 | Ga0496109_0157137 | 3300048912 | Bacteria | 2130 |
| 751 | Ga0496109_0166662 | 3300048912 | Bacteria | 2066 |
| 752 | Ga0496109_0566855 | 3300048912 | Bacteria | 1071 |
| 753 | Ga0496110_0058576 | 3300048913 | Bacteria | 3393 |
| 754 | Ga0496110_0425031 | 3300048913 | Bacteria | 1211 |
| 755 | Ga0496111_0003668 | 3300048914 | Bacteria | 9535 |
| 756 | Ga0496111_0065428 | 3300048914 | Bacteria | 2639 |
| 757 | Ga0496112_0410376 | 3300048915 | Bacteria | 1293 |
| 758 | Ga0496113_0023018 | 3300048916 | Bacteria | 4414 |
| 759 | Ga0496113_0241070 | 3300048916 | Bacteria | 1443 |
| 760 | Ga0496113_1527255 | 3300048916 | Bacteria | 515 |
| 761 | Ga0496114_0033707 | 3300048917 | Bacteria | 4221 |
| 762 | Ga0496114_0194351 | 3300048917 | Unclassified | 1776 |
| 763 | Ga0496115_0056689 | 3300048918 | Bacteria | 3149 |
| 764 | Ga0496115_0231614 | 3300048918 | Bacteria | 1523 |
| 765 | Ga0496126_0277967 | 3300048929 | Bacteria | 1388 |
| 766 | Ga0501031_0009394 | 3300049568 | Bacteria | 6355 |
| 767 | Ga0501031_0118592 | 3300049568 | Bacteria | 1729 |
| 768 | Ga0501031_0381696 | 3300049568 | Bacteria | 912 |
| 769 | Ga0501031_0596806 | 3300049568 | Bacteria | 710 |
| 770 | Ga0501032_0099239 | 3300049569 | Bacteria | 1929 |
| 771 | Ga0501032_0352561 | 3300049569 | Bacteria | 948 |
| 772 | Ga0501032_1004244 | 3300049569 | Bacteria | 524 |
| 773 | Ga0501033_0008686 | 3300049570 | Bacteria | 7858 |
| 774 | Ga0501033_0028947 | 3300049570 | Bacteria | 4162 |
| 775 | Ga0501033_0041288 | 3300049570 | Bacteria | 3443 |
| 776 | Ga0501033_0087250 | 3300049570 | Bacteria | 2284 |
| 777 | Ga0501033_0119255 | 3300049570 | Bacteria | 1916 |
| 778 | Ga0501034_0191915 | 3300049571 | Bacteria | 2005 |
| 779 | Ga0501034_0365456 | 3300049571 | Bacteria | 1370 |
| 780 | Ga0501034_0519996 | 3300049571 | Unclassified | 1102 |
| 781 | Ga0501036_0000975 | 3300049572 | Bacteria | 21611 |
| 782 | Ga0501036_0001109 | 3300049572 | Bacteria | 20452 |
| 783 | Ga0501036_0003608 | 3300049572 | Bacteria | 12372 |
| 784 | Ga0501036_0012032 | 3300049572 | Bacteria | 7172 |
| 785 | Ga0501036_0058447 | 3300049572 | Bacteria | 3267 |
| 786 | Ga0501036_0220396 | 3300049572 | Bacteria | 1593 |
| 787 | Ga0501036_0273805 | 3300049572 | Bacteria | 1413 |
| 788 | Ga0501036_0405131 | 3300049572 | Unclassified | 1138 |
| 789 | Ga0501036_1290135 | 3300049572 | Bacteria | 594 |
| 790 | Ga0501037_0028484 | 3300049573 | Bacteria | 4126 |
| 791 | Ga0501037_0037420 | 3300049573 | Bacteria | 3577 |
| 792 | Ga0501037_0042055 | 3300049573 | Bacteria | 3359 |
| 793 | Ga0501037_0427913 | 3300049573 | Bacteria | 905 |
| 794 | Ga0501038_0005493 | 3300049574 | Bacteria | 11769 |
| 795 | Ga0501038_0017558 | 3300049574 | Bacteria | 6469 |
| 796 | Ga0501038_0023789 | 3300049574 | Bacteria | 5473 |
| 797 | Ga0501038_0031898 | 3300049574 | Bacteria | 4653 |
| 798 | Ga0501039_0010800 | 3300049575 | Bacteria | 6955 |
| 799 | Ga0501039_0017540 | 3300049575 | Bacteria | 5491 |
| 800 | Ga0501039_0044299 | 3300049575 | Bacteria | 3437 |
| 801 | Ga0501039_0092016 | 3300049575 | Bacteria | 2364 |
| 802 | Ga0501039_0113124 | 3300049575 | Bacteria | 2123 |
| 803 | Ga0501039_0136204 | 3300049575 | Bacteria | 1928 |
| 804 | Ga0501039_0199625 | 3300049575 | Bacteria | 1573 |
| 805 | Ga0501039_0291017 | 3300049575 | Unclassified | 1284 |
| 806 | Ga0501039_0323855 | 3300049575 | Bacteria | 1211 |
| 807 | Ga0501040_0000181 | 3300049576 | Bacteria | 36000 |
| 808 | Ga0501040_0001595 | 3300049576 | Bacteria | 14458 |
| 809 | Ga0501040_0009782 | 3300049576 | Bacteria | 6259 |
| 810 | Ga0501040_0030855 | 3300049576 | Bacteria | 3621 |
| 811 | Ga0501040_0052289 | 3300049576 | Bacteria | 2796 |
| 812 | Ga0501040_0105660 | 3300049576 | Bacteria | 1967 |
| 813 | Ga0501040_0435816 | 3300049576 | Bacteria | 943 |
| 814 | Ga0501040_0469548 | 3300049576 | Bacteria | 906 |
| 815 | Ga0501040_0661184 | 3300049576 | Bacteria | 755 |
| 816 | Ga0501040_0774166 | 3300049576 | Bacteria | 694 |
| 817 | Ga0501040_0946193 | 3300049576 | Unclassified | 624 |
| 818 | Ga0501040_1396502 | 3300049576 | Bacteria | 508 |
| 819 | Ga0501041_0000274 | 3300049577 | Bacteria | 24538 |
| 820 | Ga0501041_0000698 | 3300049577 | Bacteria | 17842 |
| 821 | Ga0501041_0001036 | 3300049577 | Bacteria | 15215 |
| 822 | Ga0501041_0046814 | 3300049577 | Bacteria | 2632 |
| 823 | Ga0501041_0048542 | 3300049577 | Bacteria | 2586 |
| 824 | Ga0501041_0108701 | 3300049577 | Bacteria | 1720 |
| 825 | Ga0501041_0135839 | 3300049577 | Bacteria | 1532 |
| 826 | Ga0501042_0001149 | 3300049578 | Bacteria | 15289 |
| 827 | Ga0501042_0001907 | 3300049578 | Bacteria | 12526 |
| 828 | Ga0501042_0004764 | 3300049578 | Bacteria | 8660 |
| 829 | Ga0501042_0054592 | 3300049578 | Bacteria | 2850 |
| 830 | Ga0501042_0077183 | 3300049578 | Bacteria | 2385 |
| 831 | Ga0501042_0262160 | 3300049578 | Bacteria | 1248 |
| 832 | Ga0501042_0270633 | 3300049578 | Bacteria | 1226 |
| 833 | Ga0501042_0348806 | 3300049578 | Bacteria | 1071 |
| 834 | Ga0501042_0365538 | 3300049578 | Bacteria | 1044 |
| 835 | Ga0501042_1008098 | 3300049578 | Bacteria | 607 |
| 836 | Ga0501042_1391460 | 3300049578 | Unclassified | 512 |
| 837 | Ga0501043_0053516 | 3300049579 | Bacteria | 3170 |
| 838 | Ga0501043_0144455 | 3300049579 | Bacteria | 1863 |
| 839 | Ga0501043_0926359 | 3300049579 | Bacteria | 624 |
| 840 | Ga0501046_0000991 | 3300049580 | Bacteria | 27759 |
| 841 | Ga0501046_0021876 | 3300049580 | Bacteria | 5271 |
| 842 | Ga0501047_0230362 | 3300049581 | Bacteria | 1706 |
| 843 | Ga0501047_0504580 | 3300049581 | Bacteria | 1036 |
| 844 | Ga0501048_0000408 | 3300049582 | Bacteria | 29983 |
| 845 | Ga0501048_0002309 | 3300049582 | Bacteria | 14558 |
| 846 | Ga0501048_0002733 | 3300049582 | Bacteria | 13453 |
| 847 | Ga0501048_0015546 | 3300049582 | Bacteria | 5622 |
| 848 | Ga0501048_0117583 | 3300049582 | Bacteria | 1878 |
| 849 | Ga0501048_0259769 | 3300049582 | Bacteria | 1234 |
| 850 | Ga0501048_0293220 | 3300049582 | Bacteria | 1157 |
| 851 | Ga0501067_0089265 | 3300049583 | Unclassified | 1711 |
| 852 | Ga0501068_0016530 | 3300049584 | Bacteria | 4255 |
| 853 | Ga0501068_0166135 | 3300049584 | Bacteria | 1392 |
| 854 | Ga0501068_0369826 | 3300049584 | Bacteria | 922 |
| 855 | Ga0501068_0952971 | 3300049584 | Unclassified | 565 |
| 856 | Ga0501069_0036856 | 3300049585 | Bacteria | 2698 |
| 857 | Ga0501069_0466686 | 3300049585 | Bacteria | 751 |
| 858 | Ga0501070_0025921 | 3300049586 | Bacteria | 4919 |
| 859 | Ga0501070_0092145 | 3300049586 | Bacteria | 2508 |
| 860 | Ga0501070_0112090 | 3300049586 | Bacteria | 2255 |
| 861 | Ga0501070_0260621 | 3300049586 | Bacteria | 1417 |
| 862 | Ga0501070_0450035 | 3300049586 | Bacteria | 1038 |
| 863 | Ga0501071_0001921 | 3300049587 | Bacteria | 12375 |
| 864 | Ga0501071_0019013 | 3300049587 | Bacteria | 4767 |
| 865 | Ga0501071_0031341 | 3300049587 | Bacteria | 3768 |
| 866 | Ga0501071_0036698 | 3300049587 | Bacteria | 3496 |
| 867 | Ga0501071_0101179 | 3300049587 | Bacteria | 2125 |
| 868 | Ga0501071_0125042 | 3300049587 | Bacteria | 1908 |
| 869 | Ga0501071_0126978 | 3300049587 | Bacteria | 1893 |
| 870 | Ga0501071_0381181 | 3300049587 | Bacteria | 1075 |
| 871 | Ga0501071_0821969 | 3300049587 | Unclassified | 716 |
| 872 | Ga0501071_0989245 | 3300049587 | Unclassified | 650 |
| 873 | Ga0501072_0000167 | 3300049588 | Bacteria | 47771 |
| 874 | Ga0501072_0012897 | 3300049588 | Bacteria | 6391 |
| 875 | Ga0501072_0020277 | 3300049588 | Bacteria | 5150 |
| 876 | Ga0501072_0024764 | 3300049588 | Bacteria | 4671 |
| 877 | Ga0501072_0031483 | 3300049588 | Bacteria | 4153 |
| 878 | Ga0501072_0034160 | 3300049588 | Bacteria | 3985 |
| 879 | Ga0501072_0078825 | 3300049588 | Bacteria | 2608 |
| 880 | Ga0501072_0149417 | 3300049588 | Unclassified | 1863 |
| 881 | Ga0501072_0222993 | 3300049588 | Bacteria | 1502 |
| 882 | Ga0501072_0227769 | 3300049588 | Bacteria | 1485 |
| 883 | Ga0501072_0263150 | 3300049588 | Bacteria | 1373 |
| 884 | Ga0501072_0792857 | 3300049588 | Bacteria | 742 |
| 885 | Ga0501072_1092896 | 3300049588 | Bacteria | 621 |
| 886 | Ga0501073_0074234 | 3300049589 | Bacteria | 2368 |
| 887 | Ga0501073_0079774 | 3300049589 | Bacteria | 2278 |
| 888 | Ga0501073_0196757 | 3300049589 | Bacteria | 1394 |
| 889 | Ga0501073_1243710 | 3300049589 | Bacteria | 511 |
| 890 | Ga0501074_0002848 | 3300049590 | Bacteria | 12110 |
| 891 | Ga0501074_0004187 | 3300049590 | Bacteria | 10309 |
| 892 | Ga0501074_0004269 | 3300049590 | Bacteria | 10197 |
| 893 | Ga0501074_0009887 | 3300049590 | Bacteria | 6929 |
| 894 | Ga0501074_0251353 | 3300049590 | Bacteria | 1257 |
| 895 | Ga0501074_0343800 | 3300049590 | Bacteria | 1059 |
| 896 | Ga0501074_0467260 | 3300049590 | Bacteria | 894 |
| 897 | Ga0501075_0000455 | 3300049591 | Bacteria | 24361 |
| 898 | Ga0501075_0011496 | 3300049591 | Bacteria | 6266 |
| 899 | Ga0501075_0032424 | 3300049591 | Bacteria | 3881 |
| 900 | Ga0501075_0038726 | 3300049591 | Bacteria | 3565 |
| 901 | Ga0501075_0085310 | 3300049591 | Bacteria | 2392 |
| 902 | Ga0501075_0352434 | 3300049591 | Bacteria | 1121 |
| 903 | Ga0501076_0000162 | 3300049592 | Bacteria | 38846 |
| 904 | Ga0501076_0000369 | 3300049592 | Bacteria | 27977 |
| 905 | Ga0501076_0001193 | 3300049592 | Bacteria | 17238 |
| 906 | Ga0501076_0007533 | 3300049592 | Bacteria | 7921 |
| 907 | Ga0501076_0011168 | 3300049592 | Bacteria | 6682 |
| 908 | Ga0501076_0011330 | 3300049592 | Bacteria | 6639 |
| 909 | Ga0501076_0028447 | 3300049592 | Bacteria | 4340 |
| 910 | Ga0501076_0038187 | 3300049592 | Bacteria | 3770 |
| 911 | Ga0501076_0078040 | 3300049592 | Bacteria | 2657 |
| 912 | Ga0501076_0119499 | 3300049592 | Bacteria | 2134 |
| 913 | Ga0501076_0540383 | 3300049592 | Unclassified | 961 |
| 914 | Ga0501076_0692419 | 3300049592 | Bacteria | 841 |
| 915 | Ga0501076_1124019 | 3300049592 | Bacteria | 647 |
| 916 | Ga0501077_0004819 | 3300049593 | Bacteria | 8200 |
| 917 | Ga0501077_0005218 | 3300049593 | Bacteria | 7895 |
| 918 | Ga0501077_0007242 | 3300049593 | Bacteria | 6844 |
| 919 | Ga0501077_0022838 | 3300049593 | Bacteria | 3964 |
| 920 | Ga0501077_0035609 | 3300049593 | Bacteria | 3169 |
| 921 | Ga0501077_0171385 | 3300049593 | Bacteria | 1379 |
| 922 | Ga0501077_0330141 | 3300049593 | Bacteria | 972 |
| 923 | Ga0501077_0365347 | 3300049593 | Bacteria | 921 |
| 924 | Ga0501079_0000073 | 3300049741 | Bacteria | 46641 |
| 925 | Ga0501079_0002007 | 3300049741 | Bacteria | 14555 |
| 926 | Ga0501079_0006208 | 3300049741 | Bacteria | 8967 |
| 927 | Ga0501079_0011791 | 3300049741 | Bacteria | 6674 |
| 928 | Ga0501079_0072200 | 3300049741 | Bacteria | 2667 |
| 929 | Ga0501079_0187710 | 3300049741 | Bacteria | 1613 |
| 930 | Ga0501079_0258341 | 3300049741 | Bacteria | 1361 |
| 931 | Ga0501079_0361955 | 3300049741 | Unclassified | 1137 |
| 932 | Ga0501079_0392095 | 3300049741 | Bacteria | 1089 |
| 933 | Ga0501079_0457609 | 3300049741 | Bacteria | 1002 |
| 934 | Ga0501079_1314479 | 3300049741 | Bacteria | 569 |
| 935 | Ga0501080_0002888 | 3300049742 | Bacteria | 15113 |
| 936 | Ga0501080_0232927 | 3300049742 | Bacteria | 1683 |
| 937 | Ga0501080_0495666 | 3300049742 | Bacteria | 1092 |
| 938 | Ga0501080_0885878 | 3300049742 | Bacteria | 779 |
| 939 | Ga0501080_1128017 | 3300049742 | Bacteria | 676 |
| 940 | Ga0501081_0002889 | 3300049743 | Bacteria | 10898 |
| 941 | Ga0501081_0003129 | 3300049743 | Bacteria | 10512 |
| 942 | Ga0501081_0004583 | 3300049743 | Bacteria | 8877 |
| 943 | Ga0501081_0028873 | 3300049743 | Bacteria | 3746 |
| 944 | Ga0501081_0064174 | 3300049743 | Bacteria | 2550 |
| 945 | Ga0501081_0094218 | 3300049743 | Bacteria | 2109 |
| 946 | Ga0501081_0723766 | 3300049743 | Unclassified | 747 |
| 947 | Ga0501081_1333370 | 3300049743 | Bacteria | 544 |
| 948 | Ga0501083_0025933 | 3300049744 | Bacteria | 4056 |
| 949 | Ga0501083_0058477 | 3300049744 | Bacteria | 2579 |
| 950 | Ga0501083_0210413 | 3300049744 | Bacteria | 1268 |
| 951 | Ga0501083_0355188 | 3300049744 | Bacteria | 953 |
| 952 | Ga0501083_1090894 | 3300049744 | Bacteria | 519 |
| 953 | Ga0501035_0095166 | 3300049822 | Bacteria | 2618 |
| 954 | Ga0501035_0099126 | 3300049822 | Bacteria | 2558 |
| 955 | Ga0501035_0565375 | 3300049822 | Bacteria | 930 |
| 956 | Ga0501035_0725352 | 3300049822 | Bacteria | 800 |
| 957 | Ga0501035_1371899 | 3300049822 | Bacteria | 543 |
| 958 | Ga0501044_0451384 | 3300049823 | Bacteria | 1192 |
| 959 | Ga0501045_0000048 | 3300049824 | Bacteria | 52104 |
| 960 | Ga0501045_0000434 | 3300049824 | Bacteria | 25587 |
| 961 | Ga0501045_0007968 | 3300049824 | Bacteria | 7378 |
| 962 | Ga0501045_0061573 | 3300049824 | Bacteria | 2753 |
| 963 | Ga0501045_0067231 | 3300049824 | Bacteria | 2632 |
| 964 | Ga0501045_0104220 | 3300049824 | Bacteria | 2101 |
| 965 | Ga0501045_0609476 | 3300049824 | Unclassified | 808 |
| 966 | Ga0501045_0791164 | 3300049824 | Bacteria | 699 |
| 967 | Ga0501045_0819532 | 3300049824 | Bacteria | 685 |
| 968 | nmdc:mga06z11_580052_c1 | 3300050494 | Bacteria | 682 |
| 969 | nmdc:mga05p37_1064873_c1 | 3300050507 | Unclassified | 851 |
| 970 | nmdc:mga05p37_1088076_c1 | 3300050507 | Unclassified | 839 |
| 971 | nmdc:mga05p37_374156_c1 | 3300050507 | Bacteria | 1671 |
| 972 | nmdc:mga05p37_449591_c1 | 3300050507 | Bacteria | 1492 |
| 973 | nmdc:mga05p37_49734_c1 | 3300050507 | Bacteria | 5157 |
| 974 | nmdc:mga05p37_569257_c1 | 3300050507 | Bacteria | 1285 |
| 975 | nmdc:mga05p37_8462_c1 | 3300050507 | Bacteria | 12166 |
| 976 | nmdc:mga09592_49908_c1 | 3300050508 | Bacteria | 3529 |
| 977 | nmdc:mga0qj67_174520_c1 | 3300050509 | Bacteria | 1745 |
| 978 | nmdc:mga0qj67_295_c1 | 3300050509 | Bacteria | 34738 |
| 979 | nmdc:mga06r32_1140832_c1 | 3300050510 | Bacteria | 727 |
| 980 | nmdc:mga06r32_1154904_c1 | 3300050510 | Bacteria | 722 |
| 981 | nmdc:mga06r32_1247_c1 | 3300050510 | Bacteria | 22881 |
| 982 | nmdc:mga08y16_12529_c1 | 3300050511 | Bacteria | 8921 |
| 983 | nmdc:mga08y16_319671_c1 | 3300050511 | Bacteria | 1598 |
| 984 | nmdc:mga08y16_543325_c1 | 3300050511 | Bacteria | 1177 |
| 985 | nmdc:mga0n895_288864_c1 | 3300050512 | Bacteria | 1663 |
| 986 | nmdc:mga0n895_39514_c1 | 3300050512 | Bacteria | 4578 |
| 987 | nmdc:mga0rr50_159609_c1 | 3300050513 | Bacteria | 1829 |
| 988 | nmdc:mga0rr50_827858_c1 | 3300050513 | Bacteria | 790 |
| 989 | nmdc:mga0a205_16265_c1 | 3300050515 | Bacteria | 6966 |
| 990 | nmdc:mga0a205_37915_c1 | 3300050515 | Bacteria | 4635 |
| 991 | nmdc:mga0a205_602940_c1 | 3300050515 | Bacteria | 951 |
| 992 | Ga0495601_0024048 | 3300053077 | Bacteria | 3749 |
| 993 | Ga0495601_0038120 | 3300053077 | Bacteria | 3005 |
| 994 | Ga0495601_0443824 | 3300053077 | Bacteria | 839 |
| 995 | Ga0495601_0581936 | 3300053077 | Unclassified | 719 |
| 996 | Ga0495612_0174145 | 3300053078 | Bacteria | 943 |
| 997 | Ga0495595_0001385 | 3300053084 | Bacteria | 9403 |
| 998 | Ga0495595_0035794 | 3300053084 | Bacteria | 2250 |
| 999 | Ga0495595_0070628 | 3300053084 | Unclassified | 1650 |
| 1000 | Ga0495595_0099427 | 3300053084 | Unclassified | 1403 |
| 1001 | Ga0495595_0363622 | 3300053084 | Bacteria | 731 |
| 1002 | Ga0495619_0253539 | 3300053085 | Bacteria | 1219 |
| 1003 | Ga0495619_0293265 | 3300053085 | Unclassified | 1127 |
| 1004 | Ga0500556_0000824 | 3300053104 | Bacteria | 17931 |
| 1005 | Ga0500593_020380 | 3300053117 | Bacteria | 2909 |
| 1006 | Ga0500655_001681 | 3300053133 | Bacteria | 4169 |
| 1007 | Ga0500559_0000895 | 3300053136 | Bacteria | 19011 |
| 1008 | Ga0500568_0000949 | 3300053139 | Bacteria | 19941 |
| 1009 | Ga0500573_0353176 | 3300053140 | Unclassified | 713 |
| 1010 | Ga0501084_0000749 | 3300054114 | Bacteria | 24725 |
| 1011 | Ga0501084_0004755 | 3300054114 | Bacteria | 11098 |
| 1012 | Ga0501084_0008991 | 3300054114 | Bacteria | 8263 |
| 1013 | Ga0501084_0020927 | 3300054114 | Bacteria | 5454 |
| 1014 | Ga0501084_0062592 | 3300054114 | Bacteria | 3115 |
| 1015 | Ga0501084_0069275 | 3300054114 | Bacteria | 2953 |
| 1016 | Ga0501084_0101275 | 3300054114 | Bacteria | 2419 |
| 1017 | Ga0501084_0133689 | 3300054114 | Bacteria | 2088 |
| 1018 | Ga0501084_0177691 | 3300054114 | Bacteria | 1797 |
| 1019 | Ga0501084_0202701 | 3300054114 | Bacteria | 1674 |
| 1020 | Ga0590071_014859 | 3300059421 | Unclassified | 1826 |
| 1021 | Ga0590075_002541 | 3300059424 | Bacteria | 4362 |
| 1022 | Ga0590075_026523 | 3300059424 | Bacteria | 1459 |
| 1023 | Ga0590077_001473 | 3300059426 | Bacteria | 5493 |
| 1024 | Ga0587066_179600 | 3300059490 | Unclassified | 544 |
| 1025 | Ga0587073_0059223 | 3300059492 | Bacteria | 893 |
| 1026 | Ga0587082_019378 | 3300059504 | Bacteria | 1092 |
| 1027 | Ga0587083_0024509 | 3300059505 | Bacteria | 1148 |
| 1028 | Ga0587088_072459 | 3300059508 | Bacteria | 721 |
| 1029 | Ga0587091_031210 | 3300059511 | Bacteria | 1001 |
| 1030 | Ga0587067_164094 | 3300059640 | Bacteria | 567 |
| 1031 | Ga0587068_139426 | 3300059641 | Bacteria | 540 |
| 1032 | Ga0587078_067256 | 3300059646 | Bacteria | 553 |
| 1033 | Ga0501082_0001748 | 3300060353 | Bacteria | 19135 |
| 1034 | Ga0501082_0013186 | 3300060353 | Bacteria | 7106 |
| 1035 | Ga0501082_0027497 | 3300060353 | Bacteria | 4897 |
| 1036 | Ga0501082_0027617 | 3300060353 | Bacteria | 4885 |
| 1037 | Ga0501082_0029421 | 3300060353 | Bacteria | 4733 |
| 1038 | Ga0501082_0037371 | 3300060353 | Bacteria | 4185 |
| 1039 | Ga0501082_0052144 | 3300060353 | Bacteria | 3526 |
| 1040 | Ga0501082_0095896 | 3300060353 | Bacteria | 2564 |
| 1041 | Ga0501082_0390525 | 3300060353 | Bacteria | 1214 |
| 1042 | Ga0501082_0850471 | 3300060353 | Bacteria | 798 |
| 1043 | Ga0501082_1205231 | 3300060353 | Bacteria | 661 |
| 1044 | Ga0501082_1473474 | 3300060353 | Bacteria | 594 |
| 1045 | Ga0530510_0000831 | 3300061734 | Bacteria | 20295 |
| 1046 | Ga0530510_0001043 | 3300061734 | Bacteria | 18333 |
| 1047 | Ga0530510_0013188 | 3300061734 | Bacteria | 5812 |
| 1048 | Ga0530510_0020463 | 3300061734 | Bacteria | 4704 |
| 1049 | Ga0530510_0140204 | 3300061734 | Bacteria | 1781 |
| 1050 | Ga0530510_0203241 | 3300061734 | Bacteria | 1472 |
| 1051 | Ga0530510_0250049 | 3300061734 | Bacteria | 1321 |
| 1052 | Ga0530510_0294442 | 3300061734 | Bacteria | 1214 |
| 1053 | Ga0530510_0317113 | 3300061734 | Bacteria | 1168 |
| 1054 | Ga0530510_0482346 | 3300061734 | Bacteria | 939 |
| 1055 | Ga0530510_0599672 | 3300061734 | Bacteria | 838 |
| 1056 | 8054108748 | 8054107350 | Bacteria | 5022511 |
| 1057 | Ga0466968_0103734 | |||
| 1058 | JGI25407J50210_10014190 | |||
| 1059 | JGI25407J50210_10015536 | |||
| 1060 | JGI25407J50210_10021814 | |||
| 1061 | JGI25407J50210_10114121 | |||
| 1062 | Ga0006562J51391_1127962 | |||
| 1063 | Ga0065707_10838498 | |||
| 1064 | Ga0070690_101462189 | |||
| 1065 | Ga0068869_100930246 | |||
| 1066 | Ga0070682_100061080 | |||
| 1067 | Ga0070689_101764000 | |||
| 1068 | Ga0070668_100008110 | |||
| 1069 | Ga0070668_100634040 | |||
| 1070 | Ga0070675_100144304 | |||
| 1071 | Ga0070674_100328860 | |||
| 1072 | Ga0070673_102321984 | |||
| 1073 | Ga0070667_100681042 | |||
| 1074 | Ga0070703_10021940 | |||
| 1075 | Ga0070709_10000983 | |||
| 1076 | Ga0070714_100077832 | |||
| 1077 | Ga0070714_100149009 | |||
| 1078 | Ga0070714_100180610 | |||
| 1079 | Ga0070714_100468400 | |||
| 1080 | Ga0070714_100522977 | |||
| 1081 | Ga0070714_100816647 | |||
| 1082 | Ga0070713_100503201 | |||
| 1083 | Ga0070713_101480246 | |||
| 1084 | Ga0070713_102443580 | |||
| 1085 | Ga0070710_10000983 | |||
| 1086 | Ga0070710_10026704 | |||
| 1087 | Ga0070710_10198192 | |||
| 1088 | Ga0070711_100004101 | |||
| 1089 | Ga0070711_100038046 | |||
| 1090 | Ga0070711_100400901 | |||
| 1091 | Ga0070705_100173662 | |||
| 1092 | Ga0070700_100612158 | |||
| 1093 | Ga0070700_101767562 | |||
| 1094 | Ga0070708_100013286 | |||
| 1095 | Ga0070708_100163195 | |||
| 1096 | Ga0070708_100505557 | |||
| 1097 | Ga0070708_100639503 | |||
| 1098 | Ga0070708_100665263 | |||
| 1099 | Ga0070663_100026395 | |||
| 1100 | Ga0070662_100005719 | |||
| 1101 | Ga0070681_10733058 | |||
| 1102 | Ga0068867_101709257 | |||
| 1103 | Ga0070685_11603975 | |||
| 1104 | Ga0070706_100000142 | |||
| 1105 | Ga0070706_100003391 | |||
| 1106 | Ga0070706_100009953 | |||
| 1107 | Ga0070706_100011275 | |||
| 1108 | Ga0070706_100056179 | |||
| 1109 | Ga0070706_100067400 | |||
| 1110 | Ga0070706_100069270 | |||
| 1111 | Ga0070706_100965217 | |||
| 1112 | Ga0070707_100003832 | |||
| 1113 | Ga0070707_100006360 | |||
| 1114 | Ga0070707_100019230 | |||
| 1115 | Ga0070707_100026258 | |||
| 1116 | Ga0070707_100185242 | |||
| 1117 | Ga0070707_100412246 | |||
| 1118 | Ga0070698_100001643 | |||
| 1119 | Ga0070698_100012817 | |||
| 1120 | Ga0070698_100024464 | |||
| 1121 | Ga0070698_100038466 | |||
| 1122 | Ga0070698_100113874 | |||
| 1123 | Ga0070698_100744224 | |||
| 1124 | Ga0070698_101267085 | |||
| 1125 | Ga0070698_101382324 | |||
| 1126 | Ga0070699_100015884 | |||
| 1127 | Ga0070699_100062035 | |||
| 1128 | Ga0070699_100615888 | |||
| 1129 | Ga0070699_101024858 | |||
| 1130 | Ga0070699_101469240 | |||
| 1131 | Ga0070699_101640087 | |||
| 1132 | Ga0070699_101865993 | |||
| 1133 | Ga0070679_100060908 | |||
| 1134 | Ga0070684_101896266 | |||
| 1135 | Ga0070697_100011827 | |||
| 1136 | Ga0070697_100064077 | |||
| 1137 | Ga0070697_100094677 | |||
| 1138 | Ga0070686_100678173 | |||
| 1139 | Ga0070696_100798237 | |||
| 1140 | Ga0070665_100269843 | |||
| 1141 | Ga0068855_100747369 | |||
| 1142 | Ga0068857_100399528 | |||
| 1143 | Ga0068856_101769693 | |||
| 1144 | Ga0068852_100872884 | |||
| 1145 | Ga0068864_100322233 | |||
| 1146 | Ga0068864_101913771 | |||
| 1147 | Ga0068861_100007084 | |||
| 1148 | Ga0068860_101149427 | |||
| 1149 | Ga0081455_10053058 | |||
| 1150 | Ga0081455_10090328 | |||
| 1151 | Ga0081455_10203841 | |||
| 1152 | Ga0081538_10000563 | |||
| 1153 | Ga0081538_10001741 | |||
| 1154 | Ga0081538_10004705 | |||
| 1155 | Ga0081538_10015748 | |||
| 1156 | Ga0081538_10031139 | |||
| 1157 | Ga0081538_10031527 | |||
| 1158 | Ga0081538_10055754 | |||
| 1159 | Ga0081538_10164077 | |||
| 1160 | Ga0081540_1027783 | |||
| 1161 | Ga0081539_10006760 | |||
| 1162 | Ga0081539_10080116 | |||
| 1163 | Ga0070717_10006582 | |||
| 1164 | Ga0070717_10012456 | |||
| 1165 | Ga0070717_10058391 | |||
| 1166 | Ga0070717_10066609 | |||
| 1167 | Ga0070717_10083863 | |||
| 1168 | Ga0070717_10461554 | |||
| 1169 | Ga0070717_10812110 | |||
| 1170 | Ga0075432_10010328 | |||
| 1171 | Ga0070716_100000097 | |||
| 1172 | Ga0070716_100003706 | |||
| 1173 | Ga0070712_100002546 | |||
| 1174 | Ga0070712_100036478 | |||
| 1175 | Ga0070712_100283130 | |||
| 1176 | Ga0070712_100932395 | |||
| 1177 | Ga0070712_101472150 | |||
| 1178 | Ga0075367_10627241 | |||
| 1179 | Ga0075427_10001437 | |||
| 1180 | Ga0075428_100452972 | |||
| 1181 | Ga0075428_100530315 | |||
| 1182 | Ga0075428_100680063 | |||
| 1183 | Ga0075430_100002917 | |||
| 1184 | Ga0075430_100234085 | |||
| 1185 | Ga0075431_100027379 | |||
| 1186 | Ga0075431_100427124 | |||
| 1187 | Ga0075431_102063812 | |||
| 1188 | Ga0075433_10016846 | |||
| 1189 | Ga0075433_10547405 | |||
| 1190 | Ga0075434_100155704 | |||
| 1191 | Ga0075434_100383215 | |||
| 1192 | Ga0075434_101082129 | |||
| 1193 | Ga0075434_101217600 | |||
| 1194 | Ga0075429_100038260 | |||
| 1195 | Ga0075435_100202628 | |||
| 1196 | Ga0099795_10196660 | |||
| 1197 | Ga0105251_10032552 | |||
| 1198 | Ga0105244_10593318 | |||
| 1199 | Ga0105240_10184076 | |||
| 1200 | Ga0105240_10844138 | |||
| 1201 | Ga0111539_10067328 | |||
| 1202 | Ga0111539_10551431 | |||
| 1203 | Ga0111539_12285214 | |||
| 1204 | Ga0111539_12822056 | |||
| 1205 | Ga0105245_10216326 | |||
| 1206 | Ga0105247_10095875 | |||
| 1207 | Ga0114129_10078357 | |||
| 1208 | Ga0114129_10200404 | |||
| 1209 | Ga0114129_10233930 | |||
| 1210 | Ga0114129_10480397 | |||
| 1211 | Ga0114129_10502069 | |||
| 1212 | Ga0114129_11309428 | |||
| 1213 | Ga0105243_10214611 | |||
| 1214 | Ga0105241_11240148 | |||
| 1215 | Ga0105242_10070130 | |||
| 1216 | Ga0105248_10503616 | |||
| 1217 | Ga0105248_12209765 | |||
| 1218 | Ga0105237_10598666 | |||
| 1219 | Ga0105237_10672161 | |||
| 1220 | Ga0105238_10819334 | |||
| 1221 | Ga0105249_10006149 | |||
| 1222 | Ga0105249_11093758 | |||
| 1223 | Ga0105249_11541442 | |||
| 1224 | Ga0105028_101642 | |||
| 1225 | Ga0105246_10878893 | |||
| 1226 | Ga0105246_11227450 | |||
| 1227 | Ga0157340_1002342 | |||
| 1228 | Ga0157320_1011695 | |||
| 1229 | Ga0157345_1006176 | |||
| 1230 | Ga0157342_1002222 | |||
| 1231 | Ga0157371_10120671 | |||
| 1232 | Ga0157371_10390303 | |||
| 1233 | Ga0157370_10054257 | |||
| 1234 | Ga0157369_10055792 | |||
| 1235 | Ga0157369_11165213 | |||
| 1236 | Ga0163162_10988600 | |||
| 1237 | Ga0157372_11990598 | |||
| 1238 | Ga0157375_13413879 | |||
| 1239 | Ga0163163_10147155 | |||
| 1240 | Ga0163163_11008237 | |||
| 1241 | Ga0163163_11936685 | |||
| 1242 | Ga0163163_13049253 | |||
| 1243 | Ga0157380_10163599 | |||
| 1244 | Ga0157380_12967251 | |||
| 1245 | Ga0157377_10103090 | |||
| 1246 | Ga0157379_10399146 | |||
| 1247 | Ga0157379_11107174 | |||
| 1248 | Ga0157379_11558184 | |||
| 1249 | Ga0157376_10607948 | |||
| 1250 | Ga0157376_12420890 | |||
| 1251 | Ga0182005_1140437 | |||
| 1252 | Ga0163161_10064674 | |||
| 1253 | Ga0197907_10773823 | |||
| 1254 | Ga0206351_10514377 | |||
| 1255 | Ga0206350_10548992 | |||
| 1256 | Ga0206350_11212143 | |||
| 1257 | Ga0206354_10604926 | |||
| 1258 | Ga0213873_10029940 | |||
| 1259 | Ga0213875_10126330 | |||
| 1260 | Ga0213875_10141583 | |||
| 1261 | Ga0224712_10061078 | |||
| 1262 | Ga0207692_10001316 | |||
| 1263 | Ga0207692_10019012 | |||
| 1264 | Ga0207699_10003023 | |||
| 1265 | Ga0207684_10001073 | |||
| 1266 | Ga0207684_10001870 | |||
| 1267 | Ga0207684_10005449 | |||
| 1268 | Ga0207684_10008146 | |||
| 1269 | Ga0207684_10026481 | |||
| 1270 | Ga0207684_10041337 | |||
| 1271 | Ga0207684_10138132 | |||
| 1272 | Ga0207684_10970528 | |||
| 1273 | Ga0207684_11505109 | |||
| 1274 | Ga0207693_10000671 | |||
| 1275 | Ga0207693_10010726 | |||
| 1276 | Ga0207693_10275877 | |||
| 1277 | Ga0207693_10633332 | |||
| 1278 | Ga0207663_10052328 | |||
| 1279 | Ga0207663_10188636 | |||
| 1280 | Ga0207663_10642136 | |||
| 1281 | Ga0207652_10956565 | |||
| 1282 | Ga0207646_10001028 | |||
| 1283 | Ga0207646_10001962 | |||
| 1284 | Ga0207646_10024943 | |||
| 1285 | Ga0207646_10040303 | |||
| 1286 | Ga0207646_10098289 | |||
| 1287 | Ga0207646_10099779 | |||
| 1288 | Ga0207646_10104202 | |||
| 1289 | Ga0207646_10353867 | |||
| 1290 | Ga0207659_10114409 | |||
| 1291 | Ga0207700_10001352 | |||
| 1292 | Ga0207700_10002344 | |||
| 1293 | Ga0207700_10003967 | |||
| 1294 | Ga0207700_10290820 | |||
| 1295 | Ga0207700_10299109 | |||
| 1296 | Ga0207700_10382429 | |||
| 1297 | Ga0207700_11657458 | |||
| 1298 | Ga0207664_10002013 | |||
| 1299 | Ga0207664_10033085 | |||
| 1300 | Ga0207664_10450786 | |||
| 1301 | Ga0207664_10523795 | |||
| 1302 | Ga0207664_10869465 | |||
| 1303 | Ga0207706_10012303 | |||
| 1304 | Ga0207686_11399184 | |||
| 1305 | Ga0207669_10353848 | |||
| 1306 | Ga0207665_10000178 | |||
| 1307 | Ga0207665_10005547 | |||
| 1308 | Ga0207711_10357556 | |||
| 1309 | Ga0207689_10457863 | |||
| 1310 | Ga0207667_10356845 | |||
| 1311 | Ga0207712_10055695 | |||
| 1312 | Ga0207712_10515318 | |||
| 1313 | Ga0207668_10105404 | |||
| 1314 | Ga0207678_10004251 | |||
| 1315 | Ga0207708_10386454 | |||
| 1316 | Ga0207708_11653676 | |||
| 1317 | Ga0207676_10042843 | |||
| 1318 | Ga0207676_12305740 | |||
| 1319 | Ga0207674_10134721 | |||
| 1320 | Ga0207674_10555184 | |||
| 1321 | Ga0207675_100000964 | |||
| 1322 | Ga0207675_100408660 | |||
| 1323 | Ga0207428_10001806 | |||
| 1324 | Ga0207428_10087521 | |||
| 1325 | Ga0207428_10334313 | |||
| 1326 | Ga0268266_10260534 | |||
| 1327 | Ga0268265_10639840 | |||
| 1328 | Ga0265337_1036150 | |||
| 1329 | Ga0265326_10075822 | |||
| 1330 | Ga0265319_1000833 | |||
| 1331 | Ga0265319_1035454 | |||
| 1332 | Ga0265319_1160140 | |||
| 1333 | Ga0265334_10191905 | |||
| 1334 | Ga0265318_10015636 | |||
| 1335 | Ga0265318_10018610 | |||
| 1336 | Ga0265318_10141140 | |||
| 1337 | Ga0265322_10038545 | |||
| 1338 | Ga0265336_10015342 | |||
| 1339 | Ga0265336_10069854 | |||
| 1340 | Ga0265338_10006074 | |||
| 1341 | Ga0265338_10007987 | |||
| 1342 | Ga0265338_10069170 | |||
| 1343 | Ga0265338_10378061 | |||
| 1344 | Ga0265324_10001131 | |||
| 1345 | Ga0265768_100661 | |||
| 1346 | Ga0265760_10035068 | |||
| 1347 | Ga0265332_10003991 | |||
| 1348 | Ga0265320_10000154 | |||
| 1349 | Ga0265320_10022913 | |||
| 1350 | Ga0265320_10106596 | |||
| 1351 | Ga0265320_10218361 | |||
| 1352 | Ga0265325_10022357 | |||
| 1353 | Ga0265325_10067153 | |||
| 1354 | Ga0265329_10037000 | |||
| 1355 | Ga0265340_10000186 | |||
| 1356 | Ga0265339_10025132 | |||
| 1357 | Ga0265339_10144771 | |||
| 1358 | Ga0265331_10018754 | |||
| 1359 | Ga0265327_10382959 | |||
| 1360 | Ga0265316_10016181 | |||
| 1361 | Ga0307408_100017050 | |||
| 1362 | Ga0307408_100029949 | |||
| 1363 | Ga0307408_100246375 | |||
| 1364 | Ga0307408_100446534 | |||
| 1365 | Ga0307408_102087445 | |||
| 1366 | Ga0307408_102391716 | |||
| 1367 | Ga0265313_10014607 | |||
| 1368 | Ga0316575_10041924 | |||
| 1369 | Ga0265314_10005589 | |||
| 1370 | Ga0265314_10171263 | |||
| 1371 | Ga0265342_10050432 | |||
| 1372 | Ga0316576_10692399 | |||
| 1373 | Ga0307405_10002109 | |||
| 1374 | Ga0307405_10002769 | |||
| 1375 | Ga0307405_10012243 | |||
| 1376 | Ga0307405_10111051 | |||
| 1377 | Ga0307405_10418757 | |||
| 1378 | Ga0307405_10428068 | |||
| 1379 | Ga0307405_10865654 | |||
| 1380 | Ga0307405_11968542 | |||
| 1381 | Ga0307413_10149702 | |||
| 1382 | Ga0307413_10172241 | |||
| 1383 | Ga0307413_10204254 | |||
| 1384 | Ga0307413_10282620 | |||
| 1385 | Ga0307413_10314651 | |||
| 1386 | Ga0307413_10633652 | |||
| 1387 | Ga0307413_11168757 | |||
| 1388 | Ga0307410_10006583 | |||
| 1389 | Ga0307410_10038627 | |||
| 1390 | Ga0307410_10170004 | |||
| 1391 | Ga0307406_10039438 | |||
| 1392 | Ga0307406_10103878 | |||
| 1393 | Ga0307406_10128701 | |||
| 1394 | Ga0307406_10190638 | |||
| 1395 | Ga0307406_11008636 | |||
| 1396 | Ga0307407_10089446 | |||
| 1397 | Ga0307407_10092003 | |||
| 1398 | Ga0307407_10184117 | |||
| 1399 | Ga0307407_10224126 | |||
| 1400 | Ga0307407_10488398 | |||
| 1401 | Ga0307412_10073747 | |||
| 1402 | Ga0307412_10099662 | |||
| 1403 | Ga0307412_10124619 | |||
| 1404 | Ga0307412_10564523 | |||
| 1405 | Ga0307412_10976321 | |||
| 1406 | Ga0307412_11829637 | |||
| 1407 | Ga0307409_100005049 | |||
| 1408 | Ga0307409_100067052 | |||
| 1409 | Ga0307409_100292325 | |||
| 1410 | Ga0307409_100382494 | |||
| 1411 | Ga0307409_100503025 | |||
| 1412 | Ga0307409_100581058 | |||
| 1413 | Ga0307409_101353218 | |||
| 1414 | Ga0307416_100003396 | |||
| 1415 | Ga0307416_100012312 | |||
| 1416 | Ga0307416_100012406 | |||
| 1417 | Ga0307416_100045709 | |||
| 1418 | Ga0307416_100092966 | |||
| 1419 | Ga0307416_100250439 | |||
| 1420 | Ga0307416_100262378 | |||
| 1421 | Ga0307416_100925928 | |||
| 1422 | Ga0307416_103597687 | |||
| 1423 | Ga0307414_10044040 | |||
| 1424 | Ga0307414_10046088 | |||
| 1425 | Ga0307414_10512521 | |||
| 1426 | Ga0307414_10954081 | |||
| 1427 | Ga0307414_11614583 | |||
| 1428 | Ga0307411_10063215 | |||
| 1429 | Ga0307411_10102836 | |||
| 1430 | Ga0307411_10176214 | |||
| 1431 | Ga0307415_100010710 | |||
| 1432 | Ga0307415_100018693 | |||
| 1433 | Ga0307415_100030941 | |||
| 1434 | Ga0307415_100084444 | |||
| 1435 | Ga0307415_100223395 | |||
| 1436 | Ga0307415_100240758 | |||
| 1437 | Ga0307415_100242573 | |||
| 1438 | Ga0307415_100314374 | |||
| 1439 | Ga0307415_100442294 | |||
| 1440 | Ga0307415_101276983 | |||
| 1441 | Ga0307415_101328545 | |||
| 1442 | Ga0307415_101463338 | |||
| 1443 | Ga0373950_0029024 | |||
| 1444 | Ga0373958_0021262 | |||
| 1445 | Ga0373938_0010421 | |||
| 1446 | Ga0373928_0005198 | |||
| 1447 | Ga0373929_0006261 | |||
| 1448 | Ga0373934_0000165 | |||
| 1449 | Ga0373934_0075695 | |||
| 1450 | Ga0373934_0180328 | |||
| 1451 | Ga0373944_0160641 | |||
| 1452 | Ga0373949_0050394 | |||
| 1453 | Ga0373951_0007547 | |||
| 1454 | Ga0373923_0076773 | |||
| 1455 | Ga0373923_0122274 | |||
| 1456 | Ga0373923_0130757 | |||
| 1457 | Ga0373936_0198179 | |||
| 1458 | Ga0373936_0354169 | |||
| 1459 | Ga0373939_0504969 | |||
| 1460 | Ga0373941_0006061 | |||
| 1461 | Ga0373945_0351697 | |||
| 1462 | Ga0373953_0000564 | |||
| 1463 | Ga0373953_0039396 | |||
| 1464 | Ga0373954_0005533 | |||
| 1465 | Ga0373954_0019254 | |||
| 1466 | Ga0373954_0031659 | |||
| 1467 | Ga0373956_0000061 | |||
| 1468 | Ga0373956_0286453 | |||
| 1469 | Ga0373956_0568220 | |||
| 1470 | Ga0373957_0000042 | |||
| 1471 | Ga0373957_0009612 | |||
| 1472 | Ga0373957_0223038 | |||
| 1473 | Ga0373960_0039800 | |||
| 1474 | Ga0373943_0135039 | |||
| 1475 | Ga0373943_0878105 | |||
| 1476 | Ga0373946_0412891 | |||
| 1477 | Ga0373955_0000106 | |||
| 1478 | Ga0373955_0117639 | |||
| 1479 | Ga0373955_0357610 | |||
| 1480 | Ga0373962_0103800 | |||
| 1481 | Ga0316574_0003632 | |||
| 1482 | Ga0316574_0948873 | |||
| 1483 | Ga0316574_1010433 | |||
| 1484 | Ga0373924_0007373 | |||
| 1485 | Ga0373931_0035751 | |||
| 1486 | Ga0373931_0887569 | |||
| 1487 | Ga0373935_0021181 | |||
| 1488 | Ga0373935_0023504 | |||
| 1489 | Ga0373935_0165840 | |||
| 1490 | Ga0373935_1191092 | |||
| 1491 | Ga0373927_0057209 | |||
| 1492 | Ga0373927_0793398 | |||
| 1493 | Ga0373933_0000046 | |||
| 1494 | Ga0373933_0223094 | |||
| 1495 | Ga0373933_0702593 | |||
| 1496 | Ga0373947_0100388 | |||
| 1497 | Ga0373947_0359772 | |||
| 1498 | Ga0373937_0000115 | |||
| 1499 | Ga0373937_0001369 | |||
| 1500 | Ga0373937_0197156 | |||
| 1501 | Ga0373937_0212072 | |||
| 1502 | Ga0316582_0115210 | |||
| 1503 | Ga0373925_0009527 | |||
| 1504 | Ga0373925_0034917 | |||
| 1505 | Ga0373925_0082342 | |||
| 1506 | Ga0373925_0228341 | |||
| 1507 | Ga0373925_1138088 | |||
| 1508 | Ga0395899_0031526 | |||
| 1509 | Ga0395899_0169248 | |||
| 1510 | Ga0395899_0254113 | |||
| 1511 | Ga0395899_0276489 | |||
| 1512 | Ga0395900_0130610 | |||
| 1513 | Ga0395900_0147077 | |||
| 1514 | Ga0395900_0158631 | |||
| 1515 | Ga0395900_0292743 | |||
| 1516 | Ga0395900_0504868 | |||
| 1517 | Ga0395898_0031024 | |||
| 1518 | Ga0395898_0048606 | |||
| 1519 | Ga0395898_0086077 | |||
| 1520 | Ga0395898_0138784 | |||
| 1521 | Ga0395898_0145172 | |||
| 1522 | Ga0395898_0147833 | |||
| 1523 | Ga0395898_0571416 | |||
| 1524 | Ga0395898_0747063 | |||
| 1525 | Ga0395898_1008093 | |||
| 1526 | Ga0395905_0325752 | |||
| 1527 | Ga0395905_0438477 | |||
| 1528 | Ga0395905_0931365 | |||
| 1529 | Ga0395905_1345025 | |||
| 1530 | Ga0436364_0047891 | |||
| 1531 | Ga0436364_0614465 | |||
| 1532 | Ga0436364_0916892 | |||
| 1533 | Ga0395901_0007066 | |||
| 1534 | Ga0395901_0018585 | |||
| 1535 | Ga0395901_0098852 | |||
| 1536 | Ga0395901_0365707 | |||
| 1537 | Ga0395901_0369577 | |||
| 1538 | Ga0395901_0527799 | |||
| 1539 | Ga0395901_0933944 | |||
| 1540 | Ga0395901_1125331 | |||
| 1541 | Ga0436360_0200064 | |||
| 1542 | Ga0436361_0918879 | |||
| 1543 | Ga0436363_0597454 | |||
| 1544 | Ga0436363_1167476 | |||
| 1545 | Ga0436363_1713516 | |||
| 1546 | Ga0436362_1001258 | |||
| 1547 | Ga0436362_1085605 | |||
| 1548 | Ga0439447_049602 | |||
| 1549 | Ga0439461_0115627 | |||
| 1550 | Ga0439461_0137214 | |||
| 1551 | Ga0439466_0020676 | |||
| 1552 | Ga0439465_0031905 | |||
| 1553 | Ga0451853_0337398 | |||
| 1554 | Ga0439433_0108660 | |||
| 1555 | Ga0439442_002841 | |||
| 1556 | Ga0439442_090344 | |||
| 1557 | Ga0439443_010906 | |||
| 1558 | Ga0439448_0008766 | |||
| 1559 | Ga0439448_0048288 | |||
| 1560 | Ga0439432_116386 | |||
| 1561 | Ga0439449_0070824 | |||
| 1562 | Ga0439450_006319 | |||
| 1563 | Ga0439450_015007 | |||
| 1564 | Ga0439450_089151 | |||
| 1565 | Ga0439451_007829 | |||
| 1566 | Ga0439451_016207 | |||
| 1567 | Ga0439454_025171 | |||
| 1568 | Ga0439455_0020580 | |||
| 1569 | Ga0439455_0023097 | |||
| 1570 | Ga0439455_0032590 | |||
| 1571 | Ga0439455_0049665 | |||
| 1572 | Ga0439456_011321 | |||
| 1573 | Ga0439463_000650 | |||
| 1574 | Ga0439463_028336 | |||
| 1575 | Ga0450911_041637 | |||
| 1576 | Ga0450913_018142 | |||
| 1577 | Ga0450914_020466 | |||
| 1578 | Ga0450917_006870 | |||
| 1579 | Ga0450919_015146 | |||
| 1580 | Ga0450919_019655 | |||
| 1581 | Ga0450920_001765 | |||
| 1582 | Ga0450923_026551 | |||
| 1583 | Ga0450890_017254 | |||
| 1584 | Ga0450900_005890 | |||
| 1585 | Ga0450900_022595 | |||
| 1586 | Ga0450904_006773 | |||
| 1587 | Ga0450905_010595 | |||
| 1588 | Ga0450905_020166 | |||
| 1589 | Ga0450907_000541 | |||
| 1590 | Ga0450910_034248 | |||
| 1591 | Ga0439446_0030215 | |||
| 1592 | Ga0450908_017655 | |||
| 1593 | Ga0439434_0000170 | |||
| 1594 | Ga0439434_0139380 | |||
| 1595 | Ga0439435_0214560 | |||
| 1596 | Ga0439444_0007575 | |||
| 1597 | Ga0439444_0024855 | |||
| 1598 | Ga0439464_0009777 | |||
| 1599 | Ga0439464_0047394 | |||
| 1600 | Ga0439464_0101528 | |||
| 1601 | Ga0439460_0007916 | |||
| 1602 | Ga0439460_0008959 | |||
| 1603 | Ga0439460_0067128 | |||
| 1604 | Ga0439460_0326072 | |||
| 1605 | Ga0450916_000185 | |||
| 1606 | Ga0450916_009159 | |||
| 1607 | Ga0450916_042941 | |||
| 1608 | Ga0450893_0013214 | |||
| 1609 | Ga0451577_0569859 | |||
| 1610 | Ga0439440_0024204 | |||
| 1611 | Ga0439440_0026648 | |||
| 1612 | Ga0439440_0283807 | |||
| 1613 | Ga0466969_0435488 | |||
| 1614 | Ga0466966_0215467 | |||
| 1615 | Ga0466961_0104837 | |||
| 1616 | Ga0466963_0413527 | |||
| 1617 | Ga0466963_0481341 | |||
| 1618 | Ga0466963_0556702 | |||
| 1619 | Ga0466963_0777521 | |||
| 1620 | Ga0453684_0212452 | |||
| 1621 | Ga0466960_0654385 | |||
| 1622 | Ga0466959_0183898 | |||
| 1623 | Ga0451576_1260570 | |||
| 1624 | Ga0466967_0360074 | |||
| 1625 | Ga0466967_1540381 | |||
| 1626 | Ga0495592_0000166 | |||
| 1627 | Ga0495592_0133689 | |||
| 1628 | Ga0495591_107972 | |||
| 1629 | Ga0495629_0158714 | |||
| 1630 | Ga0495629_1057892 | |||
| 1631 | Ga0495651_0000067 | |||
| 1632 | Ga0495651_0003459 | |||
| 1633 | Ga0495651_0041530 | |||
| 1634 | Ga0495651_0110877 | |||
| 1635 | Ga0495651_0250941 | |||
| 1636 | Ga0495651_0329754 | |||
| 1637 | Ga0495653_0001859 | |||
| 1638 | Ga0495653_0017334 | |||
| 1639 | Ga0495653_0094497 | |||
| 1640 | Ga0495653_0533225 | |||
| 1641 | Ga0495582_0765490 | |||
| 1642 | Ga0495605_0108658 | |||
| 1643 | Ga0495664_0044501 | |||
| 1644 | Ga0495664_0152527 | |||
| 1645 | Ga0495584_0087377 | |||
| 1646 | Ga0495584_0250637 | |||
| 1647 | Ga0495607_0331687 | |||
| 1648 | Ga0495608_0000850 | |||
| 1649 | Ga0495608_0010560 | |||
| 1650 | Ga0495608_0213478 | |||
| 1651 | Ga0495616_0352037 | |||
| 1652 | Ga0495618_0015144 | |||
| 1653 | Ga0495618_0096053 | |||
| 1654 | Ga0495618_0166303 | |||
| 1655 | Ga0495618_0637070 | |||
| 1656 | Ga0495620_0170553 | |||
| 1657 | Ga0495628_0000916 | |||
| 1658 | Ga0495628_0017043 | |||
| 1659 | Ga0495628_0077779 | |||
| 1660 | Ga0495628_0105353 | |||
| 1661 | Ga0495628_0244594 | |||
| 1662 | Ga0495628_0307168 | |||
| 1663 | Ga0495628_0515981 | |||
| 1664 | Ga0495628_1097499 | |||
| 1665 | Ga0495630_0032984 | |||
| 1666 | Ga0495630_0112386 | |||
| 1667 | Ga0495630_0260145 | |||
| 1668 | Ga0495631_0065544 | |||
| 1669 | Ga0495637_0099616 | |||
| 1670 | Ga0495642_0544994 | |||
| 1671 | Ga0495652_0002074 | |||
| 1672 | Ga0495652_0052165 | |||
| 1673 | Ga0495652_0325285 | |||
| 1674 | Ga0495652_0409199 | |||
| 1675 | Ga0495652_0584039 | |||
| 1676 | Ga0495652_0926558 | |||
| 1677 | Ga0495652_0985238 | |||
| 1678 | Ga0495654_0178486 | |||
| 1679 | Ga0495665_0616336 | |||
| 1680 | Ga0495640_0103617 | |||
| 1681 | Ga0495640_0202826 | |||
| 1682 | Ga0495640_0254209 | |||
| 1683 | Ga0495586_0105439 | |||
| 1684 | Ga0495586_0115771 | |||
| 1685 | Ga0495586_0128010 | |||
| 1686 | Ga0495587_0000078 | |||
| 1687 | Ga0495587_0001751 | |||
| 1688 | Ga0495587_0106505 | |||
| 1689 | Ga0495587_0125339 | |||
| 1690 | Ga0495587_0140602 | |||
| 1691 | Ga0495587_0282159 | |||
| 1692 | Ga0495587_0377335 | |||
| 1693 | Ga0495598_0022315 | |||
| 1694 | Ga0495609_0043412 | |||
| 1695 | Ga0495621_0025565 | |||
| 1696 | Ga0495597_0282118 | |||
| 1697 | Ga0495645_0002489 | |||
| 1698 | Ga0495645_0071469 | |||
| 1699 | Ga0495645_0072004 | |||
| 1700 | Ga0495645_0079545 | |||
| 1701 | Ga0495645_0138895 | |||
| 1702 | Ga0495645_0147933 | |||
| 1703 | Ga0495645_0217912 | |||
| 1704 | Ga0495645_0288623 | |||
| 1705 | Ga0495667_0000122 | |||
| 1706 | Ga0495667_0002167 | |||
| 1707 | Ga0495667_0097586 | |||
| 1708 | Ga0495667_0121344 | |||
| 1709 | Ga0495667_0190455 | |||
| 1710 | Ga0495656_0007250 | |||
| 1711 | Ga0495656_0406663 | |||
| 1712 | Ga0495656_0764222 | |||
| 1713 | Ga0495668_0569396 | |||
| 1714 | Ga0495634_0025904 | |||
| 1715 | Ga0495634_0119751 | |||
| 1716 | Ga0495634_0162815 | |||
| 1717 | Ga0495635_0004377 | |||
| 1718 | Ga0495635_0047164 | |||
| 1719 | Ga0495635_0077003 | |||
| 1720 | Ga0495635_0205637 | |||
| 1721 | Ga0495635_0700641 | |||
| 1722 | Ga0495661_0216562 | |||
| 1723 | Ga0495657_0000098 | |||
| 1724 | Ga0495657_0001534 | |||
| 1725 | Ga0495599_0000115 | |||
| 1726 | Ga0495599_0011714 | |||
| 1727 | Ga0495599_0051536 | |||
| 1728 | Ga0495599_0159338 | |||
| 1729 | Ga0495599_0188182 | |||
| 1730 | Ga0495599_0259782 | |||
| 1731 | Ga0495623_0001407 | |||
| 1732 | Ga0495623_0026994 | |||
| 1733 | Ga0495623_0060692 | |||
| 1734 | Ga0495623_0444109 | |||
| 1735 | Ga0495646_0010628 | |||
| 1736 | Ga0495646_0061862 | |||
| 1737 | Ga0495646_0113043 | |||
| 1738 | Ga0495646_0147395 | |||
| 1739 | Ga0495658_0026431 | |||
| 1740 | Ga0495658_0248892 | |||
| 1741 | Ga0495669_0508383 | |||
| 1742 | Ga0495613_0038639 | |||
| 1743 | Ga0495613_0108456 | |||
| 1744 | Ga0495613_0331922 | |||
| 1745 | Ga0495670_0016777 | |||
| 1746 | Ga0495589_0098128 | |||
| 1747 | Ga0495600_0012600 | |||
| 1748 | Ga0495600_0087988 | |||
| 1749 | Ga0495600_0167439 | |||
| 1750 | Ga0495600_0920067 | |||
| 1751 | Ga0495604_0000142 | |||
| 1752 | Ga0495604_0062120 | |||
| 1753 | Ga0495604_0127153 | |||
| 1754 | Ga0495604_0188227 | |||
| 1755 | Ga0495604_0384018 | |||
| 1756 | Ga0495604_0519204 | |||
| 1757 | Ga0495636_0031918 | |||
| 1758 | Ga0495674_0001409 | |||
| 1759 | Ga0495674_0017598 | |||
| 1760 | Ga0495674_0024484 | |||
| 1761 | Ga0495674_0035048 | |||
| 1762 | Ga0495674_0049752 | |||
| 1763 | Ga0495674_0444774 | |||
| 1764 | Ga0495674_1071454 | |||
| 1765 | Ga0495674_1380344 | |||
| 1766 | Ga0495676_0128478 | |||
| 1767 | Ga0495680_0000111 | |||
| 1768 | Ga0495680_0000651 | |||
| 1769 | Ga0495680_0087236 | |||
| 1770 | Ga0495680_0107165 | |||
| 1771 | Ga0495675_0001226 | |||
| 1772 | Ga0495675_0017394 | |||
| 1773 | Ga0495675_0276495 | |||
| 1774 | Ga0495675_0652660 | |||
| 1775 | Ga0495677_0027547 | |||
| 1776 | Ga0495685_180566 | |||
| 1777 | Ga0495684_0035474 | |||
| 1778 | Ga0495684_0115746 | |||
| 1779 | Ga0495684_0128112 | |||
| 1780 | Ga0495684_0153244 | |||
| 1781 | Ga0495684_0996950 | |||
| 1782 | Ga0495602_0000820 | |||
| 1783 | Ga0495602_0006173 | |||
| 1784 | Ga0495602_0044859 | |||
| 1785 | Ga0495602_0142069 | |||
| 1786 | Ga0495602_0219996 | |||
| 1787 | Ga0495602_0286137 | |||
| 1788 | Ga0496100_0108299 | |||
| 1789 | Ga0496101_0033940 | |||
| 1790 | Ga0496102_1409982 | |||
| 1791 | Ga0496103_0012246 | |||
| 1792 | Ga0496104_0037147 | |||
| 1793 | Ga0496104_0040281 | |||
| 1794 | Ga0496104_0353026 | |||
| 1795 | Ga0496105_0108418 | |||
| 1796 | Ga0496105_0271930 | |||
| 1797 | Ga0496105_0278072 | |||
| 1798 | Ga0496106_0027152 | |||
| 1799 | Ga0496106_1377672 | |||
| 1800 | Ga0496107_0226926 | |||
| 1801 | Ga0496108_0042772 | |||
| 1802 | Ga0496108_0118788 | |||
| 1803 | Ga0496108_1041739 | |||
| 1804 | Ga0496108_1156962 | |||
| 1805 | Ga0496109_0025103 | |||
| 1806 | Ga0496109_0157137 | |||
| 1807 | Ga0496109_0166662 | |||
| 1808 | Ga0496109_0566855 | |||
| 1809 | Ga0496110_0058576 | |||
| 1810 | Ga0496110_0425031 | |||
| 1811 | Ga0496111_0003668 | |||
| 1812 | Ga0496111_0065428 | |||
| 1813 | Ga0496112_0410376 | |||
| 1814 | Ga0496113_0023018 | |||
| 1815 | Ga0496113_0241070 | |||
| 1816 | Ga0496113_1527255 | |||
| 1817 | Ga0496114_0033707 | |||
| 1818 | Ga0496114_0194351 | |||
| 1819 | Ga0496115_0056689 | |||
| 1820 | Ga0496115_0231614 | |||
| 1821 | Ga0496126_0277967 | |||
| 1822 | Ga0501031_0009394 | |||
| 1823 | Ga0501031_0118592 | |||
| 1824 | Ga0501031_0381696 | |||
| 1825 | Ga0501031_0596806 | |||
| 1826 | Ga0501032_0099239 | |||
| 1827 | Ga0501032_0352561 | |||
| 1828 | Ga0501032_1004244 | |||
| 1829 | Ga0501033_0008686 | |||
| 1830 | Ga0501033_0028947 | |||
| 1831 | Ga0501033_0041288 | |||
| 1832 | Ga0501033_0087250 | |||
| 1833 | Ga0501033_0119255 | |||
| 1834 | Ga0501034_0191915 | |||
| 1835 | Ga0501034_0365456 | |||
| 1836 | Ga0501034_0519996 | |||
| 1837 | Ga0501036_0000975 | |||
| 1838 | Ga0501036_0001109 | |||
| 1839 | Ga0501036_0003608 | |||
| 1840 | Ga0501036_0012032 | |||
| 1841 | Ga0501036_0058447 | |||
| 1842 | Ga0501036_0220396 | |||
| 1843 | Ga0501036_0273805 | |||
| 1844 | Ga0501036_0405131 | |||
| 1845 | Ga0501036_1290135 | |||
| 1846 | Ga0501037_0028484 | |||
| 1847 | Ga0501037_0037420 | |||
| 1848 | Ga0501037_0042055 | |||
| 1849 | Ga0501037_0427913 | |||
| 1850 | Ga0501038_0005493 | |||
| 1851 | Ga0501038_0017558 | |||
| 1852 | Ga0501038_0023789 | |||
| 1853 | Ga0501038_0031898 | |||
| 1854 | Ga0501039_0010800 | |||
| 1855 | Ga0501039_0017540 | |||
| 1856 | Ga0501039_0044299 | |||
| 1857 | Ga0501039_0092016 | |||
| 1858 | Ga0501039_0113124 | |||
| 1859 | Ga0501039_0136204 | |||
| 1860 | Ga0501039_0199625 | |||
| 1861 | Ga0501039_0291017 | |||
| 1862 | Ga0501039_0323855 | |||
| 1863 | Ga0501040_0000181 | |||
| 1864 | Ga0501040_0001595 | |||
| 1865 | Ga0501040_0009782 | |||
| 1866 | Ga0501040_0030855 | |||
| 1867 | Ga0501040_0052289 | |||
| 1868 | Ga0501040_0105660 | |||
| 1869 | Ga0501040_0435816 | |||
| 1870 | Ga0501040_0469548 | |||
| 1871 | Ga0501040_0661184 | |||
| 1872 | Ga0501040_0774166 | |||
| 1873 | Ga0501040_0946193 | |||
| 1874 | Ga0501040_1396502 | |||
| 1875 | Ga0501041_0000274 | |||
| 1876 | Ga0501041_0000698 | |||
| 1877 | Ga0501041_0001036 | |||
| 1878 | Ga0501041_0046814 | |||
| 1879 | Ga0501041_0048542 | |||
| 1880 | Ga0501041_0108701 | |||
| 1881 | Ga0501041_0135839 | |||
| 1882 | Ga0501042_0001149 | |||
| 1883 | Ga0501042_0001907 | |||
| 1884 | Ga0501042_0004764 | |||
| 1885 | Ga0501042_0054592 | |||
| 1886 | Ga0501042_0077183 | |||
| 1887 | Ga0501042_0262160 | |||
| 1888 | Ga0501042_0270633 | |||
| 1889 | Ga0501042_0348806 | |||
| 1890 | Ga0501042_0365538 | |||
| 1891 | Ga0501042_1008098 | |||
| 1892 | Ga0501042_1391460 | |||
| 1893 | Ga0501043_0053516 | |||
| 1894 | Ga0501043_0144455 | |||
| 1895 | Ga0501043_0926359 | |||
| 1896 | Ga0501046_0000991 | |||
| 1897 | Ga0501046_0021876 | |||
| 1898 | Ga0501047_0230362 | |||
| 1899 | Ga0501047_0504580 | |||
| 1900 | Ga0501048_0000408 | |||
| 1901 | Ga0501048_0002309 | |||
| 1902 | Ga0501048_0002733 | |||
| 1903 | Ga0501048_0015546 | |||
| 1904 | Ga0501048_0117583 | |||
| 1905 | Ga0501048_0259769 | |||
| 1906 | Ga0501048_0293220 | |||
| 1907 | Ga0501067_0089265 | |||
| 1908 | Ga0501068_0016530 | |||
| 1909 | Ga0501068_0166135 | |||
| 1910 | Ga0501068_0369826 | |||
| 1911 | Ga0501068_0952971 | |||
| 1912 | Ga0501069_0036856 | |||
| 1913 | Ga0501069_0466686 | |||
| 1914 | Ga0501070_0025921 | |||
| 1915 | Ga0501070_0092145 | |||
| 1916 | Ga0501070_0112090 | |||
| 1917 | Ga0501070_0260621 | |||
| 1918 | Ga0501070_0450035 | |||
| 1919 | Ga0501071_0001921 | |||
| 1920 | Ga0501071_0019013 | |||
| 1921 | Ga0501071_0031341 | |||
| 1922 | Ga0501071_0036698 | |||
| 1923 | Ga0501071_0101179 | |||
| 1924 | Ga0501071_0125042 | |||
| 1925 | Ga0501071_0126978 | |||
| 1926 | Ga0501071_0381181 | |||
| 1927 | Ga0501071_0821969 | |||
| 1928 | Ga0501071_0989245 | |||
| 1929 | Ga0501072_0000167 | |||
| 1930 | Ga0501072_0012897 | |||
| 1931 | Ga0501072_0020277 | |||
| 1932 | Ga0501072_0024764 | |||
| 1933 | Ga0501072_0031483 | |||
| 1934 | Ga0501072_0034160 | |||
| 1935 | Ga0501072_0078825 | |||
| 1936 | Ga0501072_0149417 | |||
| 1937 | Ga0501072_0222993 | |||
| 1938 | Ga0501072_0227769 | |||
| 1939 | Ga0501072_0263150 | |||
| 1940 | Ga0501072_0792857 | |||
| 1941 | Ga0501072_1092896 | |||
| 1942 | Ga0501073_0074234 | |||
| 1943 | Ga0501073_0079774 | |||
| 1944 | Ga0501073_0196757 | |||
| 1945 | Ga0501073_1243710 | |||
| 1946 | Ga0501074_0002848 | |||
| 1947 | Ga0501074_0004187 | |||
| 1948 | Ga0501074_0004269 | |||
| 1949 | Ga0501074_0009887 | |||
| 1950 | Ga0501074_0251353 | |||
| 1951 | Ga0501074_0343800 | |||
| 1952 | Ga0501074_0467260 | |||
| 1953 | Ga0501075_0000455 | |||
| 1954 | Ga0501075_0011496 | |||
| 1955 | Ga0501075_0032424 | |||
| 1956 | Ga0501075_0038726 | |||
| 1957 | Ga0501075_0085310 | |||
| 1958 | Ga0501075_0352434 | |||
| 1959 | Ga0501076_0000162 | |||
| 1960 | Ga0501076_0000369 | |||
| 1961 | Ga0501076_0001193 | |||
| 1962 | Ga0501076_0007533 | |||
| 1963 | Ga0501076_0011168 | |||
| 1964 | Ga0501076_0011330 | |||
| 1965 | Ga0501076_0028447 | |||
| 1966 | Ga0501076_0038187 | |||
| 1967 | Ga0501076_0078040 | |||
| 1968 | Ga0501076_0119499 | |||
| 1969 | Ga0501076_0540383 | |||
| 1970 | Ga0501076_0692419 | |||
| 1971 | Ga0501076_1124019 | |||
| 1972 | Ga0501077_0004819 | |||
| 1973 | Ga0501077_0005218 | |||
| 1974 | Ga0501077_0007242 | |||
| 1975 | Ga0501077_0022838 | |||
| 1976 | Ga0501077_0035609 | |||
| 1977 | Ga0501077_0171385 | |||
| 1978 | Ga0501077_0330141 | |||
| 1979 | Ga0501077_0365347 | |||
| 1980 | Ga0501079_0000073 | |||
| 1981 | Ga0501079_0002007 | |||
| 1982 | Ga0501079_0006208 | |||
| 1983 | Ga0501079_0011791 | |||
| 1984 | Ga0501079_0072200 | |||
| 1985 | Ga0501079_0187710 | |||
| 1986 | Ga0501079_0258341 | |||
| 1987 | Ga0501079_0361955 | |||
| 1988 | Ga0501079_0392095 | |||
| 1989 | Ga0501079_0457609 | |||
| 1990 | Ga0501079_1314479 | |||
| 1991 | Ga0501080_0002888 | |||
| 1992 | Ga0501080_0232927 | |||
| 1993 | Ga0501080_0495666 | |||
| 1994 | Ga0501080_0885878 | |||
| 1995 | Ga0501080_1128017 | |||
| 1996 | Ga0501081_0002889 | |||
| 1997 | Ga0501081_0003129 | |||
| 1998 | Ga0501081_0004583 | |||
| 1999 | Ga0501081_0028873 | |||
| 2000 | Ga0501081_0064174 | |||
| 2001 | Ga0501081_0094218 | |||
| 2002 | Ga0501081_0723766 | |||
| 2003 | Ga0501081_1333370 | |||
| 2004 | Ga0501083_0025933 | |||
| 2005 | Ga0501083_0058477 | |||
| 2006 | Ga0501083_0210413 | |||
| 2007 | Ga0501083_0355188 | |||
| 2008 | Ga0501083_1090894 | |||
| 2009 | Ga0501035_0095166 | |||
| 2010 | Ga0501035_0099126 | |||
| 2011 | Ga0501035_0565375 | |||
| 2012 | Ga0501035_0725352 | |||
| 2013 | Ga0501035_1371899 | |||
| 2014 | Ga0501044_0451384 | |||
| 2015 | Ga0501045_0000048 | |||
| 2016 | Ga0501045_0000434 | |||
| 2017 | Ga0501045_0007968 | |||
| 2018 | Ga0501045_0061573 | |||
| 2019 | Ga0501045_0067231 | |||
| 2020 | Ga0501045_0104220 | |||
| 2021 | Ga0501045_0609476 | |||
| 2022 | Ga0501045_0791164 | |||
| 2023 | Ga0501045_0819532 | |||
| 2024 | nmdc:mga06z11_580052_c1 | |||
| 2025 | nmdc:mga05p37_1064873_c1 | |||
| 2026 | nmdc:mga05p37_1088076_c1 | |||
| 2027 | nmdc:mga05p37_374156_c1 | |||
| 2028 | nmdc:mga05p37_449591_c1 | |||
| 2029 | nmdc:mga05p37_49734_c1 | |||
| 2030 | nmdc:mga05p37_569257_c1 | |||
| 2031 | nmdc:mga05p37_8462_c1 | |||
| 2032 | nmdc:mga09592_49908_c1 | |||
| 2033 | nmdc:mga0qj67_174520_c1 | |||
| 2034 | nmdc:mga0qj67_295_c1 | |||
| 2035 | nmdc:mga06r32_1140832_c1 | |||
| 2036 | nmdc:mga06r32_1154904_c1 | |||
| 2037 | nmdc:mga06r32_1247_c1 | |||
| 2038 | nmdc:mga08y16_12529_c1 | |||
| 2039 | nmdc:mga08y16_319671_c1 | |||
| 2040 | nmdc:mga08y16_543325_c1 | |||
| 2041 | nmdc:mga0n895_288864_c1 | |||
| 2042 | nmdc:mga0n895_39514_c1 | |||
| 2043 | nmdc:mga0rr50_159609_c1 | |||
| 2044 | nmdc:mga0rr50_827858_c1 | |||
| 2045 | nmdc:mga0a205_16265_c1 | |||
| 2046 | nmdc:mga0a205_37915_c1 | |||
| 2047 | nmdc:mga0a205_602940_c1 | |||
| 2048 | Ga0495601_0024048 | |||
| 2049 | Ga0495601_0038120 | |||
| 2050 | Ga0495601_0443824 | |||
| 2051 | Ga0495601_0581936 | |||
| 2052 | Ga0495612_0174145 | |||
| 2053 | Ga0495595_0001385 | |||
| 2054 | Ga0495595_0035794 | |||
| 2055 | Ga0495595_0070628 | |||
| 2056 | Ga0495595_0099427 | |||
| 2057 | Ga0495595_0363622 | |||
| 2058 | Ga0495619_0253539 | |||
| 2059 | Ga0495619_0293265 | |||
| 2060 | Ga0500556_0000824 | |||
| 2061 | Ga0500593_020380 | |||
| 2062 | Ga0500655_001681 | |||
| 2063 | Ga0500559_0000895 | |||
| 2064 | Ga0500568_0000949 | |||
| 2065 | Ga0500573_0353176 | |||
| 2066 | Ga0501084_0000749 | |||
| 2067 | Ga0501084_0004755 | |||
| 2068 | Ga0501084_0008991 | |||
| 2069 | Ga0501084_0020927 | |||
| 2070 | Ga0501084_0062592 | |||
| 2071 | Ga0501084_0069275 | |||
| 2072 | Ga0501084_0101275 | |||
| 2073 | Ga0501084_0133689 | |||
| 2074 | Ga0501084_0177691 | |||
| 2075 | Ga0501084_0202701 | |||
| 2076 | Ga0590071_014859 | |||
| 2077 | Ga0590075_002541 | |||
| 2078 | Ga0590075_026523 | |||
| 2079 | Ga0590077_001473 | |||
| 2080 | Ga0587066_179600 | |||
| 2081 | Ga0587073_0059223 | |||
| 2082 | Ga0587082_019378 | |||
| 2083 | Ga0587083_0024509 | |||
| 2084 | Ga0587088_072459 | |||
| 2085 | Ga0587091_031210 | |||
| 2086 | Ga0587067_164094 | |||
| 2087 | Ga0587068_139426 | |||
| 2088 | Ga0587078_067256 | |||
| 2089 | Ga0501082_0001748 | |||
| 2090 | Ga0501082_0013186 | |||
| 2091 | Ga0501082_0027497 | |||
| 2092 | Ga0501082_0027617 | |||
| 2093 | Ga0501082_0029421 | |||
| 2094 | Ga0501082_0037371 | |||
| 2095 | Ga0501082_0052144 | |||
| 2096 | Ga0501082_0095896 | |||
| 2097 | Ga0501082_0390525 | |||
| 2098 | Ga0501082_0850471 | |||
| 2099 | Ga0501082_1205231 | |||
| 2100 | Ga0501082_1473474 | |||
| 2101 | Ga0530510_0000831 | |||
| 2102 | Ga0530510_0001043 | |||
| 2103 | Ga0530510_0013188 | |||
| 2104 | Ga0530510_0020463 | |||
| 2105 | Ga0530510_0140204 | |||
| 2106 | Ga0530510_0203241 | |||
| 2107 | Ga0530510_0250049 | |||
| 2108 | Ga0530510_0294442 | |||
| 2109 | Ga0530510_0317113 | |||
| 2110 | Ga0530510_0482346 | |||
| 2111 | Ga0530510_0599672 | |||
| 2112 | 8054108748 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1th8-assembly1.cif.gz_B | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii | 0.881 | 5 | 115 |
| 4hyl-assembly1.cif.gz_A | the crystal structure of an anti-sigma-factor antagonist from haliangium ochraceum dsm 14365 | 0.8655 | 5 | 118 |
| 3if5-assembly1.cif.gz_A-2 | crystal structure analysis of mglu | 0.8627 | 9 | 83 |
| 4qtp-assembly3.cif.gz_C | crystal structure of an anti-sigma factor antagonist from mycobacterium paratuberculosis | 0.8626 | 5 | 118 |
| 6m36-assembly1.cif.gz_F | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.8618 | 5 | 103 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0N7KGR6_2_88_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9095 | 47 | 115 | 3.30.750.24 |
| af_Q80ZD3_447_566_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8831 | 6 | 119 | 3.30.750.24 |
| af_B0V3V8_450_565_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8818 | 6 | 119 | 3.30.750.24 |
| af_P53273_654_785_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8762 | 15 | 114 | 3.30.750.24 |
| af_P60070_1_106_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.8672 | 5 | 109 | 3.30.750.24 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535FFH2-F1-model_v4 | Anti-sigma factor antagonist | 1.001 | 9 | 115 |
GO:0043856
|
| AF-A0A7V8Z3R9-F1-model_v4 | Anti-sigma factor antagonist | 0.9983 | 9 | 115 |
GO:0043856
|
| AF-A0A3A0ANW7-F1-model_v4 | Anti-sigma factor antagonist | 0.9946 | 1 | 119 |
GO:0043856
|
| AF-A0A3A0ANW7-F1-model_v4 | Anti-sigma factor antagonist | 0.9863 | 1 | 119 |
GO:0043856
|
| AF-A0A1F8NU66-F1-model_v4 | Anti-sigma factor antagonist | 0.9776 | 1 | 117 |
GO:0016020
GO:0043856 |