F489604
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1077 | 454 | 1053 | 77 |
Family's Representative Sequence
| Representative Sequence | 3300039450|Ga0436363_0153792|Ga0436363_0153792_577_834 |
| Length | 85 |
| Sequence | MPMAASEIEAAIVAALPGAVVTITDLAGDGDHYRAHVVAAGFAGLSRVKQHQLVYNALSGRMGGVLHALQLTTAVPGTAPEGVSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 4 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 5 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 6 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 7 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 8 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 9 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 10 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 11 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 12 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 13 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 14 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 15 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 16 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 17 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 18 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 19 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 20 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 21 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 22 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 23 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 24 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 25 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 26 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 27 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 28 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 29 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 30 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 31 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 32 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 33 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 34 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 35 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 36 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 37 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 38 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 39 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 40 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 41 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 42 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 43 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 44 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 45 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 46 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 47 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 48 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 49 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 50 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 51 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 53 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 54 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 55 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 56 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 57 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 58 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 59 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 60 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 66 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 69 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 78 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 86 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 91 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 95 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 102 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 103 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 107 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 108 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 109 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 110 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 111 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 132 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 144 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 151 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 152 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 156 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 230 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 231 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 232 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 234 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 235 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 236 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 240 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 241 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 242 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 243 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 244 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 245 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 246 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 247 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 248 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 249 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 251 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 256 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 257 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 258 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 259 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 260 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 261 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 262 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 263 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 264 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 265 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 270 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 271 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 272 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 273 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 274 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 275 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 276 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 277 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 278 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 279 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 280 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 281 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 282 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 283 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 284 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 285 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 286 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 287 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 288 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 289 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 290 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 291 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 292 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 293 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 294 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 295 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 336 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 337 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 338 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 339 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 340 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 341 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 342 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 343 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 344 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 345 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 346 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 347 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 348 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 349 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 350 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 351 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 354 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 355 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 356 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 357 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 358 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 359 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 381 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 382 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 383 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 384 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 385 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 386 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 387 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 388 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 389 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 390 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 391 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 392 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 393 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 397 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 398 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 399 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 400 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 401 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 402 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 403 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 406 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 407 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 408 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 409 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 410 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 411 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 412 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 413 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 415 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 416 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 417 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 418 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 419 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 420 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 421 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 422 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 423 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 424 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 425 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 427 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 428 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 429 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 430 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 431 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 432 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 433 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 434 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 435 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 436 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 437 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 438 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 439 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 440 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 441 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 442 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 443 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 444 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 445 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 446 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.47 |
| Metatranscriptomes | 1.3 |
| Isolates | 2.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.19 |
| Bulb | 0 |
| Endosphere | 11.88 |
| Nodule | 0 |
| Rhizoplane | 4.92 |
| Rhizosphere | 71.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_14491 | 2162886007 | Bacteria | 5668 |
| 2 | ARcpr5yngRDRAFT_c004470 | 3300000043 | Bacteria | 1323 |
| 3 | ARCol0yngRDRAFT_1009092 | 3300000652 | Bacteria | 718 |
| 4 | JGI24736J21556_1000613 | 3300001904 | Bacteria | 6542 |
| 5 | JGI24741J21665_1000366 | 3300001915 | Bacteria | 13487 |
| 6 | JGI24752J21851_1006793 | 3300001976 | Bacteria | 1495 |
| 7 | JGI24740J21852_10005104 | 3300001979 | Bacteria | 5575 |
| 8 | JGI24740J21852_10044246 | 3300001979 | Bacteria | 1322 |
| 9 | JGI24739J22299_10005319 | 3300001989 | Bacteria | 4903 |
| 10 | JGI24739J22299_10006470 | 3300001989 | Bacteria | 4419 |
| 11 | JGI24739J22299_10110044 | 3300001989 | Bacteria | 827 |
| 12 | JGI24739J22299_10112626 | 3300001989 | Bacteria | 816 |
| 13 | JGI24739J22299_10159140 | 3300001989 | Bacteria | 667 |
| 14 | JGI24737J22298_10015406 | 3300001990 | Bacteria | 2474 |
| 15 | JGI24737J22298_10020406 | 3300001990 | Bacteria | 2115 |
| 16 | JGI24737J22298_10048588 | 3300001990 | Bacteria | 1291 |
| 17 | JGI24737J22298_10132662 | 3300001990 | Bacteria | 736 |
| 18 | JGI24737J22298_10186610 | 3300001990 | Bacteria | 612 |
| 19 | JGI24743J22301_10030394 | 3300001991 | Bacteria | 1062 |
| 20 | JGI24743J22301_10113531 | 3300001991 | Bacteria | 590 |
| 21 | JGI24735J21928_10000590 | 3300002067 | Bacteria | 12771 |
| 22 | JGI24735J21928_10004614 | 3300002067 | Bacteria | 4616 |
| 23 | JGI24735J21928_10004932 | 3300002067 | Bacteria | 4449 |
| 24 | JGI24735J21928_10015755 | 3300002067 | Bacteria | 2353 |
| 25 | JGI24735J21928_10018807 | 3300002067 | Bacteria | 2128 |
| 26 | JGI24735J21928_10041906 | 3300002067 | Bacteria | 1334 |
| 27 | JGI24735J21928_10058528 | 3300002067 | Bacteria | 1109 |
| 28 | JGI24735J21928_10059101 | 3300002067 | Bacteria | 1102 |
| 29 | JGI24735J21928_10135297 | 3300002067 | Bacteria | 711 |
| 30 | JGI24735J21928_10202768 | 3300002067 | Bacteria | 575 |
| 31 | JGI24748J21848_1005228 | 3300002074 | Bacteria | 1502 |
| 32 | JGI24748J21848_1057374 | 3300002074 | Bacteria | 516 |
| 33 | JGI24738J21930_10000184 | 3300002075 | Bacteria | 16152 |
| 34 | JGI24738J21930_10000231 | 3300002075 | Bacteria | 15154 |
| 35 | JGI24738J21930_10001740 | 3300002075 | Bacteria | 5944 |
| 36 | JGI24738J21930_10015275 | 3300002075 | Bacteria | 1636 |
| 37 | JGI24749J21850_1000049 | 3300002076 | Bacteria | 22639 |
| 38 | JGI24744J21845_10008674 | 3300002077 | Bacteria | 2089 |
| 39 | JGI24035J26624_1026616 | 3300002126 | Bacteria | 622 |
| 40 | JGI24034J26672_10003845 | 3300002239 | Bacteria | 2109 |
| 41 | JGI24034J26672_10041405 | 3300002239 | Bacteria | 774 |
| 42 | JGI24751J29686_10000216 | 3300002459 | Bacteria | 24503 |
| 43 | JGI24751J29686_10018164 | 3300002459 | Bacteria | 1454 |
| 44 | JGI25164J39214_1007846 | 3300002772 | Bacteria | 1076 |
| 45 | JGI25150J39212_1002047 | 3300002774 | Bacteria | 5243 |
| 46 | JGI25151J46595_10122326 | 3300003187 | Bacteria | 661 |
| 47 | JGI25165J46597_1000043 | 3300003214 | Bacteria | 264515 |
| 48 | JGI25153J46596_10000395 | 3300003215 | Bacteria | 29365 |
| 49 | JGI25153J46596_10002504 | 3300003215 | Bacteria | 10546 |
| 50 | rootH1_10113314 | 3300003316 | Bacteria | 1254 |
| 51 | rootH1_10035136 | 3300003323 | Bacteria | 3354 |
| 52 | Ga0055529_1042867 | 3300003763 | Bacteria | 546 |
| 53 | Ga0055537_1001019 | 3300003773 | Bacteria | 12668 |
| 54 | Ga0055524_1000056 | 3300003775 | Bacteria | 141764 |
| 55 | Ga0055528_1020848 | 3300003790 | Bacteria | 2108 |
| 56 | Ga0055530_10000931 | 3300003791 | Bacteria | 23980 |
| 57 | Ga0055530_10007314 | 3300003791 | Bacteria | 4682 |
| 58 | Ga0055540_1002064 | 3300003792 | Bacteria | 11085 |
| 59 | Ga0055531_10012617 | 3300003794 | Bacteria | 3963 |
| 60 | Ga0055531_10015017 | 3300003794 | Bacteria | 3443 |
| 61 | Ga0065165_1005029 | 3300005262 | Bacteria | 7727 |
| 62 | Ga0065165_1009273 | 3300005262 | Bacteria | 4438 |
| 63 | Ga0065165_1017463 | 3300005262 | Bacteria | 2643 |
| 64 | Ga0065165_1062777 | 3300005262 | Bacteria | 1012 |
| 65 | Ga0065714_10116065 | 3300005288 | Bacteria | 1408 |
| 66 | Ga0065704_10070504 | 3300005289 | Bacteria | 22276 |
| 67 | Ga0065707_10000505 | 3300005295 | Bacteria | 50569 |
| 68 | Ga0065707_10086198 | 3300005295 | Bacteria | 5602 |
| 69 | Ga0065707_10135500 | 3300005295 | Bacteria | 1848 |
| 70 | Ga0065707_10212812 | 3300005295 | Bacteria | 1258 |
| 71 | Ga0065707_10371722 | 3300005295 | Bacteria | 889 |
| 72 | Ga0065707_10414622 | 3300005295 | Bacteria | 837 |
| 73 | Ga0065707_10938111 | 3300005295 | Bacteria | 556 |
| 74 | Ga0070658_10006525 | 3300005327 | Bacteria | 9464 |
| 75 | Ga0070658_10068992 | 3300005327 | Bacteria | 2891 |
| 76 | Ga0070658_10097157 | 3300005327 | Bacteria | 2432 |
| 77 | Ga0070658_10584581 | 3300005327 | Bacteria | 967 |
| 78 | Ga0070658_10669238 | 3300005327 | Bacteria | 901 |
| 79 | Ga0070658_11102012 | 3300005327 | Bacteria | 691 |
| 80 | Ga0070676_10000230 | 3300005328 | Bacteria | 23872 |
| 81 | Ga0070683_100195033 | 3300005329 | Bacteria | 1923 |
| 82 | Ga0070670_100000003 | 3300005331 | Bacteria | 529510 |
| 83 | Ga0070670_100002377 | 3300005331 | Bacteria | 15504 |
| 84 | Ga0070670_100004170 | 3300005331 | Bacteria | 12090 |
| 85 | Ga0070670_100126344 | 3300005331 | Bacteria | 2207 |
| 86 | Ga0070670_100189232 | 3300005331 | Bacteria | 1787 |
| 87 | Ga0070677_10801344 | 3300005333 | Bacteria | 538 |
| 88 | Ga0068869_100000200 | 3300005334 | Bacteria | 31213 |
| 89 | Ga0070666_10000184 | 3300005335 | Bacteria | 42807 |
| 90 | Ga0070666_10033483 | 3300005335 | Bacteria | 3400 |
| 91 | Ga0070666_10257671 | 3300005335 | Bacteria | 1236 |
| 92 | Ga0070682_100302630 | 3300005337 | Bacteria | 1174 |
| 93 | Ga0068868_100001398 | 3300005338 | Bacteria | 16647 |
| 94 | Ga0070660_100004583 | 3300005339 | Bacteria | 9552 |
| 95 | Ga0070660_100070534 | 3300005339 | Bacteria | 2727 |
| 96 | Ga0070660_100209408 | 3300005339 | Bacteria | 1582 |
| 97 | Ga0070660_100996905 | 3300005339 | Bacteria | 708 |
| 98 | Ga0070661_100581848 | 3300005344 | Bacteria | 903 |
| 99 | Ga0070661_101005335 | 3300005344 | Bacteria | 692 |
| 100 | Ga0070668_100000026 | 3300005347 | Bacteria | 92584 |
| 101 | Ga0070668_100000080 | 3300005347 | Bacteria | 60157 |
| 102 | Ga0070668_100018364 | 3300005347 | Bacteria | 5250 |
| 103 | Ga0070668_100027483 | 3300005347 | Bacteria | 4320 |
| 104 | Ga0070668_100208292 | 3300005347 | Bacteria | 1607 |
| 105 | Ga0070668_100408180 | 3300005347 | Bacteria | 1161 |
| 106 | Ga0070668_100428915 | 3300005347 | Bacteria | 1133 |
| 107 | Ga0070669_100000008 | 3300005353 | Bacteria | 226764 |
| 108 | Ga0070669_100000020 | 3300005353 | Bacteria | 181297 |
| 109 | Ga0070669_100000082 | 3300005353 | Bacteria | 91465 |
| 110 | Ga0070669_100096603 | 3300005353 | Bacteria | 2223 |
| 111 | Ga0070675_100006627 | 3300005354 | Bacteria | 8902 |
| 112 | Ga0070671_100000015 | 3300005355 | Bacteria | 166132 |
| 113 | Ga0070671_100000169 | 3300005355 | Bacteria | 43010 |
| 114 | Ga0070671_100000470 | 3300005355 | Bacteria | 28105 |
| 115 | Ga0070671_100013092 | 3300005355 | Bacteria | 6684 |
| 116 | Ga0070671_100053502 | 3300005355 | Bacteria | 3356 |
| 117 | Ga0070674_100051002 | 3300005356 | Bacteria | 2849 |
| 118 | Ga0070673_100000006 | 3300005364 | Bacteria | 184299 |
| 119 | Ga0070673_101154028 | 3300005364 | Bacteria | 725 |
| 120 | Ga0070688_100464942 | 3300005365 | Bacteria | 948 |
| 121 | Ga0070659_100052995 | 3300005366 | Bacteria | 3192 |
| 122 | Ga0070659_100899434 | 3300005366 | Bacteria | 774 |
| 123 | Ga0070659_101485301 | 3300005366 | Bacteria | 604 |
| 124 | Ga0070659_101711550 | 3300005366 | Bacteria | 562 |
| 125 | Ga0070667_100000019 | 3300005367 | Bacteria | 224710 |
| 126 | Ga0070667_100006367 | 3300005367 | Bacteria | 9810 |
| 127 | Ga0070667_100037194 | 3300005367 | Bacteria | 4081 |
| 128 | Ga0070667_100038717 | 3300005367 | Bacteria | 3998 |
| 129 | Ga0070667_100681738 | 3300005367 | Bacteria | 950 |
| 130 | Ga0070705_100054779 | 3300005440 | Bacteria | 2341 |
| 131 | Ga0070705_100448402 | 3300005440 | Bacteria | 967 |
| 132 | Ga0070708_100198374 | 3300005445 | Bacteria | 1878 |
| 133 | Ga0070708_101344162 | 3300005445 | Bacteria | 667 |
| 134 | Ga0070663_100000574 | 3300005455 | Bacteria | 19656 |
| 135 | Ga0070663_100002941 | 3300005455 | Bacteria | 9696 |
| 136 | Ga0070663_101387399 | 3300005455 | Bacteria | 622 |
| 137 | Ga0070678_100552397 | 3300005456 | Bacteria | 1022 |
| 138 | Ga0070662_100007108 | 3300005457 | Bacteria | 7246 |
| 139 | Ga0070662_100094062 | 3300005457 | Bacteria | 2256 |
| 140 | Ga0070662_100561610 | 3300005457 | Bacteria | 957 |
| 141 | Ga0070662_100819864 | 3300005457 | Bacteria | 791 |
| 142 | Ga0070662_101003480 | 3300005457 | Bacteria | 715 |
| 143 | Ga0068867_100000001 | 3300005459 | Bacteria | 427563 |
| 144 | Ga0070685_10103920 | 3300005466 | Bacteria | 1739 |
| 145 | Ga0070685_10368722 | 3300005466 | Bacteria | 986 |
| 146 | Ga0070707_101322160 | 3300005468 | Bacteria | 687 |
| 147 | Ga0070679_100158874 | 3300005530 | Bacteria | 2235 |
| 148 | Ga0070679_100424436 | 3300005530 | Bacteria | 1275 |
| 149 | Ga0070684_100251597 | 3300005535 | Bacteria | 1615 |
| 150 | Ga0068853_100143479 | 3300005539 | Bacteria | 2145 |
| 151 | Ga0068853_100881719 | 3300005539 | Bacteria | 859 |
| 152 | Ga0068853_100884100 | 3300005539 | Bacteria | 858 |
| 153 | Ga0068853_102321716 | 3300005539 | Bacteria | 520 |
| 154 | Ga0070672_100004199 | 3300005543 | Bacteria | 9412 |
| 155 | Ga0070686_100290882 | 3300005544 | Bacteria | 1208 |
| 156 | Ga0070665_100002434 | 3300005548 | Bacteria | 20520 |
| 157 | Ga0070665_100009702 | 3300005548 | Bacteria | 9728 |
| 158 | Ga0070665_100095381 | 3300005548 | Bacteria | 2980 |
| 159 | Ga0070665_100378831 | 3300005548 | Bacteria | 1422 |
| 160 | Ga0070665_100420653 | 3300005548 | Bacteria | 1345 |
| 161 | Ga0070665_100895973 | 3300005548 | Bacteria | 900 |
| 162 | Ga0070665_101432299 | 3300005548 | Bacteria | 700 |
| 163 | Ga0068855_100218364 | 3300005563 | Bacteria | 2139 |
| 164 | Ga0068855_100577260 | 3300005563 | Bacteria | 1215 |
| 165 | Ga0068855_101048138 | 3300005563 | Bacteria | 855 |
| 166 | Ga0068855_101587902 | 3300005563 | Bacteria | 670 |
| 167 | Ga0068855_102121698 | 3300005563 | Bacteria | 566 |
| 168 | Ga0068857_100021366 | 3300005577 | Bacteria | 5697 |
| 169 | Ga0068857_100637109 | 3300005577 | Bacteria | 1009 |
| 170 | Ga0068857_100711507 | 3300005577 | Bacteria | 955 |
| 171 | Ga0068854_100000483 | 3300005578 | Bacteria | 24310 |
| 172 | Ga0068854_100301862 | 3300005578 | Bacteria | 1296 |
| 173 | Ga0068854_100538554 | 3300005578 | Bacteria | 988 |
| 174 | Ga0068854_101277453 | 3300005578 | Bacteria | 660 |
| 175 | Ga0068856_100003591 | 3300005614 | Bacteria | 15606 |
| 176 | Ga0068856_100020542 | 3300005614 | Bacteria | 6414 |
| 177 | Ga0068856_100312622 | 3300005614 | Bacteria | 1589 |
| 178 | Ga0068852_100028295 | 3300005616 | Bacteria | 4585 |
| 179 | Ga0068852_100608851 | 3300005616 | Bacteria | 1097 |
| 180 | Ga0068852_101516957 | 3300005616 | Bacteria | 692 |
| 181 | Ga0068859_100003505 | 3300005617 | Bacteria | 15985 |
| 182 | Ga0068859_100023533 | 3300005617 | Bacteria | 6181 |
| 183 | Ga0068859_100034581 | 3300005617 | Bacteria | 5071 |
| 184 | Ga0068859_100216629 | 3300005617 | Bacteria | 2002 |
| 185 | Ga0068859_100679313 | 3300005617 | Bacteria | 1121 |
| 186 | Ga0068859_100859376 | 3300005617 | Bacteria | 993 |
| 187 | Ga0068864_100000005 | 3300005618 | Bacteria | 400840 |
| 188 | Ga0068864_100030140 | 3300005618 | Bacteria | 4598 |
| 189 | Ga0068864_100466728 | 3300005618 | Bacteria | 1210 |
| 190 | Ga0068861_100004980 | 3300005719 | Bacteria | 8951 |
| 191 | Ga0068861_100154977 | 3300005719 | Bacteria | 1883 |
| 192 | Ga0068851_10074177 | 3300005834 | Bacteria | 1765 |
| 193 | Ga0068863_100000001 | 3300005841 | Bacteria | 581116 |
| 194 | Ga0068863_100000582 | 3300005841 | Bacteria | 37202 |
| 195 | Ga0068863_100067996 | 3300005841 | Bacteria | 3370 |
| 196 | Ga0068863_100084694 | 3300005841 | Bacteria | 3004 |
| 197 | Ga0068863_100137511 | 3300005841 | Bacteria | 2334 |
| 198 | Ga0068863_100313791 | 3300005841 | Bacteria | 1522 |
| 199 | Ga0068858_100010355 | 3300005842 | Bacteria | 8831 |
| 200 | Ga0068858_100034454 | 3300005842 | Bacteria | 4697 |
| 201 | Ga0068858_100380650 | 3300005842 | Bacteria | 1354 |
| 202 | Ga0068860_100000036 | 3300005843 | Bacteria | 234917 |
| 203 | Ga0068860_100001081 | 3300005843 | Bacteria | 30047 |
| 204 | Ga0068860_100004358 | 3300005843 | Bacteria | 14457 |
| 205 | Ga0068860_100044110 | 3300005843 | Bacteria | 4251 |
| 206 | Ga0068860_100115216 | 3300005843 | Bacteria | 2570 |
| 207 | Ga0068860_100263556 | 3300005843 | Bacteria | 1680 |
| 208 | Ga0068860_100310382 | 3300005843 | Bacteria | 1546 |
| 209 | Ga0068860_102676641 | 3300005843 | Bacteria | 517 |
| 210 | Ga0068862_100000001 | 3300005844 | Bacteria | 523031 |
| 211 | Ga0068862_100000169 | 3300005844 | Bacteria | 72633 |
| 212 | Ga0068862_100001451 | 3300005844 | Bacteria | 21840 |
| 213 | Ga0068862_100006085 | 3300005844 | Bacteria | 10046 |
| 214 | Ga0068862_100021177 | 3300005844 | Bacteria | 5435 |
| 215 | Ga0068862_100049285 | 3300005844 | Bacteria | 3597 |
| 216 | Ga0068862_100087044 | 3300005844 | Bacteria | 2717 |
| 217 | Ga0068862_101234307 | 3300005844 | Bacteria | 747 |
| 218 | Ga0081455_10000255 | 3300005937 | Bacteria | 69927 |
| 219 | Ga0081455_10023602 | 3300005937 | Bacteria | 5720 |
| 220 | Ga0081538_10004148 | 3300005981 | Bacteria | 13446 |
| 221 | Ga0081538_10036760 | 3300005981 | Bacteria | 3188 |
| 222 | Ga0075364_10197055 | 3300006051 | Bacteria | 1365 |
| 223 | Ga0075364_10888517 | 3300006051 | Bacteria | 607 |
| 224 | Ga0075366_10043167 | 3300006195 | Bacteria | 2671 |
| 225 | Ga0075366_10245806 | 3300006195 | Bacteria | 1091 |
| 226 | Ga0075366_10576769 | 3300006195 | Bacteria | 697 |
| 227 | Ga0075366_10726065 | 3300006195 | Bacteria | 617 |
| 228 | Ga0075366_10801680 | 3300006195 | Bacteria | 586 |
| 229 | Ga0097621_100001076 | 3300006237 | Bacteria | 19102 |
| 230 | Ga0075370_10043587 | 3300006353 | Bacteria | 2536 |
| 231 | Ga0075370_10637142 | 3300006353 | Bacteria | 647 |
| 232 | Ga0068871_100067527 | 3300006358 | Bacteria | 2934 |
| 233 | Ga0068871_101210368 | 3300006358 | Bacteria | 709 |
| 234 | Ga0068865_100000003 | 3300006881 | Bacteria | 231761 |
| 235 | Ga0097620_100003505 | 3300006931 | Bacteria | 15985 |
| 236 | Ga0097620_100023532 | 3300006931 | Bacteria | 6181 |
| 237 | Ga0097620_100034580 | 3300006931 | Bacteria | 5071 |
| 238 | Ga0097620_100216626 | 3300006931 | Bacteria | 2002 |
| 239 | Ga0097620_100679134 | 3300006931 | Bacteria | 1121 |
| 240 | Ga0097620_100859461 | 3300006931 | Bacteria | 993 |
| 241 | Ga0105251_10012362 | 3300009011 | Bacteria | 4831 |
| 242 | Ga0105251_10638162 | 3300009011 | Bacteria | 508 |
| 243 | Ga0105244_10606409 | 3300009036 | Bacteria | 501 |
| 244 | Ga0105250_10006517 | 3300009092 | Bacteria | 5096 |
| 245 | Ga0105240_10015679 | 3300009093 | Bacteria | 10290 |
| 246 | Ga0105240_10025126 | 3300009093 | Bacteria | 7835 |
| 247 | Ga0105240_10091793 | 3300009093 | Bacteria | 3709 |
| 248 | Ga0105240_10318721 | 3300009093 | Bacteria | 1773 |
| 249 | Ga0105240_10744819 | 3300009093 | Bacteria | 1066 |
| 250 | Ga0105240_12089073 | 3300009093 | Bacteria | 588 |
| 251 | Ga0105245_10000113 | 3300009098 | Bacteria | 78545 |
| 252 | Ga0105245_10032215 | 3300009098 | Bacteria | 4641 |
| 253 | Ga0105247_10001891 | 3300009101 | Bacteria | 14614 |
| 254 | Ga0105247_10369422 | 3300009101 | Bacteria | 1014 |
| 255 | Ga0105243_10000373 | 3300009148 | Bacteria | 48115 |
| 256 | Ga0105243_10328860 | 3300009148 | Bacteria | 1395 |
| 257 | Ga0105243_10942050 | 3300009148 | Bacteria | 862 |
| 258 | Ga0105241_10038453 | 3300009174 | Bacteria | 3607 |
| 259 | Ga0105241_10707420 | 3300009174 | Bacteria | 920 |
| 260 | Ga0105242_10000165 | 3300009176 | Bacteria | 49974 |
| 261 | Ga0105248_10001558 | 3300009177 | Bacteria | 25511 |
| 262 | Ga0105248_10024425 | 3300009177 | Bacteria | 6720 |
| 263 | Ga0105248_10043233 | 3300009177 | Bacteria | 5052 |
| 264 | Ga0105248_10088281 | 3300009177 | Bacteria | 3490 |
| 265 | Ga0105248_13138180 | 3300009177 | Bacteria | 526 |
| 266 | Ga0105237_10044206 | 3300009545 | Bacteria | 4485 |
| 267 | Ga0105237_11408470 | 3300009545 | Bacteria | 703 |
| 268 | Ga0105237_11679876 | 3300009545 | Bacteria | 642 |
| 269 | Ga0105237_12603792 | 3300009545 | Bacteria | 516 |
| 270 | Ga0105238_10635331 | 3300009551 | Bacteria | 1077 |
| 271 | Ga0105238_11154457 | 3300009551 | Bacteria | 798 |
| 272 | Ga0105238_11442421 | 3300009551 | Bacteria | 716 |
| 273 | Ga0105249_10000045 | 3300009553 | Bacteria | 182927 |
| 274 | Ga0105249_10019753 | 3300009553 | Bacteria | 6016 |
| 275 | Ga0105249_10037409 | 3300009553 | Bacteria | 4404 |
| 276 | Ga0105249_10084345 | 3300009553 | Bacteria | 2959 |
| 277 | Ga0105249_10265973 | 3300009553 | Bacteria | 1706 |
| 278 | Ga0105249_10758182 | 3300009553 | Bacteria | 1033 |
| 279 | Ga0105239_10000367 | 3300010375 | Bacteria | 66191 |
| 280 | Ga0105239_10012172 | 3300010375 | Bacteria | 9592 |
| 281 | Ga0105239_10326543 | 3300010375 | Bacteria | 1730 |
| 282 | Ga0105239_10846266 | 3300010375 | Bacteria | 1049 |
| 283 | Ga0105239_10931845 | 3300010375 | Bacteria | 997 |
| 284 | Ga0105246_10001620 | 3300011119 | Bacteria | 13399 |
| 285 | Ga0157326_1000423 | 3300012513 | Bacteria | 5017 |
| 286 | Ga0157373_10081550 | 3300013100 | Bacteria | 2280 |
| 287 | Ga0157373_10136804 | 3300013100 | Bacteria | 1723 |
| 288 | Ga0157373_10232191 | 3300013100 | Bacteria | 1303 |
| 289 | Ga0157371_10160163 | 3300013102 | Bacteria | 1607 |
| 290 | Ga0157371_10492244 | 3300013102 | Bacteria | 905 |
| 291 | Ga0157371_11482642 | 3300013102 | Bacteria | 529 |
| 292 | Ga0157371_11598663 | 3300013102 | Bacteria | 510 |
| 293 | Ga0157371_11604795 | 3300013102 | Bacteria | 509 |
| 294 | Ga0157370_10000069 | 3300013104 | Bacteria | 112889 |
| 295 | Ga0157370_10057965 | 3300013104 | Bacteria | 3681 |
| 296 | Ga0157370_10174746 | 3300013104 | Bacteria | 1996 |
| 297 | Ga0157370_10214812 | 3300013104 | Bacteria | 1782 |
| 298 | Ga0157370_10647775 | 3300013104 | Bacteria | 966 |
| 299 | Ga0157370_10971235 | 3300013104 | Bacteria | 770 |
| 300 | Ga0157370_11695857 | 3300013104 | Bacteria | 567 |
| 301 | Ga0157369_10012597 | 3300013105 | Bacteria | 9595 |
| 302 | Ga0157369_10109686 | 3300013105 | Bacteria | 2934 |
| 303 | Ga0157369_10173906 | 3300013105 | Bacteria | 2268 |
| 304 | Ga0157369_10174888 | 3300013105 | Bacteria | 2260 |
| 305 | Ga0157369_12006581 | 3300013105 | Bacteria | 587 |
| 306 | Ga0157369_12357748 | 3300013105 | Bacteria | 539 |
| 307 | Ga0157374_10100942 | 3300013296 | Bacteria | 2766 |
| 308 | Ga0157374_10393274 | 3300013296 | Bacteria | 1382 |
| 309 | Ga0157374_10432242 | 3300013296 | Bacteria | 1316 |
| 310 | Ga0157378_10002300 | 3300013297 | Bacteria | 16976 |
| 311 | Ga0163162_10016081 | 3300013306 | Bacteria | 7314 |
| 312 | Ga0163162_10019579 | 3300013306 | Bacteria | 6643 |
| 313 | Ga0163162_10301457 | 3300013306 | Bacteria | 1734 |
| 314 | Ga0163162_12257592 | 3300013306 | Bacteria | 625 |
| 315 | Ga0163162_13217757 | 3300013306 | Bacteria | 524 |
| 316 | Ga0157372_10113522 | 3300013307 | Bacteria | 3105 |
| 317 | Ga0157372_10118609 | 3300013307 | Bacteria | 3036 |
| 318 | Ga0157372_10209575 | 3300013307 | Bacteria | 2258 |
| 319 | Ga0157372_10258817 | 3300013307 | Bacteria | 2021 |
| 320 | Ga0157372_10288298 | 3300013307 | Bacteria | 1909 |
| 321 | Ga0157372_10337590 | 3300013307 | Bacteria | 1755 |
| 322 | Ga0157372_10567943 | 3300013307 | Bacteria | 1322 |
| 323 | Ga0157372_10932088 | 3300013307 | Bacteria | 1007 |
| 324 | Ga0157372_12775511 | 3300013307 | Bacteria | 562 |
| 325 | Ga0157375_10041491 | 3300013308 | Bacteria | 4443 |
| 326 | Ga0157375_10798349 | 3300013308 | Bacteria | 1093 |
| 327 | Ga0163163_10030114 | 3300014325 | Bacteria | 5225 |
| 328 | Ga0157380_10000029 | 3300014326 | Bacteria | 98248 |
| 329 | Ga0157380_10001161 | 3300014326 | Bacteria | 17056 |
| 330 | Ga0157380_10230670 | 3300014326 | Bacteria | 1663 |
| 331 | Ga0157380_12204024 | 3300014326 | Bacteria | 615 |
| 332 | Ga0182008_10307738 | 3300014497 | Bacteria | 831 |
| 333 | Ga0157377_10067056 | 3300014745 | Bacteria | 2065 |
| 334 | Ga0157379_10128162 | 3300014968 | Bacteria | 2283 |
| 335 | Ga0157379_10770590 | 3300014968 | Bacteria | 906 |
| 336 | Ga0157376_10000089 | 3300014969 | Bacteria | 69351 |
| 337 | Ga0163161_10000101 | 3300017792 | Bacteria | 81604 |
| 338 | Ga0163161_10019426 | 3300017792 | Bacteria | 4767 |
| 339 | Ga0163161_10030597 | 3300017792 | Bacteria | 3833 |
| 340 | Ga0163161_10148380 | 3300017792 | Bacteria | 1781 |
| 341 | Ga0163161_11831506 | 3300017792 | Bacteria | 540 |
| 342 | Ga0206356_11727543 | 3300020070 | Bacteria | 986 |
| 343 | Ga0206352_10131959 | 3300020078 | Bacteria | 789 |
| 344 | Ga0213876_10024618 | 3300021384 | Bacteria | 3178 |
| 345 | Ga0213876_10601056 | 3300021384 | Bacteria | 585 |
| 346 | Ga0213875_10009905 | 3300021388 | Bacteria | 4804 |
| 347 | Ga0213875_10524352 | 3300021388 | Bacteria | 570 |
| 348 | Ga0209147_103605 | 3300025229 | Bacteria | 2915 |
| 349 | Ga0207427_101450 | 3300025231 | Bacteria | 8548 |
| 350 | Ga0207425_1000041 | 3300025245 | Bacteria | 210441 |
| 351 | Ga0207425_1015629 | 3300025245 | Bacteria | 1699 |
| 352 | Ga0209026_1004345 | 3300025250 | Bacteria | 4244 |
| 353 | Ga0209148_1000238 | 3300025254 | Bacteria | 87836 |
| 354 | Ga0209148_1001034 | 3300025254 | Bacteria | 17391 |
| 355 | Ga0209129_1002094 | 3300025258 | Bacteria | 10228 |
| 356 | Ga0209233_1000079 | 3300025261 | Bacteria | 346944 |
| 357 | Ga0209233_1073702 | 3300025261 | Bacteria | 625 |
| 358 | Ga0209565_1000008 | 3300025263 | Bacteria | 774179 |
| 359 | Ga0209565_1000134 | 3300025263 | Bacteria | 104013 |
| 360 | Ga0209455_1000952 | 3300025272 | Bacteria | 14767 |
| 361 | Ga0209455_1056735 | 3300025272 | Bacteria | 526 |
| 362 | Ga0209673_1002352 | 3300025273 | Bacteria | 13340 |
| 363 | Ga0209673_1029162 | 3300025273 | Bacteria | 1761 |
| 364 | Ga0209675_1009250 | 3300025291 | Bacteria | 3499 |
| 365 | Ga0209676_1026408 | 3300025292 | Bacteria | 1844 |
| 366 | Ga0209025_1000068 | 3300025294 | Bacteria | 294129 |
| 367 | Ga0209564_1080218 | 3300025295 | Bacteria | 640 |
| 368 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 369 | Ga0209758_1012697 | 3300025297 | Bacteria | 4679 |
| 370 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 371 | Ga0209050_1000581 | 3300025298 | Bacteria | 59224 |
| 372 | Ga0209050_1000687 | 3300025298 | Bacteria | 50814 |
| 373 | Ga0209050_1007158 | 3300025298 | Bacteria | 6354 |
| 374 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 375 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 376 | Ga0207426_1037675 | 3300025302 | Bacteria | 1528 |
| 377 | Ga0209051_1000191 | 3300025303 | Bacteria | 108763 |
| 378 | Ga0209257_1000876 | 3300025304 | Bacteria | 42634 |
| 379 | Ga0209257_1002353 | 3300025304 | Bacteria | 19010 |
| 380 | Ga0209257_1002898 | 3300025304 | Bacteria | 15899 |
| 381 | Ga0209257_1003401 | 3300025304 | Bacteria | 13704 |
| 382 | Ga0209257_1037487 | 3300025304 | Bacteria | 1478 |
| 383 | Ga0209257_1100855 | 3300025304 | Bacteria | 704 |
| 384 | Ga0207697_10006525 | 3300025315 | Bacteria | 5267 |
| 385 | Ga0207697_10530809 | 3300025315 | Bacteria | 518 |
| 386 | Ga0207656_10012218 | 3300025321 | Bacteria | 3260 |
| 387 | Ga0207656_10159701 | 3300025321 | Bacteria | 1072 |
| 388 | Ga0207696_1007265 | 3300025711 | Bacteria | 4353 |
| 389 | Ga0207713_1010142 | 3300025735 | Bacteria | 5236 |
| 390 | Ga0207713_1036906 | 3300025735 | Bacteria | 2090 |
| 391 | Ga0207710_10007240 | 3300025900 | Bacteria | 4701 |
| 392 | Ga0207710_10012300 | 3300025900 | Bacteria | 3601 |
| 393 | Ga0207710_10207976 | 3300025900 | Bacteria | 968 |
| 394 | Ga0207710_10331102 | 3300025900 | Bacteria | 773 |
| 395 | Ga0207688_10409565 | 3300025901 | Bacteria | 842 |
| 396 | Ga0207688_10846280 | 3300025901 | Bacteria | 579 |
| 397 | Ga0207688_11043763 | 3300025901 | Bacteria | 516 |
| 398 | Ga0207680_10000010 | 3300025903 | Bacteria | 414170 |
| 399 | Ga0207680_10000186 | 3300025903 | Bacteria | 30147 |
| 400 | Ga0207680_10093912 | 3300025903 | Bacteria | 1914 |
| 401 | Ga0207647_10000038 | 3300025904 | Bacteria | 94897 |
| 402 | Ga0207647_10002647 | 3300025904 | Bacteria | 13526 |
| 403 | Ga0207647_10032481 | 3300025904 | Bacteria | 3352 |
| 404 | Ga0207647_10041942 | 3300025904 | Bacteria | 2874 |
| 405 | Ga0207647_10065904 | 3300025904 | Bacteria | 2197 |
| 406 | Ga0207647_10095073 | 3300025904 | Bacteria | 1774 |
| 407 | Ga0207647_10207898 | 3300025904 | Bacteria | 1131 |
| 408 | Ga0207647_10212165 | 3300025904 | Bacteria | 1118 |
| 409 | Ga0207647_10283643 | 3300025904 | Bacteria | 945 |
| 410 | Ga0207647_10393125 | 3300025904 | Bacteria | 782 |
| 411 | Ga0207645_10003616 | 3300025907 | Bacteria | 11690 |
| 412 | Ga0207705_10000121 | 3300025909 | Bacteria | 86649 |
| 413 | Ga0207705_10000365 | 3300025909 | Bacteria | 41098 |
| 414 | Ga0207705_10014470 | 3300025909 | Bacteria | 5679 |
| 415 | Ga0207705_10135124 | 3300025909 | Bacteria | 1838 |
| 416 | Ga0207705_10159690 | 3300025909 | Bacteria | 1693 |
| 417 | Ga0207654_10000375 | 3300025911 | Bacteria | 25999 |
| 418 | Ga0207654_10080510 | 3300025911 | Bacteria | 1959 |
| 419 | Ga0207654_10098883 | 3300025911 | Bacteria | 1793 |
| 420 | Ga0207695_10001183 | 3300025913 | Bacteria | 45024 |
| 421 | Ga0207695_10016421 | 3300025913 | Bacteria | 8662 |
| 422 | Ga0207695_10021724 | 3300025913 | Bacteria | 7315 |
| 423 | Ga0207695_10031555 | 3300025913 | Bacteria | 5808 |
| 424 | Ga0207695_10077775 | 3300025913 | Bacteria | 3368 |
| 425 | Ga0207695_10223979 | 3300025913 | Bacteria | 1787 |
| 426 | Ga0207695_10873246 | 3300025913 | Bacteria | 779 |
| 427 | Ga0207671_10001192 | 3300025914 | Bacteria | 30866 |
| 428 | Ga0207671_10027639 | 3300025914 | Bacteria | 4241 |
| 429 | Ga0207671_11237598 | 3300025914 | Bacteria | 583 |
| 430 | Ga0207671_11279455 | 3300025914 | Bacteria | 572 |
| 431 | Ga0207662_11126671 | 3300025918 | Bacteria | 558 |
| 432 | Ga0207657_10015487 | 3300025919 | Bacteria | 7387 |
| 433 | Ga0207657_10026870 | 3300025919 | Bacteria | 5279 |
| 434 | Ga0207657_10048996 | 3300025919 | Bacteria | 3685 |
| 435 | Ga0207657_10387615 | 3300025919 | Bacteria | 1100 |
| 436 | Ga0207657_11006315 | 3300025919 | Bacteria | 639 |
| 437 | Ga0207649_10150506 | 3300025920 | Bacteria | 1602 |
| 438 | Ga0207649_10167287 | 3300025920 | Bacteria | 1528 |
| 439 | Ga0207649_10831047 | 3300025920 | Bacteria | 722 |
| 440 | Ga0207649_11059835 | 3300025920 | Bacteria | 639 |
| 441 | Ga0207652_10134787 | 3300025921 | Bacteria | 2205 |
| 442 | Ga0207652_10286625 | 3300025921 | Bacteria | 1486 |
| 443 | Ga0207681_10000002 | 3300025923 | Bacteria | 985597 |
| 444 | Ga0207681_10000005 | 3300025923 | Bacteria | 555724 |
| 445 | Ga0207681_10000109 | 3300025923 | Bacteria | 71373 |
| 446 | Ga0207681_10000183 | 3300025923 | Bacteria | 51105 |
| 447 | Ga0207681_10033288 | 3300025923 | Bacteria | 3378 |
| 448 | Ga0207681_10094028 | 3300025923 | Bacteria | 2147 |
| 449 | Ga0207681_10122960 | 3300025923 | Bacteria | 1906 |
| 450 | Ga0207681_10716631 | 3300025923 | Bacteria | 832 |
| 451 | Ga0207694_10002087 | 3300025924 | Bacteria | 16502 |
| 452 | Ga0207694_10091001 | 3300025924 | Bacteria | 2408 |
| 453 | Ga0207694_10345340 | 3300025924 | Bacteria | 1231 |
| 454 | Ga0207694_10637068 | 3300025924 | Bacteria | 898 |
| 455 | Ga0207694_10801093 | 3300025924 | Bacteria | 796 |
| 456 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 457 | Ga0207650_10002904 | 3300025925 | Bacteria | 11832 |
| 458 | Ga0207650_10006404 | 3300025925 | Bacteria | 8018 |
| 459 | Ga0207650_10049447 | 3300025925 | Bacteria | 3105 |
| 460 | Ga0207650_10174974 | 3300025925 | Bacteria | 1708 |
| 461 | Ga0207659_10136023 | 3300025926 | Bacteria | 1902 |
| 462 | Ga0207687_10000225 | 3300025927 | Bacteria | 38523 |
| 463 | Ga0207687_10010076 | 3300025927 | Bacteria | 6180 |
| 464 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 465 | Ga0207644_10000012 | 3300025931 | Bacteria | 186652 |
| 466 | Ga0207644_10000067 | 3300025931 | Bacteria | 76116 |
| 467 | Ga0207644_10001857 | 3300025931 | Bacteria | 13746 |
| 468 | Ga0207644_10022749 | 3300025931 | Bacteria | 4285 |
| 469 | Ga0207644_10700505 | 3300025931 | Bacteria | 844 |
| 470 | Ga0207690_10157914 | 3300025932 | Bacteria | 1688 |
| 471 | Ga0207690_10186911 | 3300025932 | Bacteria | 1564 |
| 472 | Ga0207690_10337182 | 3300025932 | Bacteria | 1189 |
| 473 | Ga0207690_10342161 | 3300025932 | Bacteria | 1181 |
| 474 | Ga0207690_10356195 | 3300025932 | Bacteria | 1158 |
| 475 | Ga0207690_10878067 | 3300025932 | Bacteria | 743 |
| 476 | Ga0207706_10008805 | 3300025933 | Bacteria | 9291 |
| 477 | Ga0207706_10033279 | 3300025933 | Bacteria | 4590 |
| 478 | Ga0207706_10083285 | 3300025933 | Bacteria | 2812 |
| 479 | Ga0207706_10138164 | 3300025933 | Bacteria | 2144 |
| 480 | Ga0207706_10198802 | 3300025933 | Bacteria | 1758 |
| 481 | Ga0207706_11217586 | 3300025933 | Bacteria | 625 |
| 482 | Ga0207686_10001878 | 3300025934 | Bacteria | 11648 |
| 483 | Ga0207709_10000173 | 3300025935 | Bacteria | 86350 |
| 484 | Ga0207709_10088718 | 3300025935 | Bacteria | 2014 |
| 485 | Ga0207709_11210901 | 3300025935 | Bacteria | 622 |
| 486 | Ga0207669_10046739 | 3300025937 | Bacteria | 2560 |
| 487 | Ga0207669_11000337 | 3300025937 | Bacteria | 703 |
| 488 | Ga0207704_10000001 | 3300025938 | Bacteria | 716296 |
| 489 | Ga0207691_10009162 | 3300025940 | Bacteria | 9499 |
| 490 | Ga0207711_10000075 | 3300025941 | Bacteria | 106870 |
| 491 | Ga0207711_10024088 | 3300025941 | Bacteria | 5096 |
| 492 | Ga0207711_10114106 | 3300025941 | Bacteria | 2406 |
| 493 | Ga0207711_10236570 | 3300025941 | Bacteria | 1674 |
| 494 | Ga0207711_11362142 | 3300025941 | Bacteria | 652 |
| 495 | Ga0207689_10000744 | 3300025942 | Bacteria | 31242 |
| 496 | Ga0207689_11445008 | 3300025942 | Bacteria | 575 |
| 497 | Ga0207661_10482382 | 3300025944 | Bacteria | 1132 |
| 498 | Ga0207661_11506624 | 3300025944 | Bacteria | 616 |
| 499 | Ga0207679_10123611 | 3300025945 | Bacteria | 2064 |
| 500 | Ga0207679_10140360 | 3300025945 | Bacteria | 1952 |
| 501 | Ga0207667_10000016 | 3300025949 | Bacteria | 391466 |
| 502 | Ga0207667_10011748 | 3300025949 | Bacteria | 10154 |
| 503 | Ga0207667_10112317 | 3300025949 | Bacteria | 2810 |
| 504 | Ga0207667_10498960 | 3300025949 | Bacteria | 1235 |
| 505 | Ga0207667_10638165 | 3300025949 | Bacteria | 1071 |
| 506 | Ga0207651_10000002 | 3300025960 | Bacteria | 427663 |
| 507 | Ga0207651_11013347 | 3300025960 | Bacteria | 742 |
| 508 | Ga0207712_10000014 | 3300025961 | Bacteria | 375393 |
| 509 | Ga0207712_10000174 | 3300025961 | Bacteria | 66500 |
| 510 | Ga0207712_10018137 | 3300025961 | Bacteria | 4580 |
| 511 | Ga0207712_10057696 | 3300025961 | Bacteria | 2740 |
| 512 | Ga0207712_10092123 | 3300025961 | Bacteria | 2234 |
| 513 | Ga0207712_10657395 | 3300025961 | Bacteria | 911 |
| 514 | Ga0207712_11277392 | 3300025961 | Bacteria | 656 |
| 515 | Ga0207712_11688390 | 3300025961 | Bacteria | 568 |
| 516 | Ga0207668_10000081 | 3300025972 | Bacteria | 72145 |
| 517 | Ga0207668_10000304 | 3300025972 | Bacteria | 32235 |
| 518 | Ga0207668_10005340 | 3300025972 | Bacteria | 7558 |
| 519 | Ga0207668_10083673 | 3300025972 | Bacteria | 2322 |
| 520 | Ga0207668_10085277 | 3300025972 | Bacteria | 2304 |
| 521 | Ga0207668_10328540 | 3300025972 | Bacteria | 1271 |
| 522 | Ga0207668_10484314 | 3300025972 | Bacteria | 1061 |
| 523 | Ga0207640_10000063 | 3300025981 | Bacteria | 87065 |
| 524 | Ga0207640_10031448 | 3300025981 | Bacteria | 3280 |
| 525 | Ga0207640_10062003 | 3300025981 | Bacteria | 2479 |
| 526 | Ga0207640_10100271 | 3300025981 | Bacteria | 2029 |
| 527 | Ga0207640_10157229 | 3300025981 | Bacteria | 1677 |
| 528 | Ga0207640_11027507 | 3300025981 | Bacteria | 726 |
| 529 | Ga0207640_11246724 | 3300025981 | Bacteria | 662 |
| 530 | Ga0207640_11397633 | 3300025981 | Bacteria | 627 |
| 531 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 532 | Ga0207658_10001566 | 3300025986 | Bacteria | 17731 |
| 533 | Ga0207658_10004095 | 3300025986 | Bacteria | 10169 |
| 534 | Ga0207658_10008782 | 3300025986 | Bacteria | 6860 |
| 535 | Ga0207658_10018656 | 3300025986 | Bacteria | 4795 |
| 536 | Ga0207658_10819713 | 3300025986 | Bacteria | 845 |
| 537 | Ga0207677_10000030 | 3300026023 | Bacteria | 120692 |
| 538 | Ga0207703_10005351 | 3300026035 | Bacteria | 10337 |
| 539 | Ga0207703_10008030 | 3300026035 | Bacteria | 8339 |
| 540 | Ga0207703_10009134 | 3300026035 | Bacteria | 7806 |
| 541 | Ga0207703_10124179 | 3300026035 | Bacteria | 2220 |
| 542 | Ga0207639_10000213 | 3300026041 | Bacteria | 43227 |
| 543 | Ga0207639_10012302 | 3300026041 | Bacteria | 5959 |
| 544 | Ga0207639_10036850 | 3300026041 | Bacteria | 3628 |
| 545 | Ga0207639_10122498 | 3300026041 | Bacteria | 2139 |
| 546 | Ga0207639_10602963 | 3300026041 | Bacteria | 1013 |
| 547 | Ga0207639_10828173 | 3300026041 | Bacteria | 863 |
| 548 | Ga0207678_10000857 | 3300026067 | Bacteria | 27922 |
| 549 | Ga0207678_10001793 | 3300026067 | Bacteria | 19669 |
| 550 | Ga0207678_10088208 | 3300026067 | Bacteria | 2651 |
| 551 | Ga0207702_10000887 | 3300026078 | Bacteria | 31141 |
| 552 | Ga0207702_10002945 | 3300026078 | Bacteria | 15895 |
| 553 | Ga0207702_10019109 | 3300026078 | Bacteria | 5670 |
| 554 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 555 | Ga0207641_10000099 | 3300026088 | Bacteria | 122892 |
| 556 | Ga0207641_10002512 | 3300026088 | Bacteria | 16895 |
| 557 | Ga0207641_10004505 | 3300026088 | Bacteria | 12048 |
| 558 | Ga0207641_10013693 | 3300026088 | Bacteria | 6656 |
| 559 | Ga0207641_10014410 | 3300026088 | Bacteria | 6478 |
| 560 | Ga0207641_11282650 | 3300026088 | Bacteria | 733 |
| 561 | Ga0207648_10000001 | 3300026089 | Bacteria | 427499 |
| 562 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 563 | Ga0207676_10000770 | 3300026095 | Bacteria | 25065 |
| 564 | Ga0207676_10022559 | 3300026095 | Bacteria | 4630 |
| 565 | Ga0207674_10131652 | 3300026116 | Bacteria | 2464 |
| 566 | Ga0207674_10300559 | 3300026116 | Bacteria | 1554 |
| 567 | Ga0207674_10337148 | 3300026116 | Bacteria | 1458 |
| 568 | Ga0207674_11129632 | 3300026116 | Bacteria | 753 |
| 569 | Ga0207674_11201849 | 3300026116 | Bacteria | 728 |
| 570 | Ga0207675_100000358 | 3300026118 | Bacteria | 43765 |
| 571 | Ga0207675_100001138 | 3300026118 | Bacteria | 26336 |
| 572 | Ga0207675_100230090 | 3300026118 | Bacteria | 1788 |
| 573 | Ga0207683_10182888 | 3300026121 | Bacteria | 1901 |
| 574 | Ga0207698_10034383 | 3300026142 | Bacteria | 3694 |
| 575 | Ga0207698_10130218 | 3300026142 | Bacteria | 2148 |
| 576 | Ga0207698_10201601 | 3300026142 | Bacteria | 1782 |
| 577 | Ga0207698_10955811 | 3300026142 | Bacteria | 866 |
| 578 | Ga0207698_12752071 | 3300026142 | Bacteria | 500 |
| 579 | Ga0209371_1085272 | 3300027312 | Bacteria | 539 |
| 580 | Ga0209813_10000051 | 3300027866 | Bacteria | 47545 |
| 581 | Ga0268266_10000009 | 3300028379 | Bacteria | 1097737 |
| 582 | Ga0268266_10002003 | 3300028379 | Bacteria | 22767 |
| 583 | Ga0268266_10006189 | 3300028379 | Bacteria | 10993 |
| 584 | Ga0268266_10158947 | 3300028379 | Bacteria | 2043 |
| 585 | Ga0268266_10211526 | 3300028379 | Bacteria | 1779 |
| 586 | Ga0268266_10315170 | 3300028379 | Bacteria | 1462 |
| 587 | Ga0268266_10422983 | 3300028379 | Bacteria | 1263 |
| 588 | Ga0268266_11019591 | 3300028379 | Bacteria | 801 |
| 589 | Ga0268266_11411114 | 3300028379 | Bacteria | 672 |
| 590 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 591 | Ga0268265_10000045 | 3300028380 | Bacteria | 180378 |
| 592 | Ga0268265_10000047 | 3300028380 | Bacteria | 179354 |
| 593 | Ga0268265_10000285 | 3300028380 | Bacteria | 57084 |
| 594 | Ga0268265_10004726 | 3300028380 | Bacteria | 9397 |
| 595 | Ga0268265_10017233 | 3300028380 | Bacteria | 4981 |
| 596 | Ga0268265_10146980 | 3300028380 | Bacteria | 1982 |
| 597 | Ga0268265_10315643 | 3300028380 | Bacteria | 1413 |
| 598 | Ga0268265_10387566 | 3300028380 | Bacteria | 1287 |
| 599 | Ga0268265_11127984 | 3300028380 | Bacteria | 779 |
| 600 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 601 | Ga0268264_10000010 | 3300028381 | Bacteria | 596543 |
| 602 | Ga0268264_10000023 | 3300028381 | Bacteria | 471408 |
| 603 | Ga0268264_10004259 | 3300028381 | Bacteria | 12215 |
| 604 | Ga0268264_10012572 | 3300028381 | Bacteria | 6971 |
| 605 | Ga0268264_10105564 | 3300028381 | Bacteria | 2457 |
| 606 | Ga0268264_10209613 | 3300028381 | Bacteria | 1788 |
| 607 | Ga0268264_10405038 | 3300028381 | Bacteria | 1312 |
| 608 | Ga0307517_10633740 | 3300028786 | Bacteria | 522 |
| 609 | Ga0268256_1046229 | 3300030500 | Bacteria | 944 |
| 610 | Ga0314311_1203820 | 3300030733 | Bacteria | 1025 |
| 611 | Ga0265320_10000034 | 3300031240 | Bacteria | 141117 |
| 612 | Ga0265325_10023456 | 3300031241 | Bacteria | 3367 |
| 613 | Ga0265325_10037185 | 3300031241 | Bacteria | 2574 |
| 614 | Ga0307513_10209984 | 3300031456 | Bacteria | 1779 |
| 615 | Ga0307408_100051500 | 3300031548 | Bacteria | 2965 |
| 616 | Ga0307408_101128429 | 3300031548 | Bacteria | 728 |
| 617 | Ga0307408_101389987 | 3300031548 | Bacteria | 661 |
| 618 | Ga0265313_10000665 | 3300031595 | Bacteria | 35397 |
| 619 | Ga0265314_10019631 | 3300031711 | Bacteria | 5232 |
| 620 | Ga0265314_10042189 | 3300031711 | Bacteria | 3258 |
| 621 | Ga0265314_10118950 | 3300031711 | Bacteria | 1666 |
| 622 | Ga0307405_10055116 | 3300031731 | Bacteria | 2486 |
| 623 | Ga0307405_10530365 | 3300031731 | Bacteria | 949 |
| 624 | Ga0307405_10949213 | 3300031731 | Bacteria | 730 |
| 625 | Ga0307405_11486235 | 3300031731 | Bacteria | 595 |
| 626 | Ga0307413_10332327 | 3300031824 | Bacteria | 1165 |
| 627 | Ga0307413_11513892 | 3300031824 | Bacteria | 593 |
| 628 | Ga0307410_10027090 | 3300031852 | Bacteria | 3618 |
| 629 | Ga0307410_11135650 | 3300031852 | Bacteria | 679 |
| 630 | Ga0307406_10589289 | 3300031901 | Bacteria | 915 |
| 631 | Ga0307406_10614399 | 3300031901 | Bacteria | 898 |
| 632 | Ga0307406_10706803 | 3300031901 | Bacteria | 842 |
| 633 | Ga0307406_11005598 | 3300031901 | Bacteria | 715 |
| 634 | Ga0307406_11917748 | 3300031901 | Bacteria | 528 |
| 635 | Ga0307407_10257420 | 3300031903 | Bacteria | 1199 |
| 636 | Ga0307412_10015626 | 3300031911 | Bacteria | 4506 |
| 637 | Ga0307412_10514991 | 3300031911 | Bacteria | 998 |
| 638 | Ga0307412_10947513 | 3300031911 | Bacteria | 757 |
| 639 | Ga0307412_11429176 | 3300031911 | Bacteria | 627 |
| 640 | Ga0307409_101359966 | 3300031995 | Bacteria | 736 |
| 641 | Ga0307409_102980818 | 3300031995 | Bacteria | 500 |
| 642 | Ga0307416_100014919 | 3300032002 | Bacteria | 5345 |
| 643 | Ga0307414_11712720 | 3300032004 | Bacteria | 586 |
| 644 | Ga0307414_11795155 | 3300032004 | Bacteria | 572 |
| 645 | Ga0307411_10271081 | 3300032005 | Bacteria | 1346 |
| 646 | Ga0307411_10440296 | 3300032005 | Bacteria | 1087 |
| 647 | Ga0307411_12160541 | 3300032005 | Bacteria | 521 |
| 648 | Ga0307510_10148726 | 3300033180 | Bacteria | 1967 |
| 649 | Ga0373923_0143888 | 3300035111 | Bacteria | 1079 |
| 650 | Ga0373946_0647350 | 3300035171 | Bacteria | 550 |
| 651 | Ga0395899_0001521 | 3300037312 | Bacteria | 19608 |
| 652 | Ga0395900_0009291 | 3300037418 | Bacteria | 10081 |
| 653 | Ga0395900_1114422 | 3300037418 | Bacteria | 706 |
| 654 | Ga0395898_1303005 | 3300037466 | Bacteria | 656 |
| 655 | Ga0395905_0026896 | 3300037471 | Bacteria | 5426 |
| 656 | Ga0395905_0516629 | 3300037471 | Bacteria | 1095 |
| 657 | Ga0436364_0741438 | 3300037853 | Bacteria | 779 |
| 658 | Ga0436364_0878110 | 3300037853 | Bacteria | 2836 |
| 659 | Ga0395901_0073008 | 3300038443 | Bacteria | 3578 |
| 660 | Ga0395901_2127733 | 3300038443 | Bacteria | 506 |
| 661 | Ga0436365_0212007 | 3300039437 | Bacteria | 1166 |
| 662 | Ga0436365_0922307 | 3300039437 | Bacteria | 725 |
| 663 | Ga0436365_1667312 | 3300039437 | Bacteria | 780 |
| 664 | Ga0436365_1773361 | 3300039437 | Bacteria | 6729 |
| 665 | Ga0436361_1051839 | 3300039447 | Bacteria | 1442 |
| 666 | Ga0436363_0153792 | 3300039450 | Bacteria | 1691 |
| 667 | Ga0439436_0009694 | 3300041404 | Bacteria | 2950 |
| 668 | Ga0439439_0001779 | 3300041406 | Bacteria | 4402 |
| 669 | Ga0439447_148918 | 3300041407 | Bacteria | 538 |
| 670 | Ga0439461_0000498 | 3300041410 | Bacteria | 5666 |
| 671 | Ga0439461_0003679 | 3300041410 | Bacteria | 2530 |
| 672 | Ga0439461_0080904 | 3300041410 | Bacteria | 766 |
| 673 | Ga0439465_0004274 | 3300041413 | Bacteria | 4644 |
| 674 | Ga0439465_0004757 | 3300041413 | Bacteria | 4375 |
| 675 | Ga0451793_0810995 | 3300041452 | Bacteria | 595 |
| 676 | Ga0451793_1584048 | 3300041452 | Bacteria | 641 |
| 677 | Ga0451802_1834731 | 3300041460 | Bacteria | 516 |
| 678 | Ga0451806_522421 | 3300041462 | Bacteria | 552 |
| 679 | Ga0451807_0720757 | 3300041486 | Bacteria | 754 |
| 680 | Ga0451833_1022453 | 3300041491 | Bacteria | 551 |
| 681 | Ga0451837_1536393 | 3300041494 | Bacteria | 581 |
| 682 | Ga0451841_0590837 | 3300041498 | Bacteria | 1107 |
| 683 | Ga0451853_3774724 | 3300041512 | Bacteria | 620 |
| 684 | Ga0439431_0038651 | 3300041997 | Bacteria | 1208 |
| 685 | Ga0439442_150916 | 3300042002 | Bacteria | 517 |
| 686 | Ga0439445_0033115 | 3300042004 | Bacteria | 1349 |
| 687 | Ga0439448_0002459 | 3300042005 | Bacteria | 5047 |
| 688 | Ga0439432_000640 | 3300042006 | Bacteria | 13098 |
| 689 | Ga0439432_022961 | 3300042006 | Bacteria | 2058 |
| 690 | Ga0439452_018803 | 3300042010 | Bacteria | 1835 |
| 691 | Ga0439457_024428 | 3300042014 | Bacteria | 1337 |
| 692 | Ga0439462_0002776 | 3300042015 | Bacteria | 4116 |
| 693 | Ga0450922_019334 | 3300042124 | Bacteria | 696 |
| 694 | Ga0439446_0034458 | 3300042156 | Bacteria | 1473 |
| 695 | Ga0439458_0000137 | 3300042157 | Bacteria | 15585 |
| 696 | Ga0450909_012035 | 3300042185 | Bacteria | 1268 |
| 697 | Ga0439434_0020110 | 3300042435 | Bacteria | 2004 |
| 698 | Ga0439460_0201787 | 3300042461 | Bacteria | 678 |
| 699 | Ga0466972_0086674 | 3300044658 | Bacteria | 1488 |
| 700 | Ga0466965_0529846 | 3300044683 | Bacteria | 663 |
| 701 | Ga0466963_0311463 | 3300044694 | Bacteria | 1108 |
| 702 | Ga0466970_0256774 | 3300044765 | Bacteria | 980 |
| 703 | Ga0466957_0347333 | 3300044842 | Bacteria | 1006 |
| 704 | Ga0451576_0436970 | 3300045051 | Bacteria | 1373 |
| 705 | Ga0466958_0391983 | 3300045836 | Bacteria | 896 |
| 706 | Ga0466967_0379221 | 3300045976 | Bacteria | 1373 |
| 707 | Ga0466967_0633257 | 3300045976 | Bacteria | 1057 |
| 708 | Ga0466967_2162402 | 3300045976 | Bacteria | 552 |
| 709 | Ga0495617_011498 | 3300046452 | Bacteria | 3019 |
| 710 | Ga0495627_000156 | 3300046453 | Bacteria | 78784 |
| 711 | Ga0495627_000578 | 3300046453 | Bacteria | 29484 |
| 712 | Ga0495627_034662 | 3300046453 | Bacteria | 1576 |
| 713 | Ga0495638_0000758 | 3300046460 | Bacteria | 34400 |
| 714 | Ga0495638_0188677 | 3300046460 | Bacteria | 1171 |
| 715 | Ga0495651_0721380 | 3300046462 | Bacteria | 620 |
| 716 | Ga0495650_0001027 | 3300046471 | Bacteria | 31380 |
| 717 | Ga0495650_0227391 | 3300046471 | Bacteria | 641 |
| 718 | Ga0495584_0078046 | 3300046491 | Bacteria | 1666 |
| 719 | Ga0495585_0127704 | 3300046492 | Bacteria | 1340 |
| 720 | Ga0495585_0567920 | 3300046492 | Bacteria | 535 |
| 721 | Ga0495607_0093490 | 3300046501 | Bacteria | 1624 |
| 722 | Ga0495583_0220617 | 3300046506 | Bacteria | 766 |
| 723 | Ga0495606_0072058 | 3300046507 | Bacteria | 2173 |
| 724 | Ga0495610_0000291 | 3300046512 | Bacteria | 52599 |
| 725 | Ga0495610_0144969 | 3300046512 | Bacteria | 1018 |
| 726 | Ga0495616_0001456 | 3300046513 | Bacteria | 16481 |
| 727 | Ga0495632_0000006 | 3300046519 | Bacteria | 345883 |
| 728 | Ga0495637_0000784 | 3300046520 | Bacteria | 21358 |
| 729 | Ga0495637_0010852 | 3300046520 | Bacteria | 4391 |
| 730 | Ga0495637_0065588 | 3300046520 | Bacteria | 1478 |
| 731 | Ga0495643_0000021 | 3300046522 | Bacteria | 293465 |
| 732 | Ga0495643_0523213 | 3300046522 | Bacteria | 508 |
| 733 | Ga0495648_0010683 | 3300046524 | Bacteria | 6974 |
| 734 | Ga0495648_0045945 | 3300046524 | Bacteria | 2712 |
| 735 | Ga0495663_0000008 | 3300046525 | Bacteria | 260614 |
| 736 | Ga0495663_0018920 | 3300046525 | Bacteria | 1965 |
| 737 | Ga0495663_0053401 | 3300046525 | Bacteria | 1256 |
| 738 | Ga0495663_0242178 | 3300046525 | Bacteria | 638 |
| 739 | Ga0495654_0116202 | 3300046530 | Bacteria | 1215 |
| 740 | Ga0495597_0031259 | 3300046542 | Bacteria | 2424 |
| 741 | Ga0495633_0000190 | 3300046558 | Bacteria | 79967 |
| 742 | Ga0495633_0002635 | 3300046558 | Bacteria | 12531 |
| 743 | Ga0495633_0013695 | 3300046558 | Bacteria | 4264 |
| 744 | Ga0495633_0072188 | 3300046558 | Bacteria | 1610 |
| 745 | Ga0495633_0146062 | 3300046558 | Bacteria | 1093 |
| 746 | Ga0495668_0002221 | 3300046616 | Bacteria | 16492 |
| 747 | Ga0495668_0105921 | 3300046616 | Bacteria | 1538 |
| 748 | Ga0495668_0574724 | 3300046616 | Bacteria | 622 |
| 749 | Ga0495625_0000629 | 3300046660 | Bacteria | 51047 |
| 750 | Ga0495625_0215510 | 3300046660 | Bacteria | 1260 |
| 751 | Ga0495625_0393492 | 3300046660 | Bacteria | 867 |
| 752 | Ga0495661_0125781 | 3300046665 | Bacteria | 1411 |
| 753 | Ga0495670_0000002 | 3300046691 | Bacteria | 601814 |
| 754 | Ga0495670_0427746 | 3300046691 | Bacteria | 716 |
| 755 | Ga0495671_0000017 | 3300046692 | Bacteria | 293465 |
| 756 | Ga0495649_0327109 | 3300046694 | Bacteria | 777 |
| 757 | Ga0495636_0180483 | 3300047318 | Bacteria | 958 |
| 758 | Ga0495672_0174663 | 3300047320 | Bacteria | 1092 |
| 759 | Ga0495672_0212818 | 3300047320 | Bacteria | 959 |
| 760 | Ga0495673_0028297 | 3300047469 | Bacteria | 2656 |
| 761 | Ga0495681_0000098 | 3300047470 | Bacteria | 75809 |
| 762 | Ga0495681_0008268 | 3300047470 | Bacteria | 6539 |
| 763 | Ga0495681_0009646 | 3300047470 | Bacteria | 5927 |
| 764 | Ga0495681_0326806 | 3300047470 | Bacteria | 588 |
| 765 | Ga0495686_0005063 | 3300047472 | Bacteria | 10564 |
| 766 | Ga0495686_0008463 | 3300047472 | Bacteria | 7546 |
| 767 | Ga0495686_0029938 | 3300047472 | Bacteria | 3538 |
| 768 | Ga0495686_0042056 | 3300047472 | Bacteria | 2907 |
| 769 | Ga0495686_0248449 | 3300047472 | Bacteria | 1000 |
| 770 | Ga0495686_0254178 | 3300047472 | Bacteria | 986 |
| 771 | Ga0495686_0377163 | 3300047472 | Bacteria | 766 |
| 772 | Ga0495686_0686152 | 3300047472 | Bacteria | 523 |
| 773 | Ga0496100_0082969 | 3300048903 | Bacteria | 2168 |
| 774 | Ga0496100_0182282 | 3300048903 | Bacteria | 1519 |
| 775 | Ga0496100_1223371 | 3300048903 | Bacteria | 592 |
| 776 | Ga0496101_0111668 | 3300048904 | Bacteria | 2058 |
| 777 | Ga0496101_0138327 | 3300048904 | Bacteria | 1854 |
| 778 | Ga0496101_0333953 | 3300048904 | Bacteria | 1190 |
| 779 | Ga0496101_0346342 | 3300048904 | Bacteria | 1167 |
| 780 | Ga0496102_0000069 | 3300048905 | Bacteria | 156067 |
| 781 | Ga0496102_0000615 | 3300048905 | Bacteria | 36925 |
| 782 | Ga0496102_0172254 | 3300048905 | Bacteria | 2037 |
| 783 | Ga0496102_0298555 | 3300048905 | Bacteria | 1518 |
| 784 | Ga0496102_0681373 | 3300048905 | Bacteria | 951 |
| 785 | Ga0496103_0000173 | 3300048906 | Bacteria | 67412 |
| 786 | Ga0496103_0009010 | 3300048906 | Bacteria | 5911 |
| 787 | Ga0496103_0033025 | 3300048906 | Bacteria | 3160 |
| 788 | Ga0496103_0132529 | 3300048906 | Bacteria | 1592 |
| 789 | Ga0496103_0224202 | 3300048906 | Bacteria | 1209 |
| 790 | Ga0496103_0651014 | 3300048906 | Bacteria | 669 |
| 791 | Ga0496104_0000081 | 3300048907 | Bacteria | 94514 |
| 792 | Ga0496104_0059792 | 3300048907 | Bacteria | 3608 |
| 793 | Ga0496105_0000034 | 3300048908 | Bacteria | 127505 |
| 794 | Ga0496105_0090922 | 3300048908 | Bacteria | 2521 |
| 795 | Ga0496105_0363545 | 3300048908 | Bacteria | 1154 |
| 796 | Ga0496105_0615800 | 3300048908 | Bacteria | 841 |
| 797 | Ga0496106_0076352 | 3300048909 | Bacteria | 2568 |
| 798 | Ga0496106_0168900 | 3300048909 | Bacteria | 1733 |
| 799 | Ga0496106_0222120 | 3300048909 | Bacteria | 1507 |
| 800 | Ga0496107_0173558 | 3300048910 | Bacteria | 1600 |
| 801 | Ga0496107_0252341 | 3300048910 | Bacteria | 1312 |
| 802 | Ga0496109_0067327 | 3300048912 | Bacteria | 3280 |
| 803 | Ga0496109_0116418 | 3300048912 | Bacteria | 2488 |
| 804 | Ga0496109_0353061 | 3300048912 | Bacteria | 1389 |
| 805 | Ga0496109_0539887 | 3300048912 | Bacteria | 1100 |
| 806 | Ga0496110_0093856 | 3300048913 | Bacteria | 2686 |
| 807 | Ga0496110_0124785 | 3300048913 | Bacteria | 2322 |
| 808 | Ga0496110_0325345 | 3300048913 | Bacteria | 1400 |
| 809 | Ga0496110_1131155 | 3300048913 | Bacteria | 691 |
| 810 | Ga0496111_0328540 | 3300048914 | Bacteria | 1132 |
| 811 | Ga0496111_0458563 | 3300048914 | Bacteria | 940 |
| 812 | Ga0496112_0116278 | 3300048915 | Bacteria | 2645 |
| 813 | Ga0496112_0663427 | 3300048915 | Bacteria | 972 |
| 814 | Ga0496113_0000101 | 3300048916 | Bacteria | 36217 |
| 815 | Ga0496113_0366514 | 3300048916 | Bacteria | 1156 |
| 816 | Ga0496113_1445932 | 3300048916 | Bacteria | 532 |
| 817 | Ga0496115_0001129 | 3300048918 | Bacteria | 19266 |
| 818 | Ga0496115_0108956 | 3300048918 | Bacteria | 2274 |
| 819 | Ga0496115_1026514 | 3300048918 | Bacteria | 629 |
| 820 | Ga0496116_0000062 | 3300048919 | Bacteria | 271104 |
| 821 | Ga0496116_0000566 | 3300048919 | Bacteria | 49509 |
| 822 | Ga0496116_0032138 | 3300048919 | Bacteria | 3745 |
| 823 | Ga0496116_0050745 | 3300048919 | Bacteria | 2762 |
| 824 | Ga0496116_0101176 | 3300048919 | Bacteria | 1721 |
| 825 | Ga0496116_0361464 | 3300048919 | Bacteria | 660 |
| 826 | Ga0496117_0000146 | 3300048920 | Bacteria | 152244 |
| 827 | Ga0496117_0000485 | 3300048920 | Bacteria | 65840 |
| 828 | Ga0496117_0033071 | 3300048920 | Bacteria | 3916 |
| 829 | Ga0496117_0046000 | 3300048920 | Bacteria | 3144 |
| 830 | Ga0496117_0055578 | 3300048920 | Bacteria | 2765 |
| 831 | Ga0496117_0089533 | 3300048920 | Bacteria | 1987 |
| 832 | Ga0496117_0251385 | 3300048920 | Bacteria | 964 |
| 833 | Ga0496117_0312713 | 3300048920 | Bacteria | 826 |
| 834 | Ga0496117_0318261 | 3300048920 | Bacteria | 816 |
| 835 | Ga0496117_0330651 | 3300048920 | Bacteria | 794 |
| 836 | Ga0496118_0000190 | 3300048921 | Bacteria | 108017 |
| 837 | Ga0496118_0003742 | 3300048921 | Bacteria | 18808 |
| 838 | Ga0496118_0015425 | 3300048921 | Bacteria | 7071 |
| 839 | Ga0496118_0015970 | 3300048921 | Bacteria | 6916 |
| 840 | Ga0496118_0057773 | 3300048921 | Bacteria | 2905 |
| 841 | Ga0496118_0076829 | 3300048921 | Bacteria | 2372 |
| 842 | Ga0496118_0079363 | 3300048921 | Bacteria | 2316 |
| 843 | Ga0496118_0104776 | 3300048921 | Bacteria | 1897 |
| 844 | Ga0496118_0127031 | 3300048921 | Bacteria | 1647 |
| 845 | Ga0496118_0139050 | 3300048921 | Bacteria | 1544 |
| 846 | Ga0496118_0370348 | 3300048921 | Bacteria | 756 |
| 847 | Ga0496119_0000057 | 3300048922 | Bacteria | 173746 |
| 848 | Ga0496119_0072971 | 3300048922 | Bacteria | 2003 |
| 849 | Ga0496119_0180016 | 3300048922 | Bacteria | 1109 |
| 850 | Ga0496119_0186126 | 3300048922 | Bacteria | 1085 |
| 851 | Ga0496119_0313654 | 3300048922 | Bacteria | 769 |
| 852 | Ga0496120_0005360 | 3300048923 | Bacteria | 10261 |
| 853 | Ga0496120_0110614 | 3300048923 | Bacteria | 1436 |
| 854 | Ga0496120_0178484 | 3300048923 | Bacteria | 1045 |
| 855 | Ga0496120_0185785 | 3300048923 | Bacteria | 1017 |
| 856 | Ga0496120_0487953 | 3300048923 | Bacteria | 531 |
| 857 | Ga0496121_0005623 | 3300048924 | Bacteria | 15968 |
| 858 | Ga0496121_0010499 | 3300048924 | Bacteria | 10435 |
| 859 | Ga0496121_0015601 | 3300048924 | Bacteria | 7936 |
| 860 | Ga0496121_0016723 | 3300048924 | Bacteria | 7548 |
| 861 | Ga0496121_0017016 | 3300048924 | Bacteria | 7461 |
| 862 | Ga0496121_0058069 | 3300048924 | Bacteria | 3202 |
| 863 | Ga0496121_0115314 | 3300048924 | Bacteria | 2040 |
| 864 | Ga0496121_0180678 | 3300048924 | Bacteria | 1523 |
| 865 | Ga0496121_0205134 | 3300048924 | Bacteria | 1401 |
| 866 | Ga0496121_0568689 | 3300048924 | Bacteria | 706 |
| 867 | Ga0496121_0907952 | 3300048924 | Bacteria | 506 |
| 868 | Ga0496122_0000723 | 3300048925 | Bacteria | 64694 |
| 869 | Ga0496122_0003556 | 3300048925 | Bacteria | 20365 |
| 870 | Ga0496122_0006671 | 3300048925 | Bacteria | 13150 |
| 871 | Ga0496122_0026134 | 3300048925 | Bacteria | 5047 |
| 872 | Ga0496122_0366886 | 3300048925 | Bacteria | 745 |
| 873 | Ga0496122_0420631 | 3300048925 | Bacteria | 672 |
| 874 | Ga0496123_0000545 | 3300048926 | Bacteria | 64687 |
| 875 | Ga0496123_0002968 | 3300048926 | Bacteria | 19751 |
| 876 | Ga0496123_0016815 | 3300048926 | Bacteria | 5914 |
| 877 | Ga0496123_0062259 | 3300048926 | Bacteria | 2392 |
| 878 | Ga0496123_0235440 | 3300048926 | Bacteria | 913 |
| 879 | Ga0496124_0000546 | 3300048927 | Bacteria | 63624 |
| 880 | Ga0496124_0000874 | 3300048927 | Bacteria | 49185 |
| 881 | Ga0496124_0002439 | 3300048927 | Bacteria | 24366 |
| 882 | Ga0496124_0006061 | 3300048927 | Bacteria | 13305 |
| 883 | Ga0496124_0023588 | 3300048927 | Bacteria | 5614 |
| 884 | Ga0496124_0023873 | 3300048927 | Bacteria | 5571 |
| 885 | Ga0496124_0081473 | 3300048927 | Bacteria | 2660 |
| 886 | Ga0496124_0299780 | 3300048927 | Bacteria | 1162 |
| 887 | Ga0496124_0474242 | 3300048927 | Bacteria | 847 |
| 888 | Ga0496124_0507938 | 3300048927 | Bacteria | 806 |
| 889 | Ga0496124_0805486 | 3300048927 | Bacteria | 581 |
| 890 | Ga0496125_0002465 | 3300048928 | Bacteria | 24034 |
| 891 | Ga0496125_0006988 | 3300048928 | Bacteria | 12081 |
| 892 | Ga0496125_0033431 | 3300048928 | Bacteria | 4551 |
| 893 | Ga0496125_0034343 | 3300048928 | Bacteria | 4472 |
| 894 | Ga0496125_0071024 | 3300048928 | Bacteria | 2722 |
| 895 | Ga0496125_0355978 | 3300048928 | Bacteria | 872 |
| 896 | Ga0496125_0415581 | 3300048928 | Bacteria | 781 |
| 897 | Ga0496125_0439744 | 3300048928 | Bacteria | 750 |
| 898 | Ga0496126_0000028 | 3300048929 | Bacteria | 394082 |
| 899 | Ga0496126_0006838 | 3300048929 | Bacteria | 12646 |
| 900 | Ga0496126_0016996 | 3300048929 | Bacteria | 7259 |
| 901 | Ga0496126_0034229 | 3300048929 | Bacteria | 4773 |
| 902 | Ga0496126_0054886 | 3300048929 | Bacteria | 3607 |
| 903 | Ga0496126_0121519 | 3300048929 | Bacteria | 2264 |
| 904 | Ga0496126_0150910 | 3300048929 | Bacteria | 1992 |
| 905 | Ga0496126_0372477 | 3300048929 | Bacteria | 1164 |
| 906 | Ga0496126_0632782 | 3300048929 | Bacteria | 839 |
| 907 | Ga0496126_1231595 | 3300048929 | Bacteria | 549 |
| 908 | Ga0495678_014836 | 3300049459 | Bacteria | 3610 |
| 909 | Ga0495682_0279655 | 3300049460 | Bacteria | 589 |
| 910 | Ga0501290_000237 | 3300049513 | Bacteria | 9135 |
| 911 | Ga0501292_000042 | 3300049515 | Bacteria | 29474 |
| 912 | Ga0501294_000032 | 3300049517 | Bacteria | 13769 |
| 913 | Ga0501297_009582 | 3300049520 | Bacteria | 1085 |
| 914 | Ga0501300_000392 | 3300049523 | Bacteria | 6689 |
| 915 | Ga0501302_002270 | 3300049525 | Bacteria | 1084 |
| 916 | Ga0501315_000962 | 3300049531 | Bacteria | 2273 |
| 917 | Ga0501317_002915 | 3300049533 | Bacteria | 1662 |
| 918 | Ga0501318_049501 | 3300049534 | Bacteria | 621 |
| 919 | Ga0501321_023679 | 3300049537 | Bacteria | 780 |
| 920 | Ga0501335_000615 | 3300049551 | Bacteria | 2383 |
| 921 | Ga0501337_013057 | 3300049553 | Bacteria | 625 |
| 922 | Ga0501033_0085723 | 3300049570 | Bacteria | 2307 |
| 923 | Ga0501034_0099962 | 3300049571 | Bacteria | 2895 |
| 924 | Ga0501034_0285394 | 3300049571 | Bacteria | 1590 |
| 925 | Ga0501038_0164937 | 3300049574 | Bacteria | 1798 |
| 926 | Ga0501038_0323317 | 3300049574 | Bacteria | 1206 |
| 927 | Ga0501038_0770013 | 3300049574 | Bacteria | 717 |
| 928 | Ga0501041_0866607 | 3300049577 | Bacteria | 580 |
| 929 | Ga0501042_0040621 | 3300049578 | Bacteria | 3307 |
| 930 | Ga0501042_0260954 | 3300049578 | Bacteria | 1251 |
| 931 | Ga0501043_0113159 | 3300049579 | Bacteria | 2131 |
| 932 | Ga0501046_0030454 | 3300049580 | Bacteria | 4380 |
| 933 | Ga0501047_0000731 | 3300049581 | Bacteria | 34159 |
| 934 | Ga0501047_0450251 | 3300049581 | Bacteria | 1117 |
| 935 | Ga0501047_0935022 | 3300049581 | Bacteria | 680 |
| 936 | Ga0501070_0968333 | 3300049586 | Bacteria | 661 |
| 937 | Ga0501071_0191090 | 3300049587 | Bacteria | 1536 |
| 938 | Ga0501071_1187966 | 3300049587 | Bacteria | 589 |
| 939 | Ga0501073_0139551 | 3300049589 | Bacteria | 1679 |
| 940 | Ga0501074_0761420 | 3300049590 | Bacteria | 683 |
| 941 | Ga0501075_0834129 | 3300049591 | Bacteria | 701 |
| 942 | Ga0501076_0426670 | 3300049592 | Bacteria | 1091 |
| 943 | Ga0501076_1405930 | 3300049592 | Bacteria | 573 |
| 944 | Ga0501077_0216387 | 3300049593 | Bacteria | 1218 |
| 945 | Ga0501206_003378 | 3300049653 | Bacteria | 2028 |
| 946 | Ga0501211_000103 | 3300049658 | Bacteria | 6327 |
| 947 | Ga0501222_001746 | 3300049662 | Bacteria | 3014 |
| 948 | Ga0501223_004016 | 3300049663 | Bacteria | 3169 |
| 949 | Ga0501223_036809 | 3300049663 | Bacteria | 951 |
| 950 | Ga0501224_000754 | 3300049664 | Bacteria | 4084 |
| 951 | Ga0501227_028030 | 3300049665 | Bacteria | 1336 |
| 952 | Ga0501233_012436 | 3300049668 | Bacteria | 1708 |
| 953 | Ga0501235_001097 | 3300049669 | Bacteria | 5663 |
| 954 | Ga0501236_053975 | 3300049670 | Bacteria | 697 |
| 955 | Ga0501259_001391 | 3300049688 | Bacteria | 4043 |
| 956 | Ga0501261_000021 | 3300049690 | Bacteria | 37511 |
| 957 | Ga0501221_003846 | 3300049704 | Bacteria | 2478 |
| 958 | Ga0501225_0006973 | 3300049705 | Bacteria | 3291 |
| 959 | Ga0501225_0043405 | 3300049705 | Bacteria | 1242 |
| 960 | Ga0501079_0374717 | 3300049741 | Bacteria | 1116 |
| 961 | Ga0501080_0702389 | 3300049742 | Bacteria | 892 |
| 962 | Ga0501083_0271764 | 3300049744 | Bacteria | 1103 |
| 963 | Ga0501083_0292932 | 3300049744 | Bacteria | 1059 |
| 964 | Ga0501264_008163 | 3300049761 | Bacteria | 985 |
| 965 | Ga0501276_013553 | 3300049773 | Bacteria | 716 |
| 966 | Ga0501279_000010 | 3300049775 | Bacteria | 103375 |
| 967 | Ga0501280_000064 | 3300049776 | Bacteria | 31054 |
| 968 | Ga0501280_001057 | 3300049776 | Bacteria | 5596 |
| 969 | Ga0501281_00086 | 3300049777 | Bacteria | 10989 |
| 970 | Ga0501282_000404 | 3300049778 | Bacteria | 5157 |
| 971 | Ga0501283_001453 | 3300049779 | Bacteria | 3071 |
| 972 | Ga0501035_0179700 | 3300049822 | Bacteria | 1823 |
| 973 | Ga0501035_0244287 | 3300049822 | Bacteria | 1526 |
| 974 | Ga0501035_1048316 | 3300049822 | Bacteria | 639 |
| 975 | Ga0501044_0134255 | 3300049823 | Bacteria | 2467 |
| 976 | Ga0501044_0204047 | 3300049823 | Bacteria | 1934 |
| 977 | Ga0501044_0896240 | 3300049823 | Bacteria | 762 |
| 978 | Ga0501226_021697 | 3300049853 | Bacteria | 712 |
| 979 | Ga0501284_02268 | 3300050005 | Bacteria | 1056 |
| 980 | nmdc:mga03n38_266481_c1 | 3300050490 | Bacteria | 910 |
| 981 | nmdc:mga00v17_75476_c1 | 3300050491 | Bacteria | 1412 |
| 982 | nmdc:mga00v17_911672_c1 | 3300050491 | Bacteria | 556 |
| 983 | nmdc:mga0k408_344198_c1 | 3300050493 | Bacteria | 889 |
| 984 | nmdc:mga0k408_529690_c1 | 3300050493 | Bacteria | 697 |
| 985 | nmdc:mga0k408_583414_c1 | 3300050493 | Bacteria | 660 |
| 986 | nmdc:mga0k408_832522_c1 | 3300050493 | Bacteria | 537 |
| 987 | nmdc:mga06z11_17_c1 | 3300050494 | Bacteria | 79602 |
| 988 | nmdc:mga04h51_146_c1 | 3300050495 | Bacteria | 20585 |
| 989 | nmdc:mga04h51_411911_c1 | 3300050495 | Bacteria | 567 |
| 990 | nmdc:mga07m45_111328_c1 | 3300050496 | Bacteria | 1577 |
| 991 | nmdc:mga07m45_567769_c1 | 3300050496 | Bacteria | 656 |
| 992 | nmdc:mga07m45_60295_c1 | 3300050496 | Bacteria | 2147 |
| 993 | nmdc:mga05p37_171786_c1 | 3300050507 | Bacteria | 2643 |
| 994 | nmdc:mga05p37_2021674_c1 | 3300050507 | Bacteria | 544 |
| 995 | Ga0500643_010906 | 3300053087 | Bacteria | 3352 |
| 996 | Ga0500647_0376821 | 3300053091 | Bacteria | 582 |
| 997 | Ga0500651_0086862 | 3300053093 | Bacteria | 1931 |
| 998 | Ga0500566_0004538 | 3300053094 | Bacteria | 8291 |
| 999 | Ga0500641_0004173 | 3300053096 | Bacteria | 5101 |
| 1000 | Ga0500641_0136367 | 3300053096 | Bacteria | 1059 |
| 1001 | Ga0500556_0189304 | 3300053104 | Bacteria | 813 |
| 1002 | Ga0500562_070755 | 3300053108 | Bacteria | 941 |
| 1003 | Ga0500592_000031 | 3300053116 | Bacteria | 47686 |
| 1004 | Ga0500592_001156 | 3300053116 | Bacteria | 4293 |
| 1005 | Ga0500594_0054708 | 3300053118 | Bacteria | 1134 |
| 1006 | Ga0500595_000572 | 3300053119 | Bacteria | 21961 |
| 1007 | Ga0500595_052569 | 3300053119 | Bacteria | 1257 |
| 1008 | Ga0500595_055810 | 3300053119 | Bacteria | 1209 |
| 1009 | Ga0500608_066104 | 3300053122 | Bacteria | 1724 |
| 1010 | Ga0500618_014810 | 3300053125 | Bacteria | 1983 |
| 1011 | Ga0500626_092170 | 3300053128 | Bacteria | 1329 |
| 1012 | Ga0500642_0014296 | 3300053130 | Bacteria | 2948 |
| 1013 | Ga0500652_278543 | 3300053131 | Bacteria | 654 |
| 1014 | Ga0500655_000251 | 3300053133 | Bacteria | 12576 |
| 1015 | Ga0500658_0010885 | 3300053134 | Bacteria | 3356 |
| 1016 | Ga0500658_0014446 | 3300053134 | Bacteria | 2923 |
| 1017 | Ga0500658_0267841 | 3300053134 | Bacteria | 785 |
| 1018 | Ga0500658_0476850 | 3300053134 | Bacteria | 566 |
| 1019 | Ga0500559_0159324 | 3300053136 | Bacteria | 1060 |
| 1020 | Ga0500559_0232776 | 3300053136 | Bacteria | 868 |
| 1021 | Ga0500564_386623 | 3300053138 | Bacteria | 510 |
| 1022 | Ga0500568_0018906 | 3300053139 | Bacteria | 3006 |
| 1023 | Ga0500568_0092427 | 3300053139 | Bacteria | 1140 |
| 1024 | Ga0500568_0195118 | 3300053139 | Bacteria | 742 |
| 1025 | Ga0500588_0071841 | 3300053146 | Bacteria | 1137 |
| 1026 | Ga0500590_000131 | 3300053148 | Bacteria | 20923 |
| 1027 | Ga0500604_0036484 | 3300053151 | Bacteria | 1466 |
| 1028 | Ga0500604_0071415 | 3300053151 | Bacteria | 1107 |
| 1029 | Ga0500616_0008241 | 3300053153 | Bacteria | 6496 |
| 1030 | Ga0500616_0222499 | 3300053153 | Bacteria | 822 |
| 1031 | Ga0500616_0284202 | 3300053153 | Bacteria | 693 |
| 1032 | Ga0500616_0291538 | 3300053153 | Bacteria | 681 |
| 1033 | Ga0500622_0025695 | 3300053156 | Bacteria | 3111 |
| 1034 | Ga0500622_0077848 | 3300053156 | Bacteria | 1665 |
| 1035 | Ga0500622_0091256 | 3300053156 | Bacteria | 1511 |
| 1036 | Ga0500624_000063 | 3300053157 | Bacteria | 65333 |
| 1037 | Ga0500627_0001223 | 3300053158 | Bacteria | 7068 |
| 1038 | Ga0500627_0027041 | 3300053158 | Bacteria | 2372 |
| 1039 | Ga0500627_0378067 | 3300053158 | Bacteria | 607 |
| 1040 | Ga0500639_139272 | 3300053163 | Bacteria | 1137 |
| 1041 | Ga0500636_0058873 | 3300053177 | Bacteria | 2245 |
| 1042 | Ga0500570_004079 | 3300053724 | Bacteria | 7637 |
| 1043 | Ga0500645_180888 | 3300053730 | Bacteria | 573 |
| 1044 | Ga0500645_223100 | 3300053730 | Bacteria | 504 |
| 1045 | Ga0500601_034828 | 3300053737 | Bacteria | 604 |
| 1046 | Ga0501084_0791318 | 3300054114 | Bacteria | 799 |
| 1047 | Ga0587066_169647 | 3300059490 | Bacteria | 554 |
| 1048 | Ga0587077_168426 | 3300059493 | Bacteria | 585 |
| 1049 | Ga0587088_134191 | 3300059508 | Bacteria | 585 |
| 1050 | Ga0587094_030537 | 3300059513 | Bacteria | 833 |
| 1051 | Ga0587067_076756 | 3300059640 | Bacteria | 732 |
| 1052 | Ga0587069_140777 | 3300059642 | Bacteria | 528 |
| 1053 | Ga0501082_0979656 | 3300060353 | Bacteria | 739 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005937 | Ga0081455_10000255 | Ga0081455_1000025558 | 67 |
| 2 | 3300013307 | Ga0157372_10113522 | Ga0157372_101135224 | 67 |
| 3 | 3300048924 | Ga0496121_0568689 | Ga0496121_0568689_11_217 | 67 |
| 4 | iso_pu_bacteria | 2523231067 | 2523469825 | 72 |
| 5 | iso_pu_bacteria | 2738543031 | 2739348858 | 72 |
| 6 | iso_pu_bacteria | 2990265787 | 2990266882 | 72 |
| 7 | iso_pu_bacteria | 2993693658 | 2993693827 | 72 |
| 8 | iso_pu_bacteria | 2510917021 | 2511130325 | 73 |
| 9 | iso_pu_bacteria | 2582581305 | 2585262260 | 73 |
| 10 | iso_pu_bacteria | 2599185359 | 2600225503 | 73 |
| 11 | iso_pu_bacteria | 2643221541 | 2643731598 | 73 |
| 12 | iso_pu_bacteria | 2643221605 | 2644036775 | 73 |
| 13 | iso_pu_bacteria | 2643221606 | 2644042074 | 73 |
| 14 | iso_pu_bacteria | 2643221622 | 2644126038 | 73 |
| 15 | iso_pu_bacteria | 2643221671 | 2644394283 | 73 |
| 16 | iso_pu_bacteria | 2738541275 | 2738709615 | 73 |
| 17 | iso_pu_bacteria | 2738541301 | 2738848040 | 73 |
| 18 | iso_pu_bacteria | 2738541304 | 2738863769 | 73 |
| 19 | iso_pu_bacteria | 2738543022 | 2739296287 | 73 |
| 20 | iso_pu_bacteria | 2738543033 | 2739357965 | 73 |
| 21 | iso_pu_bacteria | 2818991466 | 2819713935 | 73 |
| 22 | iso_pu_bacteria | 2879163058 | 2879165166 | 73 |
| 23 | iso_pu_bacteria | 2917554339 | 2917557483 | 73 |
| 24 | iso_pu_bacteria | 2928526807 | 2928528495 | 73 |
| 25 | iso_pu_bacteria | 2928959182 | 2928960419 | 73 |
| 26 | iso_pu_bacteria | 2928968154 | 2928970040 | 73 |
| 27 | iso_pu_bacteria | 8054302542 | 8054303052 | 73 |
| 28 | 3300009036 | Ga0105244_10606409 | Ga0105244_106064091 | 74 |
| 29 | 3300009093 | Ga0105240_10015679 | Ga0105240_1001567910 | 74 |
| 30 | 3300010375 | Ga0105239_10000367 | Ga0105239_1000036749 | 74 |
| 31 | 3300013105 | Ga0157369_12006581 | Ga0157369_120065812 | 74 |
| 32 | 3300053104 | Ga0500556_0189304 | Ga0500556_0189304_106_336 | 74 |
| 33 | 3300005981 | Ga0081538_10004148 | Ga0081538_1000414812 | 75 |
| 34 | 3300009011 | Ga0105251_10638162 | Ga0105251_106381621 | 75 |
| 35 | 3300009101 | Ga0105247_10001891 | Ga0105247_1000189119 | 75 |
| 36 | 3300009177 | Ga0105248_10088281 | Ga0105248_100882816 | 75 |
| 37 | 3300009553 | Ga0105249_10019753 | Ga0105249_100197535 | 75 |
| 38 | 3300013306 | Ga0163162_10019579 | Ga0163162_100195797 | 75 |
| 39 | 3300013306 | Ga0163162_12257592 | Ga0163162_122575921 | 75 |
| 40 | 3300014325 | Ga0163163_10030114 | Ga0163163_100301146 | 75 |
| 41 | 3300014968 | Ga0157379_10128162 | Ga0157379_101281622 | 75 |
| 42 | 3300017792 | Ga0163161_10030597 | Ga0163161_100305973 | 75 |
| 43 | 3300021388 | Ga0213875_10524352 | Ga0213875_105243522 | 75 |
| 44 | 3300025735 | Ga0207713_1036906 | Ga0207713_10369063 | 75 |
| 45 | 3300035111 | Ga0373923_0143888 | Ga0373923_0143888_470_697 | 75 |
| 46 | 3300037853 | Ga0436364_0878110 | Ga0436364_0878110_504_734 | 75 |
| 47 | 3300039447 | Ga0436361_1051839 | Ga0436361_1051839_754_987 | 75 |
| 48 | 3300041491 | Ga0451833_1022453 | Ga0451833_1022453_148_381 | 75 |
| 49 | 3300044658 | Ga0466972_0086674 | Ga0466972_0086674_560_787 | 75 |
| 50 | 3300044842 | Ga0466957_0347333 | Ga0466957_0347333_406_633 | 75 |
| 51 | 3300045976 | Ga0466967_0379221 | Ga0466967_0379221_739_966 | 75 |
| 52 | 3300046491 | Ga0495584_0078046 | Ga0495584_0078046_1073_1300 | 75 |
| 53 | 3300046519 | Ga0495632_0000006 | Ga0495632_0000006_333366_333593 | 75 |
| 54 | 3300046520 | Ga0495637_0000784 | Ga0495637_0000784_8175_8402 | 75 |
| 55 | 3300046522 | Ga0495643_0000021 | Ga0495643_0000021_54889_55116 | 75 |
| 56 | 3300046524 | Ga0495648_0045945 | Ga0495648_0045945_405_632 | 75 |
| 57 | 3300046525 | Ga0495663_0000008 | Ga0495663_0000008_12291_12518 | 75 |
| 58 | 3300046530 | Ga0495654_0116202 | Ga0495654_0116202_526_762 | 75 |
| 59 | 3300046558 | Ga0495633_0000190 | Ga0495633_0000190_79727_79954 | 75 |
| 60 | 3300046558 | Ga0495633_0002635 | Ga0495633_0002635_14_241 | 75 |
| 61 | 3300046660 | Ga0495625_0215510 | Ga0495625_0215510_701_928 | 75 |
| 62 | 3300046692 | Ga0495671_0000017 | Ga0495671_0000017_238350_238577 | 75 |
| 63 | 3300047470 | Ga0495681_0008268 | Ga0495681_0008268_3090_3317 | 75 |
| 64 | 3300047472 | Ga0495686_0254178 | Ga0495686_0254178_484_717 | 75 |
| 65 | 3300047472 | Ga0495686_0686152 | Ga0495686_0686152_14_241 | 75 |
| 66 | 3300048903 | Ga0496100_0082969 | Ga0496100_0082969_227_454 | 75 |
| 67 | 3300048904 | Ga0496101_0138327 | Ga0496101_0138327_625_852 | 75 |
| 68 | 3300048904 | Ga0496101_0333953 | Ga0496101_0333953_492_719 | 75 |
| 69 | 3300048905 | Ga0496102_0298555 | Ga0496102_0298555_258_485 | 75 |
| 70 | 3300048906 | Ga0496103_0132529 | Ga0496103_0132529_412_639 | 75 |
| 71 | 3300048906 | Ga0496103_0651014 | Ga0496103_0651014_375_602 | 75 |
| 72 | 3300048908 | Ga0496105_0615800 | Ga0496105_0615800_158_385 | 75 |
| 73 | 3300048909 | Ga0496106_0168900 | Ga0496106_0168900_1265_1492 | 75 |
| 74 | 3300048909 | Ga0496106_0222120 | Ga0496106_0222120_342_569 | 75 |
| 75 | 3300048910 | Ga0496107_0173558 | Ga0496107_0173558_818_1045 | 75 |
| 76 | 3300048912 | Ga0496109_0116418 | Ga0496109_0116418_1893_2120 | 75 |
| 77 | 3300048913 | Ga0496110_0124785 | Ga0496110_0124785_287_514 | 75 |
| 78 | 3300048913 | Ga0496110_1131155 | Ga0496110_1131155_202_429 | 75 |
| 79 | 3300048914 | Ga0496111_0328540 | Ga0496111_0328540_310_537 | 75 |
| 80 | 3300048914 | Ga0496111_0458563 | Ga0496111_0458563_666_893 | 75 |
| 81 | 3300048919 | Ga0496116_0050745 | Ga0496116_0050745_477_704 | 75 |
| 82 | 3300048920 | Ga0496117_0055578 | Ga0496117_0055578_1277_1504 | 75 |
| 83 | 3300048920 | Ga0496117_0312713 | Ga0496117_0312713_182_409 | 75 |
| 84 | 3300048921 | Ga0496118_0003742 | Ga0496118_0003742_16884_17111 | 75 |
| 85 | 3300048921 | Ga0496118_0076829 | Ga0496118_0076829_841_1068 | 75 |
| 86 | 3300048921 | Ga0496118_0127031 | Ga0496118_0127031_1258_1485 | 75 |
| 87 | 3300048923 | Ga0496120_0487953 | Ga0496120_0487953_170_400 | 75 |
| 88 | 3300048924 | Ga0496121_0017016 | Ga0496121_0017016_3191_3418 | 75 |
| 89 | 3300048924 | Ga0496121_0115314 | Ga0496121_0115314_361_588 | 75 |
| 90 | 3300048925 | Ga0496122_0003556 | Ga0496122_0003556_7974_8201 | 75 |
| 91 | 3300048925 | Ga0496122_0420631 | Ga0496122_0420631_93_323 | 75 |
| 92 | 3300048926 | Ga0496123_0016815 | Ga0496123_0016815_141_368 | 75 |
| 93 | 3300048927 | Ga0496124_0023588 | Ga0496124_0023588_2649_2876 | 75 |
| 94 | 3300048927 | Ga0496124_0023873 | Ga0496124_0023873_1075_1302 | 75 |
| 95 | 3300048928 | Ga0496125_0034343 | Ga0496125_0034343_2047_2274 | 75 |
| 96 | 3300048929 | Ga0496126_0121519 | Ga0496126_0121519_1689_1916 | 75 |
| 97 | 3300048929 | Ga0496126_0632782 | Ga0496126_0632782_237_464 | 75 |
| 98 | 3300048929 | Ga0496126_1231595 | Ga0496126_1231595_297_524 | 75 |
| 99 | 3300049460 | Ga0495682_0279655 | Ga0495682_0279655_189_416 | 75 |
| 100 | 3300049744 | Ga0501083_0271764 | Ga0501083_0271764_583_810 | 75 |
| 101 | 3300053116 | Ga0500592_000031 | Ga0500592_000031_4541_4777 | 75 |
| 102 | 3300053119 | Ga0500595_052569 | Ga0500595_052569_599_829 | 75 |
| 103 | 3300053153 | Ga0500616_0008241 | Ga0500616_0008241_2770_3003 | 75 |
| 104 | 3300053158 | Ga0500627_0001223 | Ga0500627_0001223_5507_5743 | 75 |
| 105 | 3300005578 | Ga0068854_100301862 | Ga0068854_1003018623 | 76 |
| 106 | 3300009093 | Ga0105240_10025126 | Ga0105240_100251269 | 76 |
| 107 | 3300009093 | Ga0105240_12089073 | Ga0105240_120890732 | 76 |
| 108 | 3300009148 | Ga0105243_10942050 | Ga0105243_109420502 | 76 |
| 109 | 3300009174 | Ga0105241_10707420 | Ga0105241_107074201 | 76 |
| 110 | 3300009545 | Ga0105237_10044206 | Ga0105237_100442063 | 76 |
| 111 | 3300009551 | Ga0105238_11442421 | Ga0105238_114424212 | 76 |
| 112 | 3300013104 | Ga0157370_10214812 | Ga0157370_102148124 | 76 |
| 113 | 3300013105 | Ga0157369_10109686 | Ga0157369_101096863 | 76 |
| 114 | 3300013306 | Ga0163162_10301457 | Ga0163162_103014572 | 76 |
| 115 | 3300014497 | Ga0182008_10307738 | Ga0182008_103077382 | 76 |
| 116 | 3300021384 | Ga0213876_10024618 | Ga0213876_100246185 | 76 |
| 117 | 3300021384 | Ga0213876_10601056 | Ga0213876_106010561 | 76 |
| 118 | 3300021388 | Ga0213875_10009905 | Ga0213875_100099055 | 76 |
| 119 | 3300025913 | Ga0207695_10016421 | Ga0207695_100164218 | 76 |
| 120 | 3300025913 | Ga0207695_10021724 | Ga0207695_100217244 | 76 |
| 121 | 3300025914 | Ga0207671_10027639 | Ga0207671_100276395 | 76 |
| 122 | 3300025924 | Ga0207694_10801093 | Ga0207694_108010931 | 76 |
| 123 | 3300025981 | Ga0207640_10031448 | Ga0207640_100314484 | 76 |
| 124 | 3300026116 | Ga0207674_10300559 | Ga0207674_103005592 | 76 |
| 125 | 3300031731 | Ga0307405_11486235 | Ga0307405_114862351 | 76 |
| 126 | 3300037853 | Ga0436364_0741438 | Ga0436364_0741438_137_367 | 76 |
| 127 | 3300039437 | Ga0436365_0212007 | Ga0436365_0212007_416_646 | 76 |
| 128 | 3300039437 | Ga0436365_0922307 | Ga0436365_0922307_68_298 | 76 |
| 129 | 3300039437 | Ga0436365_1667312 | Ga0436365_1667312_209_439 | 76 |
| 130 | 3300039437 | Ga0436365_1773361 | Ga0436365_1773361_5038_5268 | 76 |
| 131 | 3300045051 | Ga0451576_0436970 | Ga0451576_0436970_545_787 | 76 |
| 132 | 3300046501 | Ga0495607_0093490 | Ga0495607_0093490_33_263 | 76 |
| 133 | 3300048920 | Ga0496117_0033071 | Ga0496117_0033071_116_346 | 76 |
| 134 | 3300048920 | Ga0496117_0089533 | Ga0496117_0089533_913_1143 | 76 |
| 135 | 3300048921 | Ga0496118_0015970 | Ga0496118_0015970_1521_1751 | 76 |
| 136 | 3300048924 | Ga0496121_0010499 | Ga0496121_0010499_7265_7495 | 76 |
| 137 | 3300048924 | Ga0496121_0016723 | Ga0496121_0016723_4437_4667 | 76 |
| 138 | 3300048929 | Ga0496126_0016996 | Ga0496126_0016996_2708_2938 | 76 |
| 139 | 3300053136 | Ga0500559_0159324 | Ga0500559_0159324_677_907 | 76 |
| 140 | 3300053156 | Ga0500622_0077848 | Ga0500622_0077848_361_591 | 76 |
| 141 | 2162886007 | SwRhRL2b_contig_14491 | SwRhRL2b_0808.00005180 | 77 |
| 142 | 3300000043 | ARcpr5yngRDRAFT_c004470 | ARcpr5yngRDRAFT_0044703 | 77 |
| 143 | 3300000652 | ARCol0yngRDRAFT_1009092 | ARCol0yngRDRAFT_10090921 | 77 |
| 144 | 3300001904 | JGI24736J21556_1000613 | JGI24736J21556_10006135 | 77 |
| 145 | 3300001915 | JGI24741J21665_1000366 | JGI24741J21665_100036612 | 77 |
| 146 | 3300001976 | JGI24752J21851_1006793 | JGI24752J21851_10067933 | 77 |
| 147 | 3300001979 | JGI24740J21852_10005104 | JGI24740J21852_100051045 | 77 |
| 148 | 3300001979 | JGI24740J21852_10044246 | JGI24740J21852_100442462 | 77 |
| 149 | 3300001989 | JGI24739J22299_10005319 | JGI24739J22299_100053193 | 77 |
| 150 | 3300001989 | JGI24739J22299_10006470 | JGI24739J22299_100064703 | 77 |
| 151 | 3300001989 | JGI24739J22299_10110044 | JGI24739J22299_101100442 | 77 |
| 152 | 3300001989 | JGI24739J22299_10112626 | JGI24739J22299_101126262 | 77 |
| 153 | 3300001989 | JGI24739J22299_10159140 | JGI24739J22299_101591402 | 77 |
| 154 | 3300001990 | JGI24737J22298_10015406 | JGI24737J22298_100154065 | 77 |
| 155 | 3300001990 | JGI24737J22298_10020406 | JGI24737J22298_100204064 | 77 |
| 156 | 3300001990 | JGI24737J22298_10048588 | JGI24737J22298_100485883 | 77 |
| 157 | 3300001990 | JGI24737J22298_10132662 | JGI24737J22298_101326622 | 77 |
| 158 | 3300001990 | JGI24737J22298_10186610 | JGI24737J22298_101866102 | 77 |
| 159 | 3300001991 | JGI24743J22301_10030394 | JGI24743J22301_100303943 | 77 |
| 160 | 3300001991 | JGI24743J22301_10113531 | JGI24743J22301_101135312 | 77 |
| 161 | 3300002067 | JGI24735J21928_10000590 | JGI24735J21928_1000059014 | 77 |
| 162 | 3300002067 | JGI24735J21928_10004614 | JGI24735J21928_100046145 | 77 |
| 163 | 3300002067 | JGI24735J21928_10004932 | JGI24735J21928_100049325 | 77 |
| 164 | 3300002067 | JGI24735J21928_10015755 | JGI24735J21928_100157554 | 77 |
| 165 | 3300002067 | JGI24735J21928_10018807 | JGI24735J21928_100188074 | 77 |
| 166 | 3300002067 | JGI24735J21928_10041906 | JGI24735J21928_100419062 | 77 |
| 167 | 3300002067 | JGI24735J21928_10058528 | JGI24735J21928_100585282 | 77 |
| 168 | 3300002067 | JGI24735J21928_10059101 | JGI24735J21928_100591012 | 77 |
| 169 | 3300002067 | JGI24735J21928_10135297 | JGI24735J21928_101352971 | 77 |
| 170 | 3300002067 | JGI24735J21928_10202768 | JGI24735J21928_102027682 | 77 |
| 171 | 3300002074 | JGI24748J21848_1005228 | JGI24748J21848_10052283 | 77 |
| 172 | 3300002074 | JGI24748J21848_1057374 | JGI24748J21848_10573742 | 77 |
| 173 | 3300002075 | JGI24738J21930_10000184 | JGI24738J21930_100001844 | 77 |
| 174 | 3300002075 | JGI24738J21930_10000231 | JGI24738J21930_1000023116 | 77 |
| 175 | 3300002075 | JGI24738J21930_10001740 | JGI24738J21930_100017407 | 77 |
| 176 | 3300002075 | JGI24738J21930_10015275 | JGI24738J21930_100152753 | 77 |
| 177 | 3300002076 | JGI24749J21850_1000049 | JGI24749J21850_10000497 | 77 |
| 178 | 3300002077 | JGI24744J21845_10008674 | JGI24744J21845_100086743 | 77 |
| 179 | 3300002126 | JGI24035J26624_1026616 | JGI24035J26624_10266161 | 77 |
| 180 | 3300002239 | JGI24034J26672_10003845 | JGI24034J26672_100038453 | 77 |
| 181 | 3300002239 | JGI24034J26672_10041405 | JGI24034J26672_100414051 | 77 |
| 182 | 3300002459 | JGI24751J29686_10000216 | JGI24751J29686_1000021618 | 77 |
| 183 | 3300002459 | JGI24751J29686_10018164 | JGI24751J29686_100181643 | 77 |
| 184 | 3300002772 | JGI25164J39214_1007846 | JGI25164J39214_10078463 | 77 |
| 185 | 3300002774 | JGI25150J39212_1002047 | JGI25150J39212_10020476 | 77 |
| 186 | 3300003187 | JGI25151J46595_10122326 | JGI25151J46595_101223262 | 77 |
| 187 | 3300003214 | JGI25165J46597_1000043 | JGI25165J46597_1000043168 | 77 |
| 188 | 3300003215 | JGI25153J46596_10000395 | JGI25153J46596_1000039516 | 77 |
| 189 | 3300003215 | JGI25153J46596_10002504 | JGI25153J46596_100025043 | 77 |
| 190 | 3300003316 | rootH1_10113314 | rootH1_101133143 | 77 |
| 191 | 3300003323 | rootH1_10035136 | rootH1_100351364 | 77 |
| 192 | 3300003763 | Ga0055529_1042867 | Ga0055529_10428672 | 77 |
| 193 | 3300003773 | Ga0055537_1001019 | Ga0055537_10010194 | 77 |
| 194 | 3300003775 | Ga0055524_1000056 | Ga0055524_10000563 | 77 |
| 195 | 3300003790 | Ga0055528_1020848 | Ga0055528_10208483 | 77 |
| 196 | 3300003791 | Ga0055530_10000931 | Ga0055530_1000093127 | 77 |
| 197 | 3300003791 | Ga0055530_10007314 | Ga0055530_100073142 | 77 |
| 198 | 3300003792 | Ga0055540_1002064 | Ga0055540_10020648 | 77 |
| 199 | 3300003794 | Ga0055531_10012617 | Ga0055531_100126174 | 77 |
| 200 | 3300003794 | Ga0055531_10015017 | Ga0055531_100150174 | 77 |
| 201 | 3300005262 | Ga0065165_1005029 | Ga0065165_10050295 | 77 |
| 202 | 3300005262 | Ga0065165_1009273 | Ga0065165_10092732 | 77 |
| 203 | 3300005262 | Ga0065165_1017463 | Ga0065165_10174632 | 77 |
| 204 | 3300005262 | Ga0065165_1062777 | Ga0065165_10627772 | 77 |
| 205 | 3300005288 | Ga0065714_10116065 | Ga0065714_101160652 | 77 |
| 206 | 3300005289 | Ga0065704_10070504 | Ga0065704_1007050421 | 77 |
| 207 | 3300005295 | Ga0065707_10000505 | Ga0065707_1000050535 | 77 |
| 208 | 3300005295 | Ga0065707_10086198 | Ga0065707_100861984 | 77 |
| 209 | 3300005295 | Ga0065707_10135500 | Ga0065707_101355003 | 77 |
| 210 | 3300005295 | Ga0065707_10212812 | Ga0065707_102128123 | 77 |
| 211 | 3300005295 | Ga0065707_10371722 | Ga0065707_103717223 | 77 |
| 212 | 3300005295 | Ga0065707_10414622 | Ga0065707_104146221 | 77 |
| 213 | 3300005295 | Ga0065707_10938111 | Ga0065707_109381112 | 77 |
| 214 | 3300005327 | Ga0070658_10006525 | Ga0070658_1000652512 | 77 |
| 215 | 3300005327 | Ga0070658_10068992 | Ga0070658_100689922 | 77 |
| 216 | 3300005327 | Ga0070658_10097157 | Ga0070658_100971575 | 77 |
| 217 | 3300005327 | Ga0070658_10584581 | Ga0070658_105845812 | 77 |
| 218 | 3300005327 | Ga0070658_10669238 | Ga0070658_106692382 | 77 |
| 219 | 3300005327 | Ga0070658_11102012 | Ga0070658_111020121 | 77 |
| 220 | 3300005328 | Ga0070676_10000230 | Ga0070676_100002307 | 77 |
| 221 | 3300005329 | Ga0070683_100195033 | Ga0070683_1001950333 | 77 |
| 222 | 3300005331 | Ga0070670_100000003 | Ga0070670_100000003364 | 77 |
| 223 | 3300005331 | Ga0070670_100002377 | Ga0070670_1000023779 | 77 |
| 224 | 3300005331 | Ga0070670_100004170 | Ga0070670_10000417016 | 77 |
| 225 | 3300005331 | Ga0070670_100126344 | Ga0070670_1001263443 | 77 |
| 226 | 3300005331 | Ga0070670_100189232 | Ga0070670_1001892323 | 77 |
| 227 | 3300005333 | Ga0070677_10801344 | Ga0070677_108013442 | 77 |
| 228 | 3300005334 | Ga0068869_100000200 | Ga0068869_10000020029 | 77 |
| 229 | 3300005335 | Ga0070666_10000184 | Ga0070666_1000018423 | 77 |
| 230 | 3300005335 | Ga0070666_10033483 | Ga0070666_100334834 | 77 |
| 231 | 3300005335 | Ga0070666_10257671 | Ga0070666_102576712 | 77 |
| 232 | 3300005337 | Ga0070682_100302630 | Ga0070682_1003026301 | 77 |
| 233 | 3300005338 | Ga0068868_100001398 | Ga0068868_10000139811 | 77 |
| 234 | 3300005339 | Ga0070660_100004583 | Ga0070660_1000045838 | 77 |
| 235 | 3300005339 | Ga0070660_100070534 | Ga0070660_1000705343 | 77 |
| 236 | 3300005339 | Ga0070660_100209408 | Ga0070660_1002094082 | 77 |
| 237 | 3300005339 | Ga0070660_100996905 | Ga0070660_1009969052 | 77 |
| 238 | 3300005344 | Ga0070661_100581848 | Ga0070661_1005818483 | 77 |
| 239 | 3300005344 | Ga0070661_101005335 | Ga0070661_1010053352 | 77 |
| 240 | 3300005347 | Ga0070668_100000026 | Ga0070668_10000002628 | 77 |
| 241 | 3300005347 | Ga0070668_100000080 | Ga0070668_10000008020 | 77 |
| 242 | 3300005347 | Ga0070668_100018364 | Ga0070668_1000183646 | 77 |
| 243 | 3300005347 | Ga0070668_100027483 | Ga0070668_1000274832 | 77 |
| 244 | 3300005347 | Ga0070668_100208292 | Ga0070668_1002082923 | 77 |
| 245 | 3300005347 | Ga0070668_100408180 | Ga0070668_1004081803 | 77 |
| 246 | 3300005347 | Ga0070668_100428915 | Ga0070668_1004289152 | 77 |
| 247 | 3300005353 | Ga0070669_100000008 | Ga0070669_10000000846 | 77 |
| 248 | 3300005353 | Ga0070669_100000020 | Ga0070669_100000020116 | 77 |
| 249 | 3300005353 | Ga0070669_100000082 | Ga0070669_1000000827 | 77 |
| 250 | 3300005353 | Ga0070669_100096603 | Ga0070669_1000966033 | 77 |
| 251 | 3300005354 | Ga0070675_100006627 | Ga0070675_1000066275 | 77 |
| 252 | 3300005355 | Ga0070671_100000015 | Ga0070671_100000015139 | 77 |
| 253 | 3300005355 | Ga0070671_100000169 | Ga0070671_10000016927 | 77 |
| 254 | 3300005355 | Ga0070671_100000470 | Ga0070671_10000047020 | 77 |
| 255 | 3300005355 | Ga0070671_100013092 | Ga0070671_1000130923 | 77 |
| 256 | 3300005355 | Ga0070671_100053502 | Ga0070671_1000535025 | 77 |
| 257 | 3300005356 | Ga0070674_100051002 | Ga0070674_1000510023 | 77 |
| 258 | 3300005364 | Ga0070673_100000006 | Ga0070673_100000006121 | 77 |
| 259 | 3300005364 | Ga0070673_101154028 | Ga0070673_1011540282 | 77 |
| 260 | 3300005365 | Ga0070688_100464942 | Ga0070688_1004649422 | 77 |
| 261 | 3300005366 | Ga0070659_100052995 | Ga0070659_1000529953 | 77 |
| 262 | 3300005366 | Ga0070659_100899434 | Ga0070659_1008994342 | 77 |
| 263 | 3300005366 | Ga0070659_101485301 | Ga0070659_1014853011 | 77 |
| 264 | 3300005366 | Ga0070659_101711550 | Ga0070659_1017115502 | 77 |
| 265 | 3300005367 | Ga0070667_100000019 | Ga0070667_100000019214 | 77 |
| 266 | 3300005367 | Ga0070667_100006367 | Ga0070667_1000063675 | 77 |
| 267 | 3300005367 | Ga0070667_100037194 | Ga0070667_1000371942 | 77 |
| 268 | 3300005367 | Ga0070667_100038717 | Ga0070667_1000387178 | 77 |
| 269 | 3300005367 | Ga0070667_100681738 | Ga0070667_1006817382 | 77 |
| 270 | 3300005440 | Ga0070705_100054779 | Ga0070705_1000547792 | 77 |
| 271 | 3300005440 | Ga0070705_100448402 | Ga0070705_1004484022 | 77 |
| 272 | 3300005445 | Ga0070708_100198374 | Ga0070708_1001983741 | 77 |
| 273 | 3300005445 | Ga0070708_101344162 | Ga0070708_1013441622 | 77 |
| 274 | 3300005455 | Ga0070663_100000574 | Ga0070663_10000057424 | 77 |
| 275 | 3300005455 | Ga0070663_100002941 | Ga0070663_1000029419 | 77 |
| 276 | 3300005455 | Ga0070663_101387399 | Ga0070663_1013873992 | 77 |
| 277 | 3300005456 | Ga0070678_100552397 | Ga0070678_1005523972 | 77 |
| 278 | 3300005457 | Ga0070662_100007108 | Ga0070662_1000071084 | 77 |
| 279 | 3300005457 | Ga0070662_100094062 | Ga0070662_1000940624 | 77 |
| 280 | 3300005457 | Ga0070662_100561610 | Ga0070662_1005616101 | 77 |
| 281 | 3300005457 | Ga0070662_100819864 | Ga0070662_1008198641 | 77 |
| 282 | 3300005457 | Ga0070662_101003480 | Ga0070662_1010034802 | 77 |
| 283 | 3300005459 | Ga0068867_100000001 | Ga0068867_100000001366 | 77 |
| 284 | 3300005466 | Ga0070685_10103920 | Ga0070685_101039204 | 77 |
| 285 | 3300005466 | Ga0070685_10368722 | Ga0070685_103687222 | 77 |
| 286 | 3300005468 | Ga0070707_101322160 | Ga0070707_1013221602 | 77 |
| 287 | 3300005530 | Ga0070679_100158874 | Ga0070679_1001588743 | 77 |
| 288 | 3300005530 | Ga0070679_100424436 | Ga0070679_1004244362 | 77 |
| 289 | 3300005535 | Ga0070684_100251597 | Ga0070684_1002515973 | 77 |
| 290 | 3300005539 | Ga0068853_100143479 | Ga0068853_1001434795 | 77 |
| 291 | 3300005539 | Ga0068853_100881719 | Ga0068853_1008817192 | 77 |
| 292 | 3300005539 | Ga0068853_100884100 | Ga0068853_1008841002 | 77 |
| 293 | 3300005539 | Ga0068853_102321716 | Ga0068853_1023217162 | 77 |
| 294 | 3300005543 | Ga0070672_100004199 | Ga0070672_10000419913 | 77 |
| 295 | 3300005544 | Ga0070686_100290882 | Ga0070686_1002908822 | 77 |
| 296 | 3300005548 | Ga0070665_100002434 | Ga0070665_1000024343 | 77 |
| 297 | 3300005548 | Ga0070665_100009702 | Ga0070665_1000097023 | 77 |
| 298 | 3300005548 | Ga0070665_100095381 | Ga0070665_1000953813 | 77 |
| 299 | 3300005548 | Ga0070665_100378831 | Ga0070665_1003788312 | 77 |
| 300 | 3300005548 | Ga0070665_100420653 | Ga0070665_1004206532 | 77 |
| 301 | 3300005548 | Ga0070665_100895973 | Ga0070665_1008959732 | 77 |
| 302 | 3300005548 | Ga0070665_101432299 | Ga0070665_1014322991 | 77 |
| 303 | 3300005563 | Ga0068855_100218364 | Ga0068855_1002183645 | 77 |
| 304 | 3300005563 | Ga0068855_100577260 | Ga0068855_1005772603 | 77 |
| 305 | 3300005563 | Ga0068855_101048138 | Ga0068855_1010481382 | 77 |
| 306 | 3300005563 | Ga0068855_101587902 | Ga0068855_1015879022 | 77 |
| 307 | 3300005563 | Ga0068855_102121698 | Ga0068855_1021216981 | 77 |
| 308 | 3300005577 | Ga0068857_100021366 | Ga0068857_1000213664 | 77 |
| 309 | 3300005577 | Ga0068857_100637109 | Ga0068857_1006371092 | 77 |
| 310 | 3300005577 | Ga0068857_100711507 | Ga0068857_1007115072 | 77 |
| 311 | 3300005578 | Ga0068854_100000483 | Ga0068854_10000048329 | 77 |
| 312 | 3300005578 | Ga0068854_100538554 | Ga0068854_1005385542 | 77 |
| 313 | 3300005578 | Ga0068854_101277453 | Ga0068854_1012774532 | 77 |
| 314 | 3300005614 | Ga0068856_100003591 | Ga0068856_1000035915 | 77 |
| 315 | 3300005614 | Ga0068856_100020542 | Ga0068856_1000205424 | 77 |
| 316 | 3300005614 | Ga0068856_100312622 | Ga0068856_1003126222 | 77 |
| 317 | 3300005616 | Ga0068852_100028295 | Ga0068852_1000282952 | 77 |
| 318 | 3300005616 | Ga0068852_100608851 | Ga0068852_1006088511 | 77 |
| 319 | 3300005616 | Ga0068852_101516957 | Ga0068852_1015169572 | 77 |
| 320 | 3300005617 | Ga0068859_100003505 | Ga0068859_1000035057 | 77 |
| 321 | 3300005617 | Ga0068859_100023533 | Ga0068859_1000235335 | 77 |
| 322 | 3300005617 | Ga0068859_100034581 | Ga0068859_1000345813 | 77 |
| 323 | 3300005617 | Ga0068859_100216629 | Ga0068859_1002166293 | 77 |
| 324 | 3300005617 | Ga0068859_100679313 | Ga0068859_1006793133 | 77 |
| 325 | 3300005617 | Ga0068859_100859376 | Ga0068859_1008593762 | 77 |
| 326 | 3300005618 | Ga0068864_100000005 | Ga0068864_100000005231 | 77 |
| 327 | 3300005618 | Ga0068864_100030140 | Ga0068864_1000301404 | 77 |
| 328 | 3300005618 | Ga0068864_100466728 | Ga0068864_1004667282 | 77 |
| 329 | 3300005719 | Ga0068861_100004980 | Ga0068861_1000049803 | 77 |
| 330 | 3300005719 | Ga0068861_100154977 | Ga0068861_1001549773 | 77 |
| 331 | 3300005834 | Ga0068851_10074177 | Ga0068851_100741773 | 77 |
| 332 | 3300005841 | Ga0068863_100000001 | Ga0068863_100000001357 | 77 |
| 333 | 3300005841 | Ga0068863_100000582 | Ga0068863_10000058212 | 77 |
| 334 | 3300005841 | Ga0068863_100067996 | Ga0068863_1000679963 | 77 |
| 335 | 3300005841 | Ga0068863_100084694 | Ga0068863_1000846941 | 77 |
| 336 | 3300005841 | Ga0068863_100137511 | Ga0068863_1001375112 | 77 |
| 337 | 3300005841 | Ga0068863_100313791 | Ga0068863_1003137913 | 77 |
| 338 | 3300005842 | Ga0068858_100010355 | Ga0068858_10001035512 | 77 |
| 339 | 3300005842 | Ga0068858_100034454 | Ga0068858_1000344544 | 77 |
| 340 | 3300005842 | Ga0068858_100380650 | Ga0068858_1003806503 | 77 |
| 341 | 3300005843 | Ga0068860_100000036 | Ga0068860_100000036228 | 77 |
| 342 | 3300005843 | Ga0068860_100001081 | Ga0068860_10000108117 | 77 |
| 343 | 3300005843 | Ga0068860_100004358 | Ga0068860_1000043582 | 77 |
| 344 | 3300005843 | Ga0068860_100044110 | Ga0068860_1000441104 | 77 |
| 345 | 3300005843 | Ga0068860_100115216 | Ga0068860_1001152162 | 77 |
| 346 | 3300005843 | Ga0068860_100263556 | Ga0068860_1002635563 | 77 |
| 347 | 3300005843 | Ga0068860_100310382 | Ga0068860_1003103823 | 77 |
| 348 | 3300005843 | Ga0068860_102676641 | Ga0068860_1026766412 | 77 |
| 349 | 3300005844 | Ga0068862_100000001 | Ga0068862_100000001222 | 77 |
| 350 | 3300005844 | Ga0068862_100000169 | Ga0068862_1000001695 | 77 |
| 351 | 3300005844 | Ga0068862_100001451 | Ga0068862_10000145111 | 77 |
| 352 | 3300005844 | Ga0068862_100006085 | Ga0068862_10000608511 | 77 |
| 353 | 3300005844 | Ga0068862_100021177 | Ga0068862_1000211777 | 77 |
| 354 | 3300005844 | Ga0068862_100049285 | Ga0068862_1000492857 | 77 |
| 355 | 3300005844 | Ga0068862_100087044 | Ga0068862_1000870442 | 77 |
| 356 | 3300005844 | Ga0068862_101234307 | Ga0068862_1012343072 | 77 |
| 357 | 3300005937 | Ga0081455_10023602 | Ga0081455_100236022 | 77 |
| 358 | 3300005981 | Ga0081538_10036760 | Ga0081538_100367604 | 77 |
| 359 | 3300006051 | Ga0075364_10197055 | Ga0075364_101970553 | 77 |
| 360 | 3300006051 | Ga0075364_10888517 | Ga0075364_108885172 | 77 |
| 361 | 3300006195 | Ga0075366_10043167 | Ga0075366_100431673 | 77 |
| 362 | 3300006195 | Ga0075366_10245806 | Ga0075366_102458063 | 77 |
| 363 | 3300006195 | Ga0075366_10576769 | Ga0075366_105767692 | 77 |
| 364 | 3300006195 | Ga0075366_10726065 | Ga0075366_107260652 | 77 |
| 365 | 3300006195 | Ga0075366_10801680 | Ga0075366_108016802 | 77 |
| 366 | 3300006237 | Ga0097621_100001076 | Ga0097621_10000107614 | 77 |
| 367 | 3300006353 | Ga0075370_10043587 | Ga0075370_100435873 | 77 |
| 368 | 3300006353 | Ga0075370_10637142 | Ga0075370_106371422 | 77 |
| 369 | 3300006358 | Ga0068871_100067527 | Ga0068871_1000675272 | 77 |
| 370 | 3300006358 | Ga0068871_101210368 | Ga0068871_1012103682 | 77 |
| 371 | 3300006881 | Ga0068865_100000003 | Ga0068865_100000003197 | 77 |
| 372 | 3300006931 | Ga0097620_100003505 | Ga0097620_1000035057 | 77 |
| 373 | 3300006931 | Ga0097620_100023532 | Ga0097620_1000235326 | 77 |
| 374 | 3300006931 | Ga0097620_100034580 | Ga0097620_1000345807 | 77 |
| 375 | 3300006931 | Ga0097620_100216626 | Ga0097620_1002166263 | 77 |
| 376 | 3300006931 | Ga0097620_100679134 | Ga0097620_1006791343 | 77 |
| 377 | 3300006931 | Ga0097620_100859461 | Ga0097620_1008594612 | 77 |
| 378 | 3300009011 | Ga0105251_10012362 | Ga0105251_100123623 | 77 |
| 379 | 3300009092 | Ga0105250_10006517 | Ga0105250_100065173 | 77 |
| 380 | 3300009093 | Ga0105240_10091793 | Ga0105240_100917935 | 77 |
| 381 | 3300009093 | Ga0105240_10318721 | Ga0105240_103187215 | 77 |
| 382 | 3300009093 | Ga0105240_10744819 | Ga0105240_107448192 | 77 |
| 383 | 3300009098 | Ga0105245_10000113 | Ga0105245_1000011349 | 77 |
| 384 | 3300009098 | Ga0105245_10032215 | Ga0105245_100322154 | 77 |
| 385 | 3300009101 | Ga0105247_10369422 | Ga0105247_103694222 | 77 |
| 386 | 3300009148 | Ga0105243_10000373 | Ga0105243_1000037342 | 77 |
| 387 | 3300009148 | Ga0105243_10328860 | Ga0105243_103288602 | 77 |
| 388 | 3300009174 | Ga0105241_10038453 | Ga0105241_100384534 | 77 |
| 389 | 3300009176 | Ga0105242_10000165 | Ga0105242_100001652 | 77 |
| 390 | 3300009177 | Ga0105248_10001558 | Ga0105248_1000155813 | 77 |
| 391 | 3300009177 | Ga0105248_10024425 | Ga0105248_100244253 | 77 |
| 392 | 3300009177 | Ga0105248_10043233 | Ga0105248_100432332 | 77 |
| 393 | 3300009177 | Ga0105248_13138180 | Ga0105248_131381802 | 77 |
| 394 | 3300009545 | Ga0105237_11408470 | Ga0105237_114084702 | 77 |
| 395 | 3300009545 | Ga0105237_11679876 | Ga0105237_116798761 | 77 |
| 396 | 3300009545 | Ga0105237_12603792 | Ga0105237_126037922 | 77 |
| 397 | 3300009551 | Ga0105238_10635331 | Ga0105238_106353312 | 77 |
| 398 | 3300009551 | Ga0105238_11154457 | Ga0105238_111544571 | 77 |
| 399 | 3300009553 | Ga0105249_10000045 | Ga0105249_1000004512 | 77 |
| 400 | 3300009553 | Ga0105249_10037409 | Ga0105249_100374095 | 77 |
| 401 | 3300009553 | Ga0105249_10084345 | Ga0105249_100843455 | 77 |
| 402 | 3300009553 | Ga0105249_10265973 | Ga0105249_102659732 | 77 |
| 403 | 3300009553 | Ga0105249_10758182 | Ga0105249_107581823 | 77 |
| 404 | 3300010375 | Ga0105239_10012172 | Ga0105239_100121725 | 77 |
| 405 | 3300010375 | Ga0105239_10326543 | Ga0105239_103265433 | 77 |
| 406 | 3300010375 | Ga0105239_10846266 | Ga0105239_108462662 | 77 |
| 407 | 3300010375 | Ga0105239_10931845 | Ga0105239_109318452 | 77 |
| 408 | 3300011119 | Ga0105246_10001620 | Ga0105246_1000162012 | 77 |
| 409 | 3300012513 | Ga0157326_1000423 | Ga0157326_10004233 | 77 |
| 410 | 3300013100 | Ga0157373_10081550 | Ga0157373_100815502 | 77 |
| 411 | 3300013100 | Ga0157373_10136804 | Ga0157373_101368044 | 77 |
| 412 | 3300013100 | Ga0157373_10232191 | Ga0157373_102321912 | 77 |
| 413 | 3300013102 | Ga0157371_10160163 | Ga0157371_101601632 | 77 |
| 414 | 3300013102 | Ga0157371_10492244 | Ga0157371_104922443 | 77 |
| 415 | 3300013102 | Ga0157371_11482642 | Ga0157371_114826422 | 77 |
| 416 | 3300013102 | Ga0157371_11598663 | Ga0157371_115986632 | 77 |
| 417 | 3300013102 | Ga0157371_11604795 | Ga0157371_116047952 | 77 |
| 418 | 3300013104 | Ga0157370_10000069 | Ga0157370_1000006957 | 77 |
| 419 | 3300013104 | Ga0157370_10057965 | Ga0157370_100579656 | 77 |
| 420 | 3300013104 | Ga0157370_10174746 | Ga0157370_101747462 | 77 |
| 421 | 3300013104 | Ga0157370_10647775 | Ga0157370_106477751 | 77 |
| 422 | 3300013104 | Ga0157370_10971235 | Ga0157370_109712352 | 77 |
| 423 | 3300013104 | Ga0157370_11695857 | Ga0157370_116958571 | 77 |
| 424 | 3300013105 | Ga0157369_10012597 | Ga0157369_100125979 | 77 |
| 425 | 3300013105 | Ga0157369_10173906 | Ga0157369_101739064 | 77 |
| 426 | 3300013105 | Ga0157369_10174888 | Ga0157369_101748883 | 77 |
| 427 | 3300013105 | Ga0157369_12357748 | Ga0157369_123577481 | 77 |
| 428 | 3300013296 | Ga0157374_10100942 | Ga0157374_101009422 | 77 |
| 429 | 3300013296 | Ga0157374_10393274 | Ga0157374_103932743 | 77 |
| 430 | 3300013296 | Ga0157374_10432242 | Ga0157374_104322423 | 77 |
| 431 | 3300013297 | Ga0157378_10002300 | Ga0157378_1000230012 | 77 |
| 432 | 3300013306 | Ga0163162_10016081 | Ga0163162_100160817 | 77 |
| 433 | 3300013306 | Ga0163162_13217757 | Ga0163162_132177571 | 77 |
| 434 | 3300013307 | Ga0157372_10118609 | Ga0157372_101186094 | 77 |
| 435 | 3300013307 | Ga0157372_10209575 | Ga0157372_102095753 | 77 |
| 436 | 3300013307 | Ga0157372_10258817 | Ga0157372_102588174 | 77 |
| 437 | 3300013307 | Ga0157372_10288298 | Ga0157372_102882984 | 77 |
| 438 | 3300013307 | Ga0157372_10337590 | Ga0157372_103375905 | 77 |
| 439 | 3300013307 | Ga0157372_10567943 | Ga0157372_105679432 | 77 |
| 440 | 3300013307 | Ga0157372_10932088 | Ga0157372_109320882 | 77 |
| 441 | 3300013307 | Ga0157372_12775511 | Ga0157372_127755112 | 77 |
| 442 | 3300013308 | Ga0157375_10041491 | Ga0157375_100414916 | 77 |
| 443 | 3300013308 | Ga0157375_10798349 | Ga0157375_107983493 | 77 |
| 444 | 3300014326 | Ga0157380_10000029 | Ga0157380_1000002964 | 77 |
| 445 | 3300014326 | Ga0157380_10001161 | Ga0157380_1000116110 | 77 |
| 446 | 3300014326 | Ga0157380_10230670 | Ga0157380_102306702 | 77 |
| 447 | 3300014326 | Ga0157380_12204024 | Ga0157380_122040241 | 77 |
| 448 | 3300014745 | Ga0157377_10067056 | Ga0157377_100670565 | 77 |
| 449 | 3300014968 | Ga0157379_10770590 | Ga0157379_107705902 | 77 |
| 450 | 3300014969 | Ga0157376_10000089 | Ga0157376_1000008950 | 77 |
| 451 | 3300017792 | Ga0163161_10000101 | Ga0163161_1000010152 | 77 |
| 452 | 3300017792 | Ga0163161_10019426 | Ga0163161_100194264 | 77 |
| 453 | 3300017792 | Ga0163161_10148380 | Ga0163161_101483802 | 77 |
| 454 | 3300017792 | Ga0163161_11831506 | Ga0163161_118315062 | 77 |
| 455 | 3300020070 | Ga0206356_11727543 | Ga0206356_117275432 | 77 |
| 456 | 3300020078 | Ga0206352_10131959 | Ga0206352_101319592 | 77 |
| 457 | 3300025229 | Ga0209147_103605 | Ga0209147_1036052 | 77 |
| 458 | 3300025231 | Ga0207427_101450 | Ga0207427_10145010 | 77 |
| 459 | 3300025245 | Ga0207425_1000041 | Ga0207425_100004163 | 77 |
| 460 | 3300025245 | Ga0207425_1015629 | Ga0207425_10156293 | 77 |
| 461 | 3300025250 | Ga0209026_1004345 | Ga0209026_10043455 | 77 |
| 462 | 3300025254 | Ga0209148_1000238 | Ga0209148_100023851 | 77 |
| 463 | 3300025254 | Ga0209148_1001034 | Ga0209148_100103425 | 77 |
| 464 | 3300025258 | Ga0209129_1002094 | Ga0209129_10020942 | 77 |
| 465 | 3300025261 | Ga0209233_1000079 | Ga0209233_1000079102 | 77 |
| 466 | 3300025261 | Ga0209233_1073702 | Ga0209233_10737022 | 77 |
| 467 | 3300025263 | Ga0209565_1000008 | Ga0209565_1000008633 | 77 |
| 468 | 3300025263 | Ga0209565_1000134 | Ga0209565_100013447 | 77 |
| 469 | 3300025272 | Ga0209455_1000952 | Ga0209455_10009526 | 77 |
| 470 | 3300025272 | Ga0209455_1056735 | Ga0209455_10567352 | 77 |
| 471 | 3300025273 | Ga0209673_1002352 | Ga0209673_100235212 | 77 |
| 472 | 3300025273 | Ga0209673_1029162 | Ga0209673_10291622 | 77 |
| 473 | 3300025291 | Ga0209675_1009250 | Ga0209675_10092505 | 77 |
| 474 | 3300025292 | Ga0209676_1026408 | Ga0209676_10264083 | 77 |
| 475 | 3300025294 | Ga0209025_1000068 | Ga0209025_1000068232 | 77 |
| 476 | 3300025295 | Ga0209564_1080218 | Ga0209564_10802182 | 77 |
| 477 | 3300025297 | Ga0209758_1000004 | Ga0209758_1000004131 | 77 |
| 478 | 3300025297 | Ga0209758_1012697 | Ga0209758_10126977 | 77 |
| 479 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000012061 | 77 |
| 480 | 3300025298 | Ga0209050_1000581 | Ga0209050_100058118 | 77 |
| 481 | 3300025298 | Ga0209050_1000687 | Ga0209050_100068713 | 77 |
| 482 | 3300025298 | Ga0209050_1007158 | Ga0209050_10071589 | 77 |
| 483 | 3300025299 | Ga0209256_1000009 | Ga0209256_1000009236 | 77 |
| 484 | 3300025299 | Ga0209256_1000010 | Ga0209256_1000010160 | 77 |
| 485 | 3300025302 | Ga0207426_1037675 | Ga0207426_10376753 | 77 |
| 486 | 3300025303 | Ga0209051_1000191 | Ga0209051_10001918 | 77 |
| 487 | 3300025304 | Ga0209257_1000876 | Ga0209257_100087611 | 77 |
| 488 | 3300025304 | Ga0209257_1002353 | Ga0209257_100235310 | 77 |
| 489 | 3300025304 | Ga0209257_1002898 | Ga0209257_10028984 | 77 |
| 490 | 3300025304 | Ga0209257_1003401 | Ga0209257_10034014 | 77 |
| 491 | 3300025304 | Ga0209257_1037487 | Ga0209257_10374871 | 77 |
| 492 | 3300025304 | Ga0209257_1100855 | Ga0209257_11008552 | 77 |
| 493 | 3300025315 | Ga0207697_10006525 | Ga0207697_100065255 | 77 |
| 494 | 3300025315 | Ga0207697_10530809 | Ga0207697_105308092 | 77 |
| 495 | 3300025321 | Ga0207656_10012218 | Ga0207656_100122183 | 77 |
| 496 | 3300025321 | Ga0207656_10159701 | Ga0207656_101597012 | 77 |
| 497 | 3300025711 | Ga0207696_1007265 | Ga0207696_10072653 | 77 |
| 498 | 3300025735 | Ga0207713_1010142 | Ga0207713_10101426 | 77 |
| 499 | 3300025900 | Ga0207710_10007240 | Ga0207710_100072403 | 77 |
| 500 | 3300025900 | Ga0207710_10012300 | Ga0207710_100123003 | 77 |
| 501 | 3300025900 | Ga0207710_10207976 | Ga0207710_102079762 | 77 |
| 502 | 3300025900 | Ga0207710_10331102 | Ga0207710_103311022 | 77 |
| 503 | 3300025901 | Ga0207688_10409565 | Ga0207688_104095651 | 77 |
| 504 | 3300025901 | Ga0207688_10846280 | Ga0207688_108462802 | 77 |
| 505 | 3300025901 | Ga0207688_11043763 | Ga0207688_110437632 | 77 |
| 506 | 3300025903 | Ga0207680_10000010 | Ga0207680_10000010156 | 77 |
| 507 | 3300025903 | Ga0207680_10000186 | Ga0207680_1000018614 | 77 |
| 508 | 3300025903 | Ga0207680_10093912 | Ga0207680_100939124 | 77 |
| 509 | 3300025904 | Ga0207647_10000038 | Ga0207647_1000003818 | 77 |
| 510 | 3300025904 | Ga0207647_10002647 | Ga0207647_1000264714 | 77 |
| 511 | 3300025904 | Ga0207647_10032481 | Ga0207647_100324813 | 77 |
| 512 | 3300025904 | Ga0207647_10041942 | Ga0207647_100419425 | 77 |
| 513 | 3300025904 | Ga0207647_10065904 | Ga0207647_100659043 | 77 |
| 514 | 3300025904 | Ga0207647_10095073 | Ga0207647_100950732 | 77 |
| 515 | 3300025904 | Ga0207647_10207898 | Ga0207647_102078982 | 77 |
| 516 | 3300025904 | Ga0207647_10212165 | Ga0207647_102121653 | 77 |
| 517 | 3300025904 | Ga0207647_10283643 | Ga0207647_102836431 | 77 |
| 518 | 3300025904 | Ga0207647_10393125 | Ga0207647_103931252 | 77 |
| 519 | 3300025907 | Ga0207645_10003616 | Ga0207645_1000361612 | 77 |
| 520 | 3300025909 | Ga0207705_10000121 | Ga0207705_1000012122 | 77 |
| 521 | 3300025909 | Ga0207705_10000365 | Ga0207705_1000036535 | 77 |
| 522 | 3300025909 | Ga0207705_10014470 | Ga0207705_100144705 | 77 |
| 523 | 3300025909 | Ga0207705_10135124 | Ga0207705_101351244 | 77 |
| 524 | 3300025909 | Ga0207705_10159690 | Ga0207705_101596903 | 77 |
| 525 | 3300025911 | Ga0207654_10000375 | Ga0207654_1000037527 | 77 |
| 526 | 3300025911 | Ga0207654_10080510 | Ga0207654_100805103 | 77 |
| 527 | 3300025911 | Ga0207654_10098883 | Ga0207654_100988833 | 77 |
| 528 | 3300025913 | Ga0207695_10001183 | Ga0207695_1000118319 | 77 |
| 529 | 3300025913 | Ga0207695_10031555 | Ga0207695_100315557 | 77 |
| 530 | 3300025913 | Ga0207695_10077775 | Ga0207695_100777753 | 77 |
| 531 | 3300025913 | Ga0207695_10223979 | Ga0207695_102239791 | 77 |
| 532 | 3300025913 | Ga0207695_10873246 | Ga0207695_108732462 | 77 |
| 533 | 3300025914 | Ga0207671_10001192 | Ga0207671_1000119214 | 77 |
| 534 | 3300025914 | Ga0207671_11237598 | Ga0207671_112375981 | 77 |
| 535 | 3300025914 | Ga0207671_11279455 | Ga0207671_112794551 | 77 |
| 536 | 3300025918 | Ga0207662_11126671 | Ga0207662_111266712 | 77 |
| 537 | 3300025919 | Ga0207657_10015487 | Ga0207657_100154873 | 77 |
| 538 | 3300025919 | Ga0207657_10026870 | Ga0207657_100268703 | 77 |
| 539 | 3300025919 | Ga0207657_10048996 | Ga0207657_100489965 | 77 |
| 540 | 3300025919 | Ga0207657_10387615 | Ga0207657_103876153 | 77 |
| 541 | 3300025919 | Ga0207657_11006315 | Ga0207657_110063152 | 77 |
| 542 | 3300025920 | Ga0207649_10150506 | Ga0207649_101505063 | 77 |
| 543 | 3300025920 | Ga0207649_10167287 | Ga0207649_101672873 | 77 |
| 544 | 3300025920 | Ga0207649_10831047 | Ga0207649_108310472 | 77 |
| 545 | 3300025920 | Ga0207649_11059835 | Ga0207649_110598352 | 77 |
| 546 | 3300025921 | Ga0207652_10134787 | Ga0207652_101347873 | 77 |
| 547 | 3300025921 | Ga0207652_10286625 | Ga0207652_102866252 | 77 |
| 548 | 3300025923 | Ga0207681_10000002 | Ga0207681_10000002138 | 77 |
| 549 | 3300025923 | Ga0207681_10000005 | Ga0207681_10000005357 | 77 |
| 550 | 3300025923 | Ga0207681_10000109 | Ga0207681_1000010928 | 77 |
| 551 | 3300025923 | Ga0207681_10000183 | Ga0207681_1000018345 | 77 |
| 552 | 3300025923 | Ga0207681_10033288 | Ga0207681_100332883 | 77 |
| 553 | 3300025923 | Ga0207681_10094028 | Ga0207681_100940285 | 77 |
| 554 | 3300025923 | Ga0207681_10122960 | Ga0207681_101229602 | 77 |
| 555 | 3300025923 | Ga0207681_10716631 | Ga0207681_107166311 | 77 |
| 556 | 3300025924 | Ga0207694_10002087 | Ga0207694_1000208714 | 77 |
| 557 | 3300025924 | Ga0207694_10091001 | Ga0207694_100910012 | 77 |
| 558 | 3300025924 | Ga0207694_10345340 | Ga0207694_103453401 | 77 |
| 559 | 3300025924 | Ga0207694_10637068 | Ga0207694_106370682 | 77 |
| 560 | 3300025925 | Ga0207650_10000004 | Ga0207650_10000004361 | 77 |
| 561 | 3300025925 | Ga0207650_10002904 | Ga0207650_1000290411 | 77 |
| 562 | 3300025925 | Ga0207650_10006404 | Ga0207650_100064045 | 77 |
| 563 | 3300025925 | Ga0207650_10049447 | Ga0207650_100494475 | 77 |
| 564 | 3300025925 | Ga0207650_10174974 | Ga0207650_101749743 | 77 |
| 565 | 3300025926 | Ga0207659_10136023 | Ga0207659_101360233 | 77 |
| 566 | 3300025927 | Ga0207687_10000225 | Ga0207687_1000022520 | 77 |
| 567 | 3300025927 | Ga0207687_10010076 | Ga0207687_100100766 | 77 |
| 568 | 3300025931 | Ga0207644_10000002 | Ga0207644_10000002137 | 77 |
| 569 | 3300025931 | Ga0207644_10000012 | Ga0207644_1000001261 | 77 |
| 570 | 3300025931 | Ga0207644_10000067 | Ga0207644_1000006748 | 77 |
| 571 | 3300025931 | Ga0207644_10001857 | Ga0207644_100018573 | 77 |
| 572 | 3300025931 | Ga0207644_10022749 | Ga0207644_100227493 | 77 |
| 573 | 3300025931 | Ga0207644_10700505 | Ga0207644_107005052 | 77 |
| 574 | 3300025932 | Ga0207690_10157914 | Ga0207690_101579142 | 77 |
| 575 | 3300025932 | Ga0207690_10186911 | Ga0207690_101869113 | 77 |
| 576 | 3300025932 | Ga0207690_10337182 | Ga0207690_103371823 | 77 |
| 577 | 3300025932 | Ga0207690_10342161 | Ga0207690_103421613 | 77 |
| 578 | 3300025932 | Ga0207690_10356195 | Ga0207690_103561952 | 77 |
| 579 | 3300025932 | Ga0207690_10878067 | Ga0207690_108780671 | 77 |
| 580 | 3300025933 | Ga0207706_10008805 | Ga0207706_100088054 | 77 |
| 581 | 3300025933 | Ga0207706_10033279 | Ga0207706_100332794 | 77 |
| 582 | 3300025933 | Ga0207706_10083285 | Ga0207706_100832854 | 77 |
| 583 | 3300025933 | Ga0207706_10138164 | Ga0207706_101381643 | 77 |
| 584 | 3300025933 | Ga0207706_10198802 | Ga0207706_101988023 | 77 |
| 585 | 3300025933 | Ga0207706_11217586 | Ga0207706_112175862 | 77 |
| 586 | 3300025934 | Ga0207686_10001878 | Ga0207686_100018782 | 77 |
| 587 | 3300025935 | Ga0207709_10000173 | Ga0207709_1000017346 | 77 |
| 588 | 3300025935 | Ga0207709_10088718 | Ga0207709_100887182 | 77 |
| 589 | 3300025935 | Ga0207709_11210901 | Ga0207709_112109012 | 77 |
| 590 | 3300025937 | Ga0207669_10046739 | Ga0207669_100467393 | 77 |
| 591 | 3300025937 | Ga0207669_11000337 | Ga0207669_110003372 | 77 |
| 592 | 3300025938 | Ga0207704_10000001 | Ga0207704_10000001322 | 77 |
| 593 | 3300025940 | Ga0207691_10009162 | Ga0207691_1000916211 | 77 |
| 594 | 3300025941 | Ga0207711_10000075 | Ga0207711_1000007523 | 77 |
| 595 | 3300025941 | Ga0207711_10024088 | Ga0207711_100240884 | 77 |
| 596 | 3300025941 | Ga0207711_10114106 | Ga0207711_101141062 | 77 |
| 597 | 3300025941 | Ga0207711_10236570 | Ga0207711_102365703 | 77 |
| 598 | 3300025941 | Ga0207711_11362142 | Ga0207711_113621422 | 77 |
| 599 | 3300025942 | Ga0207689_10000744 | Ga0207689_1000074429 | 77 |
| 600 | 3300025942 | Ga0207689_11445008 | Ga0207689_114450082 | 77 |
| 601 | 3300025944 | Ga0207661_10482382 | Ga0207661_104823822 | 77 |
| 602 | 3300025944 | Ga0207661_11506624 | Ga0207661_115066241 | 77 |
| 603 | 3300025945 | Ga0207679_10123611 | Ga0207679_101236113 | 77 |
| 604 | 3300025945 | Ga0207679_10140360 | Ga0207679_101403605 | 77 |
| 605 | 3300025949 | Ga0207667_10000016 | Ga0207667_1000001623 | 77 |
| 606 | 3300025949 | Ga0207667_10011748 | Ga0207667_100117489 | 77 |
| 607 | 3300025949 | Ga0207667_10112317 | Ga0207667_101123174 | 77 |
| 608 | 3300025949 | Ga0207667_10498960 | Ga0207667_104989603 | 77 |
| 609 | 3300025949 | Ga0207667_10638165 | Ga0207667_106381652 | 77 |
| 610 | 3300025960 | Ga0207651_10000002 | Ga0207651_1000000283 | 77 |
| 611 | 3300025960 | Ga0207651_11013347 | Ga0207651_110133472 | 77 |
| 612 | 3300025961 | Ga0207712_10000014 | Ga0207712_10000014251 | 77 |
| 613 | 3300025961 | Ga0207712_10000174 | Ga0207712_1000017412 | 77 |
| 614 | 3300025961 | Ga0207712_10018137 | Ga0207712_100181375 | 77 |
| 615 | 3300025961 | Ga0207712_10057696 | Ga0207712_100576963 | 77 |
| 616 | 3300025961 | Ga0207712_10092123 | Ga0207712_100921233 | 77 |
| 617 | 3300025961 | Ga0207712_10657395 | Ga0207712_106573952 | 77 |
| 618 | 3300025961 | Ga0207712_11277392 | Ga0207712_112773922 | 77 |
| 619 | 3300025961 | Ga0207712_11688390 | Ga0207712_116883902 | 77 |
| 620 | 3300025972 | Ga0207668_10000081 | Ga0207668_1000008158 | 77 |
| 621 | 3300025972 | Ga0207668_10000304 | Ga0207668_1000030420 | 77 |
| 622 | 3300025972 | Ga0207668_10005340 | Ga0207668_100053409 | 77 |
| 623 | 3300025972 | Ga0207668_10083673 | Ga0207668_100836732 | 77 |
| 624 | 3300025972 | Ga0207668_10085277 | Ga0207668_100852772 | 77 |
| 625 | 3300025972 | Ga0207668_10328540 | Ga0207668_103285402 | 77 |
| 626 | 3300025972 | Ga0207668_10484314 | Ga0207668_104843143 | 77 |
| 627 | 3300025981 | Ga0207640_10000063 | Ga0207640_1000006334 | 77 |
| 628 | 3300025981 | Ga0207640_10062003 | Ga0207640_100620031 | 77 |
| 629 | 3300025981 | Ga0207640_10100271 | Ga0207640_101002713 | 77 |
| 630 | 3300025981 | Ga0207640_10157229 | Ga0207640_101572294 | 77 |
| 631 | 3300025981 | Ga0207640_11027507 | Ga0207640_110275071 | 77 |
| 632 | 3300025981 | Ga0207640_11246724 | Ga0207640_112467242 | 77 |
| 633 | 3300025981 | Ga0207640_11397633 | Ga0207640_113976331 | 77 |
| 634 | 3300025986 | Ga0207658_10000002 | Ga0207658_10000002240 | 77 |
| 635 | 3300025986 | Ga0207658_10001566 | Ga0207658_100015663 | 77 |
| 636 | 3300025986 | Ga0207658_10004095 | Ga0207658_100040955 | 77 |
| 637 | 3300025986 | Ga0207658_10008782 | Ga0207658_100087824 | 77 |
| 638 | 3300025986 | Ga0207658_10018656 | Ga0207658_100186564 | 77 |
| 639 | 3300025986 | Ga0207658_10819713 | Ga0207658_108197132 | 77 |
| 640 | 3300026023 | Ga0207677_10000030 | Ga0207677_1000003054 | 77 |
| 641 | 3300026035 | Ga0207703_10005351 | Ga0207703_100053519 | 77 |
| 642 | 3300026035 | Ga0207703_10008030 | Ga0207703_100080303 | 77 |
| 643 | 3300026035 | Ga0207703_10009134 | Ga0207703_100091348 | 77 |
| 644 | 3300026035 | Ga0207703_10124179 | Ga0207703_101241792 | 77 |
| 645 | 3300026041 | Ga0207639_10000213 | Ga0207639_1000021312 | 77 |
| 646 | 3300026041 | Ga0207639_10012302 | Ga0207639_100123027 | 77 |
| 647 | 3300026041 | Ga0207639_10036850 | Ga0207639_100368504 | 77 |
| 648 | 3300026041 | Ga0207639_10122498 | Ga0207639_101224983 | 77 |
| 649 | 3300026041 | Ga0207639_10602963 | Ga0207639_106029632 | 77 |
| 650 | 3300026041 | Ga0207639_10828173 | Ga0207639_108281732 | 77 |
| 651 | 3300026067 | Ga0207678_10000857 | Ga0207678_1000085727 | 77 |
| 652 | 3300026067 | Ga0207678_10001793 | Ga0207678_100017939 | 77 |
| 653 | 3300026067 | Ga0207678_10088208 | Ga0207678_100882083 | 77 |
| 654 | 3300026078 | Ga0207702_10000887 | Ga0207702_1000088714 | 77 |
| 655 | 3300026078 | Ga0207702_10002945 | Ga0207702_1000294522 | 77 |
| 656 | 3300026078 | Ga0207702_10019109 | Ga0207702_100191096 | 77 |
| 657 | 3300026088 | Ga0207641_10000001 | Ga0207641_10000001693 | 77 |
| 658 | 3300026088 | Ga0207641_10000099 | Ga0207641_1000009973 | 77 |
| 659 | 3300026088 | Ga0207641_10002512 | Ga0207641_100025127 | 77 |
| 660 | 3300026088 | Ga0207641_10004505 | Ga0207641_100045057 | 77 |
| 661 | 3300026088 | Ga0207641_10013693 | Ga0207641_100136935 | 77 |
| 662 | 3300026088 | Ga0207641_10014410 | Ga0207641_100144109 | 77 |
| 663 | 3300026088 | Ga0207641_11282650 | Ga0207641_112826502 | 77 |
| 664 | 3300026089 | Ga0207648_10000001 | Ga0207648_1000000183 | 77 |
| 665 | 3300026095 | Ga0207676_10000006 | Ga0207676_10000006351 | 77 |
| 666 | 3300026095 | Ga0207676_10000770 | Ga0207676_100007703 | 77 |
| 667 | 3300026095 | Ga0207676_10022559 | Ga0207676_100225595 | 77 |
| 668 | 3300026116 | Ga0207674_10131652 | Ga0207674_101316521 | 77 |
| 669 | 3300026116 | Ga0207674_10337148 | Ga0207674_103371482 | 77 |
| 670 | 3300026116 | Ga0207674_11129632 | Ga0207674_111296322 | 77 |
| 671 | 3300026116 | Ga0207674_11201849 | Ga0207674_112018491 | 77 |
| 672 | 3300026118 | Ga0207675_100000358 | Ga0207675_1000003586 | 77 |
| 673 | 3300026118 | Ga0207675_100001138 | Ga0207675_10000113819 | 77 |
| 674 | 3300026118 | Ga0207675_100230090 | Ga0207675_1002300904 | 77 |
| 675 | 3300026121 | Ga0207683_10182888 | Ga0207683_101828883 | 77 |
| 676 | 3300026142 | Ga0207698_10034383 | Ga0207698_100343832 | 77 |
| 677 | 3300026142 | Ga0207698_10130218 | Ga0207698_101302184 | 77 |
| 678 | 3300026142 | Ga0207698_10201601 | Ga0207698_102016012 | 77 |
| 679 | 3300026142 | Ga0207698_10955811 | Ga0207698_109558112 | 77 |
| 680 | 3300026142 | Ga0207698_12752071 | Ga0207698_127520712 | 77 |
| 681 | 3300027312 | Ga0209371_1085272 | Ga0209371_10852721 | 77 |
| 682 | 3300027866 | Ga0209813_10000051 | Ga0209813_1000005137 | 77 |
| 683 | 3300028379 | Ga0268266_10000009 | Ga0268266_10000009172 | 77 |
| 684 | 3300028379 | Ga0268266_10002003 | Ga0268266_1000200320 | 77 |
| 685 | 3300028379 | Ga0268266_10006189 | Ga0268266_1000618911 | 77 |
| 686 | 3300028379 | Ga0268266_10158947 | Ga0268266_101589473 | 77 |
| 687 | 3300028379 | Ga0268266_10211526 | Ga0268266_102115264 | 77 |
| 688 | 3300028379 | Ga0268266_10315170 | Ga0268266_103151703 | 77 |
| 689 | 3300028379 | Ga0268266_10422983 | Ga0268266_104229833 | 77 |
| 690 | 3300028379 | Ga0268266_11019591 | Ga0268266_110195911 | 77 |
| 691 | 3300028379 | Ga0268266_11411114 | Ga0268266_114111142 | 77 |
| 692 | 3300028380 | Ga0268265_10000001 | Ga0268265_10000001810 | 77 |
| 693 | 3300028380 | Ga0268265_10000045 | Ga0268265_1000004512 | 77 |
| 694 | 3300028380 | Ga0268265_10000047 | Ga0268265_1000004776 | 77 |
| 695 | 3300028380 | Ga0268265_10000285 | Ga0268265_1000028540 | 77 |
| 696 | 3300028380 | Ga0268265_10004726 | Ga0268265_100047267 | 77 |
| 697 | 3300028380 | Ga0268265_10017233 | Ga0268265_100172337 | 77 |
| 698 | 3300028380 | Ga0268265_10146980 | Ga0268265_101469803 | 77 |
| 699 | 3300028380 | Ga0268265_10315643 | Ga0268265_103156433 | 77 |
| 700 | 3300028380 | Ga0268265_10387566 | Ga0268265_103875661 | 77 |
| 701 | 3300028380 | Ga0268265_11127984 | Ga0268265_111279842 | 77 |
| 702 | 3300028381 | Ga0268264_10000001 | Ga0268264_10000001565 | 77 |
| 703 | 3300028381 | Ga0268264_10000010 | Ga0268264_10000010355 | 77 |
| 704 | 3300028381 | Ga0268264_10000023 | Ga0268264_10000023114 | 77 |
| 705 | 3300028381 | Ga0268264_10004259 | Ga0268264_1000425913 | 77 |
| 706 | 3300028381 | Ga0268264_10012572 | Ga0268264_100125725 | 77 |
| 707 | 3300028381 | Ga0268264_10105564 | Ga0268264_101055643 | 77 |
| 708 | 3300028381 | Ga0268264_10209613 | Ga0268264_102096132 | 77 |
| 709 | 3300028381 | Ga0268264_10405038 | Ga0268264_104050383 | 77 |
| 710 | 3300028786 | Ga0307517_10633740 | Ga0307517_106337402 | 77 |
| 711 | 3300030500 | Ga0268256_1046229 | Ga0268256_10462292 | 77 |
| 712 | 3300030733 | Ga0314311_1203820 | Ga0314311_12038202 | 77 |
| 713 | 3300031240 | Ga0265320_10000034 | Ga0265320_100000344 | 77 |
| 714 | 3300031241 | Ga0265325_10023456 | Ga0265325_100234562 | 77 |
| 715 | 3300031241 | Ga0265325_10037185 | Ga0265325_100371852 | 77 |
| 716 | 3300031456 | Ga0307513_10209984 | Ga0307513_102099843 | 77 |
| 717 | 3300031548 | Ga0307408_100051500 | Ga0307408_1000515003 | 77 |
| 718 | 3300031548 | Ga0307408_101128429 | Ga0307408_1011284292 | 77 |
| 719 | 3300031548 | Ga0307408_101389987 | Ga0307408_1013899872 | 77 |
| 720 | 3300031595 | Ga0265313_10000665 | Ga0265313_1000066537 | 77 |
| 721 | 3300031711 | Ga0265314_10019631 | Ga0265314_100196312 | 77 |
| 722 | 3300031711 | Ga0265314_10042189 | Ga0265314_100421893 | 77 |
| 723 | 3300031711 | Ga0265314_10118950 | Ga0265314_101189502 | 77 |
| 724 | 3300031731 | Ga0307405_10055116 | Ga0307405_100551163 | 77 |
| 725 | 3300031731 | Ga0307405_10530365 | Ga0307405_105303652 | 77 |
| 726 | 3300031731 | Ga0307405_10949213 | Ga0307405_109492132 | 77 |
| 727 | 3300031824 | Ga0307413_10332327 | Ga0307413_103323273 | 77 |
| 728 | 3300031824 | Ga0307413_11513892 | Ga0307413_115138922 | 77 |
| 729 | 3300031852 | Ga0307410_10027090 | Ga0307410_100270905 | 77 |
| 730 | 3300031852 | Ga0307410_11135650 | Ga0307410_111356502 | 77 |
| 731 | 3300031901 | Ga0307406_10589289 | Ga0307406_105892892 | 77 |
| 732 | 3300031901 | Ga0307406_10614399 | Ga0307406_106143992 | 77 |
| 733 | 3300031901 | Ga0307406_10706803 | Ga0307406_107068031 | 77 |
| 734 | 3300031901 | Ga0307406_11005598 | Ga0307406_110055982 | 77 |
| 735 | 3300031901 | Ga0307406_11917748 | Ga0307406_119177482 | 77 |
| 736 | 3300031903 | Ga0307407_10257420 | Ga0307407_102574201 | 77 |
| 737 | 3300031911 | Ga0307412_10015626 | Ga0307412_100156265 | 77 |
| 738 | 3300031911 | Ga0307412_10514991 | Ga0307412_105149912 | 77 |
| 739 | 3300031911 | Ga0307412_10947513 | Ga0307412_109475132 | 77 |
| 740 | 3300031911 | Ga0307412_11429176 | Ga0307412_114291762 | 77 |
| 741 | 3300031995 | Ga0307409_101359966 | Ga0307409_1013599662 | 77 |
| 742 | 3300031995 | Ga0307409_102980818 | Ga0307409_1029808182 | 77 |
| 743 | 3300032002 | Ga0307416_100014919 | Ga0307416_1000149198 | 77 |
| 744 | 3300032004 | Ga0307414_11712720 | Ga0307414_117127202 | 77 |
| 745 | 3300032004 | Ga0307414_11795155 | Ga0307414_117951551 | 77 |
| 746 | 3300032005 | Ga0307411_10271081 | Ga0307411_102710813 | 77 |
| 747 | 3300032005 | Ga0307411_10440296 | Ga0307411_104402963 | 77 |
| 748 | 3300032005 | Ga0307411_12160541 | Ga0307411_121605412 | 77 |
| 749 | 3300033180 | Ga0307510_10148726 | Ga0307510_101487262 | 77 |
| 750 | 3300035171 | Ga0373946_0647350 | Ga0373946_0647350_14_256 | 77 |
| 751 | 3300037312 | Ga0395899_0001521 | Ga0395899_0001521_16833_17066 | 77 |
| 752 | 3300037418 | Ga0395900_0009291 | Ga0395900_0009291_8520_8753 | 77 |
| 753 | 3300037418 | Ga0395900_1114422 | Ga0395900_1114422_340_573 | 77 |
| 754 | 3300037466 | Ga0395898_1303005 | Ga0395898_1303005_340_573 | 77 |
| 755 | 3300037471 | Ga0395905_0026896 | Ga0395905_0026896_268_501 | 77 |
| 756 | 3300037471 | Ga0395905_0516629 | Ga0395905_0516629_549_782 | 77 |
| 757 | 3300038443 | Ga0395901_0073008 | Ga0395901_0073008_1708_1941 | 77 |
| 758 | 3300038443 | Ga0395901_2127733 | Ga0395901_2127733_52_285 | 77 |
| 759 | 3300039450 | Ga0436363_0153792 | Ga0436363_0153792_577_834 | 77 |
| 760 | 3300041404 | Ga0439436_0009694 | Ga0439436_0009694_2575_2811 | 77 |
| 761 | 3300041406 | Ga0439439_0001779 | Ga0439439_0001779_2684_2923 | 77 |
| 762 | 3300041407 | Ga0439447_148918 | Ga0439447_148918_233_472 | 77 |
| 763 | 3300041410 | Ga0439461_0000498 | Ga0439461_0000498_4777_5016 | 77 |
| 764 | 3300041410 | Ga0439461_0003679 | Ga0439461_0003679_121_357 | 77 |
| 765 | 3300041410 | Ga0439461_0080904 | Ga0439461_0080904_67_306 | 77 |
| 766 | 3300041413 | Ga0439465_0004274 | Ga0439465_0004274_2480_2719 | 77 |
| 767 | 3300041413 | Ga0439465_0004757 | Ga0439465_0004757_3130_3369 | 77 |
| 768 | 3300041452 | Ga0451793_0810995 | Ga0451793_0810995_85_318 | 77 |
| 769 | 3300041452 | Ga0451793_1584048 | Ga0451793_1584048_273_506 | 77 |
| 770 | 3300041460 | Ga0451802_1834731 | Ga0451802_1834731_145_381 | 77 |
| 771 | 3300041462 | Ga0451806_522421 | Ga0451806_522421_24_260 | 77 |
| 772 | 3300041486 | Ga0451807_0720757 | Ga0451807_0720757_400_642 | 77 |
| 773 | 3300041494 | Ga0451837_1536393 | Ga0451837_1536393_224_457 | 77 |
| 774 | 3300041498 | Ga0451841_0590837 | Ga0451841_0590837_220_453 | 77 |
| 775 | 3300041512 | Ga0451853_3774724 | Ga0451853_3774724_87_320 | 77 |
| 776 | 3300041997 | Ga0439431_0038651 | Ga0439431_0038651_962_1198 | 77 |
| 777 | 3300042002 | Ga0439442_150916 | Ga0439442_150916_252_488 | 77 |
| 778 | 3300042004 | Ga0439445_0033115 | Ga0439445_0033115_723_962 | 77 |
| 779 | 3300042005 | Ga0439448_0002459 | Ga0439448_0002459_3623_3856 | 77 |
| 780 | 3300042006 | Ga0439432_000640 | Ga0439432_000640_11321_11560 | 77 |
| 781 | 3300042006 | Ga0439432_022961 | Ga0439432_022961_82_321 | 77 |
| 782 | 3300042010 | Ga0439452_018803 | Ga0439452_018803_881_1120 | 77 |
| 783 | 3300042014 | Ga0439457_024428 | Ga0439457_024428_77_316 | 77 |
| 784 | 3300042015 | Ga0439462_0002776 | Ga0439462_0002776_904_1143 | 77 |
| 785 | 3300042124 | Ga0450922_019334 | Ga0450922_019334_33_269 | 77 |
| 786 | 3300042156 | Ga0439446_0034458 | Ga0439446_0034458_1152_1391 | 77 |
| 787 | 3300042157 | Ga0439458_0000137 | Ga0439458_0000137_2376_2609 | 77 |
| 788 | 3300042185 | Ga0450909_012035 | Ga0450909_012035_749_985 | 77 |
| 789 | 3300042435 | Ga0439434_0020110 | Ga0439434_0020110_669_908 | 77 |
| 790 | 3300042461 | Ga0439460_0201787 | Ga0439460_0201787_262_495 | 77 |
| 791 | 3300044683 | Ga0466965_0529846 | Ga0466965_0529846_355_588 | 77 |
| 792 | 3300044694 | Ga0466963_0311463 | Ga0466963_0311463_232_465 | 77 |
| 793 | 3300044765 | Ga0466970_0256774 | Ga0466970_0256774_113_346 | 77 |
| 794 | 3300045836 | Ga0466958_0391983 | Ga0466958_0391983_515_748 | 77 |
| 795 | 3300045976 | Ga0466967_0633257 | Ga0466967_0633257_369_602 | 77 |
| 796 | 3300045976 | Ga0466967_2162402 | Ga0466967_2162402_45_278 | 77 |
| 797 | 3300046452 | Ga0495617_011498 | Ga0495617_011498_1209_1442 | 77 |
| 798 | 3300046453 | Ga0495627_000156 | Ga0495627_000156_31077_31310 | 77 |
| 799 | 3300046453 | Ga0495627_000578 | Ga0495627_000578_23475_23708 | 77 |
| 800 | 3300046453 | Ga0495627_034662 | Ga0495627_034662_317_556 | 77 |
| 801 | 3300046460 | Ga0495638_0000758 | Ga0495638_0000758_26384_26617 | 77 |
| 802 | 3300046460 | Ga0495638_0188677 | Ga0495638_0188677_261_503 | 77 |
| 803 | 3300046462 | Ga0495651_0721380 | Ga0495651_0721380_136_369 | 77 |
| 804 | 3300046471 | Ga0495650_0001027 | Ga0495650_0001027_21771_22004 | 77 |
| 805 | 3300046471 | Ga0495650_0227391 | Ga0495650_0227391_203_436 | 77 |
| 806 | 3300046492 | Ga0495585_0127704 | Ga0495585_0127704_291_524 | 77 |
| 807 | 3300046492 | Ga0495585_0567920 | Ga0495585_0567920_104_346 | 77 |
| 808 | 3300046506 | Ga0495583_0220617 | Ga0495583_0220617_198_431 | 77 |
| 809 | 3300046507 | Ga0495606_0072058 | Ga0495606_0072058_361_594 | 77 |
| 810 | 3300046512 | Ga0495610_0000291 | Ga0495610_0000291_51494_51727 | 77 |
| 811 | 3300046512 | Ga0495610_0144969 | Ga0495610_0144969_532_765 | 77 |
| 812 | 3300046513 | Ga0495616_0001456 | Ga0495616_0001456_4797_5030 | 77 |
| 813 | 3300046520 | Ga0495637_0010852 | Ga0495637_0010852_625_858 | 77 |
| 814 | 3300046520 | Ga0495637_0065588 | Ga0495637_0065588_312_554 | 77 |
| 815 | 3300046522 | Ga0495643_0523213 | Ga0495643_0523213_246_479 | 77 |
| 816 | 3300046524 | Ga0495648_0010683 | Ga0495648_0010683_5947_6180 | 77 |
| 817 | 3300046525 | Ga0495663_0018920 | Ga0495663_0018920_604_837 | 77 |
| 818 | 3300046525 | Ga0495663_0053401 | Ga0495663_0053401_44_277 | 77 |
| 819 | 3300046525 | Ga0495663_0242178 | Ga0495663_0242178_45_284 | 77 |
| 820 | 3300046542 | Ga0495597_0031259 | Ga0495597_0031259_731_973 | 77 |
| 821 | 3300046558 | Ga0495633_0013695 | Ga0495633_0013695_2792_3025 | 77 |
| 822 | 3300046558 | Ga0495633_0072188 | Ga0495633_0072188_852_1085 | 77 |
| 823 | 3300046558 | Ga0495633_0146062 | Ga0495633_0146062_327_569 | 77 |
| 824 | 3300046616 | Ga0495668_0002221 | Ga0495668_0002221_15410_15643 | 77 |
| 825 | 3300046616 | Ga0495668_0105921 | Ga0495668_0105921_234_476 | 77 |
| 826 | 3300046616 | Ga0495668_0574724 | Ga0495668_0574724_204_443 | 77 |
| 827 | 3300046660 | Ga0495625_0000629 | Ga0495625_0000629_8476_8709 | 77 |
| 828 | 3300046660 | Ga0495625_0393492 | Ga0495625_0393492_304_543 | 77 |
| 829 | 3300046665 | Ga0495661_0125781 | Ga0495661_0125781_1162_1401 | 77 |
| 830 | 3300046691 | Ga0495670_0000002 | Ga0495670_0000002_87294_87533 | 77 |
| 831 | 3300046691 | Ga0495670_0427746 | Ga0495670_0427746_278_511 | 77 |
| 832 | 3300046694 | Ga0495649_0327109 | Ga0495649_0327109_259_498 | 77 |
| 833 | 3300047318 | Ga0495636_0180483 | Ga0495636_0180483_285_524 | 77 |
| 834 | 3300047320 | Ga0495672_0174663 | Ga0495672_0174663_752_985 | 77 |
| 835 | 3300047320 | Ga0495672_0212818 | Ga0495672_0212818_40_273 | 77 |
| 836 | 3300047469 | Ga0495673_0028297 | Ga0495673_0028297_84_317 | 77 |
| 837 | 3300047470 | Ga0495681_0000098 | Ga0495681_0000098_11683_11916 | 77 |
| 838 | 3300047470 | Ga0495681_0009646 | Ga0495681_0009646_3401_3640 | 77 |
| 839 | 3300047470 | Ga0495681_0326806 | Ga0495681_0326806_300_542 | 77 |
| 840 | 3300047472 | Ga0495686_0005063 | Ga0495686_0005063_5067_5300 | 77 |
| 841 | 3300047472 | Ga0495686_0008463 | Ga0495686_0008463_5328_5561 | 77 |
| 842 | 3300047472 | Ga0495686_0029938 | Ga0495686_0029938_2886_3119 | 77 |
| 843 | 3300047472 | Ga0495686_0042056 | Ga0495686_0042056_501_734 | 77 |
| 844 | 3300047472 | Ga0495686_0248449 | Ga0495686_0248449_720_953 | 77 |
| 845 | 3300047472 | Ga0495686_0377163 | Ga0495686_0377163_348_581 | 77 |
| 846 | 3300048903 | Ga0496100_0182282 | Ga0496100_0182282_40_273 | 77 |
| 847 | 3300048903 | Ga0496100_1223371 | Ga0496100_1223371_151_390 | 77 |
| 848 | 3300048904 | Ga0496101_0111668 | Ga0496101_0111668_1575_1808 | 77 |
| 849 | 3300048904 | Ga0496101_0346342 | Ga0496101_0346342_284_517 | 77 |
| 850 | 3300048905 | Ga0496102_0000069 | Ga0496102_0000069_59582_59815 | 77 |
| 851 | 3300048905 | Ga0496102_0000615 | Ga0496102_0000615_33872_34105 | 77 |
| 852 | 3300048905 | Ga0496102_0172254 | Ga0496102_0172254_1067_1300 | 77 |
| 853 | 3300048905 | Ga0496102_0681373 | Ga0496102_0681373_542_781 | 77 |
| 854 | 3300048906 | Ga0496103_0000173 | Ga0496103_0000173_18174_18407 | 77 |
| 855 | 3300048906 | Ga0496103_0009010 | Ga0496103_0009010_4392_4625 | 77 |
| 856 | 3300048906 | Ga0496103_0033025 | Ga0496103_0033025_2836_3069 | 77 |
| 857 | 3300048906 | Ga0496103_0224202 | Ga0496103_0224202_383_622 | 77 |
| 858 | 3300048907 | Ga0496104_0000081 | Ga0496104_0000081_2876_3109 | 77 |
| 859 | 3300048907 | Ga0496104_0059792 | Ga0496104_0059792_1359_1592 | 77 |
| 860 | 3300048908 | Ga0496105_0000034 | Ga0496105_0000034_104573_104806 | 77 |
| 861 | 3300048908 | Ga0496105_0090922 | Ga0496105_0090922_135_368 | 77 |
| 862 | 3300048908 | Ga0496105_0363545 | Ga0496105_0363545_309_542 | 77 |
| 863 | 3300048909 | Ga0496106_0076352 | Ga0496106_0076352_580_813 | 77 |
| 864 | 3300048910 | Ga0496107_0252341 | Ga0496107_0252341_188_421 | 77 |
| 865 | 3300048912 | Ga0496109_0067327 | Ga0496109_0067327_2262_2495 | 77 |
| 866 | 3300048912 | Ga0496109_0353061 | Ga0496109_0353061_860_1099 | 77 |
| 867 | 3300048912 | Ga0496109_0539887 | Ga0496109_0539887_452_685 | 77 |
| 868 | 3300048913 | Ga0496110_0093856 | Ga0496110_0093856_1609_1842 | 77 |
| 869 | 3300048913 | Ga0496110_0325345 | Ga0496110_0325345_200_433 | 77 |
| 870 | 3300048915 | Ga0496112_0116278 | Ga0496112_0116278_1691_1924 | 77 |
| 871 | 3300048915 | Ga0496112_0663427 | Ga0496112_0663427_684_917 | 77 |
| 872 | 3300048916 | Ga0496113_0000101 | Ga0496113_0000101_33143_33376 | 77 |
| 873 | 3300048916 | Ga0496113_0366514 | Ga0496113_0366514_730_963 | 77 |
| 874 | 3300048916 | Ga0496113_1445932 | Ga0496113_1445932_225_458 | 77 |
| 875 | 3300048918 | Ga0496115_0001129 | Ga0496115_0001129_12535_12774 | 77 |
| 876 | 3300048918 | Ga0496115_0108956 | Ga0496115_0108956_294_527 | 77 |
| 877 | 3300048918 | Ga0496115_1026514 | Ga0496115_1026514_274_507 | 77 |
| 878 | 3300048919 | Ga0496116_0000062 | Ga0496116_0000062_268047_268280 | 77 |
| 879 | 3300048919 | Ga0496116_0000566 | Ga0496116_0000566_9404_9637 | 77 |
| 880 | 3300048919 | Ga0496116_0032138 | Ga0496116_0032138_2407_2640 | 77 |
| 881 | 3300048919 | Ga0496116_0101176 | Ga0496116_0101176_949_1182 | 77 |
| 882 | 3300048919 | Ga0496116_0361464 | Ga0496116_0361464_130_363 | 77 |
| 883 | 3300048920 | Ga0496117_0000146 | Ga0496117_0000146_81370_81603 | 77 |
| 884 | 3300048920 | Ga0496117_0000485 | Ga0496117_0000485_48203_48436 | 77 |
| 885 | 3300048920 | Ga0496117_0046000 | Ga0496117_0046000_2901_3134 | 77 |
| 886 | 3300048920 | Ga0496117_0251385 | Ga0496117_0251385_534_773 | 77 |
| 887 | 3300048920 | Ga0496117_0318261 | Ga0496117_0318261_315_554 | 77 |
| 888 | 3300048920 | Ga0496117_0330651 | Ga0496117_0330651_196_429 | 77 |
| 889 | 3300048921 | Ga0496118_0000190 | Ga0496118_0000190_48203_48436 | 77 |
| 890 | 3300048921 | Ga0496118_0015425 | Ga0496118_0015425_5962_6195 | 77 |
| 891 | 3300048921 | Ga0496118_0057773 | Ga0496118_0057773_86_319 | 77 |
| 892 | 3300048921 | Ga0496118_0079363 | Ga0496118_0079363_437_670 | 77 |
| 893 | 3300048921 | Ga0496118_0104776 | Ga0496118_0104776_613_846 | 77 |
| 894 | 3300048921 | Ga0496118_0139050 | Ga0496118_0139050_878_1117 | 77 |
| 895 | 3300048921 | Ga0496118_0370348 | Ga0496118_0370348_66_299 | 77 |
| 896 | 3300048922 | Ga0496119_0000057 | Ga0496119_0000057_68941_69174 | 77 |
| 897 | 3300048922 | Ga0496119_0072971 | Ga0496119_0072971_1007_1240 | 77 |
| 898 | 3300048922 | Ga0496119_0180016 | Ga0496119_0180016_765_998 | 77 |
| 899 | 3300048922 | Ga0496119_0186126 | Ga0496119_0186126_226_465 | 77 |
| 900 | 3300048922 | Ga0496119_0313654 | Ga0496119_0313654_213_446 | 77 |
| 901 | 3300048923 | Ga0496120_0005360 | Ga0496120_0005360_2860_3093 | 77 |
| 902 | 3300048923 | Ga0496120_0110614 | Ga0496120_0110614_768_1001 | 77 |
| 903 | 3300048923 | Ga0496120_0178484 | Ga0496120_0178484_397_630 | 77 |
| 904 | 3300048923 | Ga0496120_0185785 | Ga0496120_0185785_190_423 | 77 |
| 905 | 3300048924 | Ga0496121_0005623 | Ga0496121_0005623_257_490 | 77 |
| 906 | 3300048924 | Ga0496121_0015601 | Ga0496121_0015601_1787_2020 | 77 |
| 907 | 3300048924 | Ga0496121_0058069 | Ga0496121_0058069_650_883 | 77 |
| 908 | 3300048924 | Ga0496121_0180678 | Ga0496121_0180678_494_727 | 77 |
| 909 | 3300048924 | Ga0496121_0205134 | Ga0496121_0205134_147_380 | 77 |
| 910 | 3300048924 | Ga0496121_0907952 | Ga0496121_0907952_147_380 | 77 |
| 911 | 3300048925 | Ga0496122_0000723 | Ga0496122_0000723_28323_28556 | 77 |
| 912 | 3300048925 | Ga0496122_0006671 | Ga0496122_0006671_86_319 | 77 |
| 913 | 3300048925 | Ga0496122_0026134 | Ga0496122_0026134_811_1044 | 77 |
| 914 | 3300048925 | Ga0496122_0366886 | Ga0496122_0366886_38_271 | 77 |
| 915 | 3300048926 | Ga0496123_0000545 | Ga0496123_0000545_2841_3074 | 77 |
| 916 | 3300048926 | Ga0496123_0002968 | Ga0496123_0002968_10291_10524 | 77 |
| 917 | 3300048926 | Ga0496123_0062259 | Ga0496123_0062259_443_676 | 77 |
| 918 | 3300048926 | Ga0496123_0235440 | Ga0496123_0235440_285_518 | 77 |
| 919 | 3300048927 | Ga0496124_0000546 | Ga0496124_0000546_15189_15422 | 77 |
| 920 | 3300048927 | Ga0496124_0000874 | Ga0496124_0000874_14361_14600 | 77 |
| 921 | 3300048927 | Ga0496124_0002439 | Ga0496124_0002439_5822_6055 | 77 |
| 922 | 3300048927 | Ga0496124_0006061 | Ga0496124_0006061_12745_12978 | 77 |
| 923 | 3300048927 | Ga0496124_0081473 | Ga0496124_0081473_1236_1469 | 77 |
| 924 | 3300048927 | Ga0496124_0299780 | Ga0496124_0299780_101_343 | 77 |
| 925 | 3300048927 | Ga0496124_0474242 | Ga0496124_0474242_308_541 | 77 |
| 926 | 3300048927 | Ga0496124_0507938 | Ga0496124_0507938_150_383 | 77 |
| 927 | 3300048927 | Ga0496124_0805486 | Ga0496124_0805486_145_378 | 77 |
| 928 | 3300048928 | Ga0496125_0002465 | Ga0496125_0002465_2927_3160 | 77 |
| 929 | 3300048928 | Ga0496125_0006988 | Ga0496125_0006988_2828_3061 | 77 |
| 930 | 3300048928 | Ga0496125_0033431 | Ga0496125_0033431_1475_1708 | 77 |
| 931 | 3300048928 | Ga0496125_0071024 | Ga0496125_0071024_353_586 | 77 |
| 932 | 3300048928 | Ga0496125_0355978 | Ga0496125_0355978_269_511 | 77 |
| 933 | 3300048928 | Ga0496125_0415581 | Ga0496125_0415581_468_701 | 77 |
| 934 | 3300048928 | Ga0496125_0439744 | Ga0496125_0439744_330_563 | 77 |
| 935 | 3300048929 | Ga0496126_0000028 | Ga0496126_0000028_87300_87533 | 77 |
| 936 | 3300048929 | Ga0496126_0006838 | Ga0496126_0006838_5050_5283 | 77 |
| 937 | 3300048929 | Ga0496126_0034229 | Ga0496126_0034229_878_1111 | 77 |
| 938 | 3300048929 | Ga0496126_0054886 | Ga0496126_0054886_3096_3335 | 77 |
| 939 | 3300048929 | Ga0496126_0150910 | Ga0496126_0150910_1048_1281 | 77 |
| 940 | 3300048929 | Ga0496126_0372477 | Ga0496126_0372477_663_902 | 77 |
| 941 | 3300049459 | Ga0495678_014836 | Ga0495678_014836_3367_3600 | 77 |
| 942 | 3300049513 | Ga0501290_000237 | Ga0501290_000237_5043_5276 | 77 |
| 943 | 3300049515 | Ga0501292_000042 | Ga0501292_000042_27925_28158 | 77 |
| 944 | 3300049517 | Ga0501294_000032 | Ga0501294_000032_2651_2884 | 77 |
| 945 | 3300049520 | Ga0501297_009582 | Ga0501297_009582_383_616 | 77 |
| 946 | 3300049523 | Ga0501300_000392 | Ga0501300_000392_5669_5902 | 77 |
| 947 | 3300049525 | Ga0501302_002270 | Ga0501302_002270_708_941 | 77 |
| 948 | 3300049531 | Ga0501315_000962 | Ga0501315_000962_1098_1331 | 77 |
| 949 | 3300049533 | Ga0501317_002915 | Ga0501317_002915_1117_1350 | 77 |
| 950 | 3300049534 | Ga0501318_049501 | Ga0501318_049501_100_333 | 77 |
| 951 | 3300049537 | Ga0501321_023679 | Ga0501321_023679_401_634 | 77 |
| 952 | 3300049551 | Ga0501335_000615 | Ga0501335_000615_1430_1663 | 77 |
| 953 | 3300049553 | Ga0501337_013057 | Ga0501337_013057_215_448 | 77 |
| 954 | 3300049570 | Ga0501033_0085723 | Ga0501033_0085723_763_996 | 77 |
| 955 | 3300049571 | Ga0501034_0099962 | Ga0501034_0099962_1411_1644 | 77 |
| 956 | 3300049571 | Ga0501034_0285394 | Ga0501034_0285394_355_588 | 77 |
| 957 | 3300049574 | Ga0501038_0164937 | Ga0501038_0164937_817_1050 | 77 |
| 958 | 3300049574 | Ga0501038_0323317 | Ga0501038_0323317_379_612 | 77 |
| 959 | 3300049574 | Ga0501038_0770013 | Ga0501038_0770013_204_437 | 77 |
| 960 | 3300049577 | Ga0501041_0866607 | Ga0501041_0866607_76_309 | 77 |
| 961 | 3300049578 | Ga0501042_0040621 | Ga0501042_0040621_2449_2682 | 77 |
| 962 | 3300049578 | Ga0501042_0260954 | Ga0501042_0260954_382_615 | 77 |
| 963 | 3300049579 | Ga0501043_0113159 | Ga0501043_0113159_1694_1927 | 77 |
| 964 | 3300049580 | Ga0501046_0030454 | Ga0501046_0030454_2064_2297 | 77 |
| 965 | 3300049581 | Ga0501047_0000731 | Ga0501047_0000731_8701_8934 | 77 |
| 966 | 3300049581 | Ga0501047_0450251 | Ga0501047_0450251_246_479 | 77 |
| 967 | 3300049581 | Ga0501047_0935022 | Ga0501047_0935022_19_252 | 77 |
| 968 | 3300049586 | Ga0501070_0968333 | Ga0501070_0968333_349_582 | 77 |
| 969 | 3300049587 | Ga0501071_0191090 | Ga0501071_0191090_1028_1261 | 77 |
| 970 | 3300049587 | Ga0501071_1187966 | Ga0501071_1187966_263_496 | 77 |
| 971 | 3300049589 | Ga0501073_0139551 | Ga0501073_0139551_684_917 | 77 |
| 972 | 3300049590 | Ga0501074_0761420 | Ga0501074_0761420_89_322 | 77 |
| 973 | 3300049591 | Ga0501075_0834129 | Ga0501075_0834129_239_472 | 77 |
| 974 | 3300049592 | Ga0501076_0426670 | Ga0501076_0426670_813_1046 | 77 |
| 975 | 3300049592 | Ga0501076_1405930 | Ga0501076_1405930_232_465 | 77 |
| 976 | 3300049593 | Ga0501077_0216387 | Ga0501077_0216387_342_575 | 77 |
| 977 | 3300049653 | Ga0501206_003378 | Ga0501206_003378_29_262 | 77 |
| 978 | 3300049658 | Ga0501211_000103 | Ga0501211_000103_6026_6259 | 77 |
| 979 | 3300049662 | Ga0501222_001746 | Ga0501222_001746_1037_1270 | 77 |
| 980 | 3300049663 | Ga0501223_004016 | Ga0501223_004016_2229_2462 | 77 |
| 981 | 3300049663 | Ga0501223_036809 | Ga0501223_036809_512_745 | 77 |
| 982 | 3300049664 | Ga0501224_000754 | Ga0501224_000754_3086_3319 | 77 |
| 983 | 3300049665 | Ga0501227_028030 | Ga0501227_028030_644_877 | 77 |
| 984 | 3300049668 | Ga0501233_012436 | Ga0501233_012436_1265_1498 | 77 |
| 985 | 3300049669 | Ga0501235_001097 | Ga0501235_001097_922_1155 | 77 |
| 986 | 3300049670 | Ga0501236_053975 | Ga0501236_053975_414_647 | 77 |
| 987 | 3300049688 | Ga0501259_001391 | Ga0501259_001391_772_1005 | 77 |
| 988 | 3300049690 | Ga0501261_000021 | Ga0501261_000021_24210_24443 | 77 |
| 989 | 3300049704 | Ga0501221_003846 | Ga0501221_003846_727_960 | 77 |
| 990 | 3300049705 | Ga0501225_0006973 | Ga0501225_0006973_3034_3267 | 77 |
| 991 | 3300049705 | Ga0501225_0043405 | Ga0501225_0043405_797_1030 | 77 |
| 992 | 3300049741 | Ga0501079_0374717 | Ga0501079_0374717_671_904 | 77 |
| 993 | 3300049742 | Ga0501080_0702389 | Ga0501080_0702389_207_440 | 77 |
| 994 | 3300049744 | Ga0501083_0292932 | Ga0501083_0292932_178_411 | 77 |
| 995 | 3300049761 | Ga0501264_008163 | Ga0501264_008163_356_589 | 77 |
| 996 | 3300049773 | Ga0501276_013553 | Ga0501276_013553_428_661 | 77 |
| 997 | 3300049775 | Ga0501279_000010 | Ga0501279_000010_10053_10286 | 77 |
| 998 | 3300049776 | Ga0501280_000064 | Ga0501280_000064_12687_12920 | 77 |
| 999 | 3300049776 | Ga0501280_001057 | Ga0501280_001057_381_614 | 77 |
| 1000 | 3300049777 | Ga0501281_00086 | Ga0501281_00086_1313_1546 | 77 |
| 1001 | 3300049778 | Ga0501282_000404 | Ga0501282_000404_1020_1253 | 77 |
| 1002 | 3300049779 | Ga0501283_001453 | Ga0501283_001453_834_1067 | 77 |
| 1003 | 3300049822 | Ga0501035_0179700 | Ga0501035_0179700_1038_1271 | 77 |
| 1004 | 3300049822 | Ga0501035_0244287 | Ga0501035_0244287_581_814 | 77 |
| 1005 | 3300049822 | Ga0501035_1048316 | Ga0501035_1048316_150_383 | 77 |
| 1006 | 3300049823 | Ga0501044_0134255 | Ga0501044_0134255_79_312 | 77 |
| 1007 | 3300049823 | Ga0501044_0204047 | Ga0501044_0204047_750_983 | 77 |
| 1008 | 3300049823 | Ga0501044_0896240 | Ga0501044_0896240_472_705 | 77 |
| 1009 | 3300049853 | Ga0501226_021697 | Ga0501226_021697_270_503 | 77 |
| 1010 | 3300050005 | Ga0501284_02268 | Ga0501284_02268_457_690 | 77 |
| 1011 | 3300050490 | nmdc:mga03n38_266481_c1 | nmdc:mga03n38_266481_c1_145_378 | 77 |
| 1012 | 3300050491 | nmdc:mga00v17_75476_c1 | nmdc:mga00v17_75476_c1_298_531 | 77 |
| 1013 | 3300050491 | nmdc:mga00v17_911672_c1 | nmdc:mga00v17_911672_c1_157_390 | 77 |
| 1014 | 3300050493 | nmdc:mga0k408_344198_c1 | nmdc:mga0k408_344198_c1_382_615 | 77 |
| 1015 | 3300050493 | nmdc:mga0k408_529690_c1 | nmdc:mga0k408_529690_c1_176_409 | 77 |
| 1016 | 3300050493 | nmdc:mga0k408_583414_c1 | nmdc:mga0k408_583414_c1_37_270 | 77 |
| 1017 | 3300050493 | nmdc:mga0k408_832522_c1 | nmdc:mga0k408_832522_c1_129_368 | 77 |
| 1018 | 3300050494 | nmdc:mga06z11_17_c1 | nmdc:mga06z11_17_c1_11741_11974 | 77 |
| 1019 | 3300050495 | nmdc:mga04h51_146_c1 | nmdc:mga04h51_146_c1_11741_11974 | 77 |
| 1020 | 3300050495 | nmdc:mga04h51_411911_c1 | nmdc:mga04h51_411911_c1_177_410 | 77 |
| 1021 | 3300050496 | nmdc:mga07m45_111328_c1 | nmdc:mga07m45_111328_c1_61_294 | 77 |
| 1022 | 3300050496 | nmdc:mga07m45_567769_c1 | nmdc:mga07m45_567769_c1_185_424 | 77 |
| 1023 | 3300050496 | nmdc:mga07m45_60295_c1 | nmdc:mga07m45_60295_c1_1454_1687 | 77 |
| 1024 | 3300050507 | nmdc:mga05p37_171786_c1 | nmdc:mga05p37_171786_c1_897_1130 | 77 |
| 1025 | 3300050507 | nmdc:mga05p37_2021674_c1 | nmdc:mga05p37_2021674_c1_234_476 | 77 |
| 1026 | 3300053087 | Ga0500643_010906 | Ga0500643_010906_2736_2975 | 77 |
| 1027 | 3300053091 | Ga0500647_0376821 | Ga0500647_0376821_13_255 | 77 |
| 1028 | 3300053093 | Ga0500651_0086862 | Ga0500651_0086862_1022_1264 | 77 |
| 1029 | 3300053094 | Ga0500566_0004538 | Ga0500566_0004538_7526_7765 | 77 |
| 1030 | 3300053096 | Ga0500641_0004173 | Ga0500641_0004173_3009_3248 | 77 |
| 1031 | 3300053096 | Ga0500641_0136367 | Ga0500641_0136367_355_588 | 77 |
| 1032 | 3300053108 | Ga0500562_070755 | Ga0500562_070755_469_702 | 77 |
| 1033 | 3300053116 | Ga0500592_001156 | Ga0500592_001156_2284_2517 | 77 |
| 1034 | 3300053118 | Ga0500594_0054708 | Ga0500594_0054708_137_376 | 77 |
| 1035 | 3300053119 | Ga0500595_000572 | Ga0500595_000572_13449_13688 | 77 |
| 1036 | 3300053119 | Ga0500595_055810 | Ga0500595_055810_812_1045 | 77 |
| 1037 | 3300053122 | Ga0500608_066104 | Ga0500608_066104_1252_1491 | 77 |
| 1038 | 3300053125 | Ga0500618_014810 | Ga0500618_014810_1062_1304 | 77 |
| 1039 | 3300053128 | Ga0500626_092170 | Ga0500626_092170_446_685 | 77 |
| 1040 | 3300053130 | Ga0500642_0014296 | Ga0500642_0014296_2208_2450 | 77 |
| 1041 | 3300053131 | Ga0500652_278543 | Ga0500652_278543_375_617 | 77 |
| 1042 | 3300053133 | Ga0500655_000251 | Ga0500655_000251_8732_8974 | 77 |
| 1043 | 3300053134 | Ga0500658_0010885 | Ga0500658_0010885_2110_2349 | 77 |
| 1044 | 3300053134 | Ga0500658_0014446 | Ga0500658_0014446_36_275 | 77 |
| 1045 | 3300053134 | Ga0500658_0267841 | Ga0500658_0267841_243_485 | 77 |
| 1046 | 3300053134 | Ga0500658_0476850 | Ga0500658_0476850_313_546 | 77 |
| 1047 | 3300053136 | Ga0500559_0232776 | Ga0500559_0232776_241_474 | 77 |
| 1048 | 3300053138 | Ga0500564_386623 | Ga0500564_386623_46_279 | 77 |
| 1049 | 3300053139 | Ga0500568_0018906 | Ga0500568_0018906_144_383 | 77 |
| 1050 | 3300053139 | Ga0500568_0092427 | Ga0500568_0092427_212_445 | 77 |
| 1051 | 3300053139 | Ga0500568_0195118 | Ga0500568_0195118_313_546 | 77 |
| 1052 | 3300053146 | Ga0500588_0071841 | Ga0500588_0071841_408_647 | 77 |
| 1053 | 3300053148 | Ga0500590_000131 | Ga0500590_000131_7990_8232 | 77 |
| 1054 | 3300053151 | Ga0500604_0036484 | Ga0500604_0036484_814_1047 | 77 |
| 1055 | 3300053151 | Ga0500604_0071415 | Ga0500604_0071415_423_665 | 77 |
| 1056 | 3300053153 | Ga0500616_0222499 | Ga0500616_0222499_78_311 | 77 |
| 1057 | 3300053153 | Ga0500616_0284202 | Ga0500616_0284202_212_445 | 77 |
| 1058 | 3300053153 | Ga0500616_0291538 | Ga0500616_0291538_195_428 | 77 |
| 1059 | 3300053156 | Ga0500622_0025695 | Ga0500622_0025695_380_622 | 77 |
| 1060 | 3300053156 | Ga0500622_0091256 | Ga0500622_0091256_755_994 | 77 |
| 1061 | 3300053157 | Ga0500624_000063 | Ga0500624_000063_26863_27096 | 77 |
| 1062 | 3300053158 | Ga0500627_0027041 | Ga0500627_0027041_1007_1240 | 77 |
| 1063 | 3300053158 | Ga0500627_0378067 | Ga0500627_0378067_285_518 | 77 |
| 1064 | 3300053163 | Ga0500639_139272 | Ga0500639_139272_357_599 | 77 |
| 1065 | 3300053177 | Ga0500636_0058873 | Ga0500636_0058873_1413_1646 | 77 |
| 1066 | 3300053724 | Ga0500570_004079 | Ga0500570_004079_2493_2735 | 77 |
| 1067 | 3300053730 | Ga0500645_180888 | Ga0500645_180888_199_441 | 77 |
| 1068 | 3300053730 | Ga0500645_223100 | Ga0500645_223100_223_462 | 77 |
| 1069 | 3300053737 | Ga0500601_034828 | Ga0500601_034828_117_350 | 77 |
| 1070 | 3300054114 | Ga0501084_0791318 | Ga0501084_0791318_202_435 | 77 |
| 1071 | 3300059490 | Ga0587066_169647 | Ga0587066_169647_96_329 | 77 |
| 1072 | 3300059493 | Ga0587077_168426 | Ga0587077_168426_213_446 | 77 |
| 1073 | 3300059508 | Ga0587088_134191 | Ga0587088_134191_134_367 | 77 |
| 1074 | 3300059513 | Ga0587094_030537 | Ga0587094_030537_189_422 | 77 |
| 1075 | 3300059640 | Ga0587067_076756 | Ga0587067_076756_225_458 | 77 |
| 1076 | 3300059642 | Ga0587069_140777 | Ga0587069_140777_113_346 | 77 |
| 1077 | 3300060353 | Ga0501082_0979656 | Ga0501082_0979656_245_478 | 77 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5nfl-assembly1.cif.gz_A | crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. | 0.8816 | 4 | 77 |
| 5nfl-assembly1.cif.gz_A | crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. | 0.8709 | 4 | 77 |
| 2mma-assembly1.cif.gz_B | nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana | 0.831 | 3 | 76 |
| 1v60-assembly1.cif.gz_A | solution structure of bola1 protein from mus musculus | 0.8119 | 6 | 76 |
| 3o2e-assembly1.cif.gz_A | crystal structure of a bol-like protein from babesia bovis | 0.8104 | 3 | 76 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5nflA00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.8816 | 4 | 77 | 3.30.300.90 |
| 5nflA00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.8709 | 4 | 77 | 3.30.300.90 |
| af_Q53S33_27_107_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.8547 | 8 | 77 | 3.30.300.90 |
| af_P53082_9_118_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.8508 | 1 | 75 | 3.10.20.90 |
| af_Q54GP0_1_85_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.8479 | 3 | 75 | 3.30.300.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258E1I0-F1-model_v4 | BolA family transcriptional regulator | 0.9824 | 1 | 77 |
|
| AF-A0A357LA00-F1-model_v4 | BolA family transcriptional regulator | 0.976 | 1 | 77 |
|
| AF-A0A5C8PQA4-F1-model_v4 | BolA family transcriptional regulator | 0.9741 | 1 | 77 |
|
| AF-A0A1G3ISV3-F1-model_v4 | ATP-binding protein | 0.9714 | 1 | 57 |
GO:0005524
|
| AF-A0A0S6X249-F1-model_v4 | BolA-like protein | 0.9686 | 1 | 76 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar