F489604

General Info

Members Datasets Scaffolds Average Seq Length
1077 454 1053 77

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0153792|Ga0436363_0153792_577_834
Length 85
Sequence MPMAASEIEAAIVAALPGAVVTITDLAGDGDHYRAHVVAAGFAGLSRVKQHQLVYNALSGRMGGVLHALQLTTAVPGTAPEGVSA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
4 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
5 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
6 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
7 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
8 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
9 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
10 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
11 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
12 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
13 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
14 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
15 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
16 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
17 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
18 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
19 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
20 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
21 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
22 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
23 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
24 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
25 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
26 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
27 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
28 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
29 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
30 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
31 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
32 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
33 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
34 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
35 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
36 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
37 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
38 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
39 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
40 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
41 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
42 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
43 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
44 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
45 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
46 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
47 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
48 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
49 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
50 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
51 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
52 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
53 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
54 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
55 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
56 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
57 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
58 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
59 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
60 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
61 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
62 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
63 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
64 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
65 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
66 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
67 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
68 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
69 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
70 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
71 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
72 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
73 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
74 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
75 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
76 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
77 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
78 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
79 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
80 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
81 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
82 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
83 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
84 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
85 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
86 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
87 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
108 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
118 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
142 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
143 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
144 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
151 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
152 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
155 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
156 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
158 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
159 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
165 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
167 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
170 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
230 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
231 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
232 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
233 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
237 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
238 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
239 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
240 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
245 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
246 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
247 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
248 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
249 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
251 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
256 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
257 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
258 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
261 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
262 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
263 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
264 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
265 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
266 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
267 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
268 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
269 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
270 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
271 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
272 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
273 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
274 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
275 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
276 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
277 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
278 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
279 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
280 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
281 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
282 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
283 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
284 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
285 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
286 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
287 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
288 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
289 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
290 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
291 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
292 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
293 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
294 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
295 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
296 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
297 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
298 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
299 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
300 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
301 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
302 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
303 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
304 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
305 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
306 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
307 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
308 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
309 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
310 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
311 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
312 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
313 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
314 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
315 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
316 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
317 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
318 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
319 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
320 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
321 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
322 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
323 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
324 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
325 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
335 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
336 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
337 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
338 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
339 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
340 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
341 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
342 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
343 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
344 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
345 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
346 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
347 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
348 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
349 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
350 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
351 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
352 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
353 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
354 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
355 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
356 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
357 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
358 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
359 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
374 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
375 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
376 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
377 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
378 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
379 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
380 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
381 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
382 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
383 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
384 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
385 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
386 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
387 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
388 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
389 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
390 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
391 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
392 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
393 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
394 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
395 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
396 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
397 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
398 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
399 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
400 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
401 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
402 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
403 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
406 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
407 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
408 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
409 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
410 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
411 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
412 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
413 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
414 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
415 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
416 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
417 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
418 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
419 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
420 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
421 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
422 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
423 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
424 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
425 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
426 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
427 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
428 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
429 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
430 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
431 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
432 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
433 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
434 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
435 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
436 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
437 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
438 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
439 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
440 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
441 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
442 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
443 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
444 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
445 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
446 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
447 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
454 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.47
Metatranscriptomes 1.3
Isolates 2.23

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 11.88
Nodule 0
Rhizoplane 4.92
Rhizosphere 71.49
Stem 0
Stem Tuber 0
Unclassified 11.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_14491 2162886007 Bacteria 5668
2 ARcpr5yngRDRAFT_c004470 3300000043 Bacteria 1323
3 ARCol0yngRDRAFT_1009092 3300000652 Bacteria 718
4 JGI24736J21556_1000613 3300001904 Bacteria 6542
5 JGI24741J21665_1000366 3300001915 Bacteria 13487
6 JGI24752J21851_1006793 3300001976 Bacteria 1495
7 JGI24740J21852_10005104 3300001979 Bacteria 5575
8 JGI24740J21852_10044246 3300001979 Bacteria 1322
9 JGI24739J22299_10005319 3300001989 Bacteria 4903
10 JGI24739J22299_10006470 3300001989 Bacteria 4419
11 JGI24739J22299_10110044 3300001989 Bacteria 827
12 JGI24739J22299_10112626 3300001989 Bacteria 816
13 JGI24739J22299_10159140 3300001989 Bacteria 667
14 JGI24737J22298_10015406 3300001990 Bacteria 2474
15 JGI24737J22298_10020406 3300001990 Bacteria 2115
16 JGI24737J22298_10048588 3300001990 Bacteria 1291
17 JGI24737J22298_10132662 3300001990 Bacteria 736
18 JGI24737J22298_10186610 3300001990 Bacteria 612
19 JGI24743J22301_10030394 3300001991 Bacteria 1062
20 JGI24743J22301_10113531 3300001991 Bacteria 590
21 JGI24735J21928_10000590 3300002067 Bacteria 12771
22 JGI24735J21928_10004614 3300002067 Bacteria 4616
23 JGI24735J21928_10004932 3300002067 Bacteria 4449
24 JGI24735J21928_10015755 3300002067 Bacteria 2353
25 JGI24735J21928_10018807 3300002067 Bacteria 2128
26 JGI24735J21928_10041906 3300002067 Bacteria 1334
27 JGI24735J21928_10058528 3300002067 Bacteria 1109
28 JGI24735J21928_10059101 3300002067 Bacteria 1102
29 JGI24735J21928_10135297 3300002067 Bacteria 711
30 JGI24735J21928_10202768 3300002067 Bacteria 575
31 JGI24748J21848_1005228 3300002074 Bacteria 1502
32 JGI24748J21848_1057374 3300002074 Bacteria 516
33 JGI24738J21930_10000184 3300002075 Bacteria 16152
34 JGI24738J21930_10000231 3300002075 Bacteria 15154
35 JGI24738J21930_10001740 3300002075 Bacteria 5944
36 JGI24738J21930_10015275 3300002075 Bacteria 1636
37 JGI24749J21850_1000049 3300002076 Bacteria 22639
38 JGI24744J21845_10008674 3300002077 Bacteria 2089
39 JGI24035J26624_1026616 3300002126 Bacteria 622
40 JGI24034J26672_10003845 3300002239 Bacteria 2109
41 JGI24034J26672_10041405 3300002239 Bacteria 774
42 JGI24751J29686_10000216 3300002459 Bacteria 24503
43 JGI24751J29686_10018164 3300002459 Bacteria 1454
44 JGI25164J39214_1007846 3300002772 Bacteria 1076
45 JGI25150J39212_1002047 3300002774 Bacteria 5243
46 JGI25151J46595_10122326 3300003187 Bacteria 661
47 JGI25165J46597_1000043 3300003214 Bacteria 264515
48 JGI25153J46596_10000395 3300003215 Bacteria 29365
49 JGI25153J46596_10002504 3300003215 Bacteria 10546
50 rootH1_10113314 3300003316 Bacteria 1254
51 rootH1_10035136 3300003323 Bacteria 3354
52 Ga0055529_1042867 3300003763 Bacteria 546
53 Ga0055537_1001019 3300003773 Bacteria 12668
54 Ga0055524_1000056 3300003775 Bacteria 141764
55 Ga0055528_1020848 3300003790 Bacteria 2108
56 Ga0055530_10000931 3300003791 Bacteria 23980
57 Ga0055530_10007314 3300003791 Bacteria 4682
58 Ga0055540_1002064 3300003792 Bacteria 11085
59 Ga0055531_10012617 3300003794 Bacteria 3963
60 Ga0055531_10015017 3300003794 Bacteria 3443
61 Ga0065165_1005029 3300005262 Bacteria 7727
62 Ga0065165_1009273 3300005262 Bacteria 4438
63 Ga0065165_1017463 3300005262 Bacteria 2643
64 Ga0065165_1062777 3300005262 Bacteria 1012
65 Ga0065714_10116065 3300005288 Bacteria 1408
66 Ga0065704_10070504 3300005289 Bacteria 22276
67 Ga0065707_10000505 3300005295 Bacteria 50569
68 Ga0065707_10086198 3300005295 Bacteria 5602
69 Ga0065707_10135500 3300005295 Bacteria 1848
70 Ga0065707_10212812 3300005295 Bacteria 1258
71 Ga0065707_10371722 3300005295 Bacteria 889
72 Ga0065707_10414622 3300005295 Bacteria 837
73 Ga0065707_10938111 3300005295 Bacteria 556
74 Ga0070658_10006525 3300005327 Bacteria 9464
75 Ga0070658_10068992 3300005327 Bacteria 2891
76 Ga0070658_10097157 3300005327 Bacteria 2432
77 Ga0070658_10584581 3300005327 Bacteria 967
78 Ga0070658_10669238 3300005327 Bacteria 901
79 Ga0070658_11102012 3300005327 Bacteria 691
80 Ga0070676_10000230 3300005328 Bacteria 23872
81 Ga0070683_100195033 3300005329 Bacteria 1923
82 Ga0070670_100000003 3300005331 Bacteria 529510
83 Ga0070670_100002377 3300005331 Bacteria 15504
84 Ga0070670_100004170 3300005331 Bacteria 12090
85 Ga0070670_100126344 3300005331 Bacteria 2207
86 Ga0070670_100189232 3300005331 Bacteria 1787
87 Ga0070677_10801344 3300005333 Bacteria 538
88 Ga0068869_100000200 3300005334 Bacteria 31213
89 Ga0070666_10000184 3300005335 Bacteria 42807
90 Ga0070666_10033483 3300005335 Bacteria 3400
91 Ga0070666_10257671 3300005335 Bacteria 1236
92 Ga0070682_100302630 3300005337 Bacteria 1174
93 Ga0068868_100001398 3300005338 Bacteria 16647
94 Ga0070660_100004583 3300005339 Bacteria 9552
95 Ga0070660_100070534 3300005339 Bacteria 2727
96 Ga0070660_100209408 3300005339 Bacteria 1582
97 Ga0070660_100996905 3300005339 Bacteria 708
98 Ga0070661_100581848 3300005344 Bacteria 903
99 Ga0070661_101005335 3300005344 Bacteria 692
100 Ga0070668_100000026 3300005347 Bacteria 92584
101 Ga0070668_100000080 3300005347 Bacteria 60157
102 Ga0070668_100018364 3300005347 Bacteria 5250
103 Ga0070668_100027483 3300005347 Bacteria 4320
104 Ga0070668_100208292 3300005347 Bacteria 1607
105 Ga0070668_100408180 3300005347 Bacteria 1161
106 Ga0070668_100428915 3300005347 Bacteria 1133
107 Ga0070669_100000008 3300005353 Bacteria 226764
108 Ga0070669_100000020 3300005353 Bacteria 181297
109 Ga0070669_100000082 3300005353 Bacteria 91465
110 Ga0070669_100096603 3300005353 Bacteria 2223
111 Ga0070675_100006627 3300005354 Bacteria 8902
112 Ga0070671_100000015 3300005355 Bacteria 166132
113 Ga0070671_100000169 3300005355 Bacteria 43010
114 Ga0070671_100000470 3300005355 Bacteria 28105
115 Ga0070671_100013092 3300005355 Bacteria 6684
116 Ga0070671_100053502 3300005355 Bacteria 3356
117 Ga0070674_100051002 3300005356 Bacteria 2849
118 Ga0070673_100000006 3300005364 Bacteria 184299
119 Ga0070673_101154028 3300005364 Bacteria 725
120 Ga0070688_100464942 3300005365 Bacteria 948
121 Ga0070659_100052995 3300005366 Bacteria 3192
122 Ga0070659_100899434 3300005366 Bacteria 774
123 Ga0070659_101485301 3300005366 Bacteria 604
124 Ga0070659_101711550 3300005366 Bacteria 562
125 Ga0070667_100000019 3300005367 Bacteria 224710
126 Ga0070667_100006367 3300005367 Bacteria 9810
127 Ga0070667_100037194 3300005367 Bacteria 4081
128 Ga0070667_100038717 3300005367 Bacteria 3998
129 Ga0070667_100681738 3300005367 Bacteria 950
130 Ga0070705_100054779 3300005440 Bacteria 2341
131 Ga0070705_100448402 3300005440 Bacteria 967
132 Ga0070708_100198374 3300005445 Bacteria 1878
133 Ga0070708_101344162 3300005445 Bacteria 667
134 Ga0070663_100000574 3300005455 Bacteria 19656
135 Ga0070663_100002941 3300005455 Bacteria 9696
136 Ga0070663_101387399 3300005455 Bacteria 622
137 Ga0070678_100552397 3300005456 Bacteria 1022
138 Ga0070662_100007108 3300005457 Bacteria 7246
139 Ga0070662_100094062 3300005457 Bacteria 2256
140 Ga0070662_100561610 3300005457 Bacteria 957
141 Ga0070662_100819864 3300005457 Bacteria 791
142 Ga0070662_101003480 3300005457 Bacteria 715
143 Ga0068867_100000001 3300005459 Bacteria 427563
144 Ga0070685_10103920 3300005466 Bacteria 1739
145 Ga0070685_10368722 3300005466 Bacteria 986
146 Ga0070707_101322160 3300005468 Bacteria 687
147 Ga0070679_100158874 3300005530 Bacteria 2235
148 Ga0070679_100424436 3300005530 Bacteria 1275
149 Ga0070684_100251597 3300005535 Bacteria 1615
150 Ga0068853_100143479 3300005539 Bacteria 2145
151 Ga0068853_100881719 3300005539 Bacteria 859
152 Ga0068853_100884100 3300005539 Bacteria 858
153 Ga0068853_102321716 3300005539 Bacteria 520
154 Ga0070672_100004199 3300005543 Bacteria 9412
155 Ga0070686_100290882 3300005544 Bacteria 1208
156 Ga0070665_100002434 3300005548 Bacteria 20520
157 Ga0070665_100009702 3300005548 Bacteria 9728
158 Ga0070665_100095381 3300005548 Bacteria 2980
159 Ga0070665_100378831 3300005548 Bacteria 1422
160 Ga0070665_100420653 3300005548 Bacteria 1345
161 Ga0070665_100895973 3300005548 Bacteria 900
162 Ga0070665_101432299 3300005548 Bacteria 700
163 Ga0068855_100218364 3300005563 Bacteria 2139
164 Ga0068855_100577260 3300005563 Bacteria 1215
165 Ga0068855_101048138 3300005563 Bacteria 855
166 Ga0068855_101587902 3300005563 Bacteria 670
167 Ga0068855_102121698 3300005563 Bacteria 566
168 Ga0068857_100021366 3300005577 Bacteria 5697
169 Ga0068857_100637109 3300005577 Bacteria 1009
170 Ga0068857_100711507 3300005577 Bacteria 955
171 Ga0068854_100000483 3300005578 Bacteria 24310
172 Ga0068854_100301862 3300005578 Bacteria 1296
173 Ga0068854_100538554 3300005578 Bacteria 988
174 Ga0068854_101277453 3300005578 Bacteria 660
175 Ga0068856_100003591 3300005614 Bacteria 15606
176 Ga0068856_100020542 3300005614 Bacteria 6414
177 Ga0068856_100312622 3300005614 Bacteria 1589
178 Ga0068852_100028295 3300005616 Bacteria 4585
179 Ga0068852_100608851 3300005616 Bacteria 1097
180 Ga0068852_101516957 3300005616 Bacteria 692
181 Ga0068859_100003505 3300005617 Bacteria 15985
182 Ga0068859_100023533 3300005617 Bacteria 6181
183 Ga0068859_100034581 3300005617 Bacteria 5071
184 Ga0068859_100216629 3300005617 Bacteria 2002
185 Ga0068859_100679313 3300005617 Bacteria 1121
186 Ga0068859_100859376 3300005617 Bacteria 993
187 Ga0068864_100000005 3300005618 Bacteria 400840
188 Ga0068864_100030140 3300005618 Bacteria 4598
189 Ga0068864_100466728 3300005618 Bacteria 1210
190 Ga0068861_100004980 3300005719 Bacteria 8951
191 Ga0068861_100154977 3300005719 Bacteria 1883
192 Ga0068851_10074177 3300005834 Bacteria 1765
193 Ga0068863_100000001 3300005841 Bacteria 581116
194 Ga0068863_100000582 3300005841 Bacteria 37202
195 Ga0068863_100067996 3300005841 Bacteria 3370
196 Ga0068863_100084694 3300005841 Bacteria 3004
197 Ga0068863_100137511 3300005841 Bacteria 2334
198 Ga0068863_100313791 3300005841 Bacteria 1522
199 Ga0068858_100010355 3300005842 Bacteria 8831
200 Ga0068858_100034454 3300005842 Bacteria 4697
201 Ga0068858_100380650 3300005842 Bacteria 1354
202 Ga0068860_100000036 3300005843 Bacteria 234917
203 Ga0068860_100001081 3300005843 Bacteria 30047
204 Ga0068860_100004358 3300005843 Bacteria 14457
205 Ga0068860_100044110 3300005843 Bacteria 4251
206 Ga0068860_100115216 3300005843 Bacteria 2570
207 Ga0068860_100263556 3300005843 Bacteria 1680
208 Ga0068860_100310382 3300005843 Bacteria 1546
209 Ga0068860_102676641 3300005843 Bacteria 517
210 Ga0068862_100000001 3300005844 Bacteria 523031
211 Ga0068862_100000169 3300005844 Bacteria 72633
212 Ga0068862_100001451 3300005844 Bacteria 21840
213 Ga0068862_100006085 3300005844 Bacteria 10046
214 Ga0068862_100021177 3300005844 Bacteria 5435
215 Ga0068862_100049285 3300005844 Bacteria 3597
216 Ga0068862_100087044 3300005844 Bacteria 2717
217 Ga0068862_101234307 3300005844 Bacteria 747
218 Ga0081455_10000255 3300005937 Bacteria 69927
219 Ga0081455_10023602 3300005937 Bacteria 5720
220 Ga0081538_10004148 3300005981 Bacteria 13446
221 Ga0081538_10036760 3300005981 Bacteria 3188
222 Ga0075364_10197055 3300006051 Bacteria 1365
223 Ga0075364_10888517 3300006051 Bacteria 607
224 Ga0075366_10043167 3300006195 Bacteria 2671
225 Ga0075366_10245806 3300006195 Bacteria 1091
226 Ga0075366_10576769 3300006195 Bacteria 697
227 Ga0075366_10726065 3300006195 Bacteria 617
228 Ga0075366_10801680 3300006195 Bacteria 586
229 Ga0097621_100001076 3300006237 Bacteria 19102
230 Ga0075370_10043587 3300006353 Bacteria 2536
231 Ga0075370_10637142 3300006353 Bacteria 647
232 Ga0068871_100067527 3300006358 Bacteria 2934
233 Ga0068871_101210368 3300006358 Bacteria 709
234 Ga0068865_100000003 3300006881 Bacteria 231761
235 Ga0097620_100003505 3300006931 Bacteria 15985
236 Ga0097620_100023532 3300006931 Bacteria 6181
237 Ga0097620_100034580 3300006931 Bacteria 5071
238 Ga0097620_100216626 3300006931 Bacteria 2002
239 Ga0097620_100679134 3300006931 Bacteria 1121
240 Ga0097620_100859461 3300006931 Bacteria 993
241 Ga0105251_10012362 3300009011 Bacteria 4831
242 Ga0105251_10638162 3300009011 Bacteria 508
243 Ga0105244_10606409 3300009036 Bacteria 501
244 Ga0105250_10006517 3300009092 Bacteria 5096
245 Ga0105240_10015679 3300009093 Bacteria 10290
246 Ga0105240_10025126 3300009093 Bacteria 7835
247 Ga0105240_10091793 3300009093 Bacteria 3709
248 Ga0105240_10318721 3300009093 Bacteria 1773
249 Ga0105240_10744819 3300009093 Bacteria 1066
250 Ga0105240_12089073 3300009093 Bacteria 588
251 Ga0105245_10000113 3300009098 Bacteria 78545
252 Ga0105245_10032215 3300009098 Bacteria 4641
253 Ga0105247_10001891 3300009101 Bacteria 14614
254 Ga0105247_10369422 3300009101 Bacteria 1014
255 Ga0105243_10000373 3300009148 Bacteria 48115
256 Ga0105243_10328860 3300009148 Bacteria 1395
257 Ga0105243_10942050 3300009148 Bacteria 862
258 Ga0105241_10038453 3300009174 Bacteria 3607
259 Ga0105241_10707420 3300009174 Bacteria 920
260 Ga0105242_10000165 3300009176 Bacteria 49974
261 Ga0105248_10001558 3300009177 Bacteria 25511
262 Ga0105248_10024425 3300009177 Bacteria 6720
263 Ga0105248_10043233 3300009177 Bacteria 5052
264 Ga0105248_10088281 3300009177 Bacteria 3490
265 Ga0105248_13138180 3300009177 Bacteria 526
266 Ga0105237_10044206 3300009545 Bacteria 4485
267 Ga0105237_11408470 3300009545 Bacteria 703
268 Ga0105237_11679876 3300009545 Bacteria 642
269 Ga0105237_12603792 3300009545 Bacteria 516
270 Ga0105238_10635331 3300009551 Bacteria 1077
271 Ga0105238_11154457 3300009551 Bacteria 798
272 Ga0105238_11442421 3300009551 Bacteria 716
273 Ga0105249_10000045 3300009553 Bacteria 182927
274 Ga0105249_10019753 3300009553 Bacteria 6016
275 Ga0105249_10037409 3300009553 Bacteria 4404
276 Ga0105249_10084345 3300009553 Bacteria 2959
277 Ga0105249_10265973 3300009553 Bacteria 1706
278 Ga0105249_10758182 3300009553 Bacteria 1033
279 Ga0105239_10000367 3300010375 Bacteria 66191
280 Ga0105239_10012172 3300010375 Bacteria 9592
281 Ga0105239_10326543 3300010375 Bacteria 1730
282 Ga0105239_10846266 3300010375 Bacteria 1049
283 Ga0105239_10931845 3300010375 Bacteria 997
284 Ga0105246_10001620 3300011119 Bacteria 13399
285 Ga0157326_1000423 3300012513 Bacteria 5017
286 Ga0157373_10081550 3300013100 Bacteria 2280
287 Ga0157373_10136804 3300013100 Bacteria 1723
288 Ga0157373_10232191 3300013100 Bacteria 1303
289 Ga0157371_10160163 3300013102 Bacteria 1607
290 Ga0157371_10492244 3300013102 Bacteria 905
291 Ga0157371_11482642 3300013102 Bacteria 529
292 Ga0157371_11598663 3300013102 Bacteria 510
293 Ga0157371_11604795 3300013102 Bacteria 509
294 Ga0157370_10000069 3300013104 Bacteria 112889
295 Ga0157370_10057965 3300013104 Bacteria 3681
296 Ga0157370_10174746 3300013104 Bacteria 1996
297 Ga0157370_10214812 3300013104 Bacteria 1782
298 Ga0157370_10647775 3300013104 Bacteria 966
299 Ga0157370_10971235 3300013104 Bacteria 770
300 Ga0157370_11695857 3300013104 Bacteria 567
301 Ga0157369_10012597 3300013105 Bacteria 9595
302 Ga0157369_10109686 3300013105 Bacteria 2934
303 Ga0157369_10173906 3300013105 Bacteria 2268
304 Ga0157369_10174888 3300013105 Bacteria 2260
305 Ga0157369_12006581 3300013105 Bacteria 587
306 Ga0157369_12357748 3300013105 Bacteria 539
307 Ga0157374_10100942 3300013296 Bacteria 2766
308 Ga0157374_10393274 3300013296 Bacteria 1382
309 Ga0157374_10432242 3300013296 Bacteria 1316
310 Ga0157378_10002300 3300013297 Bacteria 16976
311 Ga0163162_10016081 3300013306 Bacteria 7314
312 Ga0163162_10019579 3300013306 Bacteria 6643
313 Ga0163162_10301457 3300013306 Bacteria 1734
314 Ga0163162_12257592 3300013306 Bacteria 625
315 Ga0163162_13217757 3300013306 Bacteria 524
316 Ga0157372_10113522 3300013307 Bacteria 3105
317 Ga0157372_10118609 3300013307 Bacteria 3036
318 Ga0157372_10209575 3300013307 Bacteria 2258
319 Ga0157372_10258817 3300013307 Bacteria 2021
320 Ga0157372_10288298 3300013307 Bacteria 1909
321 Ga0157372_10337590 3300013307 Bacteria 1755
322 Ga0157372_10567943 3300013307 Bacteria 1322
323 Ga0157372_10932088 3300013307 Bacteria 1007
324 Ga0157372_12775511 3300013307 Bacteria 562
325 Ga0157375_10041491 3300013308 Bacteria 4443
326 Ga0157375_10798349 3300013308 Bacteria 1093
327 Ga0163163_10030114 3300014325 Bacteria 5225
328 Ga0157380_10000029 3300014326 Bacteria 98248
329 Ga0157380_10001161 3300014326 Bacteria 17056
330 Ga0157380_10230670 3300014326 Bacteria 1663
331 Ga0157380_12204024 3300014326 Bacteria 615
332 Ga0182008_10307738 3300014497 Bacteria 831
333 Ga0157377_10067056 3300014745 Bacteria 2065
334 Ga0157379_10128162 3300014968 Bacteria 2283
335 Ga0157379_10770590 3300014968 Bacteria 906
336 Ga0157376_10000089 3300014969 Bacteria 69351
337 Ga0163161_10000101 3300017792 Bacteria 81604
338 Ga0163161_10019426 3300017792 Bacteria 4767
339 Ga0163161_10030597 3300017792 Bacteria 3833
340 Ga0163161_10148380 3300017792 Bacteria 1781
341 Ga0163161_11831506 3300017792 Bacteria 540
342 Ga0206356_11727543 3300020070 Bacteria 986
343 Ga0206352_10131959 3300020078 Bacteria 789
344 Ga0213876_10024618 3300021384 Bacteria 3178
345 Ga0213876_10601056 3300021384 Bacteria 585
346 Ga0213875_10009905 3300021388 Bacteria 4804
347 Ga0213875_10524352 3300021388 Bacteria 570
348 Ga0209147_103605 3300025229 Bacteria 2915
349 Ga0207427_101450 3300025231 Bacteria 8548
350 Ga0207425_1000041 3300025245 Bacteria 210441
351 Ga0207425_1015629 3300025245 Bacteria 1699
352 Ga0209026_1004345 3300025250 Bacteria 4244
353 Ga0209148_1000238 3300025254 Bacteria 87836
354 Ga0209148_1001034 3300025254 Bacteria 17391
355 Ga0209129_1002094 3300025258 Bacteria 10228
356 Ga0209233_1000079 3300025261 Bacteria 346944
357 Ga0209233_1073702 3300025261 Bacteria 625
358 Ga0209565_1000008 3300025263 Bacteria 774179
359 Ga0209565_1000134 3300025263 Bacteria 104013
360 Ga0209455_1000952 3300025272 Bacteria 14767
361 Ga0209455_1056735 3300025272 Bacteria 526
362 Ga0209673_1002352 3300025273 Bacteria 13340
363 Ga0209673_1029162 3300025273 Bacteria 1761
364 Ga0209675_1009250 3300025291 Bacteria 3499
365 Ga0209676_1026408 3300025292 Bacteria 1844
366 Ga0209025_1000068 3300025294 Bacteria 294129
367 Ga0209564_1080218 3300025295 Bacteria 640
368 Ga0209758_1000004 3300025297 Bacteria 1375322
369 Ga0209758_1012697 3300025297 Bacteria 4679
370 Ga0209050_1000001 3300025298 Bacteria 3563507
371 Ga0209050_1000581 3300025298 Bacteria 59224
372 Ga0209050_1000687 3300025298 Bacteria 50814
373 Ga0209050_1007158 3300025298 Bacteria 6354
374 Ga0209256_1000009 3300025299 Bacteria 922071
375 Ga0209256_1000010 3300025299 Bacteria 912110
376 Ga0207426_1037675 3300025302 Bacteria 1528
377 Ga0209051_1000191 3300025303 Bacteria 108763
378 Ga0209257_1000876 3300025304 Bacteria 42634
379 Ga0209257_1002353 3300025304 Bacteria 19010
380 Ga0209257_1002898 3300025304 Bacteria 15899
381 Ga0209257_1003401 3300025304 Bacteria 13704
382 Ga0209257_1037487 3300025304 Bacteria 1478
383 Ga0209257_1100855 3300025304 Bacteria 704
384 Ga0207697_10006525 3300025315 Bacteria 5267
385 Ga0207697_10530809 3300025315 Bacteria 518
386 Ga0207656_10012218 3300025321 Bacteria 3260
387 Ga0207656_10159701 3300025321 Bacteria 1072
388 Ga0207696_1007265 3300025711 Bacteria 4353
389 Ga0207713_1010142 3300025735 Bacteria 5236
390 Ga0207713_1036906 3300025735 Bacteria 2090
391 Ga0207710_10007240 3300025900 Bacteria 4701
392 Ga0207710_10012300 3300025900 Bacteria 3601
393 Ga0207710_10207976 3300025900 Bacteria 968
394 Ga0207710_10331102 3300025900 Bacteria 773
395 Ga0207688_10409565 3300025901 Bacteria 842
396 Ga0207688_10846280 3300025901 Bacteria 579
397 Ga0207688_11043763 3300025901 Bacteria 516
398 Ga0207680_10000010 3300025903 Bacteria 414170
399 Ga0207680_10000186 3300025903 Bacteria 30147
400 Ga0207680_10093912 3300025903 Bacteria 1914
401 Ga0207647_10000038 3300025904 Bacteria 94897
402 Ga0207647_10002647 3300025904 Bacteria 13526
403 Ga0207647_10032481 3300025904 Bacteria 3352
404 Ga0207647_10041942 3300025904 Bacteria 2874
405 Ga0207647_10065904 3300025904 Bacteria 2197
406 Ga0207647_10095073 3300025904 Bacteria 1774
407 Ga0207647_10207898 3300025904 Bacteria 1131
408 Ga0207647_10212165 3300025904 Bacteria 1118
409 Ga0207647_10283643 3300025904 Bacteria 945
410 Ga0207647_10393125 3300025904 Bacteria 782
411 Ga0207645_10003616 3300025907 Bacteria 11690
412 Ga0207705_10000121 3300025909 Bacteria 86649
413 Ga0207705_10000365 3300025909 Bacteria 41098
414 Ga0207705_10014470 3300025909 Bacteria 5679
415 Ga0207705_10135124 3300025909 Bacteria 1838
416 Ga0207705_10159690 3300025909 Bacteria 1693
417 Ga0207654_10000375 3300025911 Bacteria 25999
418 Ga0207654_10080510 3300025911 Bacteria 1959
419 Ga0207654_10098883 3300025911 Bacteria 1793
420 Ga0207695_10001183 3300025913 Bacteria 45024
421 Ga0207695_10016421 3300025913 Bacteria 8662
422 Ga0207695_10021724 3300025913 Bacteria 7315
423 Ga0207695_10031555 3300025913 Bacteria 5808
424 Ga0207695_10077775 3300025913 Bacteria 3368
425 Ga0207695_10223979 3300025913 Bacteria 1787
426 Ga0207695_10873246 3300025913 Bacteria 779
427 Ga0207671_10001192 3300025914 Bacteria 30866
428 Ga0207671_10027639 3300025914 Bacteria 4241
429 Ga0207671_11237598 3300025914 Bacteria 583
430 Ga0207671_11279455 3300025914 Bacteria 572
431 Ga0207662_11126671 3300025918 Bacteria 558
432 Ga0207657_10015487 3300025919 Bacteria 7387
433 Ga0207657_10026870 3300025919 Bacteria 5279
434 Ga0207657_10048996 3300025919 Bacteria 3685
435 Ga0207657_10387615 3300025919 Bacteria 1100
436 Ga0207657_11006315 3300025919 Bacteria 639
437 Ga0207649_10150506 3300025920 Bacteria 1602
438 Ga0207649_10167287 3300025920 Bacteria 1528
439 Ga0207649_10831047 3300025920 Bacteria 722
440 Ga0207649_11059835 3300025920 Bacteria 639
441 Ga0207652_10134787 3300025921 Bacteria 2205
442 Ga0207652_10286625 3300025921 Bacteria 1486
443 Ga0207681_10000002 3300025923 Bacteria 985597
444 Ga0207681_10000005 3300025923 Bacteria 555724
445 Ga0207681_10000109 3300025923 Bacteria 71373
446 Ga0207681_10000183 3300025923 Bacteria 51105
447 Ga0207681_10033288 3300025923 Bacteria 3378
448 Ga0207681_10094028 3300025923 Bacteria 2147
449 Ga0207681_10122960 3300025923 Bacteria 1906
450 Ga0207681_10716631 3300025923 Bacteria 832
451 Ga0207694_10002087 3300025924 Bacteria 16502
452 Ga0207694_10091001 3300025924 Bacteria 2408
453 Ga0207694_10345340 3300025924 Bacteria 1231
454 Ga0207694_10637068 3300025924 Bacteria 898
455 Ga0207694_10801093 3300025924 Bacteria 796
456 Ga0207650_10000004 3300025925 Bacteria 743372
457 Ga0207650_10002904 3300025925 Bacteria 11832
458 Ga0207650_10006404 3300025925 Bacteria 8018
459 Ga0207650_10049447 3300025925 Bacteria 3105
460 Ga0207650_10174974 3300025925 Bacteria 1708
461 Ga0207659_10136023 3300025926 Bacteria 1902
462 Ga0207687_10000225 3300025927 Bacteria 38523
463 Ga0207687_10010076 3300025927 Bacteria 6180
464 Ga0207644_10000002 3300025931 Bacteria 942221
465 Ga0207644_10000012 3300025931 Bacteria 186652
466 Ga0207644_10000067 3300025931 Bacteria 76116
467 Ga0207644_10001857 3300025931 Bacteria 13746
468 Ga0207644_10022749 3300025931 Bacteria 4285
469 Ga0207644_10700505 3300025931 Bacteria 844
470 Ga0207690_10157914 3300025932 Bacteria 1688
471 Ga0207690_10186911 3300025932 Bacteria 1564
472 Ga0207690_10337182 3300025932 Bacteria 1189
473 Ga0207690_10342161 3300025932 Bacteria 1181
474 Ga0207690_10356195 3300025932 Bacteria 1158
475 Ga0207690_10878067 3300025932 Bacteria 743
476 Ga0207706_10008805 3300025933 Bacteria 9291
477 Ga0207706_10033279 3300025933 Bacteria 4590
478 Ga0207706_10083285 3300025933 Bacteria 2812
479 Ga0207706_10138164 3300025933 Bacteria 2144
480 Ga0207706_10198802 3300025933 Bacteria 1758
481 Ga0207706_11217586 3300025933 Bacteria 625
482 Ga0207686_10001878 3300025934 Bacteria 11648
483 Ga0207709_10000173 3300025935 Bacteria 86350
484 Ga0207709_10088718 3300025935 Bacteria 2014
485 Ga0207709_11210901 3300025935 Bacteria 622
486 Ga0207669_10046739 3300025937 Bacteria 2560
487 Ga0207669_11000337 3300025937 Bacteria 703
488 Ga0207704_10000001 3300025938 Bacteria 716296
489 Ga0207691_10009162 3300025940 Bacteria 9499
490 Ga0207711_10000075 3300025941 Bacteria 106870
491 Ga0207711_10024088 3300025941 Bacteria 5096
492 Ga0207711_10114106 3300025941 Bacteria 2406
493 Ga0207711_10236570 3300025941 Bacteria 1674
494 Ga0207711_11362142 3300025941 Bacteria 652
495 Ga0207689_10000744 3300025942 Bacteria 31242
496 Ga0207689_11445008 3300025942 Bacteria 575
497 Ga0207661_10482382 3300025944 Bacteria 1132
498 Ga0207661_11506624 3300025944 Bacteria 616
499 Ga0207679_10123611 3300025945 Bacteria 2064
500 Ga0207679_10140360 3300025945 Bacteria 1952
501 Ga0207667_10000016 3300025949 Bacteria 391466
502 Ga0207667_10011748 3300025949 Bacteria 10154
503 Ga0207667_10112317 3300025949 Bacteria 2810
504 Ga0207667_10498960 3300025949 Bacteria 1235
505 Ga0207667_10638165 3300025949 Bacteria 1071
506 Ga0207651_10000002 3300025960 Bacteria 427663
507 Ga0207651_11013347 3300025960 Bacteria 742
508 Ga0207712_10000014 3300025961 Bacteria 375393
509 Ga0207712_10000174 3300025961 Bacteria 66500
510 Ga0207712_10018137 3300025961 Bacteria 4580
511 Ga0207712_10057696 3300025961 Bacteria 2740
512 Ga0207712_10092123 3300025961 Bacteria 2234
513 Ga0207712_10657395 3300025961 Bacteria 911
514 Ga0207712_11277392 3300025961 Bacteria 656
515 Ga0207712_11688390 3300025961 Bacteria 568
516 Ga0207668_10000081 3300025972 Bacteria 72145
517 Ga0207668_10000304 3300025972 Bacteria 32235
518 Ga0207668_10005340 3300025972 Bacteria 7558
519 Ga0207668_10083673 3300025972 Bacteria 2322
520 Ga0207668_10085277 3300025972 Bacteria 2304
521 Ga0207668_10328540 3300025972 Bacteria 1271
522 Ga0207668_10484314 3300025972 Bacteria 1061
523 Ga0207640_10000063 3300025981 Bacteria 87065
524 Ga0207640_10031448 3300025981 Bacteria 3280
525 Ga0207640_10062003 3300025981 Bacteria 2479
526 Ga0207640_10100271 3300025981 Bacteria 2029
527 Ga0207640_10157229 3300025981 Bacteria 1677
528 Ga0207640_11027507 3300025981 Bacteria 726
529 Ga0207640_11246724 3300025981 Bacteria 662
530 Ga0207640_11397633 3300025981 Bacteria 627
531 Ga0207658_10000002 3300025986 Bacteria 1364188
532 Ga0207658_10001566 3300025986 Bacteria 17731
533 Ga0207658_10004095 3300025986 Bacteria 10169
534 Ga0207658_10008782 3300025986 Bacteria 6860
535 Ga0207658_10018656 3300025986 Bacteria 4795
536 Ga0207658_10819713 3300025986 Bacteria 845
537 Ga0207677_10000030 3300026023 Bacteria 120692
538 Ga0207703_10005351 3300026035 Bacteria 10337
539 Ga0207703_10008030 3300026035 Bacteria 8339
540 Ga0207703_10009134 3300026035 Bacteria 7806
541 Ga0207703_10124179 3300026035 Bacteria 2220
542 Ga0207639_10000213 3300026041 Bacteria 43227
543 Ga0207639_10012302 3300026041 Bacteria 5959
544 Ga0207639_10036850 3300026041 Bacteria 3628
545 Ga0207639_10122498 3300026041 Bacteria 2139
546 Ga0207639_10602963 3300026041 Bacteria 1013
547 Ga0207639_10828173 3300026041 Bacteria 863
548 Ga0207678_10000857 3300026067 Bacteria 27922
549 Ga0207678_10001793 3300026067 Bacteria 19669
550 Ga0207678_10088208 3300026067 Bacteria 2651
551 Ga0207702_10000887 3300026078 Bacteria 31141
552 Ga0207702_10002945 3300026078 Bacteria 15895
553 Ga0207702_10019109 3300026078 Bacteria 5670
554 Ga0207641_10000001 3300026088 Bacteria 1180841
555 Ga0207641_10000099 3300026088 Bacteria 122892
556 Ga0207641_10002512 3300026088 Bacteria 16895
557 Ga0207641_10004505 3300026088 Bacteria 12048
558 Ga0207641_10013693 3300026088 Bacteria 6656
559 Ga0207641_10014410 3300026088 Bacteria 6478
560 Ga0207641_11282650 3300026088 Bacteria 733
561 Ga0207648_10000001 3300026089 Bacteria 427499
562 Ga0207676_10000006 3300026095 Bacteria 681936
563 Ga0207676_10000770 3300026095 Bacteria 25065
564 Ga0207676_10022559 3300026095 Bacteria 4630
565 Ga0207674_10131652 3300026116 Bacteria 2464
566 Ga0207674_10300559 3300026116 Bacteria 1554
567 Ga0207674_10337148 3300026116 Bacteria 1458
568 Ga0207674_11129632 3300026116 Bacteria 753
569 Ga0207674_11201849 3300026116 Bacteria 728
570 Ga0207675_100000358 3300026118 Bacteria 43765
571 Ga0207675_100001138 3300026118 Bacteria 26336
572 Ga0207675_100230090 3300026118 Bacteria 1788
573 Ga0207683_10182888 3300026121 Bacteria 1901
574 Ga0207698_10034383 3300026142 Bacteria 3694
575 Ga0207698_10130218 3300026142 Bacteria 2148
576 Ga0207698_10201601 3300026142 Bacteria 1782
577 Ga0207698_10955811 3300026142 Bacteria 866
578 Ga0207698_12752071 3300026142 Bacteria 500
579 Ga0209371_1085272 3300027312 Bacteria 539
580 Ga0209813_10000051 3300027866 Bacteria 47545
581 Ga0268266_10000009 3300028379 Bacteria 1097737
582 Ga0268266_10002003 3300028379 Bacteria 22767
583 Ga0268266_10006189 3300028379 Bacteria 10993
584 Ga0268266_10158947 3300028379 Bacteria 2043
585 Ga0268266_10211526 3300028379 Bacteria 1779
586 Ga0268266_10315170 3300028379 Bacteria 1462
587 Ga0268266_10422983 3300028379 Bacteria 1263
588 Ga0268266_11019591 3300028379 Bacteria 801
589 Ga0268266_11411114 3300028379 Bacteria 672
590 Ga0268265_10000001 3300028380 Bacteria 1230727
591 Ga0268265_10000045 3300028380 Bacteria 180378
592 Ga0268265_10000047 3300028380 Bacteria 179354
593 Ga0268265_10000285 3300028380 Bacteria 57084
594 Ga0268265_10004726 3300028380 Bacteria 9397
595 Ga0268265_10017233 3300028380 Bacteria 4981
596 Ga0268265_10146980 3300028380 Bacteria 1982
597 Ga0268265_10315643 3300028380 Bacteria 1413
598 Ga0268265_10387566 3300028380 Bacteria 1287
599 Ga0268265_11127984 3300028380 Bacteria 779
600 Ga0268264_10000001 3300028381 Bacteria 1221000
601 Ga0268264_10000010 3300028381 Bacteria 596543
602 Ga0268264_10000023 3300028381 Bacteria 471408
603 Ga0268264_10004259 3300028381 Bacteria 12215
604 Ga0268264_10012572 3300028381 Bacteria 6971
605 Ga0268264_10105564 3300028381 Bacteria 2457
606 Ga0268264_10209613 3300028381 Bacteria 1788
607 Ga0268264_10405038 3300028381 Bacteria 1312
608 Ga0307517_10633740 3300028786 Bacteria 522
609 Ga0268256_1046229 3300030500 Bacteria 944
610 Ga0314311_1203820 3300030733 Bacteria 1025
611 Ga0265320_10000034 3300031240 Bacteria 141117
612 Ga0265325_10023456 3300031241 Bacteria 3367
613 Ga0265325_10037185 3300031241 Bacteria 2574
614 Ga0307513_10209984 3300031456 Bacteria 1779
615 Ga0307408_100051500 3300031548 Bacteria 2965
616 Ga0307408_101128429 3300031548 Bacteria 728
617 Ga0307408_101389987 3300031548 Bacteria 661
618 Ga0265313_10000665 3300031595 Bacteria 35397
619 Ga0265314_10019631 3300031711 Bacteria 5232
620 Ga0265314_10042189 3300031711 Bacteria 3258
621 Ga0265314_10118950 3300031711 Bacteria 1666
622 Ga0307405_10055116 3300031731 Bacteria 2486
623 Ga0307405_10530365 3300031731 Bacteria 949
624 Ga0307405_10949213 3300031731 Bacteria 730
625 Ga0307405_11486235 3300031731 Bacteria 595
626 Ga0307413_10332327 3300031824 Bacteria 1165
627 Ga0307413_11513892 3300031824 Bacteria 593
628 Ga0307410_10027090 3300031852 Bacteria 3618
629 Ga0307410_11135650 3300031852 Bacteria 679
630 Ga0307406_10589289 3300031901 Bacteria 915
631 Ga0307406_10614399 3300031901 Bacteria 898
632 Ga0307406_10706803 3300031901 Bacteria 842
633 Ga0307406_11005598 3300031901 Bacteria 715
634 Ga0307406_11917748 3300031901 Bacteria 528
635 Ga0307407_10257420 3300031903 Bacteria 1199
636 Ga0307412_10015626 3300031911 Bacteria 4506
637 Ga0307412_10514991 3300031911 Bacteria 998
638 Ga0307412_10947513 3300031911 Bacteria 757
639 Ga0307412_11429176 3300031911 Bacteria 627
640 Ga0307409_101359966 3300031995 Bacteria 736
641 Ga0307409_102980818 3300031995 Bacteria 500
642 Ga0307416_100014919 3300032002 Bacteria 5345
643 Ga0307414_11712720 3300032004 Bacteria 586
644 Ga0307414_11795155 3300032004 Bacteria 572
645 Ga0307411_10271081 3300032005 Bacteria 1346
646 Ga0307411_10440296 3300032005 Bacteria 1087
647 Ga0307411_12160541 3300032005 Bacteria 521
648 Ga0307510_10148726 3300033180 Bacteria 1967
649 Ga0373923_0143888 3300035111 Bacteria 1079
650 Ga0373946_0647350 3300035171 Bacteria 550
651 Ga0395899_0001521 3300037312 Bacteria 19608
652 Ga0395900_0009291 3300037418 Bacteria 10081
653 Ga0395900_1114422 3300037418 Bacteria 706
654 Ga0395898_1303005 3300037466 Bacteria 656
655 Ga0395905_0026896 3300037471 Bacteria 5426
656 Ga0395905_0516629 3300037471 Bacteria 1095
657 Ga0436364_0741438 3300037853 Bacteria 779
658 Ga0436364_0878110 3300037853 Bacteria 2836
659 Ga0395901_0073008 3300038443 Bacteria 3578
660 Ga0395901_2127733 3300038443 Bacteria 506
661 Ga0436365_0212007 3300039437 Bacteria 1166
662 Ga0436365_0922307 3300039437 Bacteria 725
663 Ga0436365_1667312 3300039437 Bacteria 780
664 Ga0436365_1773361 3300039437 Bacteria 6729
665 Ga0436361_1051839 3300039447 Bacteria 1442
666 Ga0436363_0153792 3300039450 Bacteria 1691
667 Ga0439436_0009694 3300041404 Bacteria 2950
668 Ga0439439_0001779 3300041406 Bacteria 4402
669 Ga0439447_148918 3300041407 Bacteria 538
670 Ga0439461_0000498 3300041410 Bacteria 5666
671 Ga0439461_0003679 3300041410 Bacteria 2530
672 Ga0439461_0080904 3300041410 Bacteria 766
673 Ga0439465_0004274 3300041413 Bacteria 4644
674 Ga0439465_0004757 3300041413 Bacteria 4375
675 Ga0451793_0810995 3300041452 Bacteria 595
676 Ga0451793_1584048 3300041452 Bacteria 641
677 Ga0451802_1834731 3300041460 Bacteria 516
678 Ga0451806_522421 3300041462 Bacteria 552
679 Ga0451807_0720757 3300041486 Bacteria 754
680 Ga0451833_1022453 3300041491 Bacteria 551
681 Ga0451837_1536393 3300041494 Bacteria 581
682 Ga0451841_0590837 3300041498 Bacteria 1107
683 Ga0451853_3774724 3300041512 Bacteria 620
684 Ga0439431_0038651 3300041997 Bacteria 1208
685 Ga0439442_150916 3300042002 Bacteria 517
686 Ga0439445_0033115 3300042004 Bacteria 1349
687 Ga0439448_0002459 3300042005 Bacteria 5047
688 Ga0439432_000640 3300042006 Bacteria 13098
689 Ga0439432_022961 3300042006 Bacteria 2058
690 Ga0439452_018803 3300042010 Bacteria 1835
691 Ga0439457_024428 3300042014 Bacteria 1337
692 Ga0439462_0002776 3300042015 Bacteria 4116
693 Ga0450922_019334 3300042124 Bacteria 696
694 Ga0439446_0034458 3300042156 Bacteria 1473
695 Ga0439458_0000137 3300042157 Bacteria 15585
696 Ga0450909_012035 3300042185 Bacteria 1268
697 Ga0439434_0020110 3300042435 Bacteria 2004
698 Ga0439460_0201787 3300042461 Bacteria 678
699 Ga0466972_0086674 3300044658 Bacteria 1488
700 Ga0466965_0529846 3300044683 Bacteria 663
701 Ga0466963_0311463 3300044694 Bacteria 1108
702 Ga0466970_0256774 3300044765 Bacteria 980
703 Ga0466957_0347333 3300044842 Bacteria 1006
704 Ga0451576_0436970 3300045051 Bacteria 1373
705 Ga0466958_0391983 3300045836 Bacteria 896
706 Ga0466967_0379221 3300045976 Bacteria 1373
707 Ga0466967_0633257 3300045976 Bacteria 1057
708 Ga0466967_2162402 3300045976 Bacteria 552
709 Ga0495617_011498 3300046452 Bacteria 3019
710 Ga0495627_000156 3300046453 Bacteria 78784
711 Ga0495627_000578 3300046453 Bacteria 29484
712 Ga0495627_034662 3300046453 Bacteria 1576
713 Ga0495638_0000758 3300046460 Bacteria 34400
714 Ga0495638_0188677 3300046460 Bacteria 1171
715 Ga0495651_0721380 3300046462 Bacteria 620
716 Ga0495650_0001027 3300046471 Bacteria 31380
717 Ga0495650_0227391 3300046471 Bacteria 641
718 Ga0495584_0078046 3300046491 Bacteria 1666
719 Ga0495585_0127704 3300046492 Bacteria 1340
720 Ga0495585_0567920 3300046492 Bacteria 535
721 Ga0495607_0093490 3300046501 Bacteria 1624
722 Ga0495583_0220617 3300046506 Bacteria 766
723 Ga0495606_0072058 3300046507 Bacteria 2173
724 Ga0495610_0000291 3300046512 Bacteria 52599
725 Ga0495610_0144969 3300046512 Bacteria 1018
726 Ga0495616_0001456 3300046513 Bacteria 16481
727 Ga0495632_0000006 3300046519 Bacteria 345883
728 Ga0495637_0000784 3300046520 Bacteria 21358
729 Ga0495637_0010852 3300046520 Bacteria 4391
730 Ga0495637_0065588 3300046520 Bacteria 1478
731 Ga0495643_0000021 3300046522 Bacteria 293465
732 Ga0495643_0523213 3300046522 Bacteria 508
733 Ga0495648_0010683 3300046524 Bacteria 6974
734 Ga0495648_0045945 3300046524 Bacteria 2712
735 Ga0495663_0000008 3300046525 Bacteria 260614
736 Ga0495663_0018920 3300046525 Bacteria 1965
737 Ga0495663_0053401 3300046525 Bacteria 1256
738 Ga0495663_0242178 3300046525 Bacteria 638
739 Ga0495654_0116202 3300046530 Bacteria 1215
740 Ga0495597_0031259 3300046542 Bacteria 2424
741 Ga0495633_0000190 3300046558 Bacteria 79967
742 Ga0495633_0002635 3300046558 Bacteria 12531
743 Ga0495633_0013695 3300046558 Bacteria 4264
744 Ga0495633_0072188 3300046558 Bacteria 1610
745 Ga0495633_0146062 3300046558 Bacteria 1093
746 Ga0495668_0002221 3300046616 Bacteria 16492
747 Ga0495668_0105921 3300046616 Bacteria 1538
748 Ga0495668_0574724 3300046616 Bacteria 622
749 Ga0495625_0000629 3300046660 Bacteria 51047
750 Ga0495625_0215510 3300046660 Bacteria 1260
751 Ga0495625_0393492 3300046660 Bacteria 867
752 Ga0495661_0125781 3300046665 Bacteria 1411
753 Ga0495670_0000002 3300046691 Bacteria 601814
754 Ga0495670_0427746 3300046691 Bacteria 716
755 Ga0495671_0000017 3300046692 Bacteria 293465
756 Ga0495649_0327109 3300046694 Bacteria 777
757 Ga0495636_0180483 3300047318 Bacteria 958
758 Ga0495672_0174663 3300047320 Bacteria 1092
759 Ga0495672_0212818 3300047320 Bacteria 959
760 Ga0495673_0028297 3300047469 Bacteria 2656
761 Ga0495681_0000098 3300047470 Bacteria 75809
762 Ga0495681_0008268 3300047470 Bacteria 6539
763 Ga0495681_0009646 3300047470 Bacteria 5927
764 Ga0495681_0326806 3300047470 Bacteria 588
765 Ga0495686_0005063 3300047472 Bacteria 10564
766 Ga0495686_0008463 3300047472 Bacteria 7546
767 Ga0495686_0029938 3300047472 Bacteria 3538
768 Ga0495686_0042056 3300047472 Bacteria 2907
769 Ga0495686_0248449 3300047472 Bacteria 1000
770 Ga0495686_0254178 3300047472 Bacteria 986
771 Ga0495686_0377163 3300047472 Bacteria 766
772 Ga0495686_0686152 3300047472 Bacteria 523
773 Ga0496100_0082969 3300048903 Bacteria 2168
774 Ga0496100_0182282 3300048903 Bacteria 1519
775 Ga0496100_1223371 3300048903 Bacteria 592
776 Ga0496101_0111668 3300048904 Bacteria 2058
777 Ga0496101_0138327 3300048904 Bacteria 1854
778 Ga0496101_0333953 3300048904 Bacteria 1190
779 Ga0496101_0346342 3300048904 Bacteria 1167
780 Ga0496102_0000069 3300048905 Bacteria 156067
781 Ga0496102_0000615 3300048905 Bacteria 36925
782 Ga0496102_0172254 3300048905 Bacteria 2037
783 Ga0496102_0298555 3300048905 Bacteria 1518
784 Ga0496102_0681373 3300048905 Bacteria 951
785 Ga0496103_0000173 3300048906 Bacteria 67412
786 Ga0496103_0009010 3300048906 Bacteria 5911
787 Ga0496103_0033025 3300048906 Bacteria 3160
788 Ga0496103_0132529 3300048906 Bacteria 1592
789 Ga0496103_0224202 3300048906 Bacteria 1209
790 Ga0496103_0651014 3300048906 Bacteria 669
791 Ga0496104_0000081 3300048907 Bacteria 94514
792 Ga0496104_0059792 3300048907 Bacteria 3608
793 Ga0496105_0000034 3300048908 Bacteria 127505
794 Ga0496105_0090922 3300048908 Bacteria 2521
795 Ga0496105_0363545 3300048908 Bacteria 1154
796 Ga0496105_0615800 3300048908 Bacteria 841
797 Ga0496106_0076352 3300048909 Bacteria 2568
798 Ga0496106_0168900 3300048909 Bacteria 1733
799 Ga0496106_0222120 3300048909 Bacteria 1507
800 Ga0496107_0173558 3300048910 Bacteria 1600
801 Ga0496107_0252341 3300048910 Bacteria 1312
802 Ga0496109_0067327 3300048912 Bacteria 3280
803 Ga0496109_0116418 3300048912 Bacteria 2488
804 Ga0496109_0353061 3300048912 Bacteria 1389
805 Ga0496109_0539887 3300048912 Bacteria 1100
806 Ga0496110_0093856 3300048913 Bacteria 2686
807 Ga0496110_0124785 3300048913 Bacteria 2322
808 Ga0496110_0325345 3300048913 Bacteria 1400
809 Ga0496110_1131155 3300048913 Bacteria 691
810 Ga0496111_0328540 3300048914 Bacteria 1132
811 Ga0496111_0458563 3300048914 Bacteria 940
812 Ga0496112_0116278 3300048915 Bacteria 2645
813 Ga0496112_0663427 3300048915 Bacteria 972
814 Ga0496113_0000101 3300048916 Bacteria 36217
815 Ga0496113_0366514 3300048916 Bacteria 1156
816 Ga0496113_1445932 3300048916 Bacteria 532
817 Ga0496115_0001129 3300048918 Bacteria 19266
818 Ga0496115_0108956 3300048918 Bacteria 2274
819 Ga0496115_1026514 3300048918 Bacteria 629
820 Ga0496116_0000062 3300048919 Bacteria 271104
821 Ga0496116_0000566 3300048919 Bacteria 49509
822 Ga0496116_0032138 3300048919 Bacteria 3745
823 Ga0496116_0050745 3300048919 Bacteria 2762
824 Ga0496116_0101176 3300048919 Bacteria 1721
825 Ga0496116_0361464 3300048919 Bacteria 660
826 Ga0496117_0000146 3300048920 Bacteria 152244
827 Ga0496117_0000485 3300048920 Bacteria 65840
828 Ga0496117_0033071 3300048920 Bacteria 3916
829 Ga0496117_0046000 3300048920 Bacteria 3144
830 Ga0496117_0055578 3300048920 Bacteria 2765
831 Ga0496117_0089533 3300048920 Bacteria 1987
832 Ga0496117_0251385 3300048920 Bacteria 964
833 Ga0496117_0312713 3300048920 Bacteria 826
834 Ga0496117_0318261 3300048920 Bacteria 816
835 Ga0496117_0330651 3300048920 Bacteria 794
836 Ga0496118_0000190 3300048921 Bacteria 108017
837 Ga0496118_0003742 3300048921 Bacteria 18808
838 Ga0496118_0015425 3300048921 Bacteria 7071
839 Ga0496118_0015970 3300048921 Bacteria 6916
840 Ga0496118_0057773 3300048921 Bacteria 2905
841 Ga0496118_0076829 3300048921 Bacteria 2372
842 Ga0496118_0079363 3300048921 Bacteria 2316
843 Ga0496118_0104776 3300048921 Bacteria 1897
844 Ga0496118_0127031 3300048921 Bacteria 1647
845 Ga0496118_0139050 3300048921 Bacteria 1544
846 Ga0496118_0370348 3300048921 Bacteria 756
847 Ga0496119_0000057 3300048922 Bacteria 173746
848 Ga0496119_0072971 3300048922 Bacteria 2003
849 Ga0496119_0180016 3300048922 Bacteria 1109
850 Ga0496119_0186126 3300048922 Bacteria 1085
851 Ga0496119_0313654 3300048922 Bacteria 769
852 Ga0496120_0005360 3300048923 Bacteria 10261
853 Ga0496120_0110614 3300048923 Bacteria 1436
854 Ga0496120_0178484 3300048923 Bacteria 1045
855 Ga0496120_0185785 3300048923 Bacteria 1017
856 Ga0496120_0487953 3300048923 Bacteria 531
857 Ga0496121_0005623 3300048924 Bacteria 15968
858 Ga0496121_0010499 3300048924 Bacteria 10435
859 Ga0496121_0015601 3300048924 Bacteria 7936
860 Ga0496121_0016723 3300048924 Bacteria 7548
861 Ga0496121_0017016 3300048924 Bacteria 7461
862 Ga0496121_0058069 3300048924 Bacteria 3202
863 Ga0496121_0115314 3300048924 Bacteria 2040
864 Ga0496121_0180678 3300048924 Bacteria 1523
865 Ga0496121_0205134 3300048924 Bacteria 1401
866 Ga0496121_0568689 3300048924 Bacteria 706
867 Ga0496121_0907952 3300048924 Bacteria 506
868 Ga0496122_0000723 3300048925 Bacteria 64694
869 Ga0496122_0003556 3300048925 Bacteria 20365
870 Ga0496122_0006671 3300048925 Bacteria 13150
871 Ga0496122_0026134 3300048925 Bacteria 5047
872 Ga0496122_0366886 3300048925 Bacteria 745
873 Ga0496122_0420631 3300048925 Bacteria 672
874 Ga0496123_0000545 3300048926 Bacteria 64687
875 Ga0496123_0002968 3300048926 Bacteria 19751
876 Ga0496123_0016815 3300048926 Bacteria 5914
877 Ga0496123_0062259 3300048926 Bacteria 2392
878 Ga0496123_0235440 3300048926 Bacteria 913
879 Ga0496124_0000546 3300048927 Bacteria 63624
880 Ga0496124_0000874 3300048927 Bacteria 49185
881 Ga0496124_0002439 3300048927 Bacteria 24366
882 Ga0496124_0006061 3300048927 Bacteria 13305
883 Ga0496124_0023588 3300048927 Bacteria 5614
884 Ga0496124_0023873 3300048927 Bacteria 5571
885 Ga0496124_0081473 3300048927 Bacteria 2660
886 Ga0496124_0299780 3300048927 Bacteria 1162
887 Ga0496124_0474242 3300048927 Bacteria 847
888 Ga0496124_0507938 3300048927 Bacteria 806
889 Ga0496124_0805486 3300048927 Bacteria 581
890 Ga0496125_0002465 3300048928 Bacteria 24034
891 Ga0496125_0006988 3300048928 Bacteria 12081
892 Ga0496125_0033431 3300048928 Bacteria 4551
893 Ga0496125_0034343 3300048928 Bacteria 4472
894 Ga0496125_0071024 3300048928 Bacteria 2722
895 Ga0496125_0355978 3300048928 Bacteria 872
896 Ga0496125_0415581 3300048928 Bacteria 781
897 Ga0496125_0439744 3300048928 Bacteria 750
898 Ga0496126_0000028 3300048929 Bacteria 394082
899 Ga0496126_0006838 3300048929 Bacteria 12646
900 Ga0496126_0016996 3300048929 Bacteria 7259
901 Ga0496126_0034229 3300048929 Bacteria 4773
902 Ga0496126_0054886 3300048929 Bacteria 3607
903 Ga0496126_0121519 3300048929 Bacteria 2264
904 Ga0496126_0150910 3300048929 Bacteria 1992
905 Ga0496126_0372477 3300048929 Bacteria 1164
906 Ga0496126_0632782 3300048929 Bacteria 839
907 Ga0496126_1231595 3300048929 Bacteria 549
908 Ga0495678_014836 3300049459 Bacteria 3610
909 Ga0495682_0279655 3300049460 Bacteria 589
910 Ga0501290_000237 3300049513 Bacteria 9135
911 Ga0501292_000042 3300049515 Bacteria 29474
912 Ga0501294_000032 3300049517 Bacteria 13769
913 Ga0501297_009582 3300049520 Bacteria 1085
914 Ga0501300_000392 3300049523 Bacteria 6689
915 Ga0501302_002270 3300049525 Bacteria 1084
916 Ga0501315_000962 3300049531 Bacteria 2273
917 Ga0501317_002915 3300049533 Bacteria 1662
918 Ga0501318_049501 3300049534 Bacteria 621
919 Ga0501321_023679 3300049537 Bacteria 780
920 Ga0501335_000615 3300049551 Bacteria 2383
921 Ga0501337_013057 3300049553 Bacteria 625
922 Ga0501033_0085723 3300049570 Bacteria 2307
923 Ga0501034_0099962 3300049571 Bacteria 2895
924 Ga0501034_0285394 3300049571 Bacteria 1590
925 Ga0501038_0164937 3300049574 Bacteria 1798
926 Ga0501038_0323317 3300049574 Bacteria 1206
927 Ga0501038_0770013 3300049574 Bacteria 717
928 Ga0501041_0866607 3300049577 Bacteria 580
929 Ga0501042_0040621 3300049578 Bacteria 3307
930 Ga0501042_0260954 3300049578 Bacteria 1251
931 Ga0501043_0113159 3300049579 Bacteria 2131
932 Ga0501046_0030454 3300049580 Bacteria 4380
933 Ga0501047_0000731 3300049581 Bacteria 34159
934 Ga0501047_0450251 3300049581 Bacteria 1117
935 Ga0501047_0935022 3300049581 Bacteria 680
936 Ga0501070_0968333 3300049586 Bacteria 661
937 Ga0501071_0191090 3300049587 Bacteria 1536
938 Ga0501071_1187966 3300049587 Bacteria 589
939 Ga0501073_0139551 3300049589 Bacteria 1679
940 Ga0501074_0761420 3300049590 Bacteria 683
941 Ga0501075_0834129 3300049591 Bacteria 701
942 Ga0501076_0426670 3300049592 Bacteria 1091
943 Ga0501076_1405930 3300049592 Bacteria 573
944 Ga0501077_0216387 3300049593 Bacteria 1218
945 Ga0501206_003378 3300049653 Bacteria 2028
946 Ga0501211_000103 3300049658 Bacteria 6327
947 Ga0501222_001746 3300049662 Bacteria 3014
948 Ga0501223_004016 3300049663 Bacteria 3169
949 Ga0501223_036809 3300049663 Bacteria 951
950 Ga0501224_000754 3300049664 Bacteria 4084
951 Ga0501227_028030 3300049665 Bacteria 1336
952 Ga0501233_012436 3300049668 Bacteria 1708
953 Ga0501235_001097 3300049669 Bacteria 5663
954 Ga0501236_053975 3300049670 Bacteria 697
955 Ga0501259_001391 3300049688 Bacteria 4043
956 Ga0501261_000021 3300049690 Bacteria 37511
957 Ga0501221_003846 3300049704 Bacteria 2478
958 Ga0501225_0006973 3300049705 Bacteria 3291
959 Ga0501225_0043405 3300049705 Bacteria 1242
960 Ga0501079_0374717 3300049741 Bacteria 1116
961 Ga0501080_0702389 3300049742 Bacteria 892
962 Ga0501083_0271764 3300049744 Bacteria 1103
963 Ga0501083_0292932 3300049744 Bacteria 1059
964 Ga0501264_008163 3300049761 Bacteria 985
965 Ga0501276_013553 3300049773 Bacteria 716
966 Ga0501279_000010 3300049775 Bacteria 103375
967 Ga0501280_000064 3300049776 Bacteria 31054
968 Ga0501280_001057 3300049776 Bacteria 5596
969 Ga0501281_00086 3300049777 Bacteria 10989
970 Ga0501282_000404 3300049778 Bacteria 5157
971 Ga0501283_001453 3300049779 Bacteria 3071
972 Ga0501035_0179700 3300049822 Bacteria 1823
973 Ga0501035_0244287 3300049822 Bacteria 1526
974 Ga0501035_1048316 3300049822 Bacteria 639
975 Ga0501044_0134255 3300049823 Bacteria 2467
976 Ga0501044_0204047 3300049823 Bacteria 1934
977 Ga0501044_0896240 3300049823 Bacteria 762
978 Ga0501226_021697 3300049853 Bacteria 712
979 Ga0501284_02268 3300050005 Bacteria 1056
980 nmdc:mga03n38_266481_c1 3300050490 Bacteria 910
981 nmdc:mga00v17_75476_c1 3300050491 Bacteria 1412
982 nmdc:mga00v17_911672_c1 3300050491 Bacteria 556
983 nmdc:mga0k408_344198_c1 3300050493 Bacteria 889
984 nmdc:mga0k408_529690_c1 3300050493 Bacteria 697
985 nmdc:mga0k408_583414_c1 3300050493 Bacteria 660
986 nmdc:mga0k408_832522_c1 3300050493 Bacteria 537
987 nmdc:mga06z11_17_c1 3300050494 Bacteria 79602
988 nmdc:mga04h51_146_c1 3300050495 Bacteria 20585
989 nmdc:mga04h51_411911_c1 3300050495 Bacteria 567
990 nmdc:mga07m45_111328_c1 3300050496 Bacteria 1577
991 nmdc:mga07m45_567769_c1 3300050496 Bacteria 656
992 nmdc:mga07m45_60295_c1 3300050496 Bacteria 2147
993 nmdc:mga05p37_171786_c1 3300050507 Bacteria 2643
994 nmdc:mga05p37_2021674_c1 3300050507 Bacteria 544
995 Ga0500643_010906 3300053087 Bacteria 3352
996 Ga0500647_0376821 3300053091 Bacteria 582
997 Ga0500651_0086862 3300053093 Bacteria 1931
998 Ga0500566_0004538 3300053094 Bacteria 8291
999 Ga0500641_0004173 3300053096 Bacteria 5101
1000 Ga0500641_0136367 3300053096 Bacteria 1059
1001 Ga0500556_0189304 3300053104 Bacteria 813
1002 Ga0500562_070755 3300053108 Bacteria 941
1003 Ga0500592_000031 3300053116 Bacteria 47686
1004 Ga0500592_001156 3300053116 Bacteria 4293
1005 Ga0500594_0054708 3300053118 Bacteria 1134
1006 Ga0500595_000572 3300053119 Bacteria 21961
1007 Ga0500595_052569 3300053119 Bacteria 1257
1008 Ga0500595_055810 3300053119 Bacteria 1209
1009 Ga0500608_066104 3300053122 Bacteria 1724
1010 Ga0500618_014810 3300053125 Bacteria 1983
1011 Ga0500626_092170 3300053128 Bacteria 1329
1012 Ga0500642_0014296 3300053130 Bacteria 2948
1013 Ga0500652_278543 3300053131 Bacteria 654
1014 Ga0500655_000251 3300053133 Bacteria 12576
1015 Ga0500658_0010885 3300053134 Bacteria 3356
1016 Ga0500658_0014446 3300053134 Bacteria 2923
1017 Ga0500658_0267841 3300053134 Bacteria 785
1018 Ga0500658_0476850 3300053134 Bacteria 566
1019 Ga0500559_0159324 3300053136 Bacteria 1060
1020 Ga0500559_0232776 3300053136 Bacteria 868
1021 Ga0500564_386623 3300053138 Bacteria 510
1022 Ga0500568_0018906 3300053139 Bacteria 3006
1023 Ga0500568_0092427 3300053139 Bacteria 1140
1024 Ga0500568_0195118 3300053139 Bacteria 742
1025 Ga0500588_0071841 3300053146 Bacteria 1137
1026 Ga0500590_000131 3300053148 Bacteria 20923
1027 Ga0500604_0036484 3300053151 Bacteria 1466
1028 Ga0500604_0071415 3300053151 Bacteria 1107
1029 Ga0500616_0008241 3300053153 Bacteria 6496
1030 Ga0500616_0222499 3300053153 Bacteria 822
1031 Ga0500616_0284202 3300053153 Bacteria 693
1032 Ga0500616_0291538 3300053153 Bacteria 681
1033 Ga0500622_0025695 3300053156 Bacteria 3111
1034 Ga0500622_0077848 3300053156 Bacteria 1665
1035 Ga0500622_0091256 3300053156 Bacteria 1511
1036 Ga0500624_000063 3300053157 Bacteria 65333
1037 Ga0500627_0001223 3300053158 Bacteria 7068
1038 Ga0500627_0027041 3300053158 Bacteria 2372
1039 Ga0500627_0378067 3300053158 Bacteria 607
1040 Ga0500639_139272 3300053163 Bacteria 1137
1041 Ga0500636_0058873 3300053177 Bacteria 2245
1042 Ga0500570_004079 3300053724 Bacteria 7637
1043 Ga0500645_180888 3300053730 Bacteria 573
1044 Ga0500645_223100 3300053730 Bacteria 504
1045 Ga0500601_034828 3300053737 Bacteria 604
1046 Ga0501084_0791318 3300054114 Bacteria 799
1047 Ga0587066_169647 3300059490 Bacteria 554
1048 Ga0587077_168426 3300059493 Bacteria 585
1049 Ga0587088_134191 3300059508 Bacteria 585
1050 Ga0587094_030537 3300059513 Bacteria 833
1051 Ga0587067_076756 3300059640 Bacteria 732
1052 Ga0587069_140777 3300059642 Bacteria 528
1053 Ga0501082_0979656 3300060353 Bacteria 739

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10000255 Ga0081455_1000025558 67
2 3300013307 Ga0157372_10113522 Ga0157372_101135224 67
3 3300048924 Ga0496121_0568689 Ga0496121_0568689_11_217 67
4 iso_pu_bacteria 2523231067 2523469825 72
5 iso_pu_bacteria 2738543031 2739348858 72
6 iso_pu_bacteria 2990265787 2990266882 72
7 iso_pu_bacteria 2993693658 2993693827 72
8 iso_pu_bacteria 2510917021 2511130325 73
9 iso_pu_bacteria 2582581305 2585262260 73
10 iso_pu_bacteria 2599185359 2600225503 73
11 iso_pu_bacteria 2643221541 2643731598 73
12 iso_pu_bacteria 2643221605 2644036775 73
13 iso_pu_bacteria 2643221606 2644042074 73
14 iso_pu_bacteria 2643221622 2644126038 73
15 iso_pu_bacteria 2643221671 2644394283 73
16 iso_pu_bacteria 2738541275 2738709615 73
17 iso_pu_bacteria 2738541301 2738848040 73
18 iso_pu_bacteria 2738541304 2738863769 73
19 iso_pu_bacteria 2738543022 2739296287 73
20 iso_pu_bacteria 2738543033 2739357965 73
21 iso_pu_bacteria 2818991466 2819713935 73
22 iso_pu_bacteria 2879163058 2879165166 73
23 iso_pu_bacteria 2917554339 2917557483 73
24 iso_pu_bacteria 2928526807 2928528495 73
25 iso_pu_bacteria 2928959182 2928960419 73
26 iso_pu_bacteria 2928968154 2928970040 73
27 iso_pu_bacteria 8054302542 8054303052 73
28 3300009036 Ga0105244_10606409 Ga0105244_106064091 74
29 3300009093 Ga0105240_10015679 Ga0105240_1001567910 74
30 3300010375 Ga0105239_10000367 Ga0105239_1000036749 74
31 3300013105 Ga0157369_12006581 Ga0157369_120065812 74
32 3300053104 Ga0500556_0189304 Ga0500556_0189304_106_336 74
33 3300005981 Ga0081538_10004148 Ga0081538_1000414812 75
34 3300009011 Ga0105251_10638162 Ga0105251_106381621 75
35 3300009101 Ga0105247_10001891 Ga0105247_1000189119 75
36 3300009177 Ga0105248_10088281 Ga0105248_100882816 75
37 3300009553 Ga0105249_10019753 Ga0105249_100197535 75
38 3300013306 Ga0163162_10019579 Ga0163162_100195797 75
39 3300013306 Ga0163162_12257592 Ga0163162_122575921 75
40 3300014325 Ga0163163_10030114 Ga0163163_100301146 75
41 3300014968 Ga0157379_10128162 Ga0157379_101281622 75
42 3300017792 Ga0163161_10030597 Ga0163161_100305973 75
43 3300021388 Ga0213875_10524352 Ga0213875_105243522 75
44 3300025735 Ga0207713_1036906 Ga0207713_10369063 75
45 3300035111 Ga0373923_0143888 Ga0373923_0143888_470_697 75
46 3300037853 Ga0436364_0878110 Ga0436364_0878110_504_734 75
47 3300039447 Ga0436361_1051839 Ga0436361_1051839_754_987 75
48 3300041491 Ga0451833_1022453 Ga0451833_1022453_148_381 75
49 3300044658 Ga0466972_0086674 Ga0466972_0086674_560_787 75
50 3300044842 Ga0466957_0347333 Ga0466957_0347333_406_633 75
51 3300045976 Ga0466967_0379221 Ga0466967_0379221_739_966 75
52 3300046491 Ga0495584_0078046 Ga0495584_0078046_1073_1300 75
53 3300046519 Ga0495632_0000006 Ga0495632_0000006_333366_333593 75
54 3300046520 Ga0495637_0000784 Ga0495637_0000784_8175_8402 75
55 3300046522 Ga0495643_0000021 Ga0495643_0000021_54889_55116 75
56 3300046524 Ga0495648_0045945 Ga0495648_0045945_405_632 75
57 3300046525 Ga0495663_0000008 Ga0495663_0000008_12291_12518 75
58 3300046530 Ga0495654_0116202 Ga0495654_0116202_526_762 75
59 3300046558 Ga0495633_0000190 Ga0495633_0000190_79727_79954 75
60 3300046558 Ga0495633_0002635 Ga0495633_0002635_14_241 75
61 3300046660 Ga0495625_0215510 Ga0495625_0215510_701_928 75
62 3300046692 Ga0495671_0000017 Ga0495671_0000017_238350_238577 75
63 3300047470 Ga0495681_0008268 Ga0495681_0008268_3090_3317 75
64 3300047472 Ga0495686_0254178 Ga0495686_0254178_484_717 75
65 3300047472 Ga0495686_0686152 Ga0495686_0686152_14_241 75
66 3300048903 Ga0496100_0082969 Ga0496100_0082969_227_454 75
67 3300048904 Ga0496101_0138327 Ga0496101_0138327_625_852 75
68 3300048904 Ga0496101_0333953 Ga0496101_0333953_492_719 75
69 3300048905 Ga0496102_0298555 Ga0496102_0298555_258_485 75
70 3300048906 Ga0496103_0132529 Ga0496103_0132529_412_639 75
71 3300048906 Ga0496103_0651014 Ga0496103_0651014_375_602 75
72 3300048908 Ga0496105_0615800 Ga0496105_0615800_158_385 75
73 3300048909 Ga0496106_0168900 Ga0496106_0168900_1265_1492 75
74 3300048909 Ga0496106_0222120 Ga0496106_0222120_342_569 75
75 3300048910 Ga0496107_0173558 Ga0496107_0173558_818_1045 75
76 3300048912 Ga0496109_0116418 Ga0496109_0116418_1893_2120 75
77 3300048913 Ga0496110_0124785 Ga0496110_0124785_287_514 75
78 3300048913 Ga0496110_1131155 Ga0496110_1131155_202_429 75
79 3300048914 Ga0496111_0328540 Ga0496111_0328540_310_537 75
80 3300048914 Ga0496111_0458563 Ga0496111_0458563_666_893 75
81 3300048919 Ga0496116_0050745 Ga0496116_0050745_477_704 75
82 3300048920 Ga0496117_0055578 Ga0496117_0055578_1277_1504 75
83 3300048920 Ga0496117_0312713 Ga0496117_0312713_182_409 75
84 3300048921 Ga0496118_0003742 Ga0496118_0003742_16884_17111 75
85 3300048921 Ga0496118_0076829 Ga0496118_0076829_841_1068 75
86 3300048921 Ga0496118_0127031 Ga0496118_0127031_1258_1485 75
87 3300048923 Ga0496120_0487953 Ga0496120_0487953_170_400 75
88 3300048924 Ga0496121_0017016 Ga0496121_0017016_3191_3418 75
89 3300048924 Ga0496121_0115314 Ga0496121_0115314_361_588 75
90 3300048925 Ga0496122_0003556 Ga0496122_0003556_7974_8201 75
91 3300048925 Ga0496122_0420631 Ga0496122_0420631_93_323 75
92 3300048926 Ga0496123_0016815 Ga0496123_0016815_141_368 75
93 3300048927 Ga0496124_0023588 Ga0496124_0023588_2649_2876 75
94 3300048927 Ga0496124_0023873 Ga0496124_0023873_1075_1302 75
95 3300048928 Ga0496125_0034343 Ga0496125_0034343_2047_2274 75
96 3300048929 Ga0496126_0121519 Ga0496126_0121519_1689_1916 75
97 3300048929 Ga0496126_0632782 Ga0496126_0632782_237_464 75
98 3300048929 Ga0496126_1231595 Ga0496126_1231595_297_524 75
99 3300049460 Ga0495682_0279655 Ga0495682_0279655_189_416 75
100 3300049744 Ga0501083_0271764 Ga0501083_0271764_583_810 75
101 3300053116 Ga0500592_000031 Ga0500592_000031_4541_4777 75
102 3300053119 Ga0500595_052569 Ga0500595_052569_599_829 75
103 3300053153 Ga0500616_0008241 Ga0500616_0008241_2770_3003 75
104 3300053158 Ga0500627_0001223 Ga0500627_0001223_5507_5743 75
105 3300005578 Ga0068854_100301862 Ga0068854_1003018623 76
106 3300009093 Ga0105240_10025126 Ga0105240_100251269 76
107 3300009093 Ga0105240_12089073 Ga0105240_120890732 76
108 3300009148 Ga0105243_10942050 Ga0105243_109420502 76
109 3300009174 Ga0105241_10707420 Ga0105241_107074201 76
110 3300009545 Ga0105237_10044206 Ga0105237_100442063 76
111 3300009551 Ga0105238_11442421 Ga0105238_114424212 76
112 3300013104 Ga0157370_10214812 Ga0157370_102148124 76
113 3300013105 Ga0157369_10109686 Ga0157369_101096863 76
114 3300013306 Ga0163162_10301457 Ga0163162_103014572 76
115 3300014497 Ga0182008_10307738 Ga0182008_103077382 76
116 3300021384 Ga0213876_10024618 Ga0213876_100246185 76
117 3300021384 Ga0213876_10601056 Ga0213876_106010561 76
118 3300021388 Ga0213875_10009905 Ga0213875_100099055 76
119 3300025913 Ga0207695_10016421 Ga0207695_100164218 76
120 3300025913 Ga0207695_10021724 Ga0207695_100217244 76
121 3300025914 Ga0207671_10027639 Ga0207671_100276395 76
122 3300025924 Ga0207694_10801093 Ga0207694_108010931 76
123 3300025981 Ga0207640_10031448 Ga0207640_100314484 76
124 3300026116 Ga0207674_10300559 Ga0207674_103005592 76
125 3300031731 Ga0307405_11486235 Ga0307405_114862351 76
126 3300037853 Ga0436364_0741438 Ga0436364_0741438_137_367 76
127 3300039437 Ga0436365_0212007 Ga0436365_0212007_416_646 76
128 3300039437 Ga0436365_0922307 Ga0436365_0922307_68_298 76
129 3300039437 Ga0436365_1667312 Ga0436365_1667312_209_439 76
130 3300039437 Ga0436365_1773361 Ga0436365_1773361_5038_5268 76
131 3300045051 Ga0451576_0436970 Ga0451576_0436970_545_787 76
132 3300046501 Ga0495607_0093490 Ga0495607_0093490_33_263 76
133 3300048920 Ga0496117_0033071 Ga0496117_0033071_116_346 76
134 3300048920 Ga0496117_0089533 Ga0496117_0089533_913_1143 76
135 3300048921 Ga0496118_0015970 Ga0496118_0015970_1521_1751 76
136 3300048924 Ga0496121_0010499 Ga0496121_0010499_7265_7495 76
137 3300048924 Ga0496121_0016723 Ga0496121_0016723_4437_4667 76
138 3300048929 Ga0496126_0016996 Ga0496126_0016996_2708_2938 76
139 3300053136 Ga0500559_0159324 Ga0500559_0159324_677_907 76
140 3300053156 Ga0500622_0077848 Ga0500622_0077848_361_591 76
141 2162886007 SwRhRL2b_contig_14491 SwRhRL2b_0808.00005180 77
142 3300000043 ARcpr5yngRDRAFT_c004470 ARcpr5yngRDRAFT_0044703 77
143 3300000652 ARCol0yngRDRAFT_1009092 ARCol0yngRDRAFT_10090921 77
144 3300001904 JGI24736J21556_1000613 JGI24736J21556_10006135 77
145 3300001915 JGI24741J21665_1000366 JGI24741J21665_100036612 77
146 3300001976 JGI24752J21851_1006793 JGI24752J21851_10067933 77
147 3300001979 JGI24740J21852_10005104 JGI24740J21852_100051045 77
148 3300001979 JGI24740J21852_10044246 JGI24740J21852_100442462 77
149 3300001989 JGI24739J22299_10005319 JGI24739J22299_100053193 77
150 3300001989 JGI24739J22299_10006470 JGI24739J22299_100064703 77
151 3300001989 JGI24739J22299_10110044 JGI24739J22299_101100442 77
152 3300001989 JGI24739J22299_10112626 JGI24739J22299_101126262 77
153 3300001989 JGI24739J22299_10159140 JGI24739J22299_101591402 77
154 3300001990 JGI24737J22298_10015406 JGI24737J22298_100154065 77
155 3300001990 JGI24737J22298_10020406 JGI24737J22298_100204064 77
156 3300001990 JGI24737J22298_10048588 JGI24737J22298_100485883 77
157 3300001990 JGI24737J22298_10132662 JGI24737J22298_101326622 77
158 3300001990 JGI24737J22298_10186610 JGI24737J22298_101866102 77
159 3300001991 JGI24743J22301_10030394 JGI24743J22301_100303943 77
160 3300001991 JGI24743J22301_10113531 JGI24743J22301_101135312 77
161 3300002067 JGI24735J21928_10000590 JGI24735J21928_1000059014 77
162 3300002067 JGI24735J21928_10004614 JGI24735J21928_100046145 77
163 3300002067 JGI24735J21928_10004932 JGI24735J21928_100049325 77
164 3300002067 JGI24735J21928_10015755 JGI24735J21928_100157554 77
165 3300002067 JGI24735J21928_10018807 JGI24735J21928_100188074 77
166 3300002067 JGI24735J21928_10041906 JGI24735J21928_100419062 77
167 3300002067 JGI24735J21928_10058528 JGI24735J21928_100585282 77
168 3300002067 JGI24735J21928_10059101 JGI24735J21928_100591012 77
169 3300002067 JGI24735J21928_10135297 JGI24735J21928_101352971 77
170 3300002067 JGI24735J21928_10202768 JGI24735J21928_102027682 77
171 3300002074 JGI24748J21848_1005228 JGI24748J21848_10052283 77
172 3300002074 JGI24748J21848_1057374 JGI24748J21848_10573742 77
173 3300002075 JGI24738J21930_10000184 JGI24738J21930_100001844 77
174 3300002075 JGI24738J21930_10000231 JGI24738J21930_1000023116 77
175 3300002075 JGI24738J21930_10001740 JGI24738J21930_100017407 77
176 3300002075 JGI24738J21930_10015275 JGI24738J21930_100152753 77
177 3300002076 JGI24749J21850_1000049 JGI24749J21850_10000497 77
178 3300002077 JGI24744J21845_10008674 JGI24744J21845_100086743 77
179 3300002126 JGI24035J26624_1026616 JGI24035J26624_10266161 77
180 3300002239 JGI24034J26672_10003845 JGI24034J26672_100038453 77
181 3300002239 JGI24034J26672_10041405 JGI24034J26672_100414051 77
182 3300002459 JGI24751J29686_10000216 JGI24751J29686_1000021618 77
183 3300002459 JGI24751J29686_10018164 JGI24751J29686_100181643 77
184 3300002772 JGI25164J39214_1007846 JGI25164J39214_10078463 77
185 3300002774 JGI25150J39212_1002047 JGI25150J39212_10020476 77
186 3300003187 JGI25151J46595_10122326 JGI25151J46595_101223262 77
187 3300003214 JGI25165J46597_1000043 JGI25165J46597_1000043168 77
188 3300003215 JGI25153J46596_10000395 JGI25153J46596_1000039516 77
189 3300003215 JGI25153J46596_10002504 JGI25153J46596_100025043 77
190 3300003316 rootH1_10113314 rootH1_101133143 77
191 3300003323 rootH1_10035136 rootH1_100351364 77
192 3300003763 Ga0055529_1042867 Ga0055529_10428672 77
193 3300003773 Ga0055537_1001019 Ga0055537_10010194 77
194 3300003775 Ga0055524_1000056 Ga0055524_10000563 77
195 3300003790 Ga0055528_1020848 Ga0055528_10208483 77
196 3300003791 Ga0055530_10000931 Ga0055530_1000093127 77
197 3300003791 Ga0055530_10007314 Ga0055530_100073142 77
198 3300003792 Ga0055540_1002064 Ga0055540_10020648 77
199 3300003794 Ga0055531_10012617 Ga0055531_100126174 77
200 3300003794 Ga0055531_10015017 Ga0055531_100150174 77
201 3300005262 Ga0065165_1005029 Ga0065165_10050295 77
202 3300005262 Ga0065165_1009273 Ga0065165_10092732 77
203 3300005262 Ga0065165_1017463 Ga0065165_10174632 77
204 3300005262 Ga0065165_1062777 Ga0065165_10627772 77
205 3300005288 Ga0065714_10116065 Ga0065714_101160652 77
206 3300005289 Ga0065704_10070504 Ga0065704_1007050421 77
207 3300005295 Ga0065707_10000505 Ga0065707_1000050535 77
208 3300005295 Ga0065707_10086198 Ga0065707_100861984 77
209 3300005295 Ga0065707_10135500 Ga0065707_101355003 77
210 3300005295 Ga0065707_10212812 Ga0065707_102128123 77
211 3300005295 Ga0065707_10371722 Ga0065707_103717223 77
212 3300005295 Ga0065707_10414622 Ga0065707_104146221 77
213 3300005295 Ga0065707_10938111 Ga0065707_109381112 77
214 3300005327 Ga0070658_10006525 Ga0070658_1000652512 77
215 3300005327 Ga0070658_10068992 Ga0070658_100689922 77
216 3300005327 Ga0070658_10097157 Ga0070658_100971575 77
217 3300005327 Ga0070658_10584581 Ga0070658_105845812 77
218 3300005327 Ga0070658_10669238 Ga0070658_106692382 77
219 3300005327 Ga0070658_11102012 Ga0070658_111020121 77
220 3300005328 Ga0070676_10000230 Ga0070676_100002307 77
221 3300005329 Ga0070683_100195033 Ga0070683_1001950333 77
222 3300005331 Ga0070670_100000003 Ga0070670_100000003364 77
223 3300005331 Ga0070670_100002377 Ga0070670_1000023779 77
224 3300005331 Ga0070670_100004170 Ga0070670_10000417016 77
225 3300005331 Ga0070670_100126344 Ga0070670_1001263443 77
226 3300005331 Ga0070670_100189232 Ga0070670_1001892323 77
227 3300005333 Ga0070677_10801344 Ga0070677_108013442 77
228 3300005334 Ga0068869_100000200 Ga0068869_10000020029 77
229 3300005335 Ga0070666_10000184 Ga0070666_1000018423 77
230 3300005335 Ga0070666_10033483 Ga0070666_100334834 77
231 3300005335 Ga0070666_10257671 Ga0070666_102576712 77
232 3300005337 Ga0070682_100302630 Ga0070682_1003026301 77
233 3300005338 Ga0068868_100001398 Ga0068868_10000139811 77
234 3300005339 Ga0070660_100004583 Ga0070660_1000045838 77
235 3300005339 Ga0070660_100070534 Ga0070660_1000705343 77
236 3300005339 Ga0070660_100209408 Ga0070660_1002094082 77
237 3300005339 Ga0070660_100996905 Ga0070660_1009969052 77
238 3300005344 Ga0070661_100581848 Ga0070661_1005818483 77
239 3300005344 Ga0070661_101005335 Ga0070661_1010053352 77
240 3300005347 Ga0070668_100000026 Ga0070668_10000002628 77
241 3300005347 Ga0070668_100000080 Ga0070668_10000008020 77
242 3300005347 Ga0070668_100018364 Ga0070668_1000183646 77
243 3300005347 Ga0070668_100027483 Ga0070668_1000274832 77
244 3300005347 Ga0070668_100208292 Ga0070668_1002082923 77
245 3300005347 Ga0070668_100408180 Ga0070668_1004081803 77
246 3300005347 Ga0070668_100428915 Ga0070668_1004289152 77
247 3300005353 Ga0070669_100000008 Ga0070669_10000000846 77
248 3300005353 Ga0070669_100000020 Ga0070669_100000020116 77
249 3300005353 Ga0070669_100000082 Ga0070669_1000000827 77
250 3300005353 Ga0070669_100096603 Ga0070669_1000966033 77
251 3300005354 Ga0070675_100006627 Ga0070675_1000066275 77
252 3300005355 Ga0070671_100000015 Ga0070671_100000015139 77
253 3300005355 Ga0070671_100000169 Ga0070671_10000016927 77
254 3300005355 Ga0070671_100000470 Ga0070671_10000047020 77
255 3300005355 Ga0070671_100013092 Ga0070671_1000130923 77
256 3300005355 Ga0070671_100053502 Ga0070671_1000535025 77
257 3300005356 Ga0070674_100051002 Ga0070674_1000510023 77
258 3300005364 Ga0070673_100000006 Ga0070673_100000006121 77
259 3300005364 Ga0070673_101154028 Ga0070673_1011540282 77
260 3300005365 Ga0070688_100464942 Ga0070688_1004649422 77
261 3300005366 Ga0070659_100052995 Ga0070659_1000529953 77
262 3300005366 Ga0070659_100899434 Ga0070659_1008994342 77
263 3300005366 Ga0070659_101485301 Ga0070659_1014853011 77
264 3300005366 Ga0070659_101711550 Ga0070659_1017115502 77
265 3300005367 Ga0070667_100000019 Ga0070667_100000019214 77
266 3300005367 Ga0070667_100006367 Ga0070667_1000063675 77
267 3300005367 Ga0070667_100037194 Ga0070667_1000371942 77
268 3300005367 Ga0070667_100038717 Ga0070667_1000387178 77
269 3300005367 Ga0070667_100681738 Ga0070667_1006817382 77
270 3300005440 Ga0070705_100054779 Ga0070705_1000547792 77
271 3300005440 Ga0070705_100448402 Ga0070705_1004484022 77
272 3300005445 Ga0070708_100198374 Ga0070708_1001983741 77
273 3300005445 Ga0070708_101344162 Ga0070708_1013441622 77
274 3300005455 Ga0070663_100000574 Ga0070663_10000057424 77
275 3300005455 Ga0070663_100002941 Ga0070663_1000029419 77
276 3300005455 Ga0070663_101387399 Ga0070663_1013873992 77
277 3300005456 Ga0070678_100552397 Ga0070678_1005523972 77
278 3300005457 Ga0070662_100007108 Ga0070662_1000071084 77
279 3300005457 Ga0070662_100094062 Ga0070662_1000940624 77
280 3300005457 Ga0070662_100561610 Ga0070662_1005616101 77
281 3300005457 Ga0070662_100819864 Ga0070662_1008198641 77
282 3300005457 Ga0070662_101003480 Ga0070662_1010034802 77
283 3300005459 Ga0068867_100000001 Ga0068867_100000001366 77
284 3300005466 Ga0070685_10103920 Ga0070685_101039204 77
285 3300005466 Ga0070685_10368722 Ga0070685_103687222 77
286 3300005468 Ga0070707_101322160 Ga0070707_1013221602 77
287 3300005530 Ga0070679_100158874 Ga0070679_1001588743 77
288 3300005530 Ga0070679_100424436 Ga0070679_1004244362 77
289 3300005535 Ga0070684_100251597 Ga0070684_1002515973 77
290 3300005539 Ga0068853_100143479 Ga0068853_1001434795 77
291 3300005539 Ga0068853_100881719 Ga0068853_1008817192 77
292 3300005539 Ga0068853_100884100 Ga0068853_1008841002 77
293 3300005539 Ga0068853_102321716 Ga0068853_1023217162 77
294 3300005543 Ga0070672_100004199 Ga0070672_10000419913 77
295 3300005544 Ga0070686_100290882 Ga0070686_1002908822 77
296 3300005548 Ga0070665_100002434 Ga0070665_1000024343 77
297 3300005548 Ga0070665_100009702 Ga0070665_1000097023 77
298 3300005548 Ga0070665_100095381 Ga0070665_1000953813 77
299 3300005548 Ga0070665_100378831 Ga0070665_1003788312 77
300 3300005548 Ga0070665_100420653 Ga0070665_1004206532 77
301 3300005548 Ga0070665_100895973 Ga0070665_1008959732 77
302 3300005548 Ga0070665_101432299 Ga0070665_1014322991 77
303 3300005563 Ga0068855_100218364 Ga0068855_1002183645 77
304 3300005563 Ga0068855_100577260 Ga0068855_1005772603 77
305 3300005563 Ga0068855_101048138 Ga0068855_1010481382 77
306 3300005563 Ga0068855_101587902 Ga0068855_1015879022 77
307 3300005563 Ga0068855_102121698 Ga0068855_1021216981 77
308 3300005577 Ga0068857_100021366 Ga0068857_1000213664 77
309 3300005577 Ga0068857_100637109 Ga0068857_1006371092 77
310 3300005577 Ga0068857_100711507 Ga0068857_1007115072 77
311 3300005578 Ga0068854_100000483 Ga0068854_10000048329 77
312 3300005578 Ga0068854_100538554 Ga0068854_1005385542 77
313 3300005578 Ga0068854_101277453 Ga0068854_1012774532 77
314 3300005614 Ga0068856_100003591 Ga0068856_1000035915 77
315 3300005614 Ga0068856_100020542 Ga0068856_1000205424 77
316 3300005614 Ga0068856_100312622 Ga0068856_1003126222 77
317 3300005616 Ga0068852_100028295 Ga0068852_1000282952 77
318 3300005616 Ga0068852_100608851 Ga0068852_1006088511 77
319 3300005616 Ga0068852_101516957 Ga0068852_1015169572 77
320 3300005617 Ga0068859_100003505 Ga0068859_1000035057 77
321 3300005617 Ga0068859_100023533 Ga0068859_1000235335 77
322 3300005617 Ga0068859_100034581 Ga0068859_1000345813 77
323 3300005617 Ga0068859_100216629 Ga0068859_1002166293 77
324 3300005617 Ga0068859_100679313 Ga0068859_1006793133 77
325 3300005617 Ga0068859_100859376 Ga0068859_1008593762 77
326 3300005618 Ga0068864_100000005 Ga0068864_100000005231 77
327 3300005618 Ga0068864_100030140 Ga0068864_1000301404 77
328 3300005618 Ga0068864_100466728 Ga0068864_1004667282 77
329 3300005719 Ga0068861_100004980 Ga0068861_1000049803 77
330 3300005719 Ga0068861_100154977 Ga0068861_1001549773 77
331 3300005834 Ga0068851_10074177 Ga0068851_100741773 77
332 3300005841 Ga0068863_100000001 Ga0068863_100000001357 77
333 3300005841 Ga0068863_100000582 Ga0068863_10000058212 77
334 3300005841 Ga0068863_100067996 Ga0068863_1000679963 77
335 3300005841 Ga0068863_100084694 Ga0068863_1000846941 77
336 3300005841 Ga0068863_100137511 Ga0068863_1001375112 77
337 3300005841 Ga0068863_100313791 Ga0068863_1003137913 77
338 3300005842 Ga0068858_100010355 Ga0068858_10001035512 77
339 3300005842 Ga0068858_100034454 Ga0068858_1000344544 77
340 3300005842 Ga0068858_100380650 Ga0068858_1003806503 77
341 3300005843 Ga0068860_100000036 Ga0068860_100000036228 77
342 3300005843 Ga0068860_100001081 Ga0068860_10000108117 77
343 3300005843 Ga0068860_100004358 Ga0068860_1000043582 77
344 3300005843 Ga0068860_100044110 Ga0068860_1000441104 77
345 3300005843 Ga0068860_100115216 Ga0068860_1001152162 77
346 3300005843 Ga0068860_100263556 Ga0068860_1002635563 77
347 3300005843 Ga0068860_100310382 Ga0068860_1003103823 77
348 3300005843 Ga0068860_102676641 Ga0068860_1026766412 77
349 3300005844 Ga0068862_100000001 Ga0068862_100000001222 77
350 3300005844 Ga0068862_100000169 Ga0068862_1000001695 77
351 3300005844 Ga0068862_100001451 Ga0068862_10000145111 77
352 3300005844 Ga0068862_100006085 Ga0068862_10000608511 77
353 3300005844 Ga0068862_100021177 Ga0068862_1000211777 77
354 3300005844 Ga0068862_100049285 Ga0068862_1000492857 77
355 3300005844 Ga0068862_100087044 Ga0068862_1000870442 77
356 3300005844 Ga0068862_101234307 Ga0068862_1012343072 77
357 3300005937 Ga0081455_10023602 Ga0081455_100236022 77
358 3300005981 Ga0081538_10036760 Ga0081538_100367604 77
359 3300006051 Ga0075364_10197055 Ga0075364_101970553 77
360 3300006051 Ga0075364_10888517 Ga0075364_108885172 77
361 3300006195 Ga0075366_10043167 Ga0075366_100431673 77
362 3300006195 Ga0075366_10245806 Ga0075366_102458063 77
363 3300006195 Ga0075366_10576769 Ga0075366_105767692 77
364 3300006195 Ga0075366_10726065 Ga0075366_107260652 77
365 3300006195 Ga0075366_10801680 Ga0075366_108016802 77
366 3300006237 Ga0097621_100001076 Ga0097621_10000107614 77
367 3300006353 Ga0075370_10043587 Ga0075370_100435873 77
368 3300006353 Ga0075370_10637142 Ga0075370_106371422 77
369 3300006358 Ga0068871_100067527 Ga0068871_1000675272 77
370 3300006358 Ga0068871_101210368 Ga0068871_1012103682 77
371 3300006881 Ga0068865_100000003 Ga0068865_100000003197 77
372 3300006931 Ga0097620_100003505 Ga0097620_1000035057 77
373 3300006931 Ga0097620_100023532 Ga0097620_1000235326 77
374 3300006931 Ga0097620_100034580 Ga0097620_1000345807 77
375 3300006931 Ga0097620_100216626 Ga0097620_1002166263 77
376 3300006931 Ga0097620_100679134 Ga0097620_1006791343 77
377 3300006931 Ga0097620_100859461 Ga0097620_1008594612 77
378 3300009011 Ga0105251_10012362 Ga0105251_100123623 77
379 3300009092 Ga0105250_10006517 Ga0105250_100065173 77
380 3300009093 Ga0105240_10091793 Ga0105240_100917935 77
381 3300009093 Ga0105240_10318721 Ga0105240_103187215 77
382 3300009093 Ga0105240_10744819 Ga0105240_107448192 77
383 3300009098 Ga0105245_10000113 Ga0105245_1000011349 77
384 3300009098 Ga0105245_10032215 Ga0105245_100322154 77
385 3300009101 Ga0105247_10369422 Ga0105247_103694222 77
386 3300009148 Ga0105243_10000373 Ga0105243_1000037342 77
387 3300009148 Ga0105243_10328860 Ga0105243_103288602 77
388 3300009174 Ga0105241_10038453 Ga0105241_100384534 77
389 3300009176 Ga0105242_10000165 Ga0105242_100001652 77
390 3300009177 Ga0105248_10001558 Ga0105248_1000155813 77
391 3300009177 Ga0105248_10024425 Ga0105248_100244253 77
392 3300009177 Ga0105248_10043233 Ga0105248_100432332 77
393 3300009177 Ga0105248_13138180 Ga0105248_131381802 77
394 3300009545 Ga0105237_11408470 Ga0105237_114084702 77
395 3300009545 Ga0105237_11679876 Ga0105237_116798761 77
396 3300009545 Ga0105237_12603792 Ga0105237_126037922 77
397 3300009551 Ga0105238_10635331 Ga0105238_106353312 77
398 3300009551 Ga0105238_11154457 Ga0105238_111544571 77
399 3300009553 Ga0105249_10000045 Ga0105249_1000004512 77
400 3300009553 Ga0105249_10037409 Ga0105249_100374095 77
401 3300009553 Ga0105249_10084345 Ga0105249_100843455 77
402 3300009553 Ga0105249_10265973 Ga0105249_102659732 77
403 3300009553 Ga0105249_10758182 Ga0105249_107581823 77
404 3300010375 Ga0105239_10012172 Ga0105239_100121725 77
405 3300010375 Ga0105239_10326543 Ga0105239_103265433 77
406 3300010375 Ga0105239_10846266 Ga0105239_108462662 77
407 3300010375 Ga0105239_10931845 Ga0105239_109318452 77
408 3300011119 Ga0105246_10001620 Ga0105246_1000162012 77
409 3300012513 Ga0157326_1000423 Ga0157326_10004233 77
410 3300013100 Ga0157373_10081550 Ga0157373_100815502 77
411 3300013100 Ga0157373_10136804 Ga0157373_101368044 77
412 3300013100 Ga0157373_10232191 Ga0157373_102321912 77
413 3300013102 Ga0157371_10160163 Ga0157371_101601632 77
414 3300013102 Ga0157371_10492244 Ga0157371_104922443 77
415 3300013102 Ga0157371_11482642 Ga0157371_114826422 77
416 3300013102 Ga0157371_11598663 Ga0157371_115986632 77
417 3300013102 Ga0157371_11604795 Ga0157371_116047952 77
418 3300013104 Ga0157370_10000069 Ga0157370_1000006957 77
419 3300013104 Ga0157370_10057965 Ga0157370_100579656 77
420 3300013104 Ga0157370_10174746 Ga0157370_101747462 77
421 3300013104 Ga0157370_10647775 Ga0157370_106477751 77
422 3300013104 Ga0157370_10971235 Ga0157370_109712352 77
423 3300013104 Ga0157370_11695857 Ga0157370_116958571 77
424 3300013105 Ga0157369_10012597 Ga0157369_100125979 77
425 3300013105 Ga0157369_10173906 Ga0157369_101739064 77
426 3300013105 Ga0157369_10174888 Ga0157369_101748883 77
427 3300013105 Ga0157369_12357748 Ga0157369_123577481 77
428 3300013296 Ga0157374_10100942 Ga0157374_101009422 77
429 3300013296 Ga0157374_10393274 Ga0157374_103932743 77
430 3300013296 Ga0157374_10432242 Ga0157374_104322423 77
431 3300013297 Ga0157378_10002300 Ga0157378_1000230012 77
432 3300013306 Ga0163162_10016081 Ga0163162_100160817 77
433 3300013306 Ga0163162_13217757 Ga0163162_132177571 77
434 3300013307 Ga0157372_10118609 Ga0157372_101186094 77
435 3300013307 Ga0157372_10209575 Ga0157372_102095753 77
436 3300013307 Ga0157372_10258817 Ga0157372_102588174 77
437 3300013307 Ga0157372_10288298 Ga0157372_102882984 77
438 3300013307 Ga0157372_10337590 Ga0157372_103375905 77
439 3300013307 Ga0157372_10567943 Ga0157372_105679432 77
440 3300013307 Ga0157372_10932088 Ga0157372_109320882 77
441 3300013307 Ga0157372_12775511 Ga0157372_127755112 77
442 3300013308 Ga0157375_10041491 Ga0157375_100414916 77
443 3300013308 Ga0157375_10798349 Ga0157375_107983493 77
444 3300014326 Ga0157380_10000029 Ga0157380_1000002964 77
445 3300014326 Ga0157380_10001161 Ga0157380_1000116110 77
446 3300014326 Ga0157380_10230670 Ga0157380_102306702 77
447 3300014326 Ga0157380_12204024 Ga0157380_122040241 77
448 3300014745 Ga0157377_10067056 Ga0157377_100670565 77
449 3300014968 Ga0157379_10770590 Ga0157379_107705902 77
450 3300014969 Ga0157376_10000089 Ga0157376_1000008950 77
451 3300017792 Ga0163161_10000101 Ga0163161_1000010152 77
452 3300017792 Ga0163161_10019426 Ga0163161_100194264 77
453 3300017792 Ga0163161_10148380 Ga0163161_101483802 77
454 3300017792 Ga0163161_11831506 Ga0163161_118315062 77
455 3300020070 Ga0206356_11727543 Ga0206356_117275432 77
456 3300020078 Ga0206352_10131959 Ga0206352_101319592 77
457 3300025229 Ga0209147_103605 Ga0209147_1036052 77
458 3300025231 Ga0207427_101450 Ga0207427_10145010 77
459 3300025245 Ga0207425_1000041 Ga0207425_100004163 77
460 3300025245 Ga0207425_1015629 Ga0207425_10156293 77
461 3300025250 Ga0209026_1004345 Ga0209026_10043455 77
462 3300025254 Ga0209148_1000238 Ga0209148_100023851 77
463 3300025254 Ga0209148_1001034 Ga0209148_100103425 77
464 3300025258 Ga0209129_1002094 Ga0209129_10020942 77
465 3300025261 Ga0209233_1000079 Ga0209233_1000079102 77
466 3300025261 Ga0209233_1073702 Ga0209233_10737022 77
467 3300025263 Ga0209565_1000008 Ga0209565_1000008633 77
468 3300025263 Ga0209565_1000134 Ga0209565_100013447 77
469 3300025272 Ga0209455_1000952 Ga0209455_10009526 77
470 3300025272 Ga0209455_1056735 Ga0209455_10567352 77
471 3300025273 Ga0209673_1002352 Ga0209673_100235212 77
472 3300025273 Ga0209673_1029162 Ga0209673_10291622 77
473 3300025291 Ga0209675_1009250 Ga0209675_10092505 77
474 3300025292 Ga0209676_1026408 Ga0209676_10264083 77
475 3300025294 Ga0209025_1000068 Ga0209025_1000068232 77
476 3300025295 Ga0209564_1080218 Ga0209564_10802182 77
477 3300025297 Ga0209758_1000004 Ga0209758_1000004131 77
478 3300025297 Ga0209758_1012697 Ga0209758_10126977 77
479 3300025298 Ga0209050_1000001 Ga0209050_10000012061 77
480 3300025298 Ga0209050_1000581 Ga0209050_100058118 77
481 3300025298 Ga0209050_1000687 Ga0209050_100068713 77
482 3300025298 Ga0209050_1007158 Ga0209050_10071589 77
483 3300025299 Ga0209256_1000009 Ga0209256_1000009236 77
484 3300025299 Ga0209256_1000010 Ga0209256_1000010160 77
485 3300025302 Ga0207426_1037675 Ga0207426_10376753 77
486 3300025303 Ga0209051_1000191 Ga0209051_10001918 77
487 3300025304 Ga0209257_1000876 Ga0209257_100087611 77
488 3300025304 Ga0209257_1002353 Ga0209257_100235310 77
489 3300025304 Ga0209257_1002898 Ga0209257_10028984 77
490 3300025304 Ga0209257_1003401 Ga0209257_10034014 77
491 3300025304 Ga0209257_1037487 Ga0209257_10374871 77
492 3300025304 Ga0209257_1100855 Ga0209257_11008552 77
493 3300025315 Ga0207697_10006525 Ga0207697_100065255 77
494 3300025315 Ga0207697_10530809 Ga0207697_105308092 77
495 3300025321 Ga0207656_10012218 Ga0207656_100122183 77
496 3300025321 Ga0207656_10159701 Ga0207656_101597012 77
497 3300025711 Ga0207696_1007265 Ga0207696_10072653 77
498 3300025735 Ga0207713_1010142 Ga0207713_10101426 77
499 3300025900 Ga0207710_10007240 Ga0207710_100072403 77
500 3300025900 Ga0207710_10012300 Ga0207710_100123003 77
501 3300025900 Ga0207710_10207976 Ga0207710_102079762 77
502 3300025900 Ga0207710_10331102 Ga0207710_103311022 77
503 3300025901 Ga0207688_10409565 Ga0207688_104095651 77
504 3300025901 Ga0207688_10846280 Ga0207688_108462802 77
505 3300025901 Ga0207688_11043763 Ga0207688_110437632 77
506 3300025903 Ga0207680_10000010 Ga0207680_10000010156 77
507 3300025903 Ga0207680_10000186 Ga0207680_1000018614 77
508 3300025903 Ga0207680_10093912 Ga0207680_100939124 77
509 3300025904 Ga0207647_10000038 Ga0207647_1000003818 77
510 3300025904 Ga0207647_10002647 Ga0207647_1000264714 77
511 3300025904 Ga0207647_10032481 Ga0207647_100324813 77
512 3300025904 Ga0207647_10041942 Ga0207647_100419425 77
513 3300025904 Ga0207647_10065904 Ga0207647_100659043 77
514 3300025904 Ga0207647_10095073 Ga0207647_100950732 77
515 3300025904 Ga0207647_10207898 Ga0207647_102078982 77
516 3300025904 Ga0207647_10212165 Ga0207647_102121653 77
517 3300025904 Ga0207647_10283643 Ga0207647_102836431 77
518 3300025904 Ga0207647_10393125 Ga0207647_103931252 77
519 3300025907 Ga0207645_10003616 Ga0207645_1000361612 77
520 3300025909 Ga0207705_10000121 Ga0207705_1000012122 77
521 3300025909 Ga0207705_10000365 Ga0207705_1000036535 77
522 3300025909 Ga0207705_10014470 Ga0207705_100144705 77
523 3300025909 Ga0207705_10135124 Ga0207705_101351244 77
524 3300025909 Ga0207705_10159690 Ga0207705_101596903 77
525 3300025911 Ga0207654_10000375 Ga0207654_1000037527 77
526 3300025911 Ga0207654_10080510 Ga0207654_100805103 77
527 3300025911 Ga0207654_10098883 Ga0207654_100988833 77
528 3300025913 Ga0207695_10001183 Ga0207695_1000118319 77
529 3300025913 Ga0207695_10031555 Ga0207695_100315557 77
530 3300025913 Ga0207695_10077775 Ga0207695_100777753 77
531 3300025913 Ga0207695_10223979 Ga0207695_102239791 77
532 3300025913 Ga0207695_10873246 Ga0207695_108732462 77
533 3300025914 Ga0207671_10001192 Ga0207671_1000119214 77
534 3300025914 Ga0207671_11237598 Ga0207671_112375981 77
535 3300025914 Ga0207671_11279455 Ga0207671_112794551 77
536 3300025918 Ga0207662_11126671 Ga0207662_111266712 77
537 3300025919 Ga0207657_10015487 Ga0207657_100154873 77
538 3300025919 Ga0207657_10026870 Ga0207657_100268703 77
539 3300025919 Ga0207657_10048996 Ga0207657_100489965 77
540 3300025919 Ga0207657_10387615 Ga0207657_103876153 77
541 3300025919 Ga0207657_11006315 Ga0207657_110063152 77
542 3300025920 Ga0207649_10150506 Ga0207649_101505063 77
543 3300025920 Ga0207649_10167287 Ga0207649_101672873 77
544 3300025920 Ga0207649_10831047 Ga0207649_108310472 77
545 3300025920 Ga0207649_11059835 Ga0207649_110598352 77
546 3300025921 Ga0207652_10134787 Ga0207652_101347873 77
547 3300025921 Ga0207652_10286625 Ga0207652_102866252 77
548 3300025923 Ga0207681_10000002 Ga0207681_10000002138 77
549 3300025923 Ga0207681_10000005 Ga0207681_10000005357 77
550 3300025923 Ga0207681_10000109 Ga0207681_1000010928 77
551 3300025923 Ga0207681_10000183 Ga0207681_1000018345 77
552 3300025923 Ga0207681_10033288 Ga0207681_100332883 77
553 3300025923 Ga0207681_10094028 Ga0207681_100940285 77
554 3300025923 Ga0207681_10122960 Ga0207681_101229602 77
555 3300025923 Ga0207681_10716631 Ga0207681_107166311 77
556 3300025924 Ga0207694_10002087 Ga0207694_1000208714 77
557 3300025924 Ga0207694_10091001 Ga0207694_100910012 77
558 3300025924 Ga0207694_10345340 Ga0207694_103453401 77
559 3300025924 Ga0207694_10637068 Ga0207694_106370682 77
560 3300025925 Ga0207650_10000004 Ga0207650_10000004361 77
561 3300025925 Ga0207650_10002904 Ga0207650_1000290411 77
562 3300025925 Ga0207650_10006404 Ga0207650_100064045 77
563 3300025925 Ga0207650_10049447 Ga0207650_100494475 77
564 3300025925 Ga0207650_10174974 Ga0207650_101749743 77
565 3300025926 Ga0207659_10136023 Ga0207659_101360233 77
566 3300025927 Ga0207687_10000225 Ga0207687_1000022520 77
567 3300025927 Ga0207687_10010076 Ga0207687_100100766 77
568 3300025931 Ga0207644_10000002 Ga0207644_10000002137 77
569 3300025931 Ga0207644_10000012 Ga0207644_1000001261 77
570 3300025931 Ga0207644_10000067 Ga0207644_1000006748 77
571 3300025931 Ga0207644_10001857 Ga0207644_100018573 77
572 3300025931 Ga0207644_10022749 Ga0207644_100227493 77
573 3300025931 Ga0207644_10700505 Ga0207644_107005052 77
574 3300025932 Ga0207690_10157914 Ga0207690_101579142 77
575 3300025932 Ga0207690_10186911 Ga0207690_101869113 77
576 3300025932 Ga0207690_10337182 Ga0207690_103371823 77
577 3300025932 Ga0207690_10342161 Ga0207690_103421613 77
578 3300025932 Ga0207690_10356195 Ga0207690_103561952 77
579 3300025932 Ga0207690_10878067 Ga0207690_108780671 77
580 3300025933 Ga0207706_10008805 Ga0207706_100088054 77
581 3300025933 Ga0207706_10033279 Ga0207706_100332794 77
582 3300025933 Ga0207706_10083285 Ga0207706_100832854 77
583 3300025933 Ga0207706_10138164 Ga0207706_101381643 77
584 3300025933 Ga0207706_10198802 Ga0207706_101988023 77
585 3300025933 Ga0207706_11217586 Ga0207706_112175862 77
586 3300025934 Ga0207686_10001878 Ga0207686_100018782 77
587 3300025935 Ga0207709_10000173 Ga0207709_1000017346 77
588 3300025935 Ga0207709_10088718 Ga0207709_100887182 77
589 3300025935 Ga0207709_11210901 Ga0207709_112109012 77
590 3300025937 Ga0207669_10046739 Ga0207669_100467393 77
591 3300025937 Ga0207669_11000337 Ga0207669_110003372 77
592 3300025938 Ga0207704_10000001 Ga0207704_10000001322 77
593 3300025940 Ga0207691_10009162 Ga0207691_1000916211 77
594 3300025941 Ga0207711_10000075 Ga0207711_1000007523 77
595 3300025941 Ga0207711_10024088 Ga0207711_100240884 77
596 3300025941 Ga0207711_10114106 Ga0207711_101141062 77
597 3300025941 Ga0207711_10236570 Ga0207711_102365703 77
598 3300025941 Ga0207711_11362142 Ga0207711_113621422 77
599 3300025942 Ga0207689_10000744 Ga0207689_1000074429 77
600 3300025942 Ga0207689_11445008 Ga0207689_114450082 77
601 3300025944 Ga0207661_10482382 Ga0207661_104823822 77
602 3300025944 Ga0207661_11506624 Ga0207661_115066241 77
603 3300025945 Ga0207679_10123611 Ga0207679_101236113 77
604 3300025945 Ga0207679_10140360 Ga0207679_101403605 77
605 3300025949 Ga0207667_10000016 Ga0207667_1000001623 77
606 3300025949 Ga0207667_10011748 Ga0207667_100117489 77
607 3300025949 Ga0207667_10112317 Ga0207667_101123174 77
608 3300025949 Ga0207667_10498960 Ga0207667_104989603 77
609 3300025949 Ga0207667_10638165 Ga0207667_106381652 77
610 3300025960 Ga0207651_10000002 Ga0207651_1000000283 77
611 3300025960 Ga0207651_11013347 Ga0207651_110133472 77
612 3300025961 Ga0207712_10000014 Ga0207712_10000014251 77
613 3300025961 Ga0207712_10000174 Ga0207712_1000017412 77
614 3300025961 Ga0207712_10018137 Ga0207712_100181375 77
615 3300025961 Ga0207712_10057696 Ga0207712_100576963 77
616 3300025961 Ga0207712_10092123 Ga0207712_100921233 77
617 3300025961 Ga0207712_10657395 Ga0207712_106573952 77
618 3300025961 Ga0207712_11277392 Ga0207712_112773922 77
619 3300025961 Ga0207712_11688390 Ga0207712_116883902 77
620 3300025972 Ga0207668_10000081 Ga0207668_1000008158 77
621 3300025972 Ga0207668_10000304 Ga0207668_1000030420 77
622 3300025972 Ga0207668_10005340 Ga0207668_100053409 77
623 3300025972 Ga0207668_10083673 Ga0207668_100836732 77
624 3300025972 Ga0207668_10085277 Ga0207668_100852772 77
625 3300025972 Ga0207668_10328540 Ga0207668_103285402 77
626 3300025972 Ga0207668_10484314 Ga0207668_104843143 77
627 3300025981 Ga0207640_10000063 Ga0207640_1000006334 77
628 3300025981 Ga0207640_10062003 Ga0207640_100620031 77
629 3300025981 Ga0207640_10100271 Ga0207640_101002713 77
630 3300025981 Ga0207640_10157229 Ga0207640_101572294 77
631 3300025981 Ga0207640_11027507 Ga0207640_110275071 77
632 3300025981 Ga0207640_11246724 Ga0207640_112467242 77
633 3300025981 Ga0207640_11397633 Ga0207640_113976331 77
634 3300025986 Ga0207658_10000002 Ga0207658_10000002240 77
635 3300025986 Ga0207658_10001566 Ga0207658_100015663 77
636 3300025986 Ga0207658_10004095 Ga0207658_100040955 77
637 3300025986 Ga0207658_10008782 Ga0207658_100087824 77
638 3300025986 Ga0207658_10018656 Ga0207658_100186564 77
639 3300025986 Ga0207658_10819713 Ga0207658_108197132 77
640 3300026023 Ga0207677_10000030 Ga0207677_1000003054 77
641 3300026035 Ga0207703_10005351 Ga0207703_100053519 77
642 3300026035 Ga0207703_10008030 Ga0207703_100080303 77
643 3300026035 Ga0207703_10009134 Ga0207703_100091348 77
644 3300026035 Ga0207703_10124179 Ga0207703_101241792 77
645 3300026041 Ga0207639_10000213 Ga0207639_1000021312 77
646 3300026041 Ga0207639_10012302 Ga0207639_100123027 77
647 3300026041 Ga0207639_10036850 Ga0207639_100368504 77
648 3300026041 Ga0207639_10122498 Ga0207639_101224983 77
649 3300026041 Ga0207639_10602963 Ga0207639_106029632 77
650 3300026041 Ga0207639_10828173 Ga0207639_108281732 77
651 3300026067 Ga0207678_10000857 Ga0207678_1000085727 77
652 3300026067 Ga0207678_10001793 Ga0207678_100017939 77
653 3300026067 Ga0207678_10088208 Ga0207678_100882083 77
654 3300026078 Ga0207702_10000887 Ga0207702_1000088714 77
655 3300026078 Ga0207702_10002945 Ga0207702_1000294522 77
656 3300026078 Ga0207702_10019109 Ga0207702_100191096 77
657 3300026088 Ga0207641_10000001 Ga0207641_10000001693 77
658 3300026088 Ga0207641_10000099 Ga0207641_1000009973 77
659 3300026088 Ga0207641_10002512 Ga0207641_100025127 77
660 3300026088 Ga0207641_10004505 Ga0207641_100045057 77
661 3300026088 Ga0207641_10013693 Ga0207641_100136935 77
662 3300026088 Ga0207641_10014410 Ga0207641_100144109 77
663 3300026088 Ga0207641_11282650 Ga0207641_112826502 77
664 3300026089 Ga0207648_10000001 Ga0207648_1000000183 77
665 3300026095 Ga0207676_10000006 Ga0207676_10000006351 77
666 3300026095 Ga0207676_10000770 Ga0207676_100007703 77
667 3300026095 Ga0207676_10022559 Ga0207676_100225595 77
668 3300026116 Ga0207674_10131652 Ga0207674_101316521 77
669 3300026116 Ga0207674_10337148 Ga0207674_103371482 77
670 3300026116 Ga0207674_11129632 Ga0207674_111296322 77
671 3300026116 Ga0207674_11201849 Ga0207674_112018491 77
672 3300026118 Ga0207675_100000358 Ga0207675_1000003586 77
673 3300026118 Ga0207675_100001138 Ga0207675_10000113819 77
674 3300026118 Ga0207675_100230090 Ga0207675_1002300904 77
675 3300026121 Ga0207683_10182888 Ga0207683_101828883 77
676 3300026142 Ga0207698_10034383 Ga0207698_100343832 77
677 3300026142 Ga0207698_10130218 Ga0207698_101302184 77
678 3300026142 Ga0207698_10201601 Ga0207698_102016012 77
679 3300026142 Ga0207698_10955811 Ga0207698_109558112 77
680 3300026142 Ga0207698_12752071 Ga0207698_127520712 77
681 3300027312 Ga0209371_1085272 Ga0209371_10852721 77
682 3300027866 Ga0209813_10000051 Ga0209813_1000005137 77
683 3300028379 Ga0268266_10000009 Ga0268266_10000009172 77
684 3300028379 Ga0268266_10002003 Ga0268266_1000200320 77
685 3300028379 Ga0268266_10006189 Ga0268266_1000618911 77
686 3300028379 Ga0268266_10158947 Ga0268266_101589473 77
687 3300028379 Ga0268266_10211526 Ga0268266_102115264 77
688 3300028379 Ga0268266_10315170 Ga0268266_103151703 77
689 3300028379 Ga0268266_10422983 Ga0268266_104229833 77
690 3300028379 Ga0268266_11019591 Ga0268266_110195911 77
691 3300028379 Ga0268266_11411114 Ga0268266_114111142 77
692 3300028380 Ga0268265_10000001 Ga0268265_10000001810 77
693 3300028380 Ga0268265_10000045 Ga0268265_1000004512 77
694 3300028380 Ga0268265_10000047 Ga0268265_1000004776 77
695 3300028380 Ga0268265_10000285 Ga0268265_1000028540 77
696 3300028380 Ga0268265_10004726 Ga0268265_100047267 77
697 3300028380 Ga0268265_10017233 Ga0268265_100172337 77
698 3300028380 Ga0268265_10146980 Ga0268265_101469803 77
699 3300028380 Ga0268265_10315643 Ga0268265_103156433 77
700 3300028380 Ga0268265_10387566 Ga0268265_103875661 77
701 3300028380 Ga0268265_11127984 Ga0268265_111279842 77
702 3300028381 Ga0268264_10000001 Ga0268264_10000001565 77
703 3300028381 Ga0268264_10000010 Ga0268264_10000010355 77
704 3300028381 Ga0268264_10000023 Ga0268264_10000023114 77
705 3300028381 Ga0268264_10004259 Ga0268264_1000425913 77
706 3300028381 Ga0268264_10012572 Ga0268264_100125725 77
707 3300028381 Ga0268264_10105564 Ga0268264_101055643 77
708 3300028381 Ga0268264_10209613 Ga0268264_102096132 77
709 3300028381 Ga0268264_10405038 Ga0268264_104050383 77
710 3300028786 Ga0307517_10633740 Ga0307517_106337402 77
711 3300030500 Ga0268256_1046229 Ga0268256_10462292 77
712 3300030733 Ga0314311_1203820 Ga0314311_12038202 77
713 3300031240 Ga0265320_10000034 Ga0265320_100000344 77
714 3300031241 Ga0265325_10023456 Ga0265325_100234562 77
715 3300031241 Ga0265325_10037185 Ga0265325_100371852 77
716 3300031456 Ga0307513_10209984 Ga0307513_102099843 77
717 3300031548 Ga0307408_100051500 Ga0307408_1000515003 77
718 3300031548 Ga0307408_101128429 Ga0307408_1011284292 77
719 3300031548 Ga0307408_101389987 Ga0307408_1013899872 77
720 3300031595 Ga0265313_10000665 Ga0265313_1000066537 77
721 3300031711 Ga0265314_10019631 Ga0265314_100196312 77
722 3300031711 Ga0265314_10042189 Ga0265314_100421893 77
723 3300031711 Ga0265314_10118950 Ga0265314_101189502 77
724 3300031731 Ga0307405_10055116 Ga0307405_100551163 77
725 3300031731 Ga0307405_10530365 Ga0307405_105303652 77
726 3300031731 Ga0307405_10949213 Ga0307405_109492132 77
727 3300031824 Ga0307413_10332327 Ga0307413_103323273 77
728 3300031824 Ga0307413_11513892 Ga0307413_115138922 77
729 3300031852 Ga0307410_10027090 Ga0307410_100270905 77
730 3300031852 Ga0307410_11135650 Ga0307410_111356502 77
731 3300031901 Ga0307406_10589289 Ga0307406_105892892 77
732 3300031901 Ga0307406_10614399 Ga0307406_106143992 77
733 3300031901 Ga0307406_10706803 Ga0307406_107068031 77
734 3300031901 Ga0307406_11005598 Ga0307406_110055982 77
735 3300031901 Ga0307406_11917748 Ga0307406_119177482 77
736 3300031903 Ga0307407_10257420 Ga0307407_102574201 77
737 3300031911 Ga0307412_10015626 Ga0307412_100156265 77
738 3300031911 Ga0307412_10514991 Ga0307412_105149912 77
739 3300031911 Ga0307412_10947513 Ga0307412_109475132 77
740 3300031911 Ga0307412_11429176 Ga0307412_114291762 77
741 3300031995 Ga0307409_101359966 Ga0307409_1013599662 77
742 3300031995 Ga0307409_102980818 Ga0307409_1029808182 77
743 3300032002 Ga0307416_100014919 Ga0307416_1000149198 77
744 3300032004 Ga0307414_11712720 Ga0307414_117127202 77
745 3300032004 Ga0307414_11795155 Ga0307414_117951551 77
746 3300032005 Ga0307411_10271081 Ga0307411_102710813 77
747 3300032005 Ga0307411_10440296 Ga0307411_104402963 77
748 3300032005 Ga0307411_12160541 Ga0307411_121605412 77
749 3300033180 Ga0307510_10148726 Ga0307510_101487262 77
750 3300035171 Ga0373946_0647350 Ga0373946_0647350_14_256 77
751 3300037312 Ga0395899_0001521 Ga0395899_0001521_16833_17066 77
752 3300037418 Ga0395900_0009291 Ga0395900_0009291_8520_8753 77
753 3300037418 Ga0395900_1114422 Ga0395900_1114422_340_573 77
754 3300037466 Ga0395898_1303005 Ga0395898_1303005_340_573 77
755 3300037471 Ga0395905_0026896 Ga0395905_0026896_268_501 77
756 3300037471 Ga0395905_0516629 Ga0395905_0516629_549_782 77
757 3300038443 Ga0395901_0073008 Ga0395901_0073008_1708_1941 77
758 3300038443 Ga0395901_2127733 Ga0395901_2127733_52_285 77
759 3300039450 Ga0436363_0153792 Ga0436363_0153792_577_834 77
760 3300041404 Ga0439436_0009694 Ga0439436_0009694_2575_2811 77
761 3300041406 Ga0439439_0001779 Ga0439439_0001779_2684_2923 77
762 3300041407 Ga0439447_148918 Ga0439447_148918_233_472 77
763 3300041410 Ga0439461_0000498 Ga0439461_0000498_4777_5016 77
764 3300041410 Ga0439461_0003679 Ga0439461_0003679_121_357 77
765 3300041410 Ga0439461_0080904 Ga0439461_0080904_67_306 77
766 3300041413 Ga0439465_0004274 Ga0439465_0004274_2480_2719 77
767 3300041413 Ga0439465_0004757 Ga0439465_0004757_3130_3369 77
768 3300041452 Ga0451793_0810995 Ga0451793_0810995_85_318 77
769 3300041452 Ga0451793_1584048 Ga0451793_1584048_273_506 77
770 3300041460 Ga0451802_1834731 Ga0451802_1834731_145_381 77
771 3300041462 Ga0451806_522421 Ga0451806_522421_24_260 77
772 3300041486 Ga0451807_0720757 Ga0451807_0720757_400_642 77
773 3300041494 Ga0451837_1536393 Ga0451837_1536393_224_457 77
774 3300041498 Ga0451841_0590837 Ga0451841_0590837_220_453 77
775 3300041512 Ga0451853_3774724 Ga0451853_3774724_87_320 77
776 3300041997 Ga0439431_0038651 Ga0439431_0038651_962_1198 77
777 3300042002 Ga0439442_150916 Ga0439442_150916_252_488 77
778 3300042004 Ga0439445_0033115 Ga0439445_0033115_723_962 77
779 3300042005 Ga0439448_0002459 Ga0439448_0002459_3623_3856 77
780 3300042006 Ga0439432_000640 Ga0439432_000640_11321_11560 77
781 3300042006 Ga0439432_022961 Ga0439432_022961_82_321 77
782 3300042010 Ga0439452_018803 Ga0439452_018803_881_1120 77
783 3300042014 Ga0439457_024428 Ga0439457_024428_77_316 77
784 3300042015 Ga0439462_0002776 Ga0439462_0002776_904_1143 77
785 3300042124 Ga0450922_019334 Ga0450922_019334_33_269 77
786 3300042156 Ga0439446_0034458 Ga0439446_0034458_1152_1391 77
787 3300042157 Ga0439458_0000137 Ga0439458_0000137_2376_2609 77
788 3300042185 Ga0450909_012035 Ga0450909_012035_749_985 77
789 3300042435 Ga0439434_0020110 Ga0439434_0020110_669_908 77
790 3300042461 Ga0439460_0201787 Ga0439460_0201787_262_495 77
791 3300044683 Ga0466965_0529846 Ga0466965_0529846_355_588 77
792 3300044694 Ga0466963_0311463 Ga0466963_0311463_232_465 77
793 3300044765 Ga0466970_0256774 Ga0466970_0256774_113_346 77
794 3300045836 Ga0466958_0391983 Ga0466958_0391983_515_748 77
795 3300045976 Ga0466967_0633257 Ga0466967_0633257_369_602 77
796 3300045976 Ga0466967_2162402 Ga0466967_2162402_45_278 77
797 3300046452 Ga0495617_011498 Ga0495617_011498_1209_1442 77
798 3300046453 Ga0495627_000156 Ga0495627_000156_31077_31310 77
799 3300046453 Ga0495627_000578 Ga0495627_000578_23475_23708 77
800 3300046453 Ga0495627_034662 Ga0495627_034662_317_556 77
801 3300046460 Ga0495638_0000758 Ga0495638_0000758_26384_26617 77
802 3300046460 Ga0495638_0188677 Ga0495638_0188677_261_503 77
803 3300046462 Ga0495651_0721380 Ga0495651_0721380_136_369 77
804 3300046471 Ga0495650_0001027 Ga0495650_0001027_21771_22004 77
805 3300046471 Ga0495650_0227391 Ga0495650_0227391_203_436 77
806 3300046492 Ga0495585_0127704 Ga0495585_0127704_291_524 77
807 3300046492 Ga0495585_0567920 Ga0495585_0567920_104_346 77
808 3300046506 Ga0495583_0220617 Ga0495583_0220617_198_431 77
809 3300046507 Ga0495606_0072058 Ga0495606_0072058_361_594 77
810 3300046512 Ga0495610_0000291 Ga0495610_0000291_51494_51727 77
811 3300046512 Ga0495610_0144969 Ga0495610_0144969_532_765 77
812 3300046513 Ga0495616_0001456 Ga0495616_0001456_4797_5030 77
813 3300046520 Ga0495637_0010852 Ga0495637_0010852_625_858 77
814 3300046520 Ga0495637_0065588 Ga0495637_0065588_312_554 77
815 3300046522 Ga0495643_0523213 Ga0495643_0523213_246_479 77
816 3300046524 Ga0495648_0010683 Ga0495648_0010683_5947_6180 77
817 3300046525 Ga0495663_0018920 Ga0495663_0018920_604_837 77
818 3300046525 Ga0495663_0053401 Ga0495663_0053401_44_277 77
819 3300046525 Ga0495663_0242178 Ga0495663_0242178_45_284 77
820 3300046542 Ga0495597_0031259 Ga0495597_0031259_731_973 77
821 3300046558 Ga0495633_0013695 Ga0495633_0013695_2792_3025 77
822 3300046558 Ga0495633_0072188 Ga0495633_0072188_852_1085 77
823 3300046558 Ga0495633_0146062 Ga0495633_0146062_327_569 77
824 3300046616 Ga0495668_0002221 Ga0495668_0002221_15410_15643 77
825 3300046616 Ga0495668_0105921 Ga0495668_0105921_234_476 77
826 3300046616 Ga0495668_0574724 Ga0495668_0574724_204_443 77
827 3300046660 Ga0495625_0000629 Ga0495625_0000629_8476_8709 77
828 3300046660 Ga0495625_0393492 Ga0495625_0393492_304_543 77
829 3300046665 Ga0495661_0125781 Ga0495661_0125781_1162_1401 77
830 3300046691 Ga0495670_0000002 Ga0495670_0000002_87294_87533 77
831 3300046691 Ga0495670_0427746 Ga0495670_0427746_278_511 77
832 3300046694 Ga0495649_0327109 Ga0495649_0327109_259_498 77
833 3300047318 Ga0495636_0180483 Ga0495636_0180483_285_524 77
834 3300047320 Ga0495672_0174663 Ga0495672_0174663_752_985 77
835 3300047320 Ga0495672_0212818 Ga0495672_0212818_40_273 77
836 3300047469 Ga0495673_0028297 Ga0495673_0028297_84_317 77
837 3300047470 Ga0495681_0000098 Ga0495681_0000098_11683_11916 77
838 3300047470 Ga0495681_0009646 Ga0495681_0009646_3401_3640 77
839 3300047470 Ga0495681_0326806 Ga0495681_0326806_300_542 77
840 3300047472 Ga0495686_0005063 Ga0495686_0005063_5067_5300 77
841 3300047472 Ga0495686_0008463 Ga0495686_0008463_5328_5561 77
842 3300047472 Ga0495686_0029938 Ga0495686_0029938_2886_3119 77
843 3300047472 Ga0495686_0042056 Ga0495686_0042056_501_734 77
844 3300047472 Ga0495686_0248449 Ga0495686_0248449_720_953 77
845 3300047472 Ga0495686_0377163 Ga0495686_0377163_348_581 77
846 3300048903 Ga0496100_0182282 Ga0496100_0182282_40_273 77
847 3300048903 Ga0496100_1223371 Ga0496100_1223371_151_390 77
848 3300048904 Ga0496101_0111668 Ga0496101_0111668_1575_1808 77
849 3300048904 Ga0496101_0346342 Ga0496101_0346342_284_517 77
850 3300048905 Ga0496102_0000069 Ga0496102_0000069_59582_59815 77
851 3300048905 Ga0496102_0000615 Ga0496102_0000615_33872_34105 77
852 3300048905 Ga0496102_0172254 Ga0496102_0172254_1067_1300 77
853 3300048905 Ga0496102_0681373 Ga0496102_0681373_542_781 77
854 3300048906 Ga0496103_0000173 Ga0496103_0000173_18174_18407 77
855 3300048906 Ga0496103_0009010 Ga0496103_0009010_4392_4625 77
856 3300048906 Ga0496103_0033025 Ga0496103_0033025_2836_3069 77
857 3300048906 Ga0496103_0224202 Ga0496103_0224202_383_622 77
858 3300048907 Ga0496104_0000081 Ga0496104_0000081_2876_3109 77
859 3300048907 Ga0496104_0059792 Ga0496104_0059792_1359_1592 77
860 3300048908 Ga0496105_0000034 Ga0496105_0000034_104573_104806 77
861 3300048908 Ga0496105_0090922 Ga0496105_0090922_135_368 77
862 3300048908 Ga0496105_0363545 Ga0496105_0363545_309_542 77
863 3300048909 Ga0496106_0076352 Ga0496106_0076352_580_813 77
864 3300048910 Ga0496107_0252341 Ga0496107_0252341_188_421 77
865 3300048912 Ga0496109_0067327 Ga0496109_0067327_2262_2495 77
866 3300048912 Ga0496109_0353061 Ga0496109_0353061_860_1099 77
867 3300048912 Ga0496109_0539887 Ga0496109_0539887_452_685 77
868 3300048913 Ga0496110_0093856 Ga0496110_0093856_1609_1842 77
869 3300048913 Ga0496110_0325345 Ga0496110_0325345_200_433 77
870 3300048915 Ga0496112_0116278 Ga0496112_0116278_1691_1924 77
871 3300048915 Ga0496112_0663427 Ga0496112_0663427_684_917 77
872 3300048916 Ga0496113_0000101 Ga0496113_0000101_33143_33376 77
873 3300048916 Ga0496113_0366514 Ga0496113_0366514_730_963 77
874 3300048916 Ga0496113_1445932 Ga0496113_1445932_225_458 77
875 3300048918 Ga0496115_0001129 Ga0496115_0001129_12535_12774 77
876 3300048918 Ga0496115_0108956 Ga0496115_0108956_294_527 77
877 3300048918 Ga0496115_1026514 Ga0496115_1026514_274_507 77
878 3300048919 Ga0496116_0000062 Ga0496116_0000062_268047_268280 77
879 3300048919 Ga0496116_0000566 Ga0496116_0000566_9404_9637 77
880 3300048919 Ga0496116_0032138 Ga0496116_0032138_2407_2640 77
881 3300048919 Ga0496116_0101176 Ga0496116_0101176_949_1182 77
882 3300048919 Ga0496116_0361464 Ga0496116_0361464_130_363 77
883 3300048920 Ga0496117_0000146 Ga0496117_0000146_81370_81603 77
884 3300048920 Ga0496117_0000485 Ga0496117_0000485_48203_48436 77
885 3300048920 Ga0496117_0046000 Ga0496117_0046000_2901_3134 77
886 3300048920 Ga0496117_0251385 Ga0496117_0251385_534_773 77
887 3300048920 Ga0496117_0318261 Ga0496117_0318261_315_554 77
888 3300048920 Ga0496117_0330651 Ga0496117_0330651_196_429 77
889 3300048921 Ga0496118_0000190 Ga0496118_0000190_48203_48436 77
890 3300048921 Ga0496118_0015425 Ga0496118_0015425_5962_6195 77
891 3300048921 Ga0496118_0057773 Ga0496118_0057773_86_319 77
892 3300048921 Ga0496118_0079363 Ga0496118_0079363_437_670 77
893 3300048921 Ga0496118_0104776 Ga0496118_0104776_613_846 77
894 3300048921 Ga0496118_0139050 Ga0496118_0139050_878_1117 77
895 3300048921 Ga0496118_0370348 Ga0496118_0370348_66_299 77
896 3300048922 Ga0496119_0000057 Ga0496119_0000057_68941_69174 77
897 3300048922 Ga0496119_0072971 Ga0496119_0072971_1007_1240 77
898 3300048922 Ga0496119_0180016 Ga0496119_0180016_765_998 77
899 3300048922 Ga0496119_0186126 Ga0496119_0186126_226_465 77
900 3300048922 Ga0496119_0313654 Ga0496119_0313654_213_446 77
901 3300048923 Ga0496120_0005360 Ga0496120_0005360_2860_3093 77
902 3300048923 Ga0496120_0110614 Ga0496120_0110614_768_1001 77
903 3300048923 Ga0496120_0178484 Ga0496120_0178484_397_630 77
904 3300048923 Ga0496120_0185785 Ga0496120_0185785_190_423 77
905 3300048924 Ga0496121_0005623 Ga0496121_0005623_257_490 77
906 3300048924 Ga0496121_0015601 Ga0496121_0015601_1787_2020 77
907 3300048924 Ga0496121_0058069 Ga0496121_0058069_650_883 77
908 3300048924 Ga0496121_0180678 Ga0496121_0180678_494_727 77
909 3300048924 Ga0496121_0205134 Ga0496121_0205134_147_380 77
910 3300048924 Ga0496121_0907952 Ga0496121_0907952_147_380 77
911 3300048925 Ga0496122_0000723 Ga0496122_0000723_28323_28556 77
912 3300048925 Ga0496122_0006671 Ga0496122_0006671_86_319 77
913 3300048925 Ga0496122_0026134 Ga0496122_0026134_811_1044 77
914 3300048925 Ga0496122_0366886 Ga0496122_0366886_38_271 77
915 3300048926 Ga0496123_0000545 Ga0496123_0000545_2841_3074 77
916 3300048926 Ga0496123_0002968 Ga0496123_0002968_10291_10524 77
917 3300048926 Ga0496123_0062259 Ga0496123_0062259_443_676 77
918 3300048926 Ga0496123_0235440 Ga0496123_0235440_285_518 77
919 3300048927 Ga0496124_0000546 Ga0496124_0000546_15189_15422 77
920 3300048927 Ga0496124_0000874 Ga0496124_0000874_14361_14600 77
921 3300048927 Ga0496124_0002439 Ga0496124_0002439_5822_6055 77
922 3300048927 Ga0496124_0006061 Ga0496124_0006061_12745_12978 77
923 3300048927 Ga0496124_0081473 Ga0496124_0081473_1236_1469 77
924 3300048927 Ga0496124_0299780 Ga0496124_0299780_101_343 77
925 3300048927 Ga0496124_0474242 Ga0496124_0474242_308_541 77
926 3300048927 Ga0496124_0507938 Ga0496124_0507938_150_383 77
927 3300048927 Ga0496124_0805486 Ga0496124_0805486_145_378 77
928 3300048928 Ga0496125_0002465 Ga0496125_0002465_2927_3160 77
929 3300048928 Ga0496125_0006988 Ga0496125_0006988_2828_3061 77
930 3300048928 Ga0496125_0033431 Ga0496125_0033431_1475_1708 77
931 3300048928 Ga0496125_0071024 Ga0496125_0071024_353_586 77
932 3300048928 Ga0496125_0355978 Ga0496125_0355978_269_511 77
933 3300048928 Ga0496125_0415581 Ga0496125_0415581_468_701 77
934 3300048928 Ga0496125_0439744 Ga0496125_0439744_330_563 77
935 3300048929 Ga0496126_0000028 Ga0496126_0000028_87300_87533 77
936 3300048929 Ga0496126_0006838 Ga0496126_0006838_5050_5283 77
937 3300048929 Ga0496126_0034229 Ga0496126_0034229_878_1111 77
938 3300048929 Ga0496126_0054886 Ga0496126_0054886_3096_3335 77
939 3300048929 Ga0496126_0150910 Ga0496126_0150910_1048_1281 77
940 3300048929 Ga0496126_0372477 Ga0496126_0372477_663_902 77
941 3300049459 Ga0495678_014836 Ga0495678_014836_3367_3600 77
942 3300049513 Ga0501290_000237 Ga0501290_000237_5043_5276 77
943 3300049515 Ga0501292_000042 Ga0501292_000042_27925_28158 77
944 3300049517 Ga0501294_000032 Ga0501294_000032_2651_2884 77
945 3300049520 Ga0501297_009582 Ga0501297_009582_383_616 77
946 3300049523 Ga0501300_000392 Ga0501300_000392_5669_5902 77
947 3300049525 Ga0501302_002270 Ga0501302_002270_708_941 77
948 3300049531 Ga0501315_000962 Ga0501315_000962_1098_1331 77
949 3300049533 Ga0501317_002915 Ga0501317_002915_1117_1350 77
950 3300049534 Ga0501318_049501 Ga0501318_049501_100_333 77
951 3300049537 Ga0501321_023679 Ga0501321_023679_401_634 77
952 3300049551 Ga0501335_000615 Ga0501335_000615_1430_1663 77
953 3300049553 Ga0501337_013057 Ga0501337_013057_215_448 77
954 3300049570 Ga0501033_0085723 Ga0501033_0085723_763_996 77
955 3300049571 Ga0501034_0099962 Ga0501034_0099962_1411_1644 77
956 3300049571 Ga0501034_0285394 Ga0501034_0285394_355_588 77
957 3300049574 Ga0501038_0164937 Ga0501038_0164937_817_1050 77
958 3300049574 Ga0501038_0323317 Ga0501038_0323317_379_612 77
959 3300049574 Ga0501038_0770013 Ga0501038_0770013_204_437 77
960 3300049577 Ga0501041_0866607 Ga0501041_0866607_76_309 77
961 3300049578 Ga0501042_0040621 Ga0501042_0040621_2449_2682 77
962 3300049578 Ga0501042_0260954 Ga0501042_0260954_382_615 77
963 3300049579 Ga0501043_0113159 Ga0501043_0113159_1694_1927 77
964 3300049580 Ga0501046_0030454 Ga0501046_0030454_2064_2297 77
965 3300049581 Ga0501047_0000731 Ga0501047_0000731_8701_8934 77
966 3300049581 Ga0501047_0450251 Ga0501047_0450251_246_479 77
967 3300049581 Ga0501047_0935022 Ga0501047_0935022_19_252 77
968 3300049586 Ga0501070_0968333 Ga0501070_0968333_349_582 77
969 3300049587 Ga0501071_0191090 Ga0501071_0191090_1028_1261 77
970 3300049587 Ga0501071_1187966 Ga0501071_1187966_263_496 77
971 3300049589 Ga0501073_0139551 Ga0501073_0139551_684_917 77
972 3300049590 Ga0501074_0761420 Ga0501074_0761420_89_322 77
973 3300049591 Ga0501075_0834129 Ga0501075_0834129_239_472 77
974 3300049592 Ga0501076_0426670 Ga0501076_0426670_813_1046 77
975 3300049592 Ga0501076_1405930 Ga0501076_1405930_232_465 77
976 3300049593 Ga0501077_0216387 Ga0501077_0216387_342_575 77
977 3300049653 Ga0501206_003378 Ga0501206_003378_29_262 77
978 3300049658 Ga0501211_000103 Ga0501211_000103_6026_6259 77
979 3300049662 Ga0501222_001746 Ga0501222_001746_1037_1270 77
980 3300049663 Ga0501223_004016 Ga0501223_004016_2229_2462 77
981 3300049663 Ga0501223_036809 Ga0501223_036809_512_745 77
982 3300049664 Ga0501224_000754 Ga0501224_000754_3086_3319 77
983 3300049665 Ga0501227_028030 Ga0501227_028030_644_877 77
984 3300049668 Ga0501233_012436 Ga0501233_012436_1265_1498 77
985 3300049669 Ga0501235_001097 Ga0501235_001097_922_1155 77
986 3300049670 Ga0501236_053975 Ga0501236_053975_414_647 77
987 3300049688 Ga0501259_001391 Ga0501259_001391_772_1005 77
988 3300049690 Ga0501261_000021 Ga0501261_000021_24210_24443 77
989 3300049704 Ga0501221_003846 Ga0501221_003846_727_960 77
990 3300049705 Ga0501225_0006973 Ga0501225_0006973_3034_3267 77
991 3300049705 Ga0501225_0043405 Ga0501225_0043405_797_1030 77
992 3300049741 Ga0501079_0374717 Ga0501079_0374717_671_904 77
993 3300049742 Ga0501080_0702389 Ga0501080_0702389_207_440 77
994 3300049744 Ga0501083_0292932 Ga0501083_0292932_178_411 77
995 3300049761 Ga0501264_008163 Ga0501264_008163_356_589 77
996 3300049773 Ga0501276_013553 Ga0501276_013553_428_661 77
997 3300049775 Ga0501279_000010 Ga0501279_000010_10053_10286 77
998 3300049776 Ga0501280_000064 Ga0501280_000064_12687_12920 77
999 3300049776 Ga0501280_001057 Ga0501280_001057_381_614 77
1000 3300049777 Ga0501281_00086 Ga0501281_00086_1313_1546 77
1001 3300049778 Ga0501282_000404 Ga0501282_000404_1020_1253 77
1002 3300049779 Ga0501283_001453 Ga0501283_001453_834_1067 77
1003 3300049822 Ga0501035_0179700 Ga0501035_0179700_1038_1271 77
1004 3300049822 Ga0501035_0244287 Ga0501035_0244287_581_814 77
1005 3300049822 Ga0501035_1048316 Ga0501035_1048316_150_383 77
1006 3300049823 Ga0501044_0134255 Ga0501044_0134255_79_312 77
1007 3300049823 Ga0501044_0204047 Ga0501044_0204047_750_983 77
1008 3300049823 Ga0501044_0896240 Ga0501044_0896240_472_705 77
1009 3300049853 Ga0501226_021697 Ga0501226_021697_270_503 77
1010 3300050005 Ga0501284_02268 Ga0501284_02268_457_690 77
1011 3300050490 nmdc:mga03n38_266481_c1 nmdc:mga03n38_266481_c1_145_378 77
1012 3300050491 nmdc:mga00v17_75476_c1 nmdc:mga00v17_75476_c1_298_531 77
1013 3300050491 nmdc:mga00v17_911672_c1 nmdc:mga00v17_911672_c1_157_390 77
1014 3300050493 nmdc:mga0k408_344198_c1 nmdc:mga0k408_344198_c1_382_615 77
1015 3300050493 nmdc:mga0k408_529690_c1 nmdc:mga0k408_529690_c1_176_409 77
1016 3300050493 nmdc:mga0k408_583414_c1 nmdc:mga0k408_583414_c1_37_270 77
1017 3300050493 nmdc:mga0k408_832522_c1 nmdc:mga0k408_832522_c1_129_368 77
1018 3300050494 nmdc:mga06z11_17_c1 nmdc:mga06z11_17_c1_11741_11974 77
1019 3300050495 nmdc:mga04h51_146_c1 nmdc:mga04h51_146_c1_11741_11974 77
1020 3300050495 nmdc:mga04h51_411911_c1 nmdc:mga04h51_411911_c1_177_410 77
1021 3300050496 nmdc:mga07m45_111328_c1 nmdc:mga07m45_111328_c1_61_294 77
1022 3300050496 nmdc:mga07m45_567769_c1 nmdc:mga07m45_567769_c1_185_424 77
1023 3300050496 nmdc:mga07m45_60295_c1 nmdc:mga07m45_60295_c1_1454_1687 77
1024 3300050507 nmdc:mga05p37_171786_c1 nmdc:mga05p37_171786_c1_897_1130 77
1025 3300050507 nmdc:mga05p37_2021674_c1 nmdc:mga05p37_2021674_c1_234_476 77
1026 3300053087 Ga0500643_010906 Ga0500643_010906_2736_2975 77
1027 3300053091 Ga0500647_0376821 Ga0500647_0376821_13_255 77
1028 3300053093 Ga0500651_0086862 Ga0500651_0086862_1022_1264 77
1029 3300053094 Ga0500566_0004538 Ga0500566_0004538_7526_7765 77
1030 3300053096 Ga0500641_0004173 Ga0500641_0004173_3009_3248 77
1031 3300053096 Ga0500641_0136367 Ga0500641_0136367_355_588 77
1032 3300053108 Ga0500562_070755 Ga0500562_070755_469_702 77
1033 3300053116 Ga0500592_001156 Ga0500592_001156_2284_2517 77
1034 3300053118 Ga0500594_0054708 Ga0500594_0054708_137_376 77
1035 3300053119 Ga0500595_000572 Ga0500595_000572_13449_13688 77
1036 3300053119 Ga0500595_055810 Ga0500595_055810_812_1045 77
1037 3300053122 Ga0500608_066104 Ga0500608_066104_1252_1491 77
1038 3300053125 Ga0500618_014810 Ga0500618_014810_1062_1304 77
1039 3300053128 Ga0500626_092170 Ga0500626_092170_446_685 77
1040 3300053130 Ga0500642_0014296 Ga0500642_0014296_2208_2450 77
1041 3300053131 Ga0500652_278543 Ga0500652_278543_375_617 77
1042 3300053133 Ga0500655_000251 Ga0500655_000251_8732_8974 77
1043 3300053134 Ga0500658_0010885 Ga0500658_0010885_2110_2349 77
1044 3300053134 Ga0500658_0014446 Ga0500658_0014446_36_275 77
1045 3300053134 Ga0500658_0267841 Ga0500658_0267841_243_485 77
1046 3300053134 Ga0500658_0476850 Ga0500658_0476850_313_546 77
1047 3300053136 Ga0500559_0232776 Ga0500559_0232776_241_474 77
1048 3300053138 Ga0500564_386623 Ga0500564_386623_46_279 77
1049 3300053139 Ga0500568_0018906 Ga0500568_0018906_144_383 77
1050 3300053139 Ga0500568_0092427 Ga0500568_0092427_212_445 77
1051 3300053139 Ga0500568_0195118 Ga0500568_0195118_313_546 77
1052 3300053146 Ga0500588_0071841 Ga0500588_0071841_408_647 77
1053 3300053148 Ga0500590_000131 Ga0500590_000131_7990_8232 77
1054 3300053151 Ga0500604_0036484 Ga0500604_0036484_814_1047 77
1055 3300053151 Ga0500604_0071415 Ga0500604_0071415_423_665 77
1056 3300053153 Ga0500616_0222499 Ga0500616_0222499_78_311 77
1057 3300053153 Ga0500616_0284202 Ga0500616_0284202_212_445 77
1058 3300053153 Ga0500616_0291538 Ga0500616_0291538_195_428 77
1059 3300053156 Ga0500622_0025695 Ga0500622_0025695_380_622 77
1060 3300053156 Ga0500622_0091256 Ga0500622_0091256_755_994 77
1061 3300053157 Ga0500624_000063 Ga0500624_000063_26863_27096 77
1062 3300053158 Ga0500627_0027041 Ga0500627_0027041_1007_1240 77
1063 3300053158 Ga0500627_0378067 Ga0500627_0378067_285_518 77
1064 3300053163 Ga0500639_139272 Ga0500639_139272_357_599 77
1065 3300053177 Ga0500636_0058873 Ga0500636_0058873_1413_1646 77
1066 3300053724 Ga0500570_004079 Ga0500570_004079_2493_2735 77
1067 3300053730 Ga0500645_180888 Ga0500645_180888_199_441 77
1068 3300053730 Ga0500645_223100 Ga0500645_223100_223_462 77
1069 3300053737 Ga0500601_034828 Ga0500601_034828_117_350 77
1070 3300054114 Ga0501084_0791318 Ga0501084_0791318_202_435 77
1071 3300059490 Ga0587066_169647 Ga0587066_169647_96_329 77
1072 3300059493 Ga0587077_168426 Ga0587077_168426_213_446 77
1073 3300059508 Ga0587088_134191 Ga0587088_134191_134_367 77
1074 3300059513 Ga0587094_030537 Ga0587094_030537_189_422 77
1075 3300059640 Ga0587067_076756 Ga0587067_076756_225_458 77
1076 3300059642 Ga0587069_140777 Ga0587069_140777_113_346 77
1077 3300060353 Ga0501082_0979656 Ga0501082_0979656_245_478 77

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

17

78

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.8816 4 77
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.8709 4 77
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.831 3 76
1v60-assembly1.cif.gz_A solution structure of bola1 protein from mus musculus 0.8119 6 76
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.8104 3 76
ID Description Score Start End Superfamily
5nflA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8816 4 77 3.30.300.90
5nflA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8709 4 77 3.30.300.90
af_Q53S33_27_107_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8547 8 77 3.30.300.90
af_P53082_9_118_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.8508 1 75 3.10.20.90
af_Q54GP0_1_85_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8479 3 75 3.30.300.90
ID Description Score Start End GO Terms
AF-A0A258E1I0-F1-model_v4 BolA family transcriptional regulator 0.9824 1 77
AF-A0A357LA00-F1-model_v4 BolA family transcriptional regulator 0.976 1 77
AF-A0A5C8PQA4-F1-model_v4 BolA family transcriptional regulator 0.9741 1 77
AF-A0A1G3ISV3-F1-model_v4 ATP-binding protein 0.9714 1 57 GO:0005524
AF-A0A0S6X249-F1-model_v4 BolA-like protein 0.9686 1 76

Feature Viewer

pLDDT pTM Quality
80.22 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map