F489594

General Info

Members Datasets Scaffolds Average Seq Length
1076 583 693 356

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2841941048|2841941849
Length 397
Sequence YVDPSIHFQLSLACSKEPVLAATYCLRARGQIVCISRGHRYMNRRIALITGVTGQDGAYLAEHLLSLGYVVHGIKRRSSSFNTARVDHLYQDPHAGNVPFLMHYGDMTDSTNLIRLVQQIQPTEIYNLAAQSHVAVSFETPEYTANADAVGVLRLLEAIRILGMEKETRFYQASTSELYGLVQEIPQKETTPFYPRSPYGVAKLYGYWITVNYREAYGMFASNGILFNHESPIRGETFVTRKITRGVARIEVGLEDILYLGNLEAKRDWGHARDYVEGMHMILQADKPDDFVLATGEMRSVREMVELAFAHVGRRIEWRGKGVDEIGVDAKSGKSMVKIDRTYFRPTEVDLLVGDASKARQVLGWKPKRTFAQLVEEMVASDLAEAKRDAGSGKHTV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
8 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
9 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
10 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
11 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
12 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
13 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
14 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
15 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
16 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
17 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
18 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
19 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
22 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
23 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
24 2643221580 Devosia sp. Root635 Isolate Unclassified
25 2643221674 Devosia sp. Root436 Isolate Unclassified
26 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
27 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
28 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
29 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
30 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
31 2791355199
32 2791355265 Rhizobium sp. H4 Isolate Nodule
33 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
34 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
35 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
36 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
37 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
38 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
39 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
40 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
41 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
42 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
43 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
44 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
45 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
46 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
47 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
48 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
49 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
50 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
51 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
52 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
53 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
54 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
55 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
56 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
57 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
58 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
59 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
60 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
61 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
62 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
63 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
64 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
65 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
66 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
67 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
68 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
69 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
70 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
71 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
72 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
73 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
74 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
75 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
76 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
77 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
78 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
79 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
80 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
81 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
82 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
83 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
84 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
85 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
86 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
87 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
88 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
89 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
90 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
91 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
92 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
93 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
94 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
95 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
96 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
97 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
98 2904699407
99 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
100 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
101 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
102 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
103 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
104 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
105 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
106 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
107 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
108 2922368715
109 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
110 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
111 2922425934
112 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
113 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
114 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
115 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
116 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
117 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
118 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
119 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
120 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
121 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
122 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
123 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
124 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
125 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
126 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
127 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
128 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
129 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
130 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
131 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
132 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
133 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
134 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
135 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
136 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
137 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
138 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
139 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
140 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
141 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
142 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
143 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
144 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
145 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
146 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
147 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
148 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
149 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
150 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
151 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
152 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
153 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
154 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
155 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
156 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
157 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
158 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
159 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
160 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
161 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
162 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
163 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
164 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
165 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
166 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
167 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
168 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
169 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
170 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
171 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
172 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
173 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
174 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
175 2996887358 Rhizobium sp. R711 Isolate Nodule
176 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
177 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
178 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
179 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
180 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
181 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
182 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
183 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
184 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
185 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
186 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
187 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
188 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
189 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
190 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
191 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
192 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
193 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
194 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
195 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
196 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
197 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
198 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
199 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
200 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
201 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
202 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
203 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
204 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
205 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
206 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
207 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
208 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
209 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
210 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
211 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
212 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
213 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
214 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
215 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
216 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
217 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
218 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
219 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
220 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
221 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
222 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
223 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
224 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
225 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
226 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
227 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
228 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
229 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
230 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
231 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
232 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
233 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
234 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
235 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
236 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
237 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
238 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
239 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
240 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
241 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
242 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
243 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
244 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
245 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
246 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
247 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
248 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
249 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
250 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
251 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
252 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
253 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
254 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
255 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
256 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
257 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
258 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
259 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
260 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
261 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
262 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
263 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
264 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
265 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
266 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
267 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
268 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
269 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
270 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
271 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
272 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
273 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
274 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
275 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
276 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
277 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
278 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
279 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
280 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
281 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
282 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
283 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
284 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
285 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
286 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
287 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
288 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
289 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
290 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
291 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
292 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
293 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
294 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
296 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
297 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
299 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
300 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
301 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
302 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
303 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
360 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
361 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
362 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
363 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
364 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
365 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
369 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
370 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
371 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
372 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
373 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
374 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
375 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
376 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
377 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
378 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
379 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
380 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
381 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
382 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
383 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
384 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
385 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
386 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
387 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
388 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
389 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
390 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
391 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
392 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
393 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
394 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
395 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
396 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
397 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
398 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
399 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
400 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
401 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
402 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
403 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
404 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
405 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
406 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
407 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
408 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
409 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
410 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
411 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
412 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
413 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
414 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
415 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
416 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
417 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
418 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
419 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
420 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
421 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
422 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
423 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
424 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
425 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
426 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
427 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
428 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
429 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
430 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
431 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
432 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
433 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
434 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
435 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
436 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
437 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
438 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
439 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
440 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
441 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
442 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
443 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
444 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
445 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
446 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
447 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
448 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
449 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
450 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
451 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
452 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
453 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
454 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
455 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
456 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
457 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
458 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
459 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
460 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
461 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
462 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
463 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
464 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
465 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
466 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
467 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
468 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
469 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
470 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
471 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
472 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
473 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
474 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
475 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
476 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
477 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
478 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
479 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
480 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
481 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
482 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
483 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
484 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
485 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
486 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
487 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
488 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
489 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
490 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
491 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
492 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
495 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
496 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
497 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
498 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
499 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
500 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
501 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
502 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
503 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
504 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
505 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
506 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
507 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
508 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
509 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
510 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
511 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
512 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
513 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
514 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
515 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
516 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
517 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
518 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
519 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
520 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
521 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
522 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
523 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
524 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
525 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
526 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
527 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
528 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
529 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
530 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
531 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
532 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
533 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
534 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
535 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
536 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
537 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
538 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
539 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
540 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
541 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
542 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
543 8005258706 Rhizobium sp. R693 Isolate Nodule
544 8005321885 Rhizobium sp. R72 Isolate Nodule
545 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
546 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
547 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
548 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
549 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
550 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
551 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
552 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
553 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
554 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
555 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
556 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
557 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
558 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
559 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
560 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
561 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
562 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
563 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
564 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
565 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
566 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
567 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
568 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
569 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
570 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
571 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
572 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
573 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
574 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
575 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
576 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
577 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
578 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
579 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
580 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
581 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
582 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
583 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 64.71
Metatranscriptomes 0
Isolates 35.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.34
Nodule 28.9
Rhizoplane 2.7
Rhizosphere 44.61
Stem 0
Stem Tuber 0
Unclassified 12.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3482130 2162886007 Bacteria 1532
2 JGI24736J21556_1011716 3300001904 Bacteria 1424
3 JGI24737J22298_10005764 3300001990 Bacteria 4265
4 JGI24735J21928_10010572 3300002067 Bacteria 2941
5 JGI25152J39213_1001710 3300002773 Bacteria 9001
6 JGI25406J46586_10000014 3300003203 Bacteria 93855
7 JGI25165J46597_1000013 3300003214 Bacteria 402100
8 JGI25153J46596_10000127 3300003215 Bacteria 83368
9 JGI25153J46596_10000168 3300003215 Bacteria 65461
10 JGI25153J46596_10000247 3300003215 Bacteria 44807
11 JGI25153J46596_10009473 3300003215 Bacteria 4519
12 JGI25153J46596_10011513 3300003215 Bacteria 3901
13 rootH1_10176606 3300003323 Bacteria 5122
14 JGI25160J50197_1000411 3300003354 Bacteria 27360
15 JGI25160J50197_1001248 3300003354 Bacteria 12893
16 Ga0055526_1002123 3300003771 Bacteria 13606
17 Ga0055524_1005522 3300003775 Bacteria 5620
18 Ga0055524_1008938 3300003775 Bacteria 4120
19 Ga0055528_1003908 3300003790 Bacteria 7318
20 Ga0055540_1016113 3300003792 Bacteria 2141
21 Ga0055540_1018664 3300003792 Bacteria 1895
22 Ga0055531_10005857 3300003794 Bacteria 7099
23 Ga0055543_1001498 3300004625 Bacteria 9186
24 Ga0055543_1003748 3300004625 Bacteria 4346
25 Ga0065165_1000134 3300005262 Bacteria 127890
26 Ga0065165_1000664 3300005262 Bacteria 49644
27 Ga0065165_1000976 3300005262 Bacteria 35638
28 Ga0065165_1003936 3300005262 Bacteria 9777
29 Ga0065165_1005285 3300005262 Bacteria 7359
30 Ga0065165_1040874 3300005262 Bacteria 1379
31 Ga0065704_10072745 3300005289 Bacteria 8072
32 Ga0070658_10013687 3300005327 Bacteria 6509
33 Ga0070658_10080716 3300005327 Bacteria 2671
34 Ga0070683_100047943 3300005329 Bacteria 3949
35 Ga0070683_100065692 3300005329 Bacteria 3378
36 Ga0070683_100115242 3300005329 Bacteria 2537
37 Ga0070670_100040501 3300005331 Bacteria 4005
38 Ga0068869_100028731 3300005334 Bacteria 3889
39 Ga0068869_100061092 3300005334 Bacteria 2763
40 Ga0070666_10064965 3300005335 Bacteria 2475
41 Ga0070680_100082137 3300005336 Bacteria 2659
42 Ga0070660_100023504 3300005339 Bacteria 4566
43 Ga0070689_100343932 3300005340 Bacteria 1250
44 Ga0070668_100000830 3300005347 Bacteria 21339
45 Ga0070668_100128901 3300005347 Bacteria 2029
46 Ga0070669_100069635 3300005353 Bacteria 2599
47 Ga0070671_100005278 3300005355 Bacteria 10305
48 Ga0070671_100239408 3300005355 Bacteria 1540
49 Ga0070688_100072138 3300005365 Bacteria 2212
50 Ga0070659_100187211 3300005366 Bacteria 1700
51 Ga0070667_100008652 3300005367 Bacteria 8434
52 Ga0070667_100019485 3300005367 Bacteria 5629
53 Ga0070709_10007842 3300005434 Bacteria 5862
54 Ga0070709_10011973 3300005434 Bacteria 4848
55 Ga0070709_10033440 3300005434 Bacteria 3110
56 Ga0070709_10041881 3300005434 Bacteria 2824
57 Ga0070714_100022799 3300005435 Bacteria 5136
58 Ga0070714_100136283 3300005435 Bacteria 2199
59 Ga0070713_100003900 3300005436 Bacteria 9890
60 Ga0070713_100016156 3300005436 Bacteria 5608
61 Ga0070713_100128758 3300005436 Bacteria 2230
62 Ga0070710_10006621 3300005437 Bacteria 5571
63 Ga0070710_10041028 3300005437 Bacteria 2553
64 Ga0070711_100016347 3300005439 Bacteria 4711
65 Ga0070711_100031629 3300005439 Bacteria 3514
66 Ga0070708_100027800 3300005445 Bacteria 4858
67 Ga0070663_100001338 3300005455 Bacteria 13482
68 Ga0070663_100035066 3300005455 Bacteria 3478
69 Ga0070678_100015416 3300005456 Bacteria 4859
70 Ga0070681_10097487 3300005458 Bacteria 2887
71 Ga0068867_100176825 3300005459 Bacteria 1694
72 Ga0070706_100003127 3300005467 Bacteria 16375
73 Ga0070707_100001574 3300005468 Bacteria 22107
74 Ga0070698_100026493 3300005471 Bacteria 6035
75 Ga0070699_100002004 3300005518 Bacteria 18382
76 Ga0070679_100014351 3300005530 Bacteria 7609
77 Ga0070679_100019705 3300005530 Bacteria 6564
78 Ga0070684_100018169 3300005535 Bacteria 5787
79 Ga0070684_100051351 3300005535 Bacteria 3582
80 Ga0070684_100064413 3300005535 Bacteria 3215
81 Ga0070697_100045516 3300005536 Bacteria 3556
82 Ga0068853_100089356 3300005539 Bacteria 2706
83 Ga0068853_100094702 3300005539 Bacteria 2632
84 Ga0068853_100171598 3300005539 Bacteria 1962
85 Ga0070672_100268238 3300005543 Bacteria 1441
86 Ga0070665_100003271 3300005548 Bacteria 17380
87 Ga0070665_100004109 3300005548 Bacteria 15308
88 Ga0070665_100005930 3300005548 Bacteria 12512
89 Ga0070665_100014283 3300005548 Bacteria 7974
90 Ga0070665_100048130 3300005548 Bacteria 4281
91 Ga0070665_100051472 3300005548 Bacteria 4130
92 Ga0070665_100106254 3300005548 Bacteria 2809
93 Ga0070665_100147621 3300005548 Bacteria 2354
94 Ga0068855_100079863 3300005563 Bacteria 3793
95 Ga0068855_100085960 3300005563 Bacteria 3638
96 Ga0068855_100191931 3300005563 Bacteria 2303
97 Ga0070664_100167199 3300005564 Bacteria 1949
98 Ga0068857_100003812 3300005577 Bacteria 12691
99 Ga0068857_100010456 3300005577 Bacteria 8065
100 Ga0068857_100252907 3300005577 Bacteria 1616
101 Ga0068854_100027274 3300005578 Bacteria 3935
102 Ga0068856_100039969 3300005614 Bacteria 4606
103 Ga0068856_100043689 3300005614 Bacteria 4409
104 Ga0068856_100115733 3300005614 Bacteria 2681
105 Ga0068856_100137315 3300005614 Bacteria 2451
106 Ga0068856_100183040 3300005614 Bacteria 2109
107 Ga0068856_100393435 3300005614 Bacteria 1406
108 Ga0068852_100004160 3300005616 Bacteria 10196
109 Ga0068852_100007043 3300005616 Bacteria 8188
110 Ga0068852_100289984 3300005616 Bacteria 1580
111 Ga0068864_100094104 3300005618 Bacteria 2647
112 Ga0068864_100247880 3300005618 Bacteria 1652
113 Ga0068851_10001214 3300005834 Bacteria 11191
114 Ga0068851_10014266 3300005834 Bacteria 3771
115 Ga0068870_10067631 3300005840 Bacteria 1938
116 Ga0068870_10088629 3300005840 Bacteria 1725
117 Ga0068863_100005808 3300005841 Bacteria 12096
118 Ga0068863_100014635 3300005841 Bacteria 7552
119 Ga0068863_100054034 3300005841 Bacteria 3806
120 Ga0068858_100001857 3300005842 Bacteria 21542
121 Ga0068858_100141044 3300005842 Bacteria 2262
122 Ga0068858_100222422 3300005842 Bacteria 1788
123 Ga0068858_100341322 3300005842 Bacteria 1433
124 Ga0068860_100000409 3300005843 Bacteria 55861
125 Ga0068860_100057032 3300005843 Bacteria 3712
126 Ga0068862_100120445 3300005844 Bacteria 2312
127 Ga0068862_100372379 3300005844 Bacteria 1330
128 Ga0081455_10004847 3300005937 Bacteria 14929
129 Ga0081455_10011948 3300005937 Bacteria 8690
130 Ga0081455_10066157 3300005937 Bacteria 3020
131 Ga0081540_1000353 3300005983 Bacteria 46545
132 Ga0081540_1001385 3300005983 Bacteria 21018
133 Ga0081540_1009106 3300005983 Bacteria 6858
134 Ga0081540_1017917 3300005983 Bacteria 4364
135 Ga0081540_1023238 3300005983 Bacteria 3633
136 Ga0081539_10000008 3300005985 Bacteria 525071
137 Ga0081539_10001561 3300005985 Bacteria 38000
138 Ga0081539_10017941 3300005985 Bacteria 4938
139 Ga0081539_10026626 3300005985 Bacteria 3684
140 Ga0070717_10006203 3300006028 Bacteria 8779
141 Ga0070717_10040726 3300006028 Bacteria 3785
142 Ga0070717_10172669 3300006028 Bacteria 1881
143 Ga0075365_10170202 3300006038 Bacteria 1520
144 Ga0075365_10196091 3300006038 Bacteria 1414
145 Ga0075368_10024318 3300006042 Bacteria 2320
146 Ga0075368_10071452 3300006042 Bacteria 1402
147 Ga0070716_100004406 3300006173 Bacteria 6732
148 Ga0070716_100083383 3300006173 Bacteria 1914
149 Ga0070712_100012336 3300006175 Bacteria 5431
150 Ga0075362_10116894 3300006177 Bacteria 1259
151 Ga0075367_10016272 3300006178 Bacteria 4060
152 Ga0075367_10018774 3300006178 Bacteria 3821
153 Ga0075367_10104626 3300006178 Bacteria 1733
154 Ga0075369_10021966 3300006186 Bacteria 2629
155 Ga0075366_10005853 3300006195 Bacteria 6681
156 Ga0075366_10114547 3300006195 Bacteria 1623
157 Ga0097621_100025068 3300006237 Bacteria 4664
158 Ga0097621_100238325 3300006237 Bacteria 1590
159 Ga0075370_10007506 3300006353 Bacteria 5557
160 Ga0075370_10058041 3300006353 Bacteria 2201
161 Ga0068871_100165789 3300006358 Bacteria 1891
162 Ga0075428_100336341 3300006844 Bacteria 1622
163 Ga0075430_100140342 3300006846 Bacteria 2012
164 Ga0068865_100141238 3300006881 Bacteria 1816
165 Ga0099825_1028685 3300006941 Bacteria 2676
166 Ga0075435_100071665 3300007076 Bacteria 2830
167 Ga0105240_10004736 3300009093 Bacteria 20539
168 Ga0105240_10022611 3300009093 Bacteria 8328
169 Ga0105240_10024496 3300009093 Bacteria 7952
170 Ga0105240_10028339 3300009093 Bacteria 7316
171 Ga0105240_10081017 3300009093 Bacteria 3990
172 Ga0105240_10090942 3300009093 Bacteria 3730
173 Ga0111539_10007940 3300009094 Bacteria 13532
174 Ga0111539_10043845 3300009094 Bacteria 5361
175 Ga0105245_10308093 3300009098 Bacteria 1556
176 Ga0105247_10031386 3300009101 Bacteria 3224
177 Ga0105247_10043573 3300009101 Bacteria 2750
178 Ga0105243_10039043 3300009148 Bacteria 3699
179 Ga0105243_10277624 3300009148 Bacteria 1508
180 Ga0105241_10004255 3300009174 Bacteria 10581
181 Ga0105241_10059936 3300009174 Bacteria 2927
182 Ga0105241_10108987 3300009174 Bacteria 2214
183 Ga0105248_10005020 3300009177 Bacteria 14613
184 Ga0105248_10006945 3300009177 Bacteria 12406
185 Ga0105237_10000110 3300009545 Bacteria 114577
186 Ga0105237_10004743 3300009545 Bacteria 15634
187 Ga0105237_10031433 3300009545 Bacteria 5384
188 Ga0105237_10326038 3300009545 Bacteria 1539
189 Ga0105238_10002076 3300009551 Bacteria 20251
190 Ga0105238_10009029 3300009551 Bacteria 9974
191 Ga0105238_10010980 3300009551 Bacteria 9108
192 Ga0105238_10011639 3300009551 Bacteria 8863
193 Ga0105238_10193262 3300009551 Bacteria 2011
194 Ga0105238_10227732 3300009551 Bacteria 1841
195 Ga0105249_10000013 3300009553 Bacteria 283609
196 Ga0105249_10383316 3300009553 Bacteria 1432
197 Ga0105249_10387255 3300009553 Bacteria 1425
198 Ga0105239_10000552 3300010375 Bacteria 53680
199 Ga0105239_10013891 3300010375 Bacteria 8938
200 Ga0105239_10016664 3300010375 Bacteria 8122
201 Ga0105239_10027032 3300010375 Bacteria 6316
202 Ga0105239_10036477 3300010375 Bacteria 5398
203 Ga0105239_10043844 3300010375 Bacteria 4905
204 Ga0105239_10064956 3300010375 Bacteria 4007
205 Ga0105239_10122883 3300010375 Bacteria 2885
206 Ga0105246_10025513 3300011119 Bacteria 3853
207 Ga0157370_10007573 3300013104 Bacteria 11796
208 Ga0157370_10018659 3300013104 Bacteria 6974
209 Ga0157370_10024085 3300013104 Bacteria 6034
210 Ga0157369_10066040 3300013105 Bacteria 3892
211 Ga0157369_10108377 3300013105 Bacteria 2954
212 Ga0157374_10112901 3300013296 Bacteria 2615
213 Ga0163162_10163423 3300013306 Bacteria 2349
214 Ga0163162_10346060 3300013306 Bacteria 1619
215 Ga0157372_10010497 3300013307 Bacteria 9861
216 Ga0157375_10187982 3300013308 Bacteria 2220
217 Ga0157375_10261647 3300013308 Bacteria 1892
218 Ga0163163_10016527 3300014325 Bacteria 6862
219 Ga0157380_10013096 3300014326 Bacteria 6035
220 Ga0157379_10004730 3300014968 Bacteria 11681
221 Ga0157379_10035381 3300014968 Bacteria 4453
222 Ga0157379_10052024 3300014968 Bacteria 3657
223 Ga0214544_1000005 3300021320 Bacteria 387675
224 Ga0214542_1000004 3300021321 Bacteria 415597
225 Ga0214545_1000005 3300021324 Bacteria 415590
226 Ga0214543_1000030 3300021327 Bacteria 210137
227 Ga0213872_10002000 3300021361 Bacteria 12410
228 Ga0213872_10012123 3300021361 Bacteria 4063
229 Ga0213872_10062062 3300021361 Bacteria 1689
230 Ga0213876_10003009 3300021384 Bacteria 9761
231 Ga0213876_10009215 3300021384 Bacteria 5316
232 Ga0213876_10077260 3300021384 Bacteria 1759
233 Ga0207425_1001246 3300025245 Bacteria 11161
234 Ga0207425_1003832 3300025245 Bacteria 4678
235 Ga0209148_1000239 3300025254 Bacteria 87710
236 Ga0209129_1000508 3300025258 Bacteria 27984
237 Ga0209233_1000013 3300025261 Bacteria 1013785
238 Ga0209233_1000855 3300025261 Bacteria 13478
239 Ga0209233_1011291 3300025261 Bacteria 2636
240 Ga0209233_1013934 3300025261 Bacteria 2282
241 Ga0209455_1002439 3300025272 Bacteria 7203
242 Ga0209673_1002931 3300025273 Bacteria 10739
243 Ga0209673_1026617 3300025273 Bacteria 1895
244 Ga0209564_1000262 3300025295 Bacteria 112256
245 Ga0209564_1002361 3300025295 Bacteria 15194
246 Ga0209564_1003511 3300025295 Bacteria 10604
247 Ga0209564_1010509 3300025295 Bacteria 4251
248 Ga0209758_1000075 3300025297 Bacteria 271585
249 Ga0209758_1000187 3300025297 Bacteria 138759
250 Ga0209758_1000611 3300025297 Bacteria 55313
251 Ga0209758_1000774 3300025297 Bacteria 45909
252 Ga0209758_1003883 3300025297 Bacteria 13081
253 Ga0209758_1050777 3300025297 Bacteria 1450
254 Ga0209758_1051482 3300025297 Bacteria 1433
255 Ga0209256_1004330 3300025299 Bacteria 9015
256 Ga0209256_1017028 3300025299 Bacteria 2439
257 Ga0207426_1000138 3300025302 Bacteria 196119
258 Ga0207426_1000160 3300025302 Bacteria 174540
259 Ga0207426_1000375 3300025302 Bacteria 78261
260 Ga0207426_1002253 3300025302 Bacteria 12770
261 Ga0207426_1002824 3300025302 Bacteria 10381
262 Ga0207426_1015016 3300025302 Bacteria 2825
263 Ga0207426_1030563 3300025302 Bacteria 1765
264 Ga0207426_1034907 3300025302 Bacteria 1610
265 Ga0209051_1004348 3300025303 Bacteria 8779
266 Ga0209257_1000652 3300025304 Bacteria 55125
267 Ga0207697_10026850 3300025315 Bacteria 2355
268 Ga0207656_10008380 3300025321 Bacteria 3803
269 Ga0207692_10027888 3300025898 Bacteria 2664
270 Ga0207680_10073038 3300025903 Bacteria 2132
271 Ga0207647_10000985 3300025904 Bacteria 22102
272 Ga0207647_10101551 3300025904 Bacteria 1706
273 Ga0207685_10004384 3300025905 Bacteria 3581
274 Ga0207699_10001145 3300025906 Bacteria 12548
275 Ga0207699_10037144 3300025906 Bacteria 2782
276 Ga0207643_10207571 3300025908 Bacteria 1195
277 Ga0207705_10003846 3300025909 Bacteria 11426
278 Ga0207705_10009587 3300025909 Bacteria 7041
279 Ga0207684_10005362 3300025910 Bacteria 11843
280 Ga0207654_10000136 3300025911 Bacteria 47311
281 Ga0207654_10010748 3300025911 Bacteria 4661
282 Ga0207654_10016332 3300025911 Bacteria 3864
283 Ga0207654_10120237 3300025911 Bacteria 1648
284 Ga0207707_10166254 3300025912 Bacteria 1928
285 Ga0207707_10332096 3300025912 Bacteria 1312
286 Ga0207695_10002311 3300025913 Bacteria 28436
287 Ga0207695_10006751 3300025913 Bacteria 14805
288 Ga0207695_10011572 3300025913 Bacteria 10672
289 Ga0207695_10089189 3300025913 Bacteria 3101
290 Ga0207695_10318913 3300025913 Bacteria 1444
291 Ga0207671_10007380 3300025914 Bacteria 9548
292 Ga0207671_10020739 3300025914 Bacteria 4998
293 Ga0207671_10052904 3300025914 Bacteria 3009
294 Ga0207671_10064118 3300025914 Bacteria 2731
295 Ga0207671_10128058 3300025914 Bacteria 1947
296 Ga0207671_10231136 3300025914 Bacteria 1451
297 Ga0207693_10001764 3300025915 Bacteria 18977
298 Ga0207693_10046474 3300025915 Bacteria 3410
299 Ga0207693_10060693 3300025915 Bacteria 2962
300 Ga0207663_10006336 3300025916 Bacteria 6047
301 Ga0207663_10022943 3300025916 Bacteria 3574
302 Ga0207660_10025057 3300025917 Bacteria 4046
303 Ga0207662_10022826 3300025918 Bacteria 3591
304 Ga0207657_10040912 3300025919 Bacteria 4103
305 Ga0207657_10112775 3300025919 Bacteria 2243
306 Ga0207652_10055811 3300025921 Bacteria 3399
307 Ga0207652_10180441 3300025921 Bacteria 1897
308 Ga0207646_10005593 3300025922 Bacteria 13195
309 Ga0207681_10003375 3300025923 Bacteria 9993
310 Ga0207694_10000135 3300025924 Bacteria 75715
311 Ga0207694_10014853 3300025924 Bacteria 5873
312 Ga0207694_10027701 3300025924 Bacteria 4316
313 Ga0207694_10079235 3300025924 Bacteria 2576
314 Ga0207650_10088589 3300025925 Bacteria 2361
315 Ga0207650_10239190 3300025925 Bacteria 1467
316 Ga0207659_10112415 3300025926 Bacteria 2073
317 Ga0207700_10024668 3300025928 Bacteria 4165
318 Ga0207700_10281927 3300025928 Bacteria 1429
319 Ga0207664_10119514 3300025929 Bacteria 2203
320 Ga0207706_10087080 3300025933 Bacteria 2746
321 Ga0207709_10175472 3300025935 Bacteria 1508
322 Ga0207669_10074426 3300025937 Bacteria 2148
323 Ga0207669_10217684 3300025937 Bacteria 1399
324 Ga0207704_10121996 3300025938 Bacteria 1786
325 Ga0207665_10004976 3300025939 Bacteria 8868
326 Ga0207665_10012045 3300025939 Bacteria 5677
327 Ga0207665_10052651 3300025939 Bacteria 2743
328 Ga0207691_10188391 3300025940 Bacteria 1800
329 Ga0207711_10004369 3300025941 Bacteria 12058
330 Ga0207711_10041091 3300025941 Bacteria 3937
331 Ga0207711_10175558 3300025941 Bacteria 1946
332 Ga0207711_10303840 3300025941 Bacteria 1472
333 Ga0207689_10034422 3300025942 Bacteria 4208
334 Ga0207689_10132655 3300025942 Bacteria 2050
335 Ga0207689_10218714 3300025942 Bacteria 1574
336 Ga0207661_10020327 3300025944 Bacteria 4961
337 Ga0207661_10166684 3300025944 Bacteria 1915
338 Ga0207661_10224847 3300025944 Bacteria 1660
339 Ga0207661_10286876 3300025944 Bacteria 1472
340 Ga0207679_10172774 3300025945 Bacteria 1781
341 Ga0207679_10196813 3300025945 Bacteria 1681
342 Ga0207667_10018495 3300025949 Bacteria 7812
343 Ga0207667_10092955 3300025949 Bacteria 3115
344 Ga0207667_10117268 3300025949 Bacteria 2744
345 Ga0207667_10172994 3300025949 Bacteria 2219
346 Ga0207712_10000018 3300025961 Bacteria 317921
347 Ga0207712_10008001 3300025961 Bacteria 6684
348 Ga0207668_10001436 3300025972 Bacteria 14033
349 Ga0207668_10186219 3300025972 Bacteria 1641
350 Ga0207640_10003325 3300025981 Bacteria 8660
351 Ga0207658_10084049 3300025986 Bacteria 2448
352 Ga0207658_10085883 3300025986 Bacteria 2425
353 Ga0207677_10052852 3300026023 Bacteria 2762
354 Ga0207703_10002787 3300026035 Bacteria 14941
355 Ga0207703_10306795 3300026035 Bacteria 1449
356 Ga0207639_10050318 3300026041 Bacteria 3164
357 Ga0207639_10052367 3300026041 Bacteria 3111
358 Ga0207639_10078554 3300026041 Bacteria 2605
359 Ga0207639_10184216 3300026041 Bacteria 1778
360 Ga0207678_10012336 3300026067 Bacteria 7504
361 Ga0207678_10114197 3300026067 Bacteria 2304
362 Ga0207702_10000026 3300026078 Bacteria 186067
363 Ga0207702_10013080 3300026078 Bacteria 6900
364 Ga0207702_10036603 3300026078 Bacteria 4106
365 Ga0207702_10143451 3300026078 Bacteria 2164
366 Ga0207702_10433508 3300026078 Bacteria 1273
367 Ga0207641_10003920 3300026088 Bacteria 13015
368 Ga0207641_10229803 3300026088 Bacteria 1724
369 Ga0207648_10220726 3300026089 Bacteria 1685
370 Ga0207676_10069241 3300026095 Bacteria 2825
371 Ga0207674_10007361 3300026116 Bacteria 12820
372 Ga0207674_10013128 3300026116 Bacteria 9219
373 Ga0207674_10016608 3300026116 Bacteria 8049
374 Ga0207675_100133256 3300026118 Bacteria 2356
375 Ga0207675_100144548 3300026118 Bacteria 2261
376 Ga0207683_10038042 3300026121 Bacteria 4191
377 Ga0207698_10019685 3300026142 Bacteria 4626
378 Ga0207698_10026970 3300026142 Bacteria 4072
379 Ga0209389_1000073 3300027296 Bacteria 94298
380 Ga0209389_1000499 3300027296 Bacteria 23605
381 Ga0209389_1022906 3300027296 Bacteria 5524
382 Ga0209589_1000109 3300027357 Bacteria 83533
383 Ga0209589_1010873 3300027357 Bacteria 13087
384 Ga0209589_1022228 3300027357 Bacteria 5439
385 Ga0209489_100324 3300027361 Bacteria 83533
386 Ga0209489_102828 3300027361 Bacteria 34702
387 Ga0209489_103645 3300027361 Bacteria 29671
388 Ga0209700_100020 3300027363 Bacteria 235733
389 Ga0209700_100067 3300027363 Bacteria 144074
390 Ga0209700_100355 3300027363 Bacteria 83533
391 Ga0209813_10035300 3300027866 Bacteria 1497
392 Ga0209813_10055054 3300027866 Bacteria 1255
393 Ga0207428_10002040 3300027907 Bacteria 20406
394 Ga0268266_10000753 3300028379 Bacteria 43310
395 Ga0268266_10000988 3300028379 Bacteria 35821
396 Ga0268266_10004630 3300028379 Bacteria 13117
397 Ga0268266_10005789 3300028379 Bacteria 11444
398 Ga0268266_10006566 3300028379 Bacteria 10634
399 Ga0268266_10034991 3300028379 Bacteria 4272
400 Ga0268266_10078465 3300028379 Bacteria 2873
401 Ga0268266_10209867 3300028379 Bacteria 1785
402 Ga0268266_10408797 3300028379 Bacteria 1284
403 Ga0268265_10021152 3300028380 Bacteria 4552
404 Ga0268265_10279408 3300028380 Bacteria 1493
405 Ga0268265_10353526 3300028380 Bacteria 1342
406 Ga0268264_10000020 3300028381 Bacteria 483593
407 Ga0268264_10134897 3300028381 Bacteria 2193
408 Ga0307515_10035428 3300028794 Bacteria 8119
409 Ga0307515_10202499 3300028794 Bacteria 1856
410 Ga0265338_10003763 3300028800 Bacteria 21077
411 Ga0265339_10004949 3300031249 Bacteria 8972
412 Ga0265316_10095519 3300031344 Bacteria 2264
413 Ga0307513_10101376 3300031456 Bacteria 2901
414 Ga0307513_10138748 3300031456 Bacteria 2361
415 Ga0307509_10110283 3300031507 Bacteria 2757
416 Ga0307508_10079818 3300031616 Bacteria 2853
417 Ga0265314_10008989 3300031711 Bacteria 8499
418 Ga0265342_10177626 3300031712 Bacteria 1168
419 Ga0307516_10095609 3300031730 Bacteria 2793
420 Ga0307516_10278264 3300031730 Bacteria 1356
421 Ga0307413_10045378 3300031824 Bacteria 2605
422 Ga0307407_10169319 3300031903 Bacteria 1437
423 Ga0307409_100215466 3300031995 Bacteria 1729
424 Ga0307414_10085914 3300032004 Bacteria 2320
425 Ga0307411_10050896 3300032005 Bacteria 2700
426 Ga0307415_100143713 3300032126 Bacteria 1826
427 Ga0307415_100211728 3300032126 Bacteria 1547
428 Ga0307510_10005921 3300033180 Bacteria 14593
429 Ga0307510_10020259 3300033180 Bacteria 7778
430 Ga0307510_10037404 3300033180 Bacteria 5385
431 Ga0307510_10045259 3300033180 Bacteria 4754
432 Ga0307510_10096754 3300033180 Bacteria 2766
433 Ga0373923_0029849 3300035111 Bacteria 2189
434 Ga0373936_0029461 3300035113 Bacteria 2161
435 Ga0373945_0024596 3300035116 Bacteria 2088
436 Ga0373927_0006364 3300035695 Bacteria 8045
437 Ga0373927_0187066 3300035695 Bacteria 1358
438 Ga0373933_0000631 3300035724 Bacteria 21995
439 Ga0373947_0042928 3300035725 Bacteria 2699
440 Ga0373937_0092287 3300036401 Bacteria 2806
441 Ga0373925_0015322 3300037068 Bacteria 5545
442 Ga0373925_0041371 3300037068 Bacteria 3416
443 Ga0373925_0096883 3300037068 Bacteria 2262
444 Ga0373925_0232545 3300037068 Bacteria 1474
445 Ga0395898_0010290 3300037466 Bacteria 9790
446 Ga0436364_1398367 3300037853 Bacteria 3897
447 Ga0395901_0147427 3300038443 Bacteria 2473
448 Ga0395901_0385094 3300038443 Bacteria 1443
449 Ga0395901_0409343 3300038443 Bacteria 1393
450 Ga0436365_0260840 3300039437 Bacteria 28419
451 Ga0436365_0709051 3300039437 Bacteria 32416
452 Ga0436365_0776418 3300039437 Bacteria 2484
453 Ga0436365_1937261 3300039437 Bacteria 3341
454 Ga0436360_0043776 3300039438 Bacteria 2637
455 Ga0436360_1037574 3300039438 Bacteria 3347
456 Ga0436361_0032524 3300039447 Bacteria 4189
457 Ga0436361_0530867 3300039447 Bacteria 5565
458 Ga0436361_0722566 3300039447 Bacteria 33081
459 Ga0436361_1018093 3300039447 Bacteria 9077
460 Ga0436363_0266154 3300039450 Bacteria 1675
461 Ga0436362_0276427 3300039453 Bacteria 3969
462 Ga0439440_0011149 3300042993 Bacteria 1892
463 Ga0466969_0067574 3300044656 Bacteria 1724
464 Ga0466972_0006316 3300044658 Bacteria 5954
465 Ga0466972_0049620 3300044658 Bacteria 2027
466 Ga0453683_0074572 3300044673 Bacteria 2124
467 Ga0466965_0011225 3300044683 Bacteria 4194
468 Ga0466966_0027865 3300044684 Bacteria 3682
469 Ga0466961_0000650 3300044693 Bacteria 21866
470 Ga0466961_0082998 3300044693 Bacteria 2027
471 Ga0466963_0164962 3300044694 Bacteria 1543
472 Ga0453684_0000015 3300044712 Bacteria 969198
473 Ga0453684_0000020 3300044712 Bacteria 879938
474 Ga0453684_0000189 3300044712 Bacteria 269690
475 Ga0453684_0001541 3300044712 Bacteria 64371
476 Ga0466968_0014484 3300044735 Bacteria 3117
477 Ga0466957_0299000 3300044842 Bacteria 1081
478 Ga0466960_0076811 3300044901 Bacteria 1673
479 Ga0466959_0029074 3300045049 Bacteria 4094
480 Ga0451576_0000064 3300045051 Bacteria 277677
481 Ga0451576_0082586 3300045051 Bacteria 3342
482 Ga0466967_0107400 3300045976 Bacteria 2560
483 Ga0466967_0109755 3300045976 Bacteria 2533
484 Ga0466967_0128217 3300045976 Bacteria 2352
485 Ga0466967_0354963 3300045976 Bacteria 1420
486 Ga0495590_0015942 3300046457 Bacteria 2717
487 Ga0495629_0000802 3300046459 Bacteria 25442
488 Ga0495629_0021757 3300046459 Bacteria 4575
489 Ga0495629_0060639 3300046459 Bacteria 2644
490 Ga0495629_0162149 3300046459 Bacteria 1553
491 Ga0495638_0002608 3300046460 Bacteria 14546
492 Ga0495638_0176896 3300046460 Bacteria 1220
493 Ga0495641_0010430 3300046461 Bacteria 5387
494 Ga0495651_0040589 3300046462 Bacteria 3619
495 Ga0495651_0149874 3300046462 Bacteria 1682
496 Ga0495580_0027757 3300046472 Bacteria 4117
497 Ga0495662_0000007 3300046476 Bacteria 74478
498 Ga0495662_0118781 3300046476 Bacteria 1297
499 Ga0495664_0069271 3300046477 Bacteria 2106
500 Ga0495664_0143167 3300046477 Bacteria 1449
501 Ga0495664_0178979 3300046477 Bacteria 1286
502 Ga0495584_0035572 3300046491 Bacteria 2517
503 Ga0495585_0039034 3300046492 Bacteria 2670
504 Ga0495607_0089407 3300046501 Bacteria 1672
505 Ga0495606_0063710 3300046507 Bacteria 2349
506 Ga0495618_0067517 3300046514 Bacteria 2274
507 Ga0495630_0000084 3300046517 Bacteria 74626
508 Ga0495630_0132205 3300046517 Bacteria 1895
509 Ga0495632_0011028 3300046519 Bacteria 5296
510 Ga0495643_0040821 3300046522 Bacteria 2532
511 Ga0495648_0040512 3300046524 Bacteria 2953
512 Ga0495640_0008550 3300046533 Bacteria 8026
513 Ga0495640_0072701 3300046533 Bacteria 2303
514 Ga0495586_0001213 3300046535 Bacteria 14498
515 Ga0495586_0022557 3300046535 Bacteria 3360
516 Ga0495587_0018343 3300046536 Bacteria 4340
517 Ga0495597_0069534 3300046542 Bacteria 1519
518 Ga0495668_0001264 3300046616 Bacteria 25185
519 Ga0495668_0085005 3300046616 Bacteria 1735
520 Ga0495634_0025791 3300046642 Bacteria 4105
521 Ga0495634_0046164 3300046642 Bacteria 2941
522 Ga0495625_0065166 3300046660 Bacteria 2568
523 Ga0495625_0117708 3300046660 Bacteria 1811
524 Ga0495635_0002250 3300046663 Bacteria 13118
525 Ga0495635_0235717 3300046663 Bacteria 1235
526 Ga0495657_0005609 3300046675 Bacteria 9906
527 Ga0495658_0030781 3300046683 Bacteria 2917
528 Ga0495669_0081029 3300046684 Bacteria 1489
529 Ga0495613_0046879 3300046689 Bacteria 3194
530 Ga0495624_0005463 3300046690 Bacteria 9158
531 Ga0495671_0027080 3300046692 Bacteria 2963
532 Ga0495671_0064012 3300046692 Bacteria 1811
533 Ga0495649_0055835 3300046694 Bacteria 2133
534 Ga0495581_0000215 3300047315 Bacteria 27092
535 Ga0495581_0028632 3300047315 Bacteria 3230
536 Ga0495604_0039547 3300047317 Bacteria 3706
537 Ga0495604_0156580 3300047317 Bacteria 1613
538 Ga0495674_0057386 3300047319 Bacteria 3407
539 Ga0495672_0007893 3300047320 Bacteria 7938
540 Ga0495676_0001102 3300047321 Bacteria 22909
541 Ga0495676_0001503 3300047321 Bacteria 20169
542 Ga0495676_0014528 3300047321 Bacteria 7045
543 Ga0495680_0047336 3300047322 Bacteria 3383
544 Ga0495680_0086605 3300047322 Bacteria 2357
545 Ga0495683_0055034 3300047323 Bacteria 1981
546 Ga0495683_0073936 3300047323 Bacteria 1671
547 Ga0495687_002707 3300047443 Bacteria 13752
548 Ga0495684_0031594 3300047471 Bacteria 4066
549 Ga0495684_0090398 3300047471 Bacteria 2319
550 Ga0495686_0179441 3300047472 Bacteria 1228
551 Ga0495593_0060777 3300047673 Bacteria 1978
552 Ga0495602_0119845 3300048088 Bacteria 2119
553 Ga0496100_0200756 3300048903 Bacteria 1453
554 Ga0496101_0310336 3300048904 Bacteria 1236
555 Ga0496102_0226549 3300048905 Bacteria 1762
556 Ga0496102_0362803 3300048905 Bacteria 1364
557 Ga0496103_0118490 3300048906 Bacteria 1685
558 Ga0496103_0225630 3300048906 Bacteria 1205
559 Ga0496104_0001100 3300048907 Bacteria 23122
560 Ga0496104_0019891 3300048907 Bacteria 6148
561 Ga0496104_0054854 3300048907 Bacteria 3767
562 Ga0496104_0145826 3300048907 Bacteria 2273
563 Ga0496105_0001328 3300048908 Bacteria 17320
564 Ga0496105_0028575 3300048908 Bacteria 4560
565 Ga0496105_0340748 3300048908 Bacteria 1199
566 Ga0496106_0000790 3300048909 Bacteria 22889
567 Ga0496108_0174484 3300048911 Bacteria 1860
568 Ga0496109_0020657 3300048912 Bacteria 5817
569 Ga0496109_0174024 3300048912 Bacteria 2020
570 Ga0496109_0247428 3300048912 Bacteria 1679
571 Ga0496109_0366271 3300048912 Bacteria 1361
572 Ga0496110_0018064 3300048913 Bacteria 5907
573 Ga0496110_0122141 3300048913 Bacteria 2347
574 Ga0496110_0247899 3300048913 Bacteria 1621
575 Ga0496111_0099208 3300048914 Bacteria 2139
576 Ga0496112_0022886 3300048915 Bacteria 5961
577 Ga0496112_0147312 3300048915 Bacteria 2322
578 Ga0496112_0287943 3300048915 Bacteria 1589
579 Ga0496113_0013688 3300048916 Bacteria 5508
580 Ga0496113_0096975 3300048916 Bacteria 2280
581 Ga0496115_0081514 3300048918 Bacteria 2635
582 Ga0496117_0039826 3300048920 Bacteria 3464
583 Ga0496117_0064200 3300048920 Bacteria 2505
584 Ga0496117_0088948 3300048920 Bacteria 1996
585 Ga0496117_0100016 3300048920 Bacteria 1838
586 Ga0496117_0193540 3300048920 Bacteria 1155
587 Ga0496118_0058896 3300048921 Bacteria 2866
588 Ga0496118_0072504 3300048921 Bacteria 2473
589 Ga0496118_0192147 3300048921 Bacteria 1219
590 Ga0496119_0002808 3300048922 Bacteria 18643
591 Ga0496119_0017343 3300048922 Bacteria 5419
592 Ga0496119_0071497 3300048922 Bacteria 2030
593 Ga0496119_0136104 3300048922 Bacteria 1332
594 Ga0496120_0002057 3300048923 Bacteria 21720
595 Ga0496120_0003504 3300048923 Bacteria 14221
596 Ga0496121_0001681 3300048924 Bacteria 36391
597 Ga0496121_0003198 3300048924 Bacteria 23590
598 Ga0496121_0013165 3300048924 Bacteria 8921
599 Ga0496121_0039756 3300048924 Bacteria 4137
600 Ga0496122_0005867 3300048925 Bacteria 14392
601 Ga0496122_0012846 3300048925 Bacteria 8282
602 Ga0496123_0020115 3300048926 Bacteria 5235
603 Ga0496124_0002423 3300048927 Bacteria 24474
604 Ga0496125_0005360 3300048928 Bacteria 14304
605 Ga0496125_0031413 3300048928 Bacteria 4734
606 Ga0496125_0048054 3300048928 Bacteria 3562
607 Ga0496126_0018165 3300048929 Bacteria 6977
608 Ga0496126_0039823 3300048929 Bacteria 4358
609 Ga0496126_0094472 3300048929 Bacteria 2624
610 Ga0496126_0127584 3300048929 Bacteria 2200
611 Ga0496126_0196048 3300048929 Bacteria 1708
612 Ga0495682_0036994 3300049460 Bacteria 1796
613 Ga0501031_0017580 3300049568 Bacteria 4648
614 Ga0501033_0000590 3300049570 Bacteria 33630
615 Ga0501034_0000076 3300049571 Bacteria 174683
616 Ga0501034_0376913 3300049571 Bacteria 1344
617 Ga0501034_0401557 3300049571 Bacteria 1293
618 Ga0501036_0211551 3300049572 Bacteria 1629
619 Ga0501037_0008987 3300049573 Bacteria 7319
620 Ga0501037_0010911 3300049573 Bacteria 6677
621 Ga0501038_0037761 3300049574 Bacteria 4234
622 Ga0501039_0013969 3300049575 Bacteria 6145
623 Ga0501039_0136096 3300049575 Bacteria 1929
624 Ga0501043_0052081 3300049579 Bacteria 3216
625 Ga0501047_0014216 3300049581 Bacteria 7566
626 Ga0501047_0022387 3300049581 Bacteria 6069
627 Ga0501047_0088578 3300049581 Bacteria 2972
628 Ga0501048_0014790 3300049582 Bacteria 5772
629 Ga0501070_0094918 3300049586 Bacteria 2468
630 Ga0501073_0025069 3300049589 Bacteria 4281
631 Ga0501080_0000004 3300049742 Bacteria 180905
632 Ga0501080_0195352 3300049742 Bacteria 1859
633 Ga0501081_0075408 3300049743 Bacteria 2355
634 Ga0501035_0000191 3300049822 Bacteria 75056
635 Ga0501044_0000227 3300049823 Bacteria 70875
636 Ga0501044_0004541 3300049823 Bacteria 15516
637 Ga0501044_0256981 3300049823 Bacteria 1686
638 nmdc:mga03n38_204_c1 3300050490 Bacteria 13570
639 nmdc:mga0yw44_132069_c1 3300050492 Bacteria 1617
640 nmdc:mga0yw44_15076_c1 3300050492 Bacteria 4127
641 nmdc:mga0yw44_170290_c1 3300050492 Bacteria 1430
642 nmdc:mga0yw44_181974_c1 3300050492 Bacteria 1384
643 nmdc:mga0yw44_72652_c1 3300050492 Bacteria 2139
644 nmdc:mga0k408_42943_c1 3300050493 Bacteria 2604
645 nmdc:mga0k408_82863_c1 3300050493 Bacteria 1880
646 nmdc:mga06z11_205046_c1 3300050494 Bacteria 1147
647 nmdc:mga06z11_24442_c1 3300050494 Bacteria 2850
648 nmdc:mga06z11_38395_c1 3300050494 Bacteria 2378
649 nmdc:mga04h51_15680_c1 3300050495 Bacteria 2187
650 nmdc:mga04h51_65800_c1 3300050495 Bacteria 1254
651 nmdc:mga07m45_33634_c1 3300050496 Bacteria 2848
652 nmdc:mga07m45_751_c1 3300050496 Bacteria 5066
653 nmdc:mga0qj67_291146_c1 3300050509 Bacteria 1323
654 nmdc:mga06r32_109674_c1 3300050510 Bacteria 2714
655 nmdc:mga08y16_164079_c1 3300050511 Bacteria 2308
656 nmdc:mga08y16_514_c1 3300050511 Bacteria 35764
657 nmdc:mga0rr50_170102_c1 3300050513 Bacteria 1775
658 nmdc:mga0sz30_18837_c1 3300050516 Bacteria 2767
659 Ga0500643_001125 3300053087 Bacteria 15957
660 Ga0500646_0025209 3300053090 Bacteria 1605
661 Ga0500651_0013310 3300053093 Bacteria 5010
662 Ga0500566_0000232 3300053094 Bacteria 29876
663 Ga0500640_023559 3300053095 Bacteria 2668
664 Ga0500555_011850 3300053103 Bacteria 2508
665 Ga0500557_000036 3300053105 Bacteria 71169
666 Ga0500562_015703 3300053108 Bacteria 1943
667 Ga0500572_004823 3300053111 Bacteria 3056
668 Ga0500595_000218 3300053119 Bacteria 39105
669 Ga0500607_093658 3300053121 Bacteria 1506
670 Ga0500642_0000122 3300053130 Bacteria 35651
671 Ga0500642_0001048 3300053130 Bacteria 7975
672 Ga0500655_009118 3300053133 Bacteria 1786
673 Ga0500658_0032893 3300053134 Bacteria 2036
674 Ga0500658_0048764 3300053134 Bacteria 1723
675 Ga0500568_0011572 3300053139 Bacteria 4085
676 Ga0500573_0000003 3300053140 Bacteria 355643
677 Ga0500586_000362 3300053145 Bacteria 9030
678 Ga0500590_062055 3300053148 Bacteria 1876
679 Ga0500603_001454 3300053150 Bacteria 5401
680 Ga0500604_0002821 3300053151 Bacteria 4717
681 Ga0500616_0020064 3300053153 Bacteria 3757
682 Ga0500622_0012277 3300053156 Bacteria 4644
683 Ga0500630_012678 3300053159 Bacteria 4153
684 Ga0500638_000841 3300053162 Bacteria 8559
685 Ga0500638_070655 3300053162 Bacteria 1669
686 Ga0500639_027833 3300053163 Bacteria 2986
687 Ga0500636_0044126 3300053177 Bacteria 2630
688 Ga0500637_0120120 3300053178 Bacteria 1524
689 Ga0500645_010068 3300053730 Bacteria 3145
690 Ga0500596_000723 3300053735 Bacteria 6467
691 Ga0500596_004089 3300053735 Bacteria 2704
692 Ga0501082_0029242 3300060353 Bacteria 4746
693 Ga0466962_0057131 3300061719 Bacteria 1863

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0031413 Ga0496125_0031413_2391_3245 270
2 3300050492 nmdc:mga0yw44_15076_c1 nmdc:mga0yw44_15076_c1_18_935 284
3 3300044673 Ga0453683_0074572 Ga0453683_0074572_61_1035 311
4 3300047321 Ga0495676_0001102 Ga0495676_0001102_13619_14572 315
5 3300046459 Ga0495629_0000802 Ga0495629_0000802_7717_8676 317
6 3300046461 Ga0495641_0010430 Ga0495641_0010430_3558_4517 317
7 3300046476 Ga0495662_0000007 Ga0495662_0000007_15790_16749 317
8 3300046477 Ga0495664_0069271 Ga0495664_0069271_992_1951 317
9 3300046517 Ga0495630_0000084 Ga0495630_0000084_4868_5827 317
10 3300046535 Ga0495586_0001213 Ga0495586_0001213_8293_9252 317
11 3300046642 Ga0495634_0025791 Ga0495634_0025791_2062_3021 317
12 3300046690 Ga0495624_0005463 Ga0495624_0005463_1469_2428 317
13 3300047315 Ga0495581_0000215 Ga0495581_0000215_23796_24755 317
14 3300047319 Ga0495674_0057386 Ga0495674_0057386_1155_2114 317
15 3300047321 Ga0495676_0001503 Ga0495676_0001503_3897_4856 317
16 3300047322 Ga0495680_0086605 Ga0495680_0086605_142_1101 317
17 3300005616 Ga0068852_100289984 Ga0068852_1002899842 319
18 iso_pu_bacteria 2513237137 2513862239 321
19 iso_pu_bacteria 2513237137 2513864074 321
20 iso_pu_bacteria 2513237101 2513695350 322
21 iso_pu_bacteria 2513237101 2513698568 322
22 iso_pu_bacteria 8016622563 8016624576 322
23 iso_pu_bacteria 8019678201 8019686532 322
24 3300044842 Ga0466957_0299000 Ga0466957_0299000_83_1066 326
25 3300046517 Ga0495630_0132205 Ga0495630_0132205_902_1885 326
26 iso_pu_bacteria 2885409591 2885414063 326
27 iso_pu_bacteria 2956939328 2956941609 326
28 iso_pu_bacteria 3001119090 3001119977 326
29 3300006846 Ga0075430_100140342 Ga0075430_1001403421 328
30 3300009094 Ga0111539_10043845 Ga0111539_100438452 328
31 3300050511 nmdc:mga08y16_164079_c1 nmdc:mga08y16_164079_c1_356_1393 328
32 3300009553 Ga0105249_10000013 Ga0105249_10000013162 329
33 3300025961 Ga0207712_10000018 Ga0207712_10000018130 329
34 3300005471 Ga0070698_100026493 Ga0070698_1000264937 330
35 3300006178 Ga0075367_10104626 Ga0075367_101046262 330
36 3300031903 Ga0307407_10169319 Ga0307407_101693192 330
37 3300031995 Ga0307409_100215466 Ga0307409_1002154661 330
38 3300032004 Ga0307414_10085914 Ga0307414_100859143 330
39 3300032126 Ga0307415_100143713 Ga0307415_1001437132 330
40 3300044683 Ga0466965_0011225 Ga0466965_0011225_2618_3658 330
41 3300044694 Ga0466963_0164962 Ga0466963_0164962_374_1420 330
42 3300045976 Ga0466967_0128217 Ga0466967_0128217_537_1583 330
43 3300045976 Ga0466967_0354963 Ga0466967_0354963_289_1332 330
44 3300048922 Ga0496119_0071497 Ga0496119_0071497_506_1504 330
45 iso_pu_bacteria 2885409591 2885412410 330
46 3300021361 Ga0213872_10002000 Ga0213872_100020003 335
47 3300031712 Ga0265342_10177626 Ga0265342_101776261 335
48 3300039447 Ga0436361_0032524 Ga0436361_0032524_1364_2371 335
49 3300021361 Ga0213872_10062062 Ga0213872_100620622 336
50 3300039447 Ga0436361_1018093 Ga0436361_1018093_7466_8476 336
51 3300006844 Ga0075428_100336341 Ga0075428_1003363412 337
52 3300050509 nmdc:mga0qj67_291146_c1 nmdc:mga0qj67_291146_c1_11_1108 337
53 3300005563 Ga0068855_100079863 Ga0068855_1000798634 338
54 3300003214 JGI25165J46597_1000013 JGI25165J46597_100001372 340
55 3300025261 Ga0209233_1000013 Ga0209233_1000013326 340
56 iso_pu_bacteria 2879142872 2879144577 341
57 3300025913 Ga0207695_10089189 Ga0207695_100891892 343
58 iso_pu_bacteria 2876761206 2876762135 344
59 iso_pu_bacteria 2876761206 2876768620 344
60 iso_pu_bacteria 8019608314 8019608886 344
61 3300009094 Ga0111539_10007940 Ga0111539_100079405 345
62 3300025961 Ga0207712_10008001 Ga0207712_100080016 345
63 3300027907 Ga0207428_10002040 Ga0207428_1000204012 345
64 3300046616 Ga0495668_0001264 Ga0495668_0001264_11418_12485 345
65 3300050511 nmdc:mga08y16_514_c1 nmdc:mga08y16_514_c1_11547_12587 345
66 iso_pu_bacteria 2744054633 2745082491 345
67 3300005329 Ga0070683_100065692 Ga0070683_1000656922 346
68 3300005535 Ga0070684_100051351 Ga0070684_1000513512 346
69 3300005564 Ga0070664_100167199 Ga0070664_1001671992 346
70 3300025944 Ga0207661_10286876 Ga0207661_102868762 346
71 3300025945 Ga0207679_10172774 Ga0207679_101727742 346
72 3300031711 Ga0265314_10008989 Ga0265314_100089894 346
73 3300061719 Ga0466962_0057131 Ga0466962_0057131_340_1380 346
74 3300049742 Ga0501080_0195352 Ga0501080_0195352_625_1677 347
75 3300050510 nmdc:mga06r32_109674_c1 nmdc:mga06r32_109674_c1_968_2023 347
76 iso_pu_bacteria 2721755755 2723847429 347
77 iso_pu_bacteria 2919166419 2919169399 347
78 iso_pu_bacteria 8019638758 8019647649 347
79 3300005985 Ga0081539_10017941 Ga0081539_100179414 348
80 iso_pu_bacteria 2513237084 2513570684 348
81 iso_pu_bacteria 2513237093 2513632189 348
82 iso_pu_bacteria 2643221580 2643911506 348
83 iso_pu_bacteria 2643221674 2644410284 348
84 iso_pu_bacteria 2791355265 2793356519 348
85 iso_pu_bacteria 2838680041 2838680629 348
86 iso_pu_bacteria 2838694306 2838695338 348
87 iso_pu_bacteria 2838707686 2838708714 348
88 iso_pu_bacteria 2842077413 2842080051 348
89 iso_pu_bacteria 2842118031 2842120670 348
90 iso_pu_bacteria 2842237096 2842238126 348
91 iso_pu_bacteria 2842291075 2842293711 348
92 iso_pu_bacteria 2842370503 2842371092 348
93 iso_pu_bacteria 2842377471 2842380108 348
94 iso_pu_bacteria 2842384541 2842387179 348
95 iso_pu_bacteria 2935894831 2935895861 348
96 iso_pu_bacteria 8018127388 8018133170 348
97 3300003323 rootH1_10176606 rootH1_101766065 349
98 3300013306 Ga0163162_10163423 Ga0163162_101634232 349
99 3300013308 Ga0157375_10187982 Ga0157375_101879822 349
100 3300046491 Ga0495584_0035572 Ga0495584_0035572_1191_2249 349
101 iso_pu_bacteria 2713897090 2715499199 349
102 iso_pu_bacteria 2920822456 2920828869 349
103 iso_pu_bacteria 2939669807 2939669940 349
104 iso_pu_bacteria 2996887358 2996891329 349
105 iso_pu_bacteria 8005258706 8005263873 349
106 iso_pu_bacteria 8005321885 8005325856 349
107 iso_pu_bacteria 8049293176 8049299043 349
108 3300002773 JGI25152J39213_1001710 JGI25152J39213_100171010 350
109 3300003215 JGI25153J46596_10009473 JGI25153J46596_100094732 350
110 3300003771 Ga0055526_1002123 Ga0055526_100212315 350
111 3300003775 Ga0055524_1005522 Ga0055524_10055222 350
112 3300003775 Ga0055524_1008938 Ga0055524_10089382 350
113 3300003790 Ga0055528_1003908 Ga0055528_10039082 350
114 3300003792 Ga0055540_1016113 Ga0055540_10161133 350
115 3300003792 Ga0055540_1018664 Ga0055540_10186642 350
116 3300005262 Ga0065165_1040874 Ga0065165_10408741 350
117 3300005327 Ga0070658_10013687 Ga0070658_100136875 350
118 3300005353 Ga0070669_100069635 Ga0070669_1000696352 350
119 3300006186 Ga0075369_10021966 Ga0075369_100219662 350
120 3300009093 Ga0105240_10004736 Ga0105240_100047364 350
121 3300010375 Ga0105239_10027032 Ga0105239_100270326 350
122 3300025258 Ga0209129_1000508 Ga0209129_100050824 350
123 3300025273 Ga0209673_1002931 Ga0209673_10029317 350
124 3300025273 Ga0209673_1026617 Ga0209673_10266172 350
125 3300025295 Ga0209564_1000262 Ga0209564_100026241 350
126 3300025295 Ga0209564_1003511 Ga0209564_10035115 350
127 3300025297 Ga0209758_1000774 Ga0209758_100077417 350
128 3300025299 Ga0209256_1004330 Ga0209256_10043305 350
129 3300025299 Ga0209256_1017028 Ga0209256_10170282 350
130 3300025302 Ga0207426_1030563 Ga0207426_10305631 350
131 3300025303 Ga0209051_1004348 Ga0209051_10043487 350
132 3300025909 Ga0207705_10009587 Ga0207705_100095873 350
133 3300025913 Ga0207695_10006751 Ga0207695_100067519 350
134 3300048920 Ga0496117_0039826 Ga0496117_0039826_532_1608 350
135 3300048921 Ga0496118_0192147 Ga0496118_0192147_97_1173 350
136 3300048922 Ga0496119_0017343 Ga0496119_0017343_3020_4126 350
137 3300048923 Ga0496120_0002057 Ga0496120_0002057_7868_8974 350
138 3300048924 Ga0496121_0013165 Ga0496121_0013165_5457_6533 350
139 3300048925 Ga0496122_0005867 Ga0496122_0005867_9999_11075 350
140 3300048926 Ga0496123_0020115 Ga0496123_0020115_2264_3340 350
141 3300048928 Ga0496125_0005360 Ga0496125_0005360_6332_7408 350
142 iso_pu_bacteria 2510917030 2511194002 350
143 iso_pu_bacteria 2582581298 2585223301 350
144 iso_pu_bacteria 2585427529 2585546103 350
145 iso_pu_bacteria 2903727486 2903731960 350
146 iso_pu_bacteria 2919100787 2919101820 350
147 iso_pu_bacteria 2935769743 2935777514 350
148 iso_pu_bacteria 2935777560 2935781075 350
149 3300026118 Ga0207675_100133256 Ga0207675_1001332562 351
150 3300031344 Ga0265316_10095519 Ga0265316_100955192 351
151 3300042993 Ga0439440_0011149 Ga0439440_0011149_816_1874 351
152 3300046477 Ga0495664_0143167 Ga0495664_0143167_380_1438 351
153 3300049568 Ga0501031_0017580 Ga0501031_0017580_1067_2140 351
154 3300049573 Ga0501037_0008987 Ga0501037_0008987_2441_3514 351
155 3300049574 Ga0501038_0037761 Ga0501038_0037761_2929_4002 351
156 3300049575 Ga0501039_0013969 Ga0501039_0013969_378_1451 351
157 iso_pu_bacteria 2507262055 2507507092 351
158 iso_pu_bacteria 2508501009 2508541071 351
159 iso_pu_bacteria 2511231028 2511399068 351
160 iso_pu_bacteria 2513237092 2513628095 351
161 iso_pu_bacteria 2513237095 2513646089 351
162 iso_pu_bacteria 2517093001 2517103451 351
163 iso_pu_bacteria 2517093001 2517106454 351
164 iso_pu_bacteria 2524023205 2524440984 351
165 iso_pu_bacteria 2524023205 2524443045 351
166 iso_pu_bacteria 2744054633 2745079700 351
167 iso_pu_bacteria 2816332527 2818243858 351
168 iso_pu_bacteria 2824600985 2824603203 351
169 iso_pu_bacteria 2824609381 2824613697 351
170 iso_pu_bacteria 2824617872 2824620616 351
171 iso_pu_bacteria 2824617872 2824621209 351
172 iso_pu_bacteria 2824626560 2824629678 351
173 iso_pu_bacteria 2824626560 2824630212 351
174 iso_pu_bacteria 2824635225 2824636412 351
175 iso_pu_bacteria 2824635225 2824636987 351
176 iso_pu_bacteria 2824644064 2824644831 351
177 iso_pu_bacteria 2824644064 2824646030 351
178 iso_pu_bacteria 2824661429 2824664415 351
179 iso_pu_bacteria 2824661429 2824669234 351
180 iso_pu_bacteria 2824696289 2824696687 351
181 iso_pu_bacteria 2824714736 2824715305 351
182 iso_pu_bacteria 2824714736 2824716933 351
183 iso_pu_bacteria 2824723954 2824724618 351
184 iso_pu_bacteria 2824723954 2824725418 351
185 iso_pu_bacteria 2824746037 2824747884 351
186 iso_pu_bacteria 2824753945 2824755332 351
187 iso_pu_bacteria 2824773399 2824776843 351
188 iso_pu_bacteria 2841957949 2841959165 351
189 iso_pu_bacteria 2844315083 2844322502 351
190 iso_pu_bacteria 2849076700 2849077680 351
191 iso_pu_bacteria 2849076700 2849077757 351
192 iso_pu_bacteria 2857509624 2857510911 351
193 iso_pu_bacteria 2876761206 2876761804 351
194 iso_pu_bacteria 2876761206 2876761830 351
195 iso_pu_bacteria 2879099564 2879102801 351
196 iso_pu_bacteria 2879127579 2879128053 351
197 iso_pu_bacteria 2879142872 2879143381 351
198 iso_pu_bacteria 2881364244 2881364409 351
199 iso_pu_bacteria 2881665667 2881667554 351
200 iso_pu_bacteria 2888378607 2888382749 351
201 iso_pu_bacteria 2888388044 2888388557 351
202 iso_pu_bacteria 2888388044 2888395026 351
203 iso_pu_bacteria 2903727486 2903733672 351
204 iso_pu_bacteria 2906602504 2906609030 351
205 iso_pu_bacteria 2906626472 2906628713 351
206 iso_pu_bacteria 2922368715 2922376414 351
207 iso_pu_bacteria 2922393267 2922399211 351
208 iso_pu_bacteria 2932784394 2932792610 351
209 iso_pu_bacteria 2932794094 2932800968 351
210 iso_pu_bacteria 2932801729 2932804620 351
211 iso_pu_bacteria 2932809354 2932809779 351
212 iso_pu_bacteria 2932809354 2932815283 351
213 iso_pu_bacteria 2932818245 2932818476 351
214 iso_pu_bacteria 2932818245 2932824437 351
215 iso_pu_bacteria 2932818245 2932827284 351
216 iso_pu_bacteria 2932828146 2932828583 351
217 iso_pu_bacteria 2932828146 2932832164 351
218 iso_pu_bacteria 2935608549 2935610538 351
219 iso_pu_bacteria 2935616580 2935622102 351
220 iso_pu_bacteria 2935638405 2935638977 351
221 iso_pu_bacteria 2935665750 2935666171 351
222 iso_pu_bacteria 2935665750 2935669197 351
223 iso_pu_bacteria 2935675223 2935676783 351
224 iso_pu_bacteria 2935675223 2935683245 351
225 iso_pu_bacteria 2935675223 2935684376 351
226 iso_pu_bacteria 2935684952 2935685172 351
227 iso_pu_bacteria 2935684952 2935692186 351
228 iso_pu_bacteria 2935694250 2935694861 351
229 iso_pu_bacteria 2935694250 2935702409 351
230 iso_pu_bacteria 2935703347 2935703984 351
231 iso_pu_bacteria 2935703347 2935708727 351
232 iso_pu_bacteria 2935713505 2935713725 351
233 iso_pu_bacteria 2935713505 2935720576 351
234 iso_pu_bacteria 2935722832 2935724344 351
235 iso_pu_bacteria 2935722832 2935729857 351
236 iso_pu_bacteria 2935732158 2935733298 351
237 iso_pu_bacteria 2935732158 2935739161 351
238 iso_pu_bacteria 2935741537 2935742677 351
239 iso_pu_bacteria 2935741537 2935748298 351
240 iso_pu_bacteria 2935750917 2935751137 351
241 iso_pu_bacteria 2935750917 2935758501 351
242 iso_pu_bacteria 2935760218 2935760339 351
243 iso_pu_bacteria 2935760218 2935766073 351
244 iso_pu_bacteria 2935785616 2935786392 351
245 iso_pu_bacteria 2935793552 2935793810 351
246 iso_pu_bacteria 2935801545 2935805913 351
247 iso_pu_bacteria 2935810662 2935810890 351
248 iso_pu_bacteria 2935810662 2935815528 351
249 iso_pu_bacteria 2935819856 2935820239 351
250 iso_pu_bacteria 2935819856 2935823698 351
251 iso_pu_bacteria 2935827899 2935828472 351
252 iso_pu_bacteria 2935837841 2935843290 351
253 iso_pu_bacteria 2935847175 2935849225 351
254 iso_pu_bacteria 2935855204 2935860349 351
255 iso_pu_bacteria 2935864058 2935867747 351
256 iso_pu_bacteria 2935873716 2935878444 351
257 iso_pu_bacteria 2935883170 2935885149 351
258 iso_pu_bacteria 2935908558 2935915877 351
259 iso_pu_bacteria 2935916978 2935923010 351
260 iso_pu_bacteria 2935926038 2935934209 351
261 iso_pu_bacteria 2935934488 2935942685 351
262 iso_pu_bacteria 2935942939 2935951126 351
263 iso_pu_bacteria 2935951376 2935958615 351
264 iso_pu_bacteria 2935967501 2935975676 351
265 iso_pu_bacteria 2935984226 2935991761 351
266 iso_pu_bacteria 2935992306 2935998673 351
267 iso_pu_bacteria 2936002035 2936002603 351
268 iso_pu_bacteria 2936002035 2936006979 351
269 iso_pu_bacteria 2936037263 2936037690 351
270 iso_pu_bacteria 2936037263 2936040766 351
271 iso_pu_bacteria 2940556831 2940558061 351
272 iso_pu_bacteria 2940556831 2940564405 351
273 iso_pu_bacteria 2941531003 2941536498 351
274 iso_pu_bacteria 2941538514 2941544836 351
275 iso_pu_bacteria 3005483717 3005485233 351
276 iso_pu_bacteria 3005506211 3005507976 351
277 iso_pu_bacteria 3005594810 3005598021 351
278 iso_pu_bacteria 3005710791 3005713705 351
279 iso_pu_bacteria 3005718088 3005721217 351
280 iso_pu_bacteria 8016511872 8016519993 351
281 iso_pu_bacteria 8016511872 8016520909 351
282 iso_pu_bacteria 8017057580 8017064688 351
283 iso_pu_bacteria 8017057580 8017065554 351
284 iso_pu_bacteria 8019547302 8019551611 351
285 iso_pu_bacteria 8019576017 8019584052 351
286 iso_pu_bacteria 8019576017 8019584957 351
287 iso_pu_bacteria 8019586578 8019592914 351
288 iso_pu_bacteria 8019597564 8019598542 351
289 iso_pu_bacteria 8019597564 8019599482 351
290 iso_pu_bacteria 8019608314 8019609834 351
291 iso_pu_bacteria 8019648815 8019656945 351
292 iso_pu_bacteria 8019659431 8019664086 351
293 iso_pu_bacteria 8019687851 8019692329 351
294 iso_pu_bacteria 8056967851 8056973409 351
295 3300005327 Ga0070658_10080716 Ga0070658_100807162 352
296 3300005329 Ga0070683_100115242 Ga0070683_1001152422 352
297 3300005331 Ga0070670_100040501 Ga0070670_1000405013 352
298 3300005334 Ga0068869_100028731 Ga0068869_1000287314 352
299 3300005334 Ga0068869_100061092 Ga0068869_1000610922 352
300 3300005335 Ga0070666_10064965 Ga0070666_100649652 352
301 3300005339 Ga0070660_100023504 Ga0070660_1000235042 352
302 3300005340 Ga0070689_100343932 Ga0070689_1003439321 352
303 3300005347 Ga0070668_100000830 Ga0070668_10000083010 352
304 3300005355 Ga0070671_100005278 Ga0070671_1000052786 352
305 3300005365 Ga0070688_100072138 Ga0070688_1000721383 352
306 3300005367 Ga0070667_100008652 Ga0070667_1000086526 352
307 3300005435 Ga0070714_100136283 Ga0070714_1001362831 352
308 3300005445 Ga0070708_100027800 Ga0070708_1000278002 352
309 3300005456 Ga0070678_100015416 Ga0070678_1000154163 352
310 3300005458 Ga0070681_10097487 Ga0070681_100974872 352
311 3300005459 Ga0068867_100176825 Ga0068867_1001768252 352
312 3300005467 Ga0070706_100003127 Ga0070706_1000031277 352
313 3300005468 Ga0070707_100001574 Ga0070707_1000015742 352
314 3300005518 Ga0070699_100002004 Ga0070699_1000020047 352
315 3300005536 Ga0070697_100045516 Ga0070697_1000455162 352
316 3300005548 Ga0070665_100005930 Ga0070665_1000059304 352
317 3300005548 Ga0070665_100014283 Ga0070665_1000142832 352
318 3300005548 Ga0070665_100048130 Ga0070665_1000481302 352
319 3300005548 Ga0070665_100147621 Ga0070665_1001476212 352
320 3300005614 Ga0068856_100043689 Ga0068856_1000436893 352
321 3300005614 Ga0068856_100183040 Ga0068856_1001830402 352
322 3300005618 Ga0068864_100094104 Ga0068864_1000941042 352
323 3300005840 Ga0068870_10088629 Ga0068870_100886292 352
324 3300005841 Ga0068863_100005808 Ga0068863_1000058083 352
325 3300005842 Ga0068858_100001857 Ga0068858_1000018577 352
326 3300005842 Ga0068858_100222422 Ga0068858_1002224222 352
327 3300005843 Ga0068860_100057032 Ga0068860_1000570322 352
328 3300006237 Ga0097621_100025068 Ga0097621_1000250683 352
329 3300006358 Ga0068871_100165789 Ga0068871_1001657892 352
330 3300006881 Ga0068865_100141238 Ga0068865_1001412381 352
331 3300009093 Ga0105240_10024496 Ga0105240_100244967 352
332 3300009148 Ga0105243_10039043 Ga0105243_100390432 352
333 3300009148 Ga0105243_10277624 Ga0105243_102776242 352
334 3300009174 Ga0105241_10059936 Ga0105241_100599362 352
335 3300009174 Ga0105241_10108987 Ga0105241_101089872 352
336 3300009177 Ga0105248_10005020 Ga0105248_1000502013 352
337 3300009545 Ga0105237_10000110 Ga0105237_1000011098 352
338 3300009545 Ga0105237_10326038 Ga0105237_103260382 352
339 3300009551 Ga0105238_10009029 Ga0105238_100090297 352
340 3300009551 Ga0105238_10227732 Ga0105238_102277322 352
341 3300009553 Ga0105249_10383316 Ga0105249_103833161 352
342 3300009553 Ga0105249_10387255 Ga0105249_103872551 352
343 3300010375 Ga0105239_10000552 Ga0105239_1000055252 352
344 3300010375 Ga0105239_10122883 Ga0105239_101228833 352
345 3300011119 Ga0105246_10025513 Ga0105246_100255132 352
346 3300013104 Ga0157370_10007573 Ga0157370_1000757311 352
347 3300013306 Ga0163162_10346060 Ga0163162_103460602 352
348 3300013307 Ga0157372_10010497 Ga0157372_100104978 352
349 3300014968 Ga0157379_10004730 Ga0157379_1000473011 352
350 3300014968 Ga0157379_10052024 Ga0157379_100520243 352
351 3300025297 Ga0209758_1051482 Ga0209758_10514822 352
352 3300025908 Ga0207643_10207571 Ga0207643_102075711 352
353 3300025909 Ga0207705_10003846 Ga0207705_100038465 352
354 3300025910 Ga0207684_10005362 Ga0207684_100053623 352
355 3300025911 Ga0207654_10016332 Ga0207654_100163322 352
356 3300025911 Ga0207654_10120237 Ga0207654_101202372 352
357 3300025912 Ga0207707_10166254 Ga0207707_101662542 352
358 3300025912 Ga0207707_10332096 Ga0207707_103320961 352
359 3300025914 Ga0207671_10020739 Ga0207671_100207394 352
360 3300025914 Ga0207671_10064118 Ga0207671_100641182 352
361 3300025919 Ga0207657_10040912 Ga0207657_100409123 352
362 3300025919 Ga0207657_10112775 Ga0207657_101127752 352
363 3300025922 Ga0207646_10005593 Ga0207646_100055935 352
364 3300025923 Ga0207681_10003375 Ga0207681_1000337510 352
365 3300025924 Ga0207694_10027701 Ga0207694_100277012 352
366 3300025925 Ga0207650_10239190 Ga0207650_102391901 352
367 3300025929 Ga0207664_10119514 Ga0207664_101195143 352
368 3300025935 Ga0207709_10175472 Ga0207709_101754722 352
369 3300025937 Ga0207669_10074426 Ga0207669_100744262 352
370 3300025938 Ga0207704_10121996 Ga0207704_101219961 352
371 3300025941 Ga0207711_10004369 Ga0207711_1000436911 352
372 3300025941 Ga0207711_10041091 Ga0207711_100410914 352
373 3300025942 Ga0207689_10034422 Ga0207689_100344224 352
374 3300025942 Ga0207689_10132655 Ga0207689_101326552 352
375 3300025949 Ga0207667_10117268 Ga0207667_101172682 352
376 3300025949 Ga0207667_10172994 Ga0207667_101729942 352
377 3300025972 Ga0207668_10001436 Ga0207668_1000143610 352
378 3300025986 Ga0207658_10084049 Ga0207658_100840492 352
379 3300025986 Ga0207658_10085883 Ga0207658_100858833 352
380 3300026023 Ga0207677_10052852 Ga0207677_100528523 352
381 3300026035 Ga0207703_10002787 Ga0207703_100027877 352
382 3300026035 Ga0207703_10306795 Ga0207703_103067952 352
383 3300026067 Ga0207678_10114197 Ga0207678_101141972 352
384 3300026088 Ga0207641_10003920 Ga0207641_1000392011 352
385 3300026089 Ga0207648_10220726 Ga0207648_102207262 352
386 3300026095 Ga0207676_10069241 Ga0207676_100692413 352
387 3300026121 Ga0207683_10038042 Ga0207683_100380422 352
388 3300028379 Ga0268266_10000753 Ga0268266_100007534 352
389 3300028379 Ga0268266_10004630 Ga0268266_100046309 352
390 3300028379 Ga0268266_10006566 Ga0268266_100065665 352
391 3300028381 Ga0268264_10134897 Ga0268264_101348971 352
392 3300028800 Ga0265338_10003763 Ga0265338_1000376312 352
393 3300031730 Ga0307516_10278264 Ga0307516_102782642 352
394 3300038443 Ga0395901_0147427 Ga0395901_0147427_626_1699 352
395 3300038443 Ga0395901_0409343 Ga0395901_0409343_175_1263 352
396 3300044712 Ga0453684_0000015 Ga0453684_0000015_443900_444964 352
397 3300044712 Ga0453684_0000020 Ga0453684_0000020_464556_465620 352
398 3300048906 Ga0496103_0225630 Ga0496103_0225630_99_1178 352
399 3300048907 Ga0496104_0145826 Ga0496104_0145826_199_1278 352
400 3300048908 Ga0496105_0028575 Ga0496105_0028575_1709_2788 352
401 3300048911 Ga0496108_0174484 Ga0496108_0174484_358_1437 352
402 3300048912 Ga0496109_0366271 Ga0496109_0366271_237_1316 352
403 3300048913 Ga0496110_0122141 Ga0496110_0122141_780_1859 352
404 3300048914 Ga0496111_0099208 Ga0496111_0099208_211_1290 352
405 3300048916 Ga0496113_0096975 Ga0496113_0096975_196_1275 352
406 3300049570 Ga0501033_0000590 Ga0501033_0000590_28284_29342 352
407 3300049571 Ga0501034_0000076 Ga0501034_0000076_4590_5663 352
408 3300049571 Ga0501034_0376913 Ga0501034_0376913_247_1308 352
409 3300049571 Ga0501034_0401557 Ga0501034_0401557_139_1212 352
410 3300049572 Ga0501036_0211551 Ga0501036_0211551_494_1552 352
411 3300049573 Ga0501037_0010911 Ga0501037_0010911_5183_6256 352
412 3300049575 Ga0501039_0136096 Ga0501039_0136096_811_1884 352
413 3300049579 Ga0501043_0052081 Ga0501043_0052081_1536_2594 352
414 3300049581 Ga0501047_0014216 Ga0501047_0014216_5300_6373 352
415 3300049581 Ga0501047_0088578 Ga0501047_0088578_389_1447 352
416 3300049582 Ga0501048_0014790 Ga0501048_0014790_1823_2896 352
417 3300049586 Ga0501070_0094918 Ga0501070_0094918_991_2064 352
418 3300049742 Ga0501080_0000004 Ga0501080_0000004_5968_7041 352
419 3300049743 Ga0501081_0075408 Ga0501081_0075408_541_1614 352
420 3300049822 Ga0501035_0000191 Ga0501035_0000191_69923_70996 352
421 3300049823 Ga0501044_0000227 Ga0501044_0000227_5219_6292 352
422 3300049823 Ga0501044_0004541 Ga0501044_0004541_8159_9217 352
423 3300053140 Ga0500573_0000003 Ga0500573_0000003_217692_218750 352
424 3300053730 Ga0500645_010068 Ga0500645_010068_666_1724 352
425 3300060353 Ga0501082_0029242 Ga0501082_0029242_1927_3000 352
426 3300005366 Ga0070659_100187211 Ga0070659_1001872111 353
427 3300005548 Ga0070665_100051472 Ga0070665_1000514724 353
428 3300005841 Ga0068863_100054034 Ga0068863_1000540343 353
429 3300005842 Ga0068858_100141044 Ga0068858_1001410442 353
430 3300005937 Ga0081455_10011948 Ga0081455_100119484 353
431 3300005983 Ga0081540_1000353 Ga0081540_10003537 353
432 3300005983 Ga0081540_1009106 Ga0081540_10091064 353
433 3300005983 Ga0081540_1023238 Ga0081540_10232383 353
434 3300005985 Ga0081539_10001561 Ga0081539_1000156127 353
435 3300005985 Ga0081539_10026626 Ga0081539_100266263 353
436 3300006195 Ga0075366_10114547 Ga0075366_101145472 353
437 3300007076 Ga0075435_100071665 Ga0075435_1000716652 353
438 3300021361 Ga0213872_10012123 Ga0213872_100121233 353
439 3300025297 Ga0209758_1050777 Ga0209758_10507771 353
440 3300025904 Ga0207647_10101551 Ga0207647_101015512 353
441 3300025914 Ga0207671_10052904 Ga0207671_100529042 353
442 3300025918 Ga0207662_10022826 Ga0207662_100228262 353
443 3300025940 Ga0207691_10188391 Ga0207691_101883912 353
444 3300028379 Ga0268266_10034991 Ga0268266_100349913 353
445 3300028379 Ga0268266_10209867 Ga0268266_102098672 353
446 3300028380 Ga0268265_10353526 Ga0268265_103535261 353
447 3300031824 Ga0307413_10045378 Ga0307413_100453782 353
448 3300032005 Ga0307411_10050896 Ga0307411_100508963 353
449 3300039447 Ga0436361_0530867 Ga0436361_0530867_4387_5484 353
450 3300039447 Ga0436361_0722566 Ga0436361_0722566_3120_4220 353
451 3300046457 Ga0495590_0015942 Ga0495590_0015942_814_1896 353
452 3300046492 Ga0495585_0039034 Ga0495585_0039034_918_2000 353
453 3300046519 Ga0495632_0011028 Ga0495632_0011028_2661_3743 353
454 3300046660 Ga0495625_0065166 Ga0495625_0065166_760_1842 353
455 3300046684 Ga0495669_0081029 Ga0495669_0081029_19_1101 353
456 3300046692 Ga0495671_0027080 Ga0495671_0027080_748_1830 353
457 3300046692 Ga0495671_0064012 Ga0495671_0064012_677_1759 353
458 3300047323 Ga0495683_0055034 Ga0495683_0055034_723_1805 353
459 3300048912 Ga0496109_0247428 Ga0496109_0247428_567_1649 353
460 3300050493 nmdc:mga0k408_42943_c1 nmdc:mga0k408_42943_c1_1009_2091 353
461 3300050494 nmdc:mga06z11_205046_c1 nmdc:mga06z11_205046_c1_52_1134 353
462 3300050496 nmdc:mga07m45_33634_c1 nmdc:mga07m45_33634_c1_452_1534 353
463 3300053151 Ga0500604_0002821 Ga0500604_0002821_3261_4346 353
464 iso_pu_bacteria 2889033259 2889042115 353
465 iso_pu_bacteria 8006984368 8006992190 353
466 3300001904 JGI24736J21556_1011716 JGI24736J21556_10117161 354
467 3300001990 JGI24737J22298_10005764 JGI24737J22298_100057643 354
468 3300002067 JGI24735J21928_10010572 JGI24735J21928_100105721 354
469 3300003203 JGI25406J46586_10000014 JGI25406J46586_100000148 354
470 3300003215 JGI25153J46596_10000127 JGI25153J46596_100001275 354
471 3300003215 JGI25153J46596_10000168 JGI25153J46596_1000016845 354
472 3300003215 JGI25153J46596_10000247 JGI25153J46596_1000024715 354
473 3300003215 JGI25153J46596_10011513 JGI25153J46596_100115132 354
474 3300003354 JGI25160J50197_1000411 JGI25160J50197_100041122 354
475 3300003354 JGI25160J50197_1001248 JGI25160J50197_10012482 354
476 3300003794 Ga0055531_10005857 Ga0055531_100058572 354
477 3300004625 Ga0055543_1001498 Ga0055543_10014987 354
478 3300004625 Ga0055543_1003748 Ga0055543_10037481 354
479 3300005262 Ga0065165_1000134 Ga0065165_100013452 354
480 3300005262 Ga0065165_1000664 Ga0065165_100066435 354
481 3300005262 Ga0065165_1000976 Ga0065165_100097624 354
482 3300005262 Ga0065165_1003936 Ga0065165_10039364 354
483 3300005262 Ga0065165_1005285 Ga0065165_10052854 354
484 3300005329 Ga0070683_100047943 Ga0070683_1000479434 354
485 3300005336 Ga0070680_100082137 Ga0070680_1000821372 354
486 3300005347 Ga0070668_100128901 Ga0070668_1001289012 354
487 3300005355 Ga0070671_100239408 Ga0070671_1002394082 354
488 3300005367 Ga0070667_100019485 Ga0070667_1000194853 354
489 3300005434 Ga0070709_10007842 Ga0070709_100078426 354
490 3300005434 Ga0070709_10011973 Ga0070709_100119734 354
491 3300005434 Ga0070709_10033440 Ga0070709_100334402 354
492 3300005434 Ga0070709_10041881 Ga0070709_100418813 354
493 3300005435 Ga0070714_100022799 Ga0070714_1000227993 354
494 3300005436 Ga0070713_100003900 Ga0070713_1000039003 354
495 3300005436 Ga0070713_100016156 Ga0070713_1000161562 354
496 3300005436 Ga0070713_100128758 Ga0070713_1001287582 354
497 3300005437 Ga0070710_10006621 Ga0070710_100066214 354
498 3300005437 Ga0070710_10041028 Ga0070710_100410282 354
499 3300005439 Ga0070711_100016347 Ga0070711_1000163473 354
500 3300005439 Ga0070711_100031629 Ga0070711_1000316293 354
501 3300005455 Ga0070663_100035066 Ga0070663_1000350663 354
502 3300005530 Ga0070679_100014351 Ga0070679_1000143512 354
503 3300005530 Ga0070679_100019705 Ga0070679_1000197053 354
504 3300005535 Ga0070684_100018169 Ga0070684_1000181695 354
505 3300005535 Ga0070684_100064413 Ga0070684_1000644132 354
506 3300005539 Ga0068853_100089356 Ga0068853_1000893562 354
507 3300005539 Ga0068853_100094702 Ga0068853_1000947024 354
508 3300005539 Ga0068853_100171598 Ga0068853_1001715982 354
509 3300005543 Ga0070672_100268238 Ga0070672_1002682382 354
510 3300005548 Ga0070665_100004109 Ga0070665_10000410911 354
511 3300005563 Ga0068855_100085960 Ga0068855_1000859603 354
512 3300005563 Ga0068855_100191931 Ga0068855_1001919312 354
513 3300005577 Ga0068857_100003812 Ga0068857_1000038124 354
514 3300005577 Ga0068857_100010456 Ga0068857_1000104567 354
515 3300005577 Ga0068857_100252907 Ga0068857_1002529071 354
516 3300005578 Ga0068854_100027274 Ga0068854_1000272743 354
517 3300005614 Ga0068856_100039969 Ga0068856_1000399692 354
518 3300005614 Ga0068856_100115733 Ga0068856_1001157332 354
519 3300005614 Ga0068856_100137315 Ga0068856_1001373152 354
520 3300005614 Ga0068856_100393435 Ga0068856_1003934351 354
521 3300005616 Ga0068852_100004160 Ga0068852_1000041602 354
522 3300005616 Ga0068852_100007043 Ga0068852_1000070433 354
523 3300005618 Ga0068864_100247880 Ga0068864_1002478801 354
524 3300005834 Ga0068851_10001214 Ga0068851_100012142 354
525 3300005834 Ga0068851_10014266 Ga0068851_100142662 354
526 3300005840 Ga0068870_10067631 Ga0068870_100676312 354
527 3300005841 Ga0068863_100014635 Ga0068863_1000146353 354
528 3300005842 Ga0068858_100341322 Ga0068858_1003413222 354
529 3300005843 Ga0068860_100000409 Ga0068860_1000004093 354
530 3300005844 Ga0068862_100120445 Ga0068862_1001204452 354
531 3300005937 Ga0081455_10004847 Ga0081455_1000484712 354
532 3300005937 Ga0081455_10066157 Ga0081455_100661571 354
533 3300005983 Ga0081540_1001385 Ga0081540_10013858 354
534 3300005983 Ga0081540_1017917 Ga0081540_10179175 354
535 3300005985 Ga0081539_10000008 Ga0081539_10000008150 354
536 3300006028 Ga0070717_10006203 Ga0070717_100062034 354
537 3300006028 Ga0070717_10040726 Ga0070717_100407263 354
538 3300006028 Ga0070717_10172669 Ga0070717_101726692 354
539 3300006038 Ga0075365_10170202 Ga0075365_101702022 354
540 3300006042 Ga0075368_10024318 Ga0075368_100243182 354
541 3300006042 Ga0075368_10071452 Ga0075368_100714521 354
542 3300006173 Ga0070716_100004406 Ga0070716_1000044062 354
543 3300006173 Ga0070716_100083383 Ga0070716_1000833831 354
544 3300006175 Ga0070712_100012336 Ga0070712_1000123364 354
545 3300006177 Ga0075362_10116894 Ga0075362_101168942 354
546 3300006178 Ga0075367_10018774 Ga0075367_100187743 354
547 3300006195 Ga0075366_10005853 Ga0075366_100058535 354
548 3300006237 Ga0097621_100238325 Ga0097621_1002383252 354
549 3300006941 Ga0099825_1028685 Ga0099825_10286852 354
550 3300009093 Ga0105240_10022611 Ga0105240_100226112 354
551 3300009093 Ga0105240_10028339 Ga0105240_100283396 354
552 3300009093 Ga0105240_10081017 Ga0105240_100810172 354
553 3300009093 Ga0105240_10090942 Ga0105240_100909423 354
554 3300009098 Ga0105245_10308093 Ga0105245_103080932 354
555 3300009101 Ga0105247_10043573 Ga0105247_100435732 354
556 3300009174 Ga0105241_10004255 Ga0105241_100042552 354
557 3300009177 Ga0105248_10006945 Ga0105248_100069451 354
558 3300009545 Ga0105237_10004743 Ga0105237_1000474314 354
559 3300009545 Ga0105237_10031433 Ga0105237_100314336 354
560 3300009551 Ga0105238_10002076 Ga0105238_100020762 354
561 3300009551 Ga0105238_10010980 Ga0105238_100109806 354
562 3300009551 Ga0105238_10011639 Ga0105238_100116397 354
563 3300009551 Ga0105238_10193262 Ga0105238_101932622 354
564 3300010375 Ga0105239_10013891 Ga0105239_100138918 354
565 3300010375 Ga0105239_10016664 Ga0105239_100166643 354
566 3300010375 Ga0105239_10036477 Ga0105239_100364773 354
567 3300010375 Ga0105239_10043844 Ga0105239_100438442 354
568 3300010375 Ga0105239_10064956 Ga0105239_100649562 354
569 3300013104 Ga0157370_10018659 Ga0157370_100186594 354
570 3300013104 Ga0157370_10024085 Ga0157370_100240852 354
571 3300013105 Ga0157369_10066040 Ga0157369_100660404 354
572 3300013105 Ga0157369_10108377 Ga0157369_101083773 354
573 3300013296 Ga0157374_10112901 Ga0157374_101129013 354
574 3300013308 Ga0157375_10261647 Ga0157375_102616471 354
575 3300014325 Ga0163163_10016527 Ga0163163_100165274 354
576 3300014968 Ga0157379_10035381 Ga0157379_100353812 354
577 3300021320 Ga0214544_1000005 Ga0214544_1000005226 354
578 3300021321 Ga0214542_1000004 Ga0214542_1000004230 354
579 3300021324 Ga0214545_1000005 Ga0214545_1000005165 354
580 3300021327 Ga0214543_1000030 Ga0214543_100003019 354
581 3300021384 Ga0213876_10003009 Ga0213876_100030097 354
582 3300021384 Ga0213876_10077260 Ga0213876_100772602 354
583 3300025245 Ga0207425_1001246 Ga0207425_100124610 354
584 3300025245 Ga0207425_1003832 Ga0207425_10038321 354
585 3300025254 Ga0209148_1000239 Ga0209148_100023937 354
586 3300025261 Ga0209233_1000855 Ga0209233_100085511 354
587 3300025261 Ga0209233_1011291 Ga0209233_10112913 354
588 3300025261 Ga0209233_1013934 Ga0209233_10139342 354
589 3300025272 Ga0209455_1002439 Ga0209455_10024393 354
590 3300025295 Ga0209564_1002361 Ga0209564_10023613 354
591 3300025295 Ga0209564_1010509 Ga0209564_10105092 354
592 3300025297 Ga0209758_1000075 Ga0209758_1000075164 354
593 3300025297 Ga0209758_1000187 Ga0209758_100018787 354
594 3300025297 Ga0209758_1000611 Ga0209758_10006116 354
595 3300025297 Ga0209758_1003883 Ga0209758_100388312 354
596 3300025302 Ga0207426_1000138 Ga0207426_1000138162 354
597 3300025302 Ga0207426_1000160 Ga0207426_1000160118 354
598 3300025302 Ga0207426_1000375 Ga0207426_100037525 354
599 3300025302 Ga0207426_1002253 Ga0207426_10022531 354
600 3300025302 Ga0207426_1002824 Ga0207426_10028247 354
601 3300025302 Ga0207426_1015016 Ga0207426_10150163 354
602 3300025302 Ga0207426_1034907 Ga0207426_10349071 354
603 3300025304 Ga0209257_1000652 Ga0209257_10006526 354
604 3300025315 Ga0207697_10026850 Ga0207697_100268503 354
605 3300025321 Ga0207656_10008380 Ga0207656_100083802 354
606 3300025898 Ga0207692_10027888 Ga0207692_100278882 354
607 3300025903 Ga0207680_10073038 Ga0207680_100730382 354
608 3300025904 Ga0207647_10000985 Ga0207647_1000098511 354
609 3300025905 Ga0207685_10004384 Ga0207685_100043842 354
610 3300025906 Ga0207699_10001145 Ga0207699_100011456 354
611 3300025906 Ga0207699_10037144 Ga0207699_100371442 354
612 3300025911 Ga0207654_10000136 Ga0207654_100001367 354
613 3300025911 Ga0207654_10010748 Ga0207654_100107483 354
614 3300025913 Ga0207695_10002311 Ga0207695_1000231113 354
615 3300025913 Ga0207695_10011572 Ga0207695_100115722 354
616 3300025913 Ga0207695_10318913 Ga0207695_103189131 354
617 3300025914 Ga0207671_10007380 Ga0207671_100073809 354
618 3300025914 Ga0207671_10128058 Ga0207671_101280582 354
619 3300025914 Ga0207671_10231136 Ga0207671_102311361 354
620 3300025915 Ga0207693_10001764 Ga0207693_1000176414 354
621 3300025915 Ga0207693_10046474 Ga0207693_100464742 354
622 3300025915 Ga0207693_10060693 Ga0207693_100606933 354
623 3300025916 Ga0207663_10006336 Ga0207663_100063364 354
624 3300025916 Ga0207663_10022943 Ga0207663_100229434 354
625 3300025917 Ga0207660_10025057 Ga0207660_100250571 354
626 3300025921 Ga0207652_10055811 Ga0207652_100558113 354
627 3300025921 Ga0207652_10180441 Ga0207652_101804412 354
628 3300025924 Ga0207694_10000135 Ga0207694_1000013520 354
629 3300025924 Ga0207694_10014853 Ga0207694_100148531 354
630 3300025924 Ga0207694_10079235 Ga0207694_100792352 354
631 3300025925 Ga0207650_10088589 Ga0207650_100885892 354
632 3300025926 Ga0207659_10112415 Ga0207659_101124152 354
633 3300025928 Ga0207700_10024668 Ga0207700_100246684 354
634 3300025928 Ga0207700_10281927 Ga0207700_102819272 354
635 3300025933 Ga0207706_10087080 Ga0207706_100870802 354
636 3300025939 Ga0207665_10004976 Ga0207665_100049767 354
637 3300025939 Ga0207665_10012045 Ga0207665_100120453 354
638 3300025939 Ga0207665_10052651 Ga0207665_100526512 354
639 3300025941 Ga0207711_10175558 Ga0207711_101755581 354
640 3300025941 Ga0207711_10303840 Ga0207711_103038401 354
641 3300025942 Ga0207689_10218714 Ga0207689_102187141 354
642 3300025944 Ga0207661_10020327 Ga0207661_100203272 354
643 3300025944 Ga0207661_10166684 Ga0207661_101666842 354
644 3300025944 Ga0207661_10224847 Ga0207661_102248472 354
645 3300025945 Ga0207679_10196813 Ga0207679_101968132 354
646 3300025949 Ga0207667_10018495 Ga0207667_100184957 354
647 3300025949 Ga0207667_10092955 Ga0207667_100929552 354
648 3300025972 Ga0207668_10186219 Ga0207668_101862192 354
649 3300025981 Ga0207640_10003325 Ga0207640_100033259 354
650 3300026041 Ga0207639_10050318 Ga0207639_100503182 354
651 3300026041 Ga0207639_10052367 Ga0207639_100523672 354
652 3300026041 Ga0207639_10078554 Ga0207639_100785543 354
653 3300026041 Ga0207639_10184216 Ga0207639_101842162 354
654 3300026078 Ga0207702_10000026 Ga0207702_10000026124 354
655 3300026078 Ga0207702_10013080 Ga0207702_100130802 354
656 3300026078 Ga0207702_10036603 Ga0207702_100366033 354
657 3300026078 Ga0207702_10143451 Ga0207702_101434512 354
658 3300026078 Ga0207702_10433508 Ga0207702_104335081 354
659 3300026088 Ga0207641_10229803 Ga0207641_102298031 354
660 3300026116 Ga0207674_10007361 Ga0207674_1000736111 354
661 3300026116 Ga0207674_10013128 Ga0207674_100131284 354
662 3300026116 Ga0207674_10016608 Ga0207674_100166082 354
663 3300026118 Ga0207675_100144548 Ga0207675_1001445482 354
664 3300026142 Ga0207698_10019685 Ga0207698_100196851 354
665 3300026142 Ga0207698_10026970 Ga0207698_100269702 354
666 3300027296 Ga0209389_1000073 Ga0209389_100007364 354
667 3300027296 Ga0209389_1000499 Ga0209389_10004999 354
668 3300027296 Ga0209389_1022906 Ga0209389_10229063 354
669 3300027357 Ga0209589_1000109 Ga0209589_10001097 354
670 3300027357 Ga0209589_1010873 Ga0209589_10108732 354
671 3300027357 Ga0209589_1022228 Ga0209589_10222283 354
672 3300027361 Ga0209489_100324 Ga0209489_1003247 354
673 3300027361 Ga0209489_102828 Ga0209489_10282828 354
674 3300027361 Ga0209489_103645 Ga0209489_10364520 354
675 3300027363 Ga0209700_100020 Ga0209700_100020205 354
676 3300027363 Ga0209700_100067 Ga0209700_10006764 354
677 3300027363 Ga0209700_100355 Ga0209700_1003557 354
678 3300027866 Ga0209813_10035300 Ga0209813_100353002 354
679 3300027866 Ga0209813_10055054 Ga0209813_100550542 354
680 3300028379 Ga0268266_10005789 Ga0268266_1000578911 354
681 3300028379 Ga0268266_10078465 Ga0268266_100784653 354
682 3300028379 Ga0268266_10408797 Ga0268266_104087972 354
683 3300028380 Ga0268265_10021152 Ga0268265_100211522 354
684 3300028380 Ga0268265_10279408 Ga0268265_102794082 354
685 3300028381 Ga0268264_10000020 Ga0268264_1000002015 354
686 3300028794 Ga0307515_10035428 Ga0307515_100354285 354
687 3300028794 Ga0307515_10202499 Ga0307515_102024992 354
688 3300031249 Ga0265339_10004949 Ga0265339_100049492 354
689 3300031456 Ga0307513_10101376 Ga0307513_101013763 354
690 3300031456 Ga0307513_10138748 Ga0307513_101387481 354
691 3300031507 Ga0307509_10110283 Ga0307509_101102833 354
692 3300031616 Ga0307508_10079818 Ga0307508_100798183 354
693 3300031730 Ga0307516_10095609 Ga0307516_100956092 354
694 3300032126 Ga0307415_100211728 Ga0307415_1002117281 354
695 3300033180 Ga0307510_10005921 Ga0307510_100059211 354
696 3300033180 Ga0307510_10020259 Ga0307510_100202597 354
697 3300033180 Ga0307510_10037404 Ga0307510_100374041 354
698 3300033180 Ga0307510_10045259 Ga0307510_100452594 354
699 3300033180 Ga0307510_10096754 Ga0307510_100967542 354
700 3300035111 Ga0373923_0029849 Ga0373923_0029849_269_1354 354
701 3300035113 Ga0373936_0029461 Ga0373936_0029461_925_2010 354
702 3300035116 Ga0373945_0024596 Ga0373945_0024596_790_1875 354
703 3300035695 Ga0373927_0006364 Ga0373927_0006364_2311_3396 354
704 3300035695 Ga0373927_0187066 Ga0373927_0187066_135_1220 354
705 3300035724 Ga0373933_0000631 Ga0373933_0000631_7105_8190 354
706 3300035725 Ga0373947_0042928 Ga0373947_0042928_392_1477 354
707 3300036401 Ga0373937_0092287 Ga0373937_0092287_335_1420 354
708 3300037068 Ga0373925_0015322 Ga0373925_0015322_1231_2316 354
709 3300037068 Ga0373925_0041371 Ga0373925_0041371_1518_2603 354
710 3300037068 Ga0373925_0096883 Ga0373925_0096883_1046_2134 354
711 3300037068 Ga0373925_0232545 Ga0373925_0232545_298_1383 354
712 3300037466 Ga0395898_0010290 Ga0395898_0010290_415_1503 354
713 3300037853 Ga0436364_1398367 Ga0436364_1398367_1845_2930 354
714 3300038443 Ga0395901_0385094 Ga0395901_0385094_75_1160 354
715 3300039437 Ga0436365_0260840 Ga0436365_0260840_17048_18136 354
716 3300039437 Ga0436365_1937261 Ga0436365_1937261_1005_2093 354
717 3300039438 Ga0436360_0043776 Ga0436360_0043776_359_1444 354
718 3300039438 Ga0436360_1037574 Ga0436360_1037574_1757_2842 354
719 3300039450 Ga0436363_0266154 Ga0436363_0266154_341_1426 354
720 3300039453 Ga0436362_0276427 Ga0436362_0276427_1512_2597 354
721 3300044656 Ga0466969_0067574 Ga0466969_0067574_196_1266 354
722 3300044658 Ga0466972_0006316 Ga0466972_0006316_2694_3764 354
723 3300044658 Ga0466972_0049620 Ga0466972_0049620_837_1907 354
724 3300044684 Ga0466966_0027865 Ga0466966_0027865_312_1382 354
725 3300044693 Ga0466961_0000650 Ga0466961_0000650_3021_4091 354
726 3300044693 Ga0466961_0082998 Ga0466961_0082998_323_1408 354
727 3300044712 Ga0453684_0000189 Ga0453684_0000189_183893_184984 354
728 3300044735 Ga0466968_0014484 Ga0466968_0014484_1037_2107 354
729 3300044901 Ga0466960_0076811 Ga0466960_0076811_348_1418 354
730 3300045049 Ga0466959_0029074 Ga0466959_0029074_2919_3989 354
731 3300045051 Ga0451576_0082586 Ga0451576_0082586_54_1148 354
732 3300045976 Ga0466967_0107400 Ga0466967_0107400_975_2057 354
733 3300045976 Ga0466967_0109755 Ga0466967_0109755_797_1882 354
734 3300046459 Ga0495629_0021757 Ga0495629_0021757_933_2003 354
735 3300046459 Ga0495629_0060639 Ga0495629_0060639_697_1782 354
736 3300046459 Ga0495629_0162149 Ga0495629_0162149_338_1423 354
737 3300046460 Ga0495638_0002608 Ga0495638_0002608_2918_3988 354
738 3300046460 Ga0495638_0176896 Ga0495638_0176896_16_1101 354
739 3300046462 Ga0495651_0040589 Ga0495651_0040589_1252_2337 354
740 3300046462 Ga0495651_0149874 Ga0495651_0149874_159_1244 354
741 3300046472 Ga0495580_0027757 Ga0495580_0027757_1912_2997 354
742 3300046476 Ga0495662_0118781 Ga0495662_0118781_135_1220 354
743 3300046477 Ga0495664_0178979 Ga0495664_0178979_50_1135 354
744 3300046501 Ga0495607_0089407 Ga0495607_0089407_577_1647 354
745 3300046507 Ga0495606_0063710 Ga0495606_0063710_211_1281 354
746 3300046514 Ga0495618_0067517 Ga0495618_0067517_907_1977 354
747 3300046522 Ga0495643_0040821 Ga0495643_0040821_1185_2255 354
748 3300046524 Ga0495648_0040512 Ga0495648_0040512_1514_2584 354
749 3300046533 Ga0495640_0008550 Ga0495640_0008550_2598_3668 354
750 3300046533 Ga0495640_0072701 Ga0495640_0072701_340_1425 354
751 3300046535 Ga0495586_0022557 Ga0495586_0022557_1876_2961 354
752 3300046536 Ga0495587_0018343 Ga0495587_0018343_1405_2490 354
753 3300046542 Ga0495597_0069534 Ga0495597_0069534_116_1186 354
754 3300046616 Ga0495668_0085005 Ga0495668_0085005_97_1167 354
755 3300046642 Ga0495634_0046164 Ga0495634_0046164_1098_2168 354
756 3300046660 Ga0495625_0117708 Ga0495625_0117708_20_1090 354
757 3300046663 Ga0495635_0002250 Ga0495635_0002250_10082_11152 354
758 3300046663 Ga0495635_0235717 Ga0495635_0235717_78_1163 354
759 3300046675 Ga0495657_0005609 Ga0495657_0005609_4475_5545 354
760 3300046683 Ga0495658_0030781 Ga0495658_0030781_1229_2314 354
761 3300046689 Ga0495613_0046879 Ga0495613_0046879_1112_2182 354
762 3300046694 Ga0495649_0055835 Ga0495649_0055835_681_1751 354
763 3300047315 Ga0495581_0028632 Ga0495581_0028632_299_1369 354
764 3300047317 Ga0495604_0039547 Ga0495604_0039547_68_1138 354
765 3300047317 Ga0495604_0156580 Ga0495604_0156580_53_1138 354
766 3300047320 Ga0495672_0007893 Ga0495672_0007893_5379_6464 354
767 3300047321 Ga0495676_0014528 Ga0495676_0014528_4591_5661 354
768 3300047322 Ga0495680_0047336 Ga0495680_0047336_82_1167 354
769 3300047323 Ga0495683_0073936 Ga0495683_0073936_120_1190 354
770 3300047443 Ga0495687_002707 Ga0495687_002707_1284_2354 354
771 3300047471 Ga0495684_0031594 Ga0495684_0031594_205_1290 354
772 3300047471 Ga0495684_0090398 Ga0495684_0090398_972_2057 354
773 3300047472 Ga0495686_0179441 Ga0495686_0179441_20_1105 354
774 3300047673 Ga0495593_0060777 Ga0495593_0060777_346_1431 354
775 3300048088 Ga0495602_0119845 Ga0495602_0119845_460_1530 354
776 3300048903 Ga0496100_0200756 Ga0496100_0200756_172_1242 354
777 3300048904 Ga0496101_0310336 Ga0496101_0310336_58_1128 354
778 3300048905 Ga0496102_0226549 Ga0496102_0226549_497_1567 354
779 3300048905 Ga0496102_0362803 Ga0496102_0362803_187_1272 354
780 3300048906 Ga0496103_0118490 Ga0496103_0118490_383_1453 354
781 3300048907 Ga0496104_0001100 Ga0496104_0001100_16807_17877 354
782 3300048907 Ga0496104_0019891 Ga0496104_0019891_4080_5165 354
783 3300048907 Ga0496104_0054854 Ga0496104_0054854_2169_3239 354
784 3300048908 Ga0496105_0001328 Ga0496105_0001328_4086_5156 354
785 3300048908 Ga0496105_0340748 Ga0496105_0340748_49_1134 354
786 3300048909 Ga0496106_0000790 Ga0496106_0000790_17656_18741 354
787 3300048912 Ga0496109_0020657 Ga0496109_0020657_1217_2302 354
788 3300048912 Ga0496109_0174024 Ga0496109_0174024_698_1768 354
789 3300048913 Ga0496110_0018064 Ga0496110_0018064_3805_4890 354
790 3300048913 Ga0496110_0247899 Ga0496110_0247899_311_1381 354
791 3300048915 Ga0496112_0022886 Ga0496112_0022886_1169_2254 354
792 3300048915 Ga0496112_0147312 Ga0496112_0147312_1072_2142 354
793 3300048916 Ga0496113_0013688 Ga0496113_0013688_3446_4531 354
794 3300048918 Ga0496115_0081514 Ga0496115_0081514_545_1630 354
795 3300048920 Ga0496117_0064200 Ga0496117_0064200_41_1111 354
796 3300048920 Ga0496117_0088948 Ga0496117_0088948_76_1161 354
797 3300048920 Ga0496117_0100016 Ga0496117_0100016_288_1373 354
798 3300048920 Ga0496117_0193540 Ga0496117_0193540_64_1134 354
799 3300048921 Ga0496118_0058896 Ga0496118_0058896_1215_2300 354
800 3300048921 Ga0496118_0072504 Ga0496118_0072504_512_1582 354
801 3300048922 Ga0496119_0002808 Ga0496119_0002808_5354_6424 354
802 3300048922 Ga0496119_0136104 Ga0496119_0136104_170_1255 354
803 3300048923 Ga0496120_0003504 Ga0496120_0003504_1347_2417 354
804 3300048924 Ga0496121_0001681 Ga0496121_0001681_28776_29861 354
805 3300048924 Ga0496121_0003198 Ga0496121_0003198_4214_5299 354
806 3300048924 Ga0496121_0039756 Ga0496121_0039756_1776_2846 354
807 3300048925 Ga0496122_0012846 Ga0496122_0012846_4797_5882 354
808 3300048927 Ga0496124_0002423 Ga0496124_0002423_4125_5210 354
809 3300048928 Ga0496125_0048054 Ga0496125_0048054_2311_3381 354
810 3300048929 Ga0496126_0018165 Ga0496126_0018165_4737_5825 354
811 3300048929 Ga0496126_0039823 Ga0496126_0039823_2301_3386 354
812 3300048929 Ga0496126_0094472 Ga0496126_0094472_68_1138 354
813 3300048929 Ga0496126_0127584 Ga0496126_0127584_79_1164 354
814 3300048929 Ga0496126_0196048 Ga0496126_0196048_553_1638 354
815 3300049460 Ga0495682_0036994 Ga0495682_0036994_419_1489 354
816 3300049581 Ga0501047_0022387 Ga0501047_0022387_4939_6024 354
817 3300049589 Ga0501073_0025069 Ga0501073_0025069_392_1477 354
818 3300049823 Ga0501044_0256981 Ga0501044_0256981_562_1644 354
819 3300050492 nmdc:mga0yw44_170290_c1 nmdc:mga0yw44_170290_c1_33_1103 354
820 3300050492 nmdc:mga0yw44_181974_c1 nmdc:mga0yw44_181974_c1_296_1366 354
821 3300050492 nmdc:mga0yw44_72652_c1 nmdc:mga0yw44_72652_c1_69_1139 354
822 3300050493 nmdc:mga0k408_82863_c1 nmdc:mga0k408_82863_c1_485_1555 354
823 3300050494 nmdc:mga06z11_24442_c1 nmdc:mga06z11_24442_c1_1490_2575 354
824 3300050494 nmdc:mga06z11_38395_c1 nmdc:mga06z11_38395_c1_1231_2316 354
825 3300050495 nmdc:mga04h51_65800_c1 nmdc:mga04h51_65800_c1_120_1205 354
826 3300050513 nmdc:mga0rr50_170102_c1 nmdc:mga0rr50_170102_c1_238_1395 354
827 3300050516 nmdc:mga0sz30_18837_c1 nmdc:mga0sz30_18837_c1_253_1323 354
828 3300053087 Ga0500643_001125 Ga0500643_001125_9663_10748 354
829 3300053090 Ga0500646_0025209 Ga0500646_0025209_401_1471 354
830 3300053093 Ga0500651_0013310 Ga0500651_0013310_779_1849 354
831 3300053094 Ga0500566_0000232 Ga0500566_0000232_19692_20777 354
832 3300053095 Ga0500640_023559 Ga0500640_023559_760_1830 354
833 3300053103 Ga0500555_011850 Ga0500555_011850_935_2020 354
834 3300053105 Ga0500557_000036 Ga0500557_000036_1218_2288 354
835 3300053108 Ga0500562_015703 Ga0500562_015703_554_1624 354
836 3300053111 Ga0500572_004823 Ga0500572_004823_384_1454 354
837 3300053119 Ga0500595_000218 Ga0500595_000218_26469_27554 354
838 3300053121 Ga0500607_093658 Ga0500607_093658_203_1288 354
839 3300053130 Ga0500642_0000122 Ga0500642_0000122_1853_2923 354
840 3300053130 Ga0500642_0001048 Ga0500642_0001048_5476_6561 354
841 3300053133 Ga0500655_009118 Ga0500655_009118_701_1771 354
842 3300053134 Ga0500658_0032893 Ga0500658_0032893_339_1424 354
843 3300053145 Ga0500586_000362 Ga0500586_000362_6774_7859 354
844 3300053148 Ga0500590_062055 Ga0500590_062055_465_1580 354
845 3300053150 Ga0500603_001454 Ga0500603_001454_3469_4554 354
846 3300053153 Ga0500616_0020064 Ga0500616_0020064_1451_2521 354
847 3300053156 Ga0500622_0012277 Ga0500622_0012277_3343_4428 354
848 3300053159 Ga0500630_012678 Ga0500630_012678_587_1672 354
849 3300053162 Ga0500638_000841 Ga0500638_000841_2593_3678 354
850 3300053162 Ga0500638_070655 Ga0500638_070655_117_1187 354
851 3300053163 Ga0500639_027833 Ga0500639_027833_1516_2601 354
852 3300053177 Ga0500636_0044126 Ga0500636_0044126_185_1270 354
853 3300053178 Ga0500637_0120120 Ga0500637_0120120_46_1134 354
854 3300053735 Ga0500596_000723 Ga0500596_000723_2324_3412 354
855 3300053735 Ga0500596_004089 Ga0500596_004089_860_1945 354
856 iso_pu_bacteria 2507262055 2507506583 354
857 iso_pu_bacteria 2508501009 2508540433 354
858 iso_pu_bacteria 2508501042 2508693540 354
859 iso_pu_bacteria 2508501042 2508696467 354
860 iso_pu_bacteria 2513237095 2513648662 354
861 iso_pu_bacteria 2513237095 2513652212 354
862 iso_pu_bacteria 2513237098 2513674773 354
863 iso_pu_bacteria 2513237101 2513698332 354
864 iso_pu_bacteria 2513237139 2513879883 354
865 iso_pu_bacteria 2513237141 2513893859 354
866 iso_pu_bacteria 2513237145 2513921336 354
867 iso_pu_bacteria 2513237145 2513923408 354
868 iso_pu_bacteria 2513237161 2514013168 354
869 iso_pu_bacteria 2515154112 2515629371 354
870 iso_pu_bacteria 2517093001 2517108622 354
871 iso_pu_bacteria 2617270735 2617348520 354
872 iso_pu_bacteria 2617270735 2617349923 354
873 iso_pu_bacteria 2721755755 2723844652 354
874 iso_pu_bacteria 2728368998 2728748670 354
875 iso_pu_bacteria 2791355196 2793065833 354
876 iso_pu_bacteria 2791355199 2793082495 354
877 iso_pu_bacteria 2791355199 2793084066 354
878 iso_pu_bacteria 2816332527 2818241924 354
879 iso_pu_bacteria 2816332527 2818243769 354
880 iso_pu_bacteria 2824600985 2824601440 354
881 iso_pu_bacteria 2824626560 2824629017 354
882 iso_pu_bacteria 2824635225 2824635684 354
883 iso_pu_bacteria 2824644064 2824644669 354
884 iso_pu_bacteria 2824653114 2824657889 354
885 iso_pu_bacteria 2824704595 2824704854 354
886 iso_pu_bacteria 2824714736 2824715116 354
887 iso_pu_bacteria 2824723954 2824724353 354
888 iso_pu_bacteria 2824753945 2824754138 354
889 iso_pu_bacteria 2824763712 2824765698 354
890 iso_pu_bacteria 2824773399 2824777578 354
891 iso_pu_bacteria 2841941048 2841941849 354
892 iso_pu_bacteria 2841941048 2841948295 354
893 iso_pu_bacteria 2841949485 2841957204 354
894 iso_pu_bacteria 2841957949 2841961481 354
895 iso_pu_bacteria 2841966195 2841968695 354
896 iso_pu_bacteria 2841966195 2841970149 354
897 iso_pu_bacteria 2841974524 2841977202 354
898 iso_pu_bacteria 2841983080 2841985666 354
899 iso_pu_bacteria 2847930680 2847932719 354
900 iso_pu_bacteria 2847930680 2847934215 354
901 iso_pu_bacteria 2847930680 2847938151 354
902 iso_pu_bacteria 2847939898 2847940991 354
903 iso_pu_bacteria 2857509624 2857516250 354
904 iso_pu_bacteria 2874590934 2874593904 354
905 iso_pu_bacteria 2874604998 2874605783 354
906 iso_pu_bacteria 2874612657 2874613902 354
907 iso_pu_bacteria 2874628541 2874634470 354
908 iso_pu_bacteria 2874645413 2874646388 354
909 iso_pu_bacteria 2876771140 2876773536 354
910 iso_pu_bacteria 2876808645 2876815129 354
911 iso_pu_bacteria 2876818435 2876821757 354
912 iso_pu_bacteria 2879074833 2879077450 354
913 iso_pu_bacteria 2879083081 2879084303 354
914 iso_pu_bacteria 2879099564 2879102079 354
915 iso_pu_bacteria 2879110137 2879117819 354
916 iso_pu_bacteria 2879127579 2879129022 354
917 iso_pu_bacteria 2881364244 2881368984 354
918 iso_pu_bacteria 2881665667 2881666186 354
919 iso_pu_bacteria 2885374607 2885382073 354
920 iso_pu_bacteria 2885383462 2885385796 354
921 iso_pu_bacteria 2889033259 2889042137 354
922 iso_pu_bacteria 2903748898 2903757936 354
923 iso_pu_bacteria 2903768456 2903772808 354
924 iso_pu_bacteria 2904666416 2904673490 354
925 iso_pu_bacteria 2904699407 2904710505 354
926 iso_pu_bacteria 2906602504 2906609779 354
927 iso_pu_bacteria 2906626472 2906629389 354
928 iso_pu_bacteria 2906643746 2906644008 354
929 iso_pu_bacteria 2906643746 2906648086 354
930 iso_pu_bacteria 2908739725 2908745490 354
931 iso_pu_bacteria 2908775508 2908778325 354
932 iso_pu_bacteria 2922361189 2922368661 354
933 iso_pu_bacteria 2922386360 2922388673 354
934 iso_pu_bacteria 2922386360 2922388691 354
935 iso_pu_bacteria 2922386360 2922393102 354
936 iso_pu_bacteria 2922393267 2922394175 354
937 iso_pu_bacteria 2922425934 2922428280 354
938 iso_pu_bacteria 2929615660 2929621331 354
939 iso_pu_bacteria 2929615660 2929623419 354
940 iso_pu_bacteria 2929624759 2929631855 354
941 iso_pu_bacteria 2929624759 2929632839 354
942 iso_pu_bacteria 2932784394 2932785443 354
943 iso_pu_bacteria 2932794094 2932800915 354
944 iso_pu_bacteria 2932801729 2932809272 354
945 iso_pu_bacteria 2932809354 2932816073 354
946 iso_pu_bacteria 2932818245 2932825407 354
947 iso_pu_bacteria 2932828146 2932835016 354
948 iso_pu_bacteria 2933577622 2933583642 354
949 iso_pu_bacteria 2933577622 2933585425 354
950 iso_pu_bacteria 2935608549 2935616199 354
951 iso_pu_bacteria 2935616580 2935625203 354
952 iso_pu_bacteria 2935638405 2935647145 354
953 iso_pu_bacteria 2935648319 2935652777 354
954 iso_pu_bacteria 2935648319 2935655668 354
955 iso_pu_bacteria 2935656913 2935661237 354
956 iso_pu_bacteria 2935656913 2935664546 354
957 iso_pu_bacteria 2935665750 2935673864 354
958 iso_pu_bacteria 2935675223 2935681076 354
959 iso_pu_bacteria 2935684952 2935690708 354
960 iso_pu_bacteria 2935694250 2935703027 354
961 iso_pu_bacteria 2935713505 2935717596 354
962 iso_pu_bacteria 2935722832 2935727254 354
963 iso_pu_bacteria 2935732158 2935741330 354
964 iso_pu_bacteria 2935741537 2935750705 354
965 iso_pu_bacteria 2935750917 2935755717 354
966 iso_pu_bacteria 2935760218 2935769450 354
967 iso_pu_bacteria 2935769743 2935776240 354
968 iso_pu_bacteria 2935777560 2935784596 354
969 iso_pu_bacteria 2935777560 2935784745 354
970 iso_pu_bacteria 2935785616 2935790577 354
971 iso_pu_bacteria 2935793552 2935799015 354
972 iso_pu_bacteria 2935801545 2935809547 354
973 iso_pu_bacteria 2935810662 2935818698 354
974 iso_pu_bacteria 2935819856 2935827177 354
975 iso_pu_bacteria 2935827899 2935836526 354
976 iso_pu_bacteria 2935837841 2935846337 354
977 iso_pu_bacteria 2935847175 2935854546 354
978 iso_pu_bacteria 2935855204 2935863831 354
979 iso_pu_bacteria 2935864058 2935871933 354
980 iso_pu_bacteria 2935873716 2935882755 354
981 iso_pu_bacteria 2935883170 2935890517 354
982 iso_pu_bacteria 2935908558 2935915266 354
983 iso_pu_bacteria 2935926038 2935932523 354
984 iso_pu_bacteria 2935934488 2935941152 354
985 iso_pu_bacteria 2935942939 2935949193 354
986 iso_pu_bacteria 2935951376 2935957919 354
987 iso_pu_bacteria 2935959822 2935963155 354
988 iso_pu_bacteria 2935967501 2935974199 354
989 iso_pu_bacteria 2935975950 2935983427 354
990 iso_pu_bacteria 2935984226 2935986559 354
991 iso_pu_bacteria 2935984226 2935988819 354
992 iso_pu_bacteria 2935992306 2936000914 354
993 iso_pu_bacteria 2935992306 2936001499 354
994 iso_pu_bacteria 2936002035 2936010480 354
995 iso_pu_bacteria 2936011229 2936015525 354
996 iso_pu_bacteria 2936011229 2936018618 354
997 iso_pu_bacteria 2936019824 2936024159 354
998 iso_pu_bacteria 2936019824 2936027135 354
999 iso_pu_bacteria 2936028420 2936033411 354
1000 iso_pu_bacteria 2936028420 2936036017 354
1001 iso_pu_bacteria 2936037263 2936045420 354
1002 iso_pu_bacteria 2936046547 2936051267 354
1003 iso_pu_bacteria 2936046547 2936054096 354
1004 iso_pu_bacteria 2936055302 2936060054 354
1005 iso_pu_bacteria 2936055302 2936062505 354
1006 iso_pu_bacteria 2936055302 2936063446 354
1007 iso_pu_bacteria 2940556831 2940561002 354
1008 iso_pu_bacteria 2941531003 2941537169 354
1009 iso_pu_bacteria 2941538514 2941546801 354
1010 iso_pu_bacteria 3005594810 3005597071 354
1011 iso_pu_bacteria 3005594810 3005602906 354
1012 iso_pu_bacteria 3005718088 3005720545 354
1013 iso_pu_bacteria 3005718088 3005725378 354
1014 iso_pu_bacteria 8006933436 8006942951 354
1015 iso_pu_bacteria 8006973647 8006982671 354
1016 iso_pu_bacteria 8006994254 8006994411 354
1017 iso_pu_bacteria 8016511872 8016512300 354
1018 iso_pu_bacteria 8016522445 8016527606 354
1019 iso_pu_bacteria 8016530956 8016532703 354
1020 iso_pu_bacteria 8016539877 8016545930 354
1021 iso_pu_bacteria 8016548790 8016556179 354
1022 iso_pu_bacteria 8016557553 8016564547 354
1023 iso_pu_bacteria 8016566248 8016571009 354
1024 iso_pu_bacteria 8016575299 8016583514 354
1025 iso_pu_bacteria 8016583857 8016584480 354
1026 iso_pu_bacteria 8016583857 8016595133 354
1027 iso_pu_bacteria 8016595262 8016602204 354
1028 iso_pu_bacteria 8016603502 8016605199 354
1029 iso_pu_bacteria 8016613128 8016617040 354
1030 iso_pu_bacteria 8016630954 8016634172 354
1031 iso_pu_bacteria 8017057580 8017066734 354
1032 iso_pu_bacteria 8019538911 8019542168 354
1033 iso_pu_bacteria 8019547302 8019547478 354
1034 iso_pu_bacteria 8019547302 8019547666 354
1035 iso_pu_bacteria 8019576017 8019585361 354
1036 iso_pu_bacteria 8019586578 8019593355 354
1037 iso_pu_bacteria 8019597564 8019598128 354
1038 iso_pu_bacteria 8019629233 8019632202 354
1039 iso_pu_bacteria 8019629233 8019632661 354
1040 iso_pu_bacteria 8019648815 8019654307 354
1041 iso_pu_bacteria 8019659431 8019660118 354
1042 iso_pu_bacteria 8019668869 8019669545 354
1043 iso_pu_bacteria 8019687851 8019692622 354
1044 iso_pu_bacteria 8055742211 8055743744 354
1045 iso_pu_bacteria 8055742211 8055744464 354
1046 iso_pu_bacteria 8056673599 8056677130 354
1047 iso_pu_bacteria 8056681323 8056684396 354
1048 iso_pu_bacteria 8056689827 8056694333 354
1049 iso_pu_bacteria 8056967851 8056973379 354
1050 3300021384 Ga0213876_10009215 Ga0213876_100092154 355
1051 3300039437 Ga0436365_0709051 Ga0436365_0709051_24502_25584 355
1052 3300039437 Ga0436365_0776418 Ga0436365_0776418_180_1310 355
1053 3300044712 Ga0453684_0001541 Ga0453684_0001541_58173_59273 355
1054 3300045051 Ga0451576_0000064 Ga0451576_0000064_5247_6347 355
1055 3300053134 Ga0500658_0048764 Ga0500658_0048764_510_1592 355
1056 3300053139 Ga0500568_0011572 Ga0500568_0011572_2433_3515 355
1057 3300005548 Ga0070665_100106254 Ga0070665_1001062542 357
1058 3300005844 Ga0068862_100372379 Ga0068862_1003723792 357
1059 3300006353 Ga0075370_10058041 Ga0075370_100580412 357
1060 3300014326 Ga0157380_10013096 Ga0157380_100130962 357
1061 3300025937 Ga0207669_10217684 Ga0207669_102176842 357
1062 3300050495 nmdc:mga04h51_15680_c1 nmdc:mga04h51_15680_c1_535_1629 357
1063 3300005455 Ga0070663_100001338 Ga0070663_10000133811 359
1064 3300005548 Ga0070665_100003271 Ga0070665_10000327113 359
1065 3300006038 Ga0075365_10196091 Ga0075365_101960912 359
1066 3300006178 Ga0075367_10016272 Ga0075367_100162722 359
1067 3300006353 Ga0075370_10007506 Ga0075370_100075067 359
1068 3300009101 Ga0105247_10031386 Ga0105247_100313863 359
1069 3300026067 Ga0207678_10012336 Ga0207678_100123366 359
1070 3300028379 Ga0268266_10000988 Ga0268266_1000098826 359
1071 3300048915 Ga0496112_0287943 Ga0496112_0287943_30_1133 359
1072 3300050490 nmdc:mga03n38_204_c1 nmdc:mga03n38_204_c1_6796_7899 359
1073 3300050492 nmdc:mga0yw44_132069_c1 nmdc:mga0yw44_132069_c1_172_1275 359
1074 3300050496 nmdc:mga07m45_751_c1 nmdc:mga07m45_751_c1_433_1536 359
1075 2162886007 SwRhRL2b_contig_3482130 SwRhRL2b_0287.00004930 360
1076 3300005289 Ga0065704_10072745 Ga0065704_100727454 360

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

48

378

0.99

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

47

294

0.98

PF04321

RmlD_sub_bind

RmlD substrate binding domain

44

226

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gpj-assembly1.cif.gz_A crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4f-man 0.9791 3 347
6gpl-assembly1.cif.gz_B crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4k6d-man 0.9784 3 347
6q94-assembly3.cif.gz_H-2 crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man 0.9732 3 349
6gpk-assembly1.cif.gz_C crystal structure of human gdp-d-mannose 4,6-dehydratase (e157q) in complex with gdp-man 0.9727 3 347
6q94-assembly1.cif.gz_B-3 crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man 0.9713 3 347
ID Description Score Start End Superfamily
af_Q4D941_50_182_3.90.25.10 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9883 193 323 3.90.25.10
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9825 3 268 3.40.50.720
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9717 3 268 3.40.50.720
af_F1QPT3_45_368_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9696 26 340 3.40.50.720
af_Q4D941_50_182_3.90.25.10 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9663 193 323 3.90.25.10
ID Description Score Start End GO Terms
AF-A0A357FXF0-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.998 192 296 GO:0008446
GO:0042351
AF-A0A5J4NJV4-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) (GDP-D-mannose dehydratase) 0.9954 213 345 GO:0008446
GO:0042351
AF-A0A730K5U1-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9953 185 289 GO:0008446
GO:0042351
AF-A0A382VIM8-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9952 171 342 GO:0008446
GO:0042351
AF-A0A3D0JWK2-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9945 185 345 GO:0008446
GO:0042351

Feature Viewer

pLDDT pTM Quality
91.08 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map