F489594
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1076 | 583 | 693 | 356 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2841941048|2841941849 |
| Length | 397 |
| Sequence | YVDPSIHFQLSLACSKEPVLAATYCLRARGQIVCISRGHRYMNRRIALITGVTGQDGAYLAEHLLSLGYVVHGIKRRSSSFNTARVDHLYQDPHAGNVPFLMHYGDMTDSTNLIRLVQQIQPTEIYNLAAQSHVAVSFETPEYTANADAVGVLRLLEAIRILGMEKETRFYQASTSELYGLVQEIPQKETTPFYPRSPYGVAKLYGYWITVNYREAYGMFASNGILFNHESPIRGETFVTRKITRGVARIEVGLEDILYLGNLEAKRDWGHARDYVEGMHMILQADKPDDFVLATGEMRSVREMVELAFAHVGRRIEWRGKGVDEIGVDAKSGKSMVKIDRTYFRPTEVDLLVGDASKARQVLGWKPKRTFAQLVEEMVASDLAEAKRDAGSGKHTV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 6 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 7 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 8 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 9 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 10 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 11 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 12 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 13 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 14 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 15 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 16 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 17 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 18 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 19 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 20 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 21 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 22 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 23 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 24 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 25 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 26 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 27 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 28 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 29 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 30 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 31 | 2791355199 | |||
| 32 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 33 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 34 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 35 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 36 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 37 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 38 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 39 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 40 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 41 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 42 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 43 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 44 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 45 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 46 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 47 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 48 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 49 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 50 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 51 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 52 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 53 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 54 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 55 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 56 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 57 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 58 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 59 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 60 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 61 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 62 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 63 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 64 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 65 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 66 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 67 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 68 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 69 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 70 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 71 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 72 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 73 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 74 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 75 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 76 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 77 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 78 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 79 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 80 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 81 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 82 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 83 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 84 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 85 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 86 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 87 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 88 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 89 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 90 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 91 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 92 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 93 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 94 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 95 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 96 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 97 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 98 | 2904699407 | |||
| 99 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 100 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 101 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 102 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 103 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 104 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 105 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 106 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 107 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 108 | 2922368715 | |||
| 109 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 110 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 111 | 2922425934 | |||
| 112 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 113 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 114 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 115 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 116 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 117 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 118 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 119 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 120 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 121 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 122 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 123 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 124 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 125 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 126 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 127 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 128 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 129 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 130 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 131 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 132 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 133 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 134 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 135 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 136 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 137 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 138 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 139 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 140 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 141 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 142 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 143 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 144 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 145 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 146 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 147 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 148 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 149 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 150 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 151 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 152 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 153 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 154 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 155 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 156 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 157 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 158 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 159 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 160 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 161 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 162 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 163 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 164 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 165 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 166 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 167 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 168 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 169 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 170 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 171 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 172 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 173 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 174 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 175 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 176 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 177 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 178 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 179 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 180 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 181 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 182 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 183 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 184 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 185 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 186 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 187 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 188 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 189 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 190 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 191 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 192 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 193 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 194 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 195 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 196 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 197 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 198 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 199 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 201 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 203 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 205 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 207 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 209 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 211 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 214 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 216 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 217 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 222 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 223 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 224 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 225 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 226 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 228 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 229 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 230 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 231 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 234 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 236 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 237 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 238 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 239 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 240 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 241 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 242 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 243 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 244 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 245 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 246 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 247 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 248 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 249 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 251 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 252 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 253 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 254 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 255 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 256 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 257 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 258 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 260 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 261 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 262 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 263 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 264 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 265 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 266 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 269 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 273 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 275 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 276 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 277 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 278 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 282 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 287 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 288 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 289 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 290 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 291 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 292 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 293 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 294 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 295 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 296 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 297 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 298 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 299 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 300 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 301 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 302 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 303 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 304 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 360 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 361 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 362 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 363 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 364 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 365 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 369 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 370 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 371 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 372 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 373 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 374 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 375 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 376 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 377 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 378 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 379 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 380 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 381 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 382 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 383 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 384 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 385 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 386 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 387 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 388 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 389 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 390 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 391 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 392 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 393 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 394 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 395 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 396 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 397 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 398 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 399 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 400 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 401 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 402 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 403 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 404 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 405 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 406 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 407 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 408 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 409 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 410 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 411 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 412 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 413 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 414 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 415 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 416 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 461 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 462 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 463 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 464 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 465 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 466 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 467 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 468 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 469 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 470 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 471 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 472 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 473 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 474 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 475 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 476 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 477 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 478 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 479 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 480 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 481 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 482 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 483 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 484 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 487 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 488 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 489 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 499 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 500 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 502 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 503 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 504 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 505 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 506 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 507 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 510 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 511 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 512 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 513 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 514 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 515 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 516 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 517 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 518 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 519 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 520 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 521 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 522 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 523 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 524 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 525 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 526 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 527 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 528 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 529 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 530 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 531 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 532 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 533 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 534 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 535 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 536 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 537 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 538 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 539 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 540 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 541 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 542 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 543 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 544 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 545 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 546 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 547 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 548 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 549 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 550 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 551 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 552 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 553 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 554 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 555 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 556 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 557 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 558 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 559 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 560 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 561 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 562 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 563 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 564 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 565 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 566 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 567 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 568 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 569 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 570 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 571 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 572 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 573 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 574 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 575 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 576 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 577 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 578 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 579 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 580 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 581 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 582 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 583 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 64.71 |
| Metatranscriptomes | 0 |
| Isolates | 35.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.34 |
| Nodule | 28.9 |
| Rhizoplane | 2.7 |
| Rhizosphere | 44.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3482130 | 2162886007 | Bacteria | 1532 |
| 2 | JGI24736J21556_1011716 | 3300001904 | Bacteria | 1424 |
| 3 | JGI24737J22298_10005764 | 3300001990 | Bacteria | 4265 |
| 4 | JGI24735J21928_10010572 | 3300002067 | Bacteria | 2941 |
| 5 | JGI25152J39213_1001710 | 3300002773 | Bacteria | 9001 |
| 6 | JGI25406J46586_10000014 | 3300003203 | Bacteria | 93855 |
| 7 | JGI25165J46597_1000013 | 3300003214 | Bacteria | 402100 |
| 8 | JGI25153J46596_10000127 | 3300003215 | Bacteria | 83368 |
| 9 | JGI25153J46596_10000168 | 3300003215 | Bacteria | 65461 |
| 10 | JGI25153J46596_10000247 | 3300003215 | Bacteria | 44807 |
| 11 | JGI25153J46596_10009473 | 3300003215 | Bacteria | 4519 |
| 12 | JGI25153J46596_10011513 | 3300003215 | Bacteria | 3901 |
| 13 | rootH1_10176606 | 3300003323 | Bacteria | 5122 |
| 14 | JGI25160J50197_1000411 | 3300003354 | Bacteria | 27360 |
| 15 | JGI25160J50197_1001248 | 3300003354 | Bacteria | 12893 |
| 16 | Ga0055526_1002123 | 3300003771 | Bacteria | 13606 |
| 17 | Ga0055524_1005522 | 3300003775 | Bacteria | 5620 |
| 18 | Ga0055524_1008938 | 3300003775 | Bacteria | 4120 |
| 19 | Ga0055528_1003908 | 3300003790 | Bacteria | 7318 |
| 20 | Ga0055540_1016113 | 3300003792 | Bacteria | 2141 |
| 21 | Ga0055540_1018664 | 3300003792 | Bacteria | 1895 |
| 22 | Ga0055531_10005857 | 3300003794 | Bacteria | 7099 |
| 23 | Ga0055543_1001498 | 3300004625 | Bacteria | 9186 |
| 24 | Ga0055543_1003748 | 3300004625 | Bacteria | 4346 |
| 25 | Ga0065165_1000134 | 3300005262 | Bacteria | 127890 |
| 26 | Ga0065165_1000664 | 3300005262 | Bacteria | 49644 |
| 27 | Ga0065165_1000976 | 3300005262 | Bacteria | 35638 |
| 28 | Ga0065165_1003936 | 3300005262 | Bacteria | 9777 |
| 29 | Ga0065165_1005285 | 3300005262 | Bacteria | 7359 |
| 30 | Ga0065165_1040874 | 3300005262 | Bacteria | 1379 |
| 31 | Ga0065704_10072745 | 3300005289 | Bacteria | 8072 |
| 32 | Ga0070658_10013687 | 3300005327 | Bacteria | 6509 |
| 33 | Ga0070658_10080716 | 3300005327 | Bacteria | 2671 |
| 34 | Ga0070683_100047943 | 3300005329 | Bacteria | 3949 |
| 35 | Ga0070683_100065692 | 3300005329 | Bacteria | 3378 |
| 36 | Ga0070683_100115242 | 3300005329 | Bacteria | 2537 |
| 37 | Ga0070670_100040501 | 3300005331 | Bacteria | 4005 |
| 38 | Ga0068869_100028731 | 3300005334 | Bacteria | 3889 |
| 39 | Ga0068869_100061092 | 3300005334 | Bacteria | 2763 |
| 40 | Ga0070666_10064965 | 3300005335 | Bacteria | 2475 |
| 41 | Ga0070680_100082137 | 3300005336 | Bacteria | 2659 |
| 42 | Ga0070660_100023504 | 3300005339 | Bacteria | 4566 |
| 43 | Ga0070689_100343932 | 3300005340 | Bacteria | 1250 |
| 44 | Ga0070668_100000830 | 3300005347 | Bacteria | 21339 |
| 45 | Ga0070668_100128901 | 3300005347 | Bacteria | 2029 |
| 46 | Ga0070669_100069635 | 3300005353 | Bacteria | 2599 |
| 47 | Ga0070671_100005278 | 3300005355 | Bacteria | 10305 |
| 48 | Ga0070671_100239408 | 3300005355 | Bacteria | 1540 |
| 49 | Ga0070688_100072138 | 3300005365 | Bacteria | 2212 |
| 50 | Ga0070659_100187211 | 3300005366 | Bacteria | 1700 |
| 51 | Ga0070667_100008652 | 3300005367 | Bacteria | 8434 |
| 52 | Ga0070667_100019485 | 3300005367 | Bacteria | 5629 |
| 53 | Ga0070709_10007842 | 3300005434 | Bacteria | 5862 |
| 54 | Ga0070709_10011973 | 3300005434 | Bacteria | 4848 |
| 55 | Ga0070709_10033440 | 3300005434 | Bacteria | 3110 |
| 56 | Ga0070709_10041881 | 3300005434 | Bacteria | 2824 |
| 57 | Ga0070714_100022799 | 3300005435 | Bacteria | 5136 |
| 58 | Ga0070714_100136283 | 3300005435 | Bacteria | 2199 |
| 59 | Ga0070713_100003900 | 3300005436 | Bacteria | 9890 |
| 60 | Ga0070713_100016156 | 3300005436 | Bacteria | 5608 |
| 61 | Ga0070713_100128758 | 3300005436 | Bacteria | 2230 |
| 62 | Ga0070710_10006621 | 3300005437 | Bacteria | 5571 |
| 63 | Ga0070710_10041028 | 3300005437 | Bacteria | 2553 |
| 64 | Ga0070711_100016347 | 3300005439 | Bacteria | 4711 |
| 65 | Ga0070711_100031629 | 3300005439 | Bacteria | 3514 |
| 66 | Ga0070708_100027800 | 3300005445 | Bacteria | 4858 |
| 67 | Ga0070663_100001338 | 3300005455 | Bacteria | 13482 |
| 68 | Ga0070663_100035066 | 3300005455 | Bacteria | 3478 |
| 69 | Ga0070678_100015416 | 3300005456 | Bacteria | 4859 |
| 70 | Ga0070681_10097487 | 3300005458 | Bacteria | 2887 |
| 71 | Ga0068867_100176825 | 3300005459 | Bacteria | 1694 |
| 72 | Ga0070706_100003127 | 3300005467 | Bacteria | 16375 |
| 73 | Ga0070707_100001574 | 3300005468 | Bacteria | 22107 |
| 74 | Ga0070698_100026493 | 3300005471 | Bacteria | 6035 |
| 75 | Ga0070699_100002004 | 3300005518 | Bacteria | 18382 |
| 76 | Ga0070679_100014351 | 3300005530 | Bacteria | 7609 |
| 77 | Ga0070679_100019705 | 3300005530 | Bacteria | 6564 |
| 78 | Ga0070684_100018169 | 3300005535 | Bacteria | 5787 |
| 79 | Ga0070684_100051351 | 3300005535 | Bacteria | 3582 |
| 80 | Ga0070684_100064413 | 3300005535 | Bacteria | 3215 |
| 81 | Ga0070697_100045516 | 3300005536 | Bacteria | 3556 |
| 82 | Ga0068853_100089356 | 3300005539 | Bacteria | 2706 |
| 83 | Ga0068853_100094702 | 3300005539 | Bacteria | 2632 |
| 84 | Ga0068853_100171598 | 3300005539 | Bacteria | 1962 |
| 85 | Ga0070672_100268238 | 3300005543 | Bacteria | 1441 |
| 86 | Ga0070665_100003271 | 3300005548 | Bacteria | 17380 |
| 87 | Ga0070665_100004109 | 3300005548 | Bacteria | 15308 |
| 88 | Ga0070665_100005930 | 3300005548 | Bacteria | 12512 |
| 89 | Ga0070665_100014283 | 3300005548 | Bacteria | 7974 |
| 90 | Ga0070665_100048130 | 3300005548 | Bacteria | 4281 |
| 91 | Ga0070665_100051472 | 3300005548 | Bacteria | 4130 |
| 92 | Ga0070665_100106254 | 3300005548 | Bacteria | 2809 |
| 93 | Ga0070665_100147621 | 3300005548 | Bacteria | 2354 |
| 94 | Ga0068855_100079863 | 3300005563 | Bacteria | 3793 |
| 95 | Ga0068855_100085960 | 3300005563 | Bacteria | 3638 |
| 96 | Ga0068855_100191931 | 3300005563 | Bacteria | 2303 |
| 97 | Ga0070664_100167199 | 3300005564 | Bacteria | 1949 |
| 98 | Ga0068857_100003812 | 3300005577 | Bacteria | 12691 |
| 99 | Ga0068857_100010456 | 3300005577 | Bacteria | 8065 |
| 100 | Ga0068857_100252907 | 3300005577 | Bacteria | 1616 |
| 101 | Ga0068854_100027274 | 3300005578 | Bacteria | 3935 |
| 102 | Ga0068856_100039969 | 3300005614 | Bacteria | 4606 |
| 103 | Ga0068856_100043689 | 3300005614 | Bacteria | 4409 |
| 104 | Ga0068856_100115733 | 3300005614 | Bacteria | 2681 |
| 105 | Ga0068856_100137315 | 3300005614 | Bacteria | 2451 |
| 106 | Ga0068856_100183040 | 3300005614 | Bacteria | 2109 |
| 107 | Ga0068856_100393435 | 3300005614 | Bacteria | 1406 |
| 108 | Ga0068852_100004160 | 3300005616 | Bacteria | 10196 |
| 109 | Ga0068852_100007043 | 3300005616 | Bacteria | 8188 |
| 110 | Ga0068852_100289984 | 3300005616 | Bacteria | 1580 |
| 111 | Ga0068864_100094104 | 3300005618 | Bacteria | 2647 |
| 112 | Ga0068864_100247880 | 3300005618 | Bacteria | 1652 |
| 113 | Ga0068851_10001214 | 3300005834 | Bacteria | 11191 |
| 114 | Ga0068851_10014266 | 3300005834 | Bacteria | 3771 |
| 115 | Ga0068870_10067631 | 3300005840 | Bacteria | 1938 |
| 116 | Ga0068870_10088629 | 3300005840 | Bacteria | 1725 |
| 117 | Ga0068863_100005808 | 3300005841 | Bacteria | 12096 |
| 118 | Ga0068863_100014635 | 3300005841 | Bacteria | 7552 |
| 119 | Ga0068863_100054034 | 3300005841 | Bacteria | 3806 |
| 120 | Ga0068858_100001857 | 3300005842 | Bacteria | 21542 |
| 121 | Ga0068858_100141044 | 3300005842 | Bacteria | 2262 |
| 122 | Ga0068858_100222422 | 3300005842 | Bacteria | 1788 |
| 123 | Ga0068858_100341322 | 3300005842 | Bacteria | 1433 |
| 124 | Ga0068860_100000409 | 3300005843 | Bacteria | 55861 |
| 125 | Ga0068860_100057032 | 3300005843 | Bacteria | 3712 |
| 126 | Ga0068862_100120445 | 3300005844 | Bacteria | 2312 |
| 127 | Ga0068862_100372379 | 3300005844 | Bacteria | 1330 |
| 128 | Ga0081455_10004847 | 3300005937 | Bacteria | 14929 |
| 129 | Ga0081455_10011948 | 3300005937 | Bacteria | 8690 |
| 130 | Ga0081455_10066157 | 3300005937 | Bacteria | 3020 |
| 131 | Ga0081540_1000353 | 3300005983 | Bacteria | 46545 |
| 132 | Ga0081540_1001385 | 3300005983 | Bacteria | 21018 |
| 133 | Ga0081540_1009106 | 3300005983 | Bacteria | 6858 |
| 134 | Ga0081540_1017917 | 3300005983 | Bacteria | 4364 |
| 135 | Ga0081540_1023238 | 3300005983 | Bacteria | 3633 |
| 136 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 137 | Ga0081539_10001561 | 3300005985 | Bacteria | 38000 |
| 138 | Ga0081539_10017941 | 3300005985 | Bacteria | 4938 |
| 139 | Ga0081539_10026626 | 3300005985 | Bacteria | 3684 |
| 140 | Ga0070717_10006203 | 3300006028 | Bacteria | 8779 |
| 141 | Ga0070717_10040726 | 3300006028 | Bacteria | 3785 |
| 142 | Ga0070717_10172669 | 3300006028 | Bacteria | 1881 |
| 143 | Ga0075365_10170202 | 3300006038 | Bacteria | 1520 |
| 144 | Ga0075365_10196091 | 3300006038 | Bacteria | 1414 |
| 145 | Ga0075368_10024318 | 3300006042 | Bacteria | 2320 |
| 146 | Ga0075368_10071452 | 3300006042 | Bacteria | 1402 |
| 147 | Ga0070716_100004406 | 3300006173 | Bacteria | 6732 |
| 148 | Ga0070716_100083383 | 3300006173 | Bacteria | 1914 |
| 149 | Ga0070712_100012336 | 3300006175 | Bacteria | 5431 |
| 150 | Ga0075362_10116894 | 3300006177 | Bacteria | 1259 |
| 151 | Ga0075367_10016272 | 3300006178 | Bacteria | 4060 |
| 152 | Ga0075367_10018774 | 3300006178 | Bacteria | 3821 |
| 153 | Ga0075367_10104626 | 3300006178 | Bacteria | 1733 |
| 154 | Ga0075369_10021966 | 3300006186 | Bacteria | 2629 |
| 155 | Ga0075366_10005853 | 3300006195 | Bacteria | 6681 |
| 156 | Ga0075366_10114547 | 3300006195 | Bacteria | 1623 |
| 157 | Ga0097621_100025068 | 3300006237 | Bacteria | 4664 |
| 158 | Ga0097621_100238325 | 3300006237 | Bacteria | 1590 |
| 159 | Ga0075370_10007506 | 3300006353 | Bacteria | 5557 |
| 160 | Ga0075370_10058041 | 3300006353 | Bacteria | 2201 |
| 161 | Ga0068871_100165789 | 3300006358 | Bacteria | 1891 |
| 162 | Ga0075428_100336341 | 3300006844 | Bacteria | 1622 |
| 163 | Ga0075430_100140342 | 3300006846 | Bacteria | 2012 |
| 164 | Ga0068865_100141238 | 3300006881 | Bacteria | 1816 |
| 165 | Ga0099825_1028685 | 3300006941 | Bacteria | 2676 |
| 166 | Ga0075435_100071665 | 3300007076 | Bacteria | 2830 |
| 167 | Ga0105240_10004736 | 3300009093 | Bacteria | 20539 |
| 168 | Ga0105240_10022611 | 3300009093 | Bacteria | 8328 |
| 169 | Ga0105240_10024496 | 3300009093 | Bacteria | 7952 |
| 170 | Ga0105240_10028339 | 3300009093 | Bacteria | 7316 |
| 171 | Ga0105240_10081017 | 3300009093 | Bacteria | 3990 |
| 172 | Ga0105240_10090942 | 3300009093 | Bacteria | 3730 |
| 173 | Ga0111539_10007940 | 3300009094 | Bacteria | 13532 |
| 174 | Ga0111539_10043845 | 3300009094 | Bacteria | 5361 |
| 175 | Ga0105245_10308093 | 3300009098 | Bacteria | 1556 |
| 176 | Ga0105247_10031386 | 3300009101 | Bacteria | 3224 |
| 177 | Ga0105247_10043573 | 3300009101 | Bacteria | 2750 |
| 178 | Ga0105243_10039043 | 3300009148 | Bacteria | 3699 |
| 179 | Ga0105243_10277624 | 3300009148 | Bacteria | 1508 |
| 180 | Ga0105241_10004255 | 3300009174 | Bacteria | 10581 |
| 181 | Ga0105241_10059936 | 3300009174 | Bacteria | 2927 |
| 182 | Ga0105241_10108987 | 3300009174 | Bacteria | 2214 |
| 183 | Ga0105248_10005020 | 3300009177 | Bacteria | 14613 |
| 184 | Ga0105248_10006945 | 3300009177 | Bacteria | 12406 |
| 185 | Ga0105237_10000110 | 3300009545 | Bacteria | 114577 |
| 186 | Ga0105237_10004743 | 3300009545 | Bacteria | 15634 |
| 187 | Ga0105237_10031433 | 3300009545 | Bacteria | 5384 |
| 188 | Ga0105237_10326038 | 3300009545 | Bacteria | 1539 |
| 189 | Ga0105238_10002076 | 3300009551 | Bacteria | 20251 |
| 190 | Ga0105238_10009029 | 3300009551 | Bacteria | 9974 |
| 191 | Ga0105238_10010980 | 3300009551 | Bacteria | 9108 |
| 192 | Ga0105238_10011639 | 3300009551 | Bacteria | 8863 |
| 193 | Ga0105238_10193262 | 3300009551 | Bacteria | 2011 |
| 194 | Ga0105238_10227732 | 3300009551 | Bacteria | 1841 |
| 195 | Ga0105249_10000013 | 3300009553 | Bacteria | 283609 |
| 196 | Ga0105249_10383316 | 3300009553 | Bacteria | 1432 |
| 197 | Ga0105249_10387255 | 3300009553 | Bacteria | 1425 |
| 198 | Ga0105239_10000552 | 3300010375 | Bacteria | 53680 |
| 199 | Ga0105239_10013891 | 3300010375 | Bacteria | 8938 |
| 200 | Ga0105239_10016664 | 3300010375 | Bacteria | 8122 |
| 201 | Ga0105239_10027032 | 3300010375 | Bacteria | 6316 |
| 202 | Ga0105239_10036477 | 3300010375 | Bacteria | 5398 |
| 203 | Ga0105239_10043844 | 3300010375 | Bacteria | 4905 |
| 204 | Ga0105239_10064956 | 3300010375 | Bacteria | 4007 |
| 205 | Ga0105239_10122883 | 3300010375 | Bacteria | 2885 |
| 206 | Ga0105246_10025513 | 3300011119 | Bacteria | 3853 |
| 207 | Ga0157370_10007573 | 3300013104 | Bacteria | 11796 |
| 208 | Ga0157370_10018659 | 3300013104 | Bacteria | 6974 |
| 209 | Ga0157370_10024085 | 3300013104 | Bacteria | 6034 |
| 210 | Ga0157369_10066040 | 3300013105 | Bacteria | 3892 |
| 211 | Ga0157369_10108377 | 3300013105 | Bacteria | 2954 |
| 212 | Ga0157374_10112901 | 3300013296 | Bacteria | 2615 |
| 213 | Ga0163162_10163423 | 3300013306 | Bacteria | 2349 |
| 214 | Ga0163162_10346060 | 3300013306 | Bacteria | 1619 |
| 215 | Ga0157372_10010497 | 3300013307 | Bacteria | 9861 |
| 216 | Ga0157375_10187982 | 3300013308 | Bacteria | 2220 |
| 217 | Ga0157375_10261647 | 3300013308 | Bacteria | 1892 |
| 218 | Ga0163163_10016527 | 3300014325 | Bacteria | 6862 |
| 219 | Ga0157380_10013096 | 3300014326 | Bacteria | 6035 |
| 220 | Ga0157379_10004730 | 3300014968 | Bacteria | 11681 |
| 221 | Ga0157379_10035381 | 3300014968 | Bacteria | 4453 |
| 222 | Ga0157379_10052024 | 3300014968 | Bacteria | 3657 |
| 223 | Ga0214544_1000005 | 3300021320 | Bacteria | 387675 |
| 224 | Ga0214542_1000004 | 3300021321 | Bacteria | 415597 |
| 225 | Ga0214545_1000005 | 3300021324 | Bacteria | 415590 |
| 226 | Ga0214543_1000030 | 3300021327 | Bacteria | 210137 |
| 227 | Ga0213872_10002000 | 3300021361 | Bacteria | 12410 |
| 228 | Ga0213872_10012123 | 3300021361 | Bacteria | 4063 |
| 229 | Ga0213872_10062062 | 3300021361 | Bacteria | 1689 |
| 230 | Ga0213876_10003009 | 3300021384 | Bacteria | 9761 |
| 231 | Ga0213876_10009215 | 3300021384 | Bacteria | 5316 |
| 232 | Ga0213876_10077260 | 3300021384 | Bacteria | 1759 |
| 233 | Ga0207425_1001246 | 3300025245 | Bacteria | 11161 |
| 234 | Ga0207425_1003832 | 3300025245 | Bacteria | 4678 |
| 235 | Ga0209148_1000239 | 3300025254 | Bacteria | 87710 |
| 236 | Ga0209129_1000508 | 3300025258 | Bacteria | 27984 |
| 237 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 238 | Ga0209233_1000855 | 3300025261 | Bacteria | 13478 |
| 239 | Ga0209233_1011291 | 3300025261 | Bacteria | 2636 |
| 240 | Ga0209233_1013934 | 3300025261 | Bacteria | 2282 |
| 241 | Ga0209455_1002439 | 3300025272 | Bacteria | 7203 |
| 242 | Ga0209673_1002931 | 3300025273 | Bacteria | 10739 |
| 243 | Ga0209673_1026617 | 3300025273 | Bacteria | 1895 |
| 244 | Ga0209564_1000262 | 3300025295 | Bacteria | 112256 |
| 245 | Ga0209564_1002361 | 3300025295 | Bacteria | 15194 |
| 246 | Ga0209564_1003511 | 3300025295 | Bacteria | 10604 |
| 247 | Ga0209564_1010509 | 3300025295 | Bacteria | 4251 |
| 248 | Ga0209758_1000075 | 3300025297 | Bacteria | 271585 |
| 249 | Ga0209758_1000187 | 3300025297 | Bacteria | 138759 |
| 250 | Ga0209758_1000611 | 3300025297 | Bacteria | 55313 |
| 251 | Ga0209758_1000774 | 3300025297 | Bacteria | 45909 |
| 252 | Ga0209758_1003883 | 3300025297 | Bacteria | 13081 |
| 253 | Ga0209758_1050777 | 3300025297 | Bacteria | 1450 |
| 254 | Ga0209758_1051482 | 3300025297 | Bacteria | 1433 |
| 255 | Ga0209256_1004330 | 3300025299 | Bacteria | 9015 |
| 256 | Ga0209256_1017028 | 3300025299 | Bacteria | 2439 |
| 257 | Ga0207426_1000138 | 3300025302 | Bacteria | 196119 |
| 258 | Ga0207426_1000160 | 3300025302 | Bacteria | 174540 |
| 259 | Ga0207426_1000375 | 3300025302 | Bacteria | 78261 |
| 260 | Ga0207426_1002253 | 3300025302 | Bacteria | 12770 |
| 261 | Ga0207426_1002824 | 3300025302 | Bacteria | 10381 |
| 262 | Ga0207426_1015016 | 3300025302 | Bacteria | 2825 |
| 263 | Ga0207426_1030563 | 3300025302 | Bacteria | 1765 |
| 264 | Ga0207426_1034907 | 3300025302 | Bacteria | 1610 |
| 265 | Ga0209051_1004348 | 3300025303 | Bacteria | 8779 |
| 266 | Ga0209257_1000652 | 3300025304 | Bacteria | 55125 |
| 267 | Ga0207697_10026850 | 3300025315 | Bacteria | 2355 |
| 268 | Ga0207656_10008380 | 3300025321 | Bacteria | 3803 |
| 269 | Ga0207692_10027888 | 3300025898 | Bacteria | 2664 |
| 270 | Ga0207680_10073038 | 3300025903 | Bacteria | 2132 |
| 271 | Ga0207647_10000985 | 3300025904 | Bacteria | 22102 |
| 272 | Ga0207647_10101551 | 3300025904 | Bacteria | 1706 |
| 273 | Ga0207685_10004384 | 3300025905 | Bacteria | 3581 |
| 274 | Ga0207699_10001145 | 3300025906 | Bacteria | 12548 |
| 275 | Ga0207699_10037144 | 3300025906 | Bacteria | 2782 |
| 276 | Ga0207643_10207571 | 3300025908 | Bacteria | 1195 |
| 277 | Ga0207705_10003846 | 3300025909 | Bacteria | 11426 |
| 278 | Ga0207705_10009587 | 3300025909 | Bacteria | 7041 |
| 279 | Ga0207684_10005362 | 3300025910 | Bacteria | 11843 |
| 280 | Ga0207654_10000136 | 3300025911 | Bacteria | 47311 |
| 281 | Ga0207654_10010748 | 3300025911 | Bacteria | 4661 |
| 282 | Ga0207654_10016332 | 3300025911 | Bacteria | 3864 |
| 283 | Ga0207654_10120237 | 3300025911 | Bacteria | 1648 |
| 284 | Ga0207707_10166254 | 3300025912 | Bacteria | 1928 |
| 285 | Ga0207707_10332096 | 3300025912 | Bacteria | 1312 |
| 286 | Ga0207695_10002311 | 3300025913 | Bacteria | 28436 |
| 287 | Ga0207695_10006751 | 3300025913 | Bacteria | 14805 |
| 288 | Ga0207695_10011572 | 3300025913 | Bacteria | 10672 |
| 289 | Ga0207695_10089189 | 3300025913 | Bacteria | 3101 |
| 290 | Ga0207695_10318913 | 3300025913 | Bacteria | 1444 |
| 291 | Ga0207671_10007380 | 3300025914 | Bacteria | 9548 |
| 292 | Ga0207671_10020739 | 3300025914 | Bacteria | 4998 |
| 293 | Ga0207671_10052904 | 3300025914 | Bacteria | 3009 |
| 294 | Ga0207671_10064118 | 3300025914 | Bacteria | 2731 |
| 295 | Ga0207671_10128058 | 3300025914 | Bacteria | 1947 |
| 296 | Ga0207671_10231136 | 3300025914 | Bacteria | 1451 |
| 297 | Ga0207693_10001764 | 3300025915 | Bacteria | 18977 |
| 298 | Ga0207693_10046474 | 3300025915 | Bacteria | 3410 |
| 299 | Ga0207693_10060693 | 3300025915 | Bacteria | 2962 |
| 300 | Ga0207663_10006336 | 3300025916 | Bacteria | 6047 |
| 301 | Ga0207663_10022943 | 3300025916 | Bacteria | 3574 |
| 302 | Ga0207660_10025057 | 3300025917 | Bacteria | 4046 |
| 303 | Ga0207662_10022826 | 3300025918 | Bacteria | 3591 |
| 304 | Ga0207657_10040912 | 3300025919 | Bacteria | 4103 |
| 305 | Ga0207657_10112775 | 3300025919 | Bacteria | 2243 |
| 306 | Ga0207652_10055811 | 3300025921 | Bacteria | 3399 |
| 307 | Ga0207652_10180441 | 3300025921 | Bacteria | 1897 |
| 308 | Ga0207646_10005593 | 3300025922 | Bacteria | 13195 |
| 309 | Ga0207681_10003375 | 3300025923 | Bacteria | 9993 |
| 310 | Ga0207694_10000135 | 3300025924 | Bacteria | 75715 |
| 311 | Ga0207694_10014853 | 3300025924 | Bacteria | 5873 |
| 312 | Ga0207694_10027701 | 3300025924 | Bacteria | 4316 |
| 313 | Ga0207694_10079235 | 3300025924 | Bacteria | 2576 |
| 314 | Ga0207650_10088589 | 3300025925 | Bacteria | 2361 |
| 315 | Ga0207650_10239190 | 3300025925 | Bacteria | 1467 |
| 316 | Ga0207659_10112415 | 3300025926 | Bacteria | 2073 |
| 317 | Ga0207700_10024668 | 3300025928 | Bacteria | 4165 |
| 318 | Ga0207700_10281927 | 3300025928 | Bacteria | 1429 |
| 319 | Ga0207664_10119514 | 3300025929 | Bacteria | 2203 |
| 320 | Ga0207706_10087080 | 3300025933 | Bacteria | 2746 |
| 321 | Ga0207709_10175472 | 3300025935 | Bacteria | 1508 |
| 322 | Ga0207669_10074426 | 3300025937 | Bacteria | 2148 |
| 323 | Ga0207669_10217684 | 3300025937 | Bacteria | 1399 |
| 324 | Ga0207704_10121996 | 3300025938 | Bacteria | 1786 |
| 325 | Ga0207665_10004976 | 3300025939 | Bacteria | 8868 |
| 326 | Ga0207665_10012045 | 3300025939 | Bacteria | 5677 |
| 327 | Ga0207665_10052651 | 3300025939 | Bacteria | 2743 |
| 328 | Ga0207691_10188391 | 3300025940 | Bacteria | 1800 |
| 329 | Ga0207711_10004369 | 3300025941 | Bacteria | 12058 |
| 330 | Ga0207711_10041091 | 3300025941 | Bacteria | 3937 |
| 331 | Ga0207711_10175558 | 3300025941 | Bacteria | 1946 |
| 332 | Ga0207711_10303840 | 3300025941 | Bacteria | 1472 |
| 333 | Ga0207689_10034422 | 3300025942 | Bacteria | 4208 |
| 334 | Ga0207689_10132655 | 3300025942 | Bacteria | 2050 |
| 335 | Ga0207689_10218714 | 3300025942 | Bacteria | 1574 |
| 336 | Ga0207661_10020327 | 3300025944 | Bacteria | 4961 |
| 337 | Ga0207661_10166684 | 3300025944 | Bacteria | 1915 |
| 338 | Ga0207661_10224847 | 3300025944 | Bacteria | 1660 |
| 339 | Ga0207661_10286876 | 3300025944 | Bacteria | 1472 |
| 340 | Ga0207679_10172774 | 3300025945 | Bacteria | 1781 |
| 341 | Ga0207679_10196813 | 3300025945 | Bacteria | 1681 |
| 342 | Ga0207667_10018495 | 3300025949 | Bacteria | 7812 |
| 343 | Ga0207667_10092955 | 3300025949 | Bacteria | 3115 |
| 344 | Ga0207667_10117268 | 3300025949 | Bacteria | 2744 |
| 345 | Ga0207667_10172994 | 3300025949 | Bacteria | 2219 |
| 346 | Ga0207712_10000018 | 3300025961 | Bacteria | 317921 |
| 347 | Ga0207712_10008001 | 3300025961 | Bacteria | 6684 |
| 348 | Ga0207668_10001436 | 3300025972 | Bacteria | 14033 |
| 349 | Ga0207668_10186219 | 3300025972 | Bacteria | 1641 |
| 350 | Ga0207640_10003325 | 3300025981 | Bacteria | 8660 |
| 351 | Ga0207658_10084049 | 3300025986 | Bacteria | 2448 |
| 352 | Ga0207658_10085883 | 3300025986 | Bacteria | 2425 |
| 353 | Ga0207677_10052852 | 3300026023 | Bacteria | 2762 |
| 354 | Ga0207703_10002787 | 3300026035 | Bacteria | 14941 |
| 355 | Ga0207703_10306795 | 3300026035 | Bacteria | 1449 |
| 356 | Ga0207639_10050318 | 3300026041 | Bacteria | 3164 |
| 357 | Ga0207639_10052367 | 3300026041 | Bacteria | 3111 |
| 358 | Ga0207639_10078554 | 3300026041 | Bacteria | 2605 |
| 359 | Ga0207639_10184216 | 3300026041 | Bacteria | 1778 |
| 360 | Ga0207678_10012336 | 3300026067 | Bacteria | 7504 |
| 361 | Ga0207678_10114197 | 3300026067 | Bacteria | 2304 |
| 362 | Ga0207702_10000026 | 3300026078 | Bacteria | 186067 |
| 363 | Ga0207702_10013080 | 3300026078 | Bacteria | 6900 |
| 364 | Ga0207702_10036603 | 3300026078 | Bacteria | 4106 |
| 365 | Ga0207702_10143451 | 3300026078 | Bacteria | 2164 |
| 366 | Ga0207702_10433508 | 3300026078 | Bacteria | 1273 |
| 367 | Ga0207641_10003920 | 3300026088 | Bacteria | 13015 |
| 368 | Ga0207641_10229803 | 3300026088 | Bacteria | 1724 |
| 369 | Ga0207648_10220726 | 3300026089 | Bacteria | 1685 |
| 370 | Ga0207676_10069241 | 3300026095 | Bacteria | 2825 |
| 371 | Ga0207674_10007361 | 3300026116 | Bacteria | 12820 |
| 372 | Ga0207674_10013128 | 3300026116 | Bacteria | 9219 |
| 373 | Ga0207674_10016608 | 3300026116 | Bacteria | 8049 |
| 374 | Ga0207675_100133256 | 3300026118 | Bacteria | 2356 |
| 375 | Ga0207675_100144548 | 3300026118 | Bacteria | 2261 |
| 376 | Ga0207683_10038042 | 3300026121 | Bacteria | 4191 |
| 377 | Ga0207698_10019685 | 3300026142 | Bacteria | 4626 |
| 378 | Ga0207698_10026970 | 3300026142 | Bacteria | 4072 |
| 379 | Ga0209389_1000073 | 3300027296 | Bacteria | 94298 |
| 380 | Ga0209389_1000499 | 3300027296 | Bacteria | 23605 |
| 381 | Ga0209389_1022906 | 3300027296 | Bacteria | 5524 |
| 382 | Ga0209589_1000109 | 3300027357 | Bacteria | 83533 |
| 383 | Ga0209589_1010873 | 3300027357 | Bacteria | 13087 |
| 384 | Ga0209589_1022228 | 3300027357 | Bacteria | 5439 |
| 385 | Ga0209489_100324 | 3300027361 | Bacteria | 83533 |
| 386 | Ga0209489_102828 | 3300027361 | Bacteria | 34702 |
| 387 | Ga0209489_103645 | 3300027361 | Bacteria | 29671 |
| 388 | Ga0209700_100020 | 3300027363 | Bacteria | 235733 |
| 389 | Ga0209700_100067 | 3300027363 | Bacteria | 144074 |
| 390 | Ga0209700_100355 | 3300027363 | Bacteria | 83533 |
| 391 | Ga0209813_10035300 | 3300027866 | Bacteria | 1497 |
| 392 | Ga0209813_10055054 | 3300027866 | Bacteria | 1255 |
| 393 | Ga0207428_10002040 | 3300027907 | Bacteria | 20406 |
| 394 | Ga0268266_10000753 | 3300028379 | Bacteria | 43310 |
| 395 | Ga0268266_10000988 | 3300028379 | Bacteria | 35821 |
| 396 | Ga0268266_10004630 | 3300028379 | Bacteria | 13117 |
| 397 | Ga0268266_10005789 | 3300028379 | Bacteria | 11444 |
| 398 | Ga0268266_10006566 | 3300028379 | Bacteria | 10634 |
| 399 | Ga0268266_10034991 | 3300028379 | Bacteria | 4272 |
| 400 | Ga0268266_10078465 | 3300028379 | Bacteria | 2873 |
| 401 | Ga0268266_10209867 | 3300028379 | Bacteria | 1785 |
| 402 | Ga0268266_10408797 | 3300028379 | Bacteria | 1284 |
| 403 | Ga0268265_10021152 | 3300028380 | Bacteria | 4552 |
| 404 | Ga0268265_10279408 | 3300028380 | Bacteria | 1493 |
| 405 | Ga0268265_10353526 | 3300028380 | Bacteria | 1342 |
| 406 | Ga0268264_10000020 | 3300028381 | Bacteria | 483593 |
| 407 | Ga0268264_10134897 | 3300028381 | Bacteria | 2193 |
| 408 | Ga0307515_10035428 | 3300028794 | Bacteria | 8119 |
| 409 | Ga0307515_10202499 | 3300028794 | Bacteria | 1856 |
| 410 | Ga0265338_10003763 | 3300028800 | Bacteria | 21077 |
| 411 | Ga0265339_10004949 | 3300031249 | Bacteria | 8972 |
| 412 | Ga0265316_10095519 | 3300031344 | Bacteria | 2264 |
| 413 | Ga0307513_10101376 | 3300031456 | Bacteria | 2901 |
| 414 | Ga0307513_10138748 | 3300031456 | Bacteria | 2361 |
| 415 | Ga0307509_10110283 | 3300031507 | Bacteria | 2757 |
| 416 | Ga0307508_10079818 | 3300031616 | Bacteria | 2853 |
| 417 | Ga0265314_10008989 | 3300031711 | Bacteria | 8499 |
| 418 | Ga0265342_10177626 | 3300031712 | Bacteria | 1168 |
| 419 | Ga0307516_10095609 | 3300031730 | Bacteria | 2793 |
| 420 | Ga0307516_10278264 | 3300031730 | Bacteria | 1356 |
| 421 | Ga0307413_10045378 | 3300031824 | Bacteria | 2605 |
| 422 | Ga0307407_10169319 | 3300031903 | Bacteria | 1437 |
| 423 | Ga0307409_100215466 | 3300031995 | Bacteria | 1729 |
| 424 | Ga0307414_10085914 | 3300032004 | Bacteria | 2320 |
| 425 | Ga0307411_10050896 | 3300032005 | Bacteria | 2700 |
| 426 | Ga0307415_100143713 | 3300032126 | Bacteria | 1826 |
| 427 | Ga0307415_100211728 | 3300032126 | Bacteria | 1547 |
| 428 | Ga0307510_10005921 | 3300033180 | Bacteria | 14593 |
| 429 | Ga0307510_10020259 | 3300033180 | Bacteria | 7778 |
| 430 | Ga0307510_10037404 | 3300033180 | Bacteria | 5385 |
| 431 | Ga0307510_10045259 | 3300033180 | Bacteria | 4754 |
| 432 | Ga0307510_10096754 | 3300033180 | Bacteria | 2766 |
| 433 | Ga0373923_0029849 | 3300035111 | Bacteria | 2189 |
| 434 | Ga0373936_0029461 | 3300035113 | Bacteria | 2161 |
| 435 | Ga0373945_0024596 | 3300035116 | Bacteria | 2088 |
| 436 | Ga0373927_0006364 | 3300035695 | Bacteria | 8045 |
| 437 | Ga0373927_0187066 | 3300035695 | Bacteria | 1358 |
| 438 | Ga0373933_0000631 | 3300035724 | Bacteria | 21995 |
| 439 | Ga0373947_0042928 | 3300035725 | Bacteria | 2699 |
| 440 | Ga0373937_0092287 | 3300036401 | Bacteria | 2806 |
| 441 | Ga0373925_0015322 | 3300037068 | Bacteria | 5545 |
| 442 | Ga0373925_0041371 | 3300037068 | Bacteria | 3416 |
| 443 | Ga0373925_0096883 | 3300037068 | Bacteria | 2262 |
| 444 | Ga0373925_0232545 | 3300037068 | Bacteria | 1474 |
| 445 | Ga0395898_0010290 | 3300037466 | Bacteria | 9790 |
| 446 | Ga0436364_1398367 | 3300037853 | Bacteria | 3897 |
| 447 | Ga0395901_0147427 | 3300038443 | Bacteria | 2473 |
| 448 | Ga0395901_0385094 | 3300038443 | Bacteria | 1443 |
| 449 | Ga0395901_0409343 | 3300038443 | Bacteria | 1393 |
| 450 | Ga0436365_0260840 | 3300039437 | Bacteria | 28419 |
| 451 | Ga0436365_0709051 | 3300039437 | Bacteria | 32416 |
| 452 | Ga0436365_0776418 | 3300039437 | Bacteria | 2484 |
| 453 | Ga0436365_1937261 | 3300039437 | Bacteria | 3341 |
| 454 | Ga0436360_0043776 | 3300039438 | Bacteria | 2637 |
| 455 | Ga0436360_1037574 | 3300039438 | Bacteria | 3347 |
| 456 | Ga0436361_0032524 | 3300039447 | Bacteria | 4189 |
| 457 | Ga0436361_0530867 | 3300039447 | Bacteria | 5565 |
| 458 | Ga0436361_0722566 | 3300039447 | Bacteria | 33081 |
| 459 | Ga0436361_1018093 | 3300039447 | Bacteria | 9077 |
| 460 | Ga0436363_0266154 | 3300039450 | Bacteria | 1675 |
| 461 | Ga0436362_0276427 | 3300039453 | Bacteria | 3969 |
| 462 | Ga0439440_0011149 | 3300042993 | Bacteria | 1892 |
| 463 | Ga0466969_0067574 | 3300044656 | Bacteria | 1724 |
| 464 | Ga0466972_0006316 | 3300044658 | Bacteria | 5954 |
| 465 | Ga0466972_0049620 | 3300044658 | Bacteria | 2027 |
| 466 | Ga0453683_0074572 | 3300044673 | Bacteria | 2124 |
| 467 | Ga0466965_0011225 | 3300044683 | Bacteria | 4194 |
| 468 | Ga0466966_0027865 | 3300044684 | Bacteria | 3682 |
| 469 | Ga0466961_0000650 | 3300044693 | Bacteria | 21866 |
| 470 | Ga0466961_0082998 | 3300044693 | Bacteria | 2027 |
| 471 | Ga0466963_0164962 | 3300044694 | Bacteria | 1543 |
| 472 | Ga0453684_0000015 | 3300044712 | Bacteria | 969198 |
| 473 | Ga0453684_0000020 | 3300044712 | Bacteria | 879938 |
| 474 | Ga0453684_0000189 | 3300044712 | Bacteria | 269690 |
| 475 | Ga0453684_0001541 | 3300044712 | Bacteria | 64371 |
| 476 | Ga0466968_0014484 | 3300044735 | Bacteria | 3117 |
| 477 | Ga0466957_0299000 | 3300044842 | Bacteria | 1081 |
| 478 | Ga0466960_0076811 | 3300044901 | Bacteria | 1673 |
| 479 | Ga0466959_0029074 | 3300045049 | Bacteria | 4094 |
| 480 | Ga0451576_0000064 | 3300045051 | Bacteria | 277677 |
| 481 | Ga0451576_0082586 | 3300045051 | Bacteria | 3342 |
| 482 | Ga0466967_0107400 | 3300045976 | Bacteria | 2560 |
| 483 | Ga0466967_0109755 | 3300045976 | Bacteria | 2533 |
| 484 | Ga0466967_0128217 | 3300045976 | Bacteria | 2352 |
| 485 | Ga0466967_0354963 | 3300045976 | Bacteria | 1420 |
| 486 | Ga0495590_0015942 | 3300046457 | Bacteria | 2717 |
| 487 | Ga0495629_0000802 | 3300046459 | Bacteria | 25442 |
| 488 | Ga0495629_0021757 | 3300046459 | Bacteria | 4575 |
| 489 | Ga0495629_0060639 | 3300046459 | Bacteria | 2644 |
| 490 | Ga0495629_0162149 | 3300046459 | Bacteria | 1553 |
| 491 | Ga0495638_0002608 | 3300046460 | Bacteria | 14546 |
| 492 | Ga0495638_0176896 | 3300046460 | Bacteria | 1220 |
| 493 | Ga0495641_0010430 | 3300046461 | Bacteria | 5387 |
| 494 | Ga0495651_0040589 | 3300046462 | Bacteria | 3619 |
| 495 | Ga0495651_0149874 | 3300046462 | Bacteria | 1682 |
| 496 | Ga0495580_0027757 | 3300046472 | Bacteria | 4117 |
| 497 | Ga0495662_0000007 | 3300046476 | Bacteria | 74478 |
| 498 | Ga0495662_0118781 | 3300046476 | Bacteria | 1297 |
| 499 | Ga0495664_0069271 | 3300046477 | Bacteria | 2106 |
| 500 | Ga0495664_0143167 | 3300046477 | Bacteria | 1449 |
| 501 | Ga0495664_0178979 | 3300046477 | Bacteria | 1286 |
| 502 | Ga0495584_0035572 | 3300046491 | Bacteria | 2517 |
| 503 | Ga0495585_0039034 | 3300046492 | Bacteria | 2670 |
| 504 | Ga0495607_0089407 | 3300046501 | Bacteria | 1672 |
| 505 | Ga0495606_0063710 | 3300046507 | Bacteria | 2349 |
| 506 | Ga0495618_0067517 | 3300046514 | Bacteria | 2274 |
| 507 | Ga0495630_0000084 | 3300046517 | Bacteria | 74626 |
| 508 | Ga0495630_0132205 | 3300046517 | Bacteria | 1895 |
| 509 | Ga0495632_0011028 | 3300046519 | Bacteria | 5296 |
| 510 | Ga0495643_0040821 | 3300046522 | Bacteria | 2532 |
| 511 | Ga0495648_0040512 | 3300046524 | Bacteria | 2953 |
| 512 | Ga0495640_0008550 | 3300046533 | Bacteria | 8026 |
| 513 | Ga0495640_0072701 | 3300046533 | Bacteria | 2303 |
| 514 | Ga0495586_0001213 | 3300046535 | Bacteria | 14498 |
| 515 | Ga0495586_0022557 | 3300046535 | Bacteria | 3360 |
| 516 | Ga0495587_0018343 | 3300046536 | Bacteria | 4340 |
| 517 | Ga0495597_0069534 | 3300046542 | Bacteria | 1519 |
| 518 | Ga0495668_0001264 | 3300046616 | Bacteria | 25185 |
| 519 | Ga0495668_0085005 | 3300046616 | Bacteria | 1735 |
| 520 | Ga0495634_0025791 | 3300046642 | Bacteria | 4105 |
| 521 | Ga0495634_0046164 | 3300046642 | Bacteria | 2941 |
| 522 | Ga0495625_0065166 | 3300046660 | Bacteria | 2568 |
| 523 | Ga0495625_0117708 | 3300046660 | Bacteria | 1811 |
| 524 | Ga0495635_0002250 | 3300046663 | Bacteria | 13118 |
| 525 | Ga0495635_0235717 | 3300046663 | Bacteria | 1235 |
| 526 | Ga0495657_0005609 | 3300046675 | Bacteria | 9906 |
| 527 | Ga0495658_0030781 | 3300046683 | Bacteria | 2917 |
| 528 | Ga0495669_0081029 | 3300046684 | Bacteria | 1489 |
| 529 | Ga0495613_0046879 | 3300046689 | Bacteria | 3194 |
| 530 | Ga0495624_0005463 | 3300046690 | Bacteria | 9158 |
| 531 | Ga0495671_0027080 | 3300046692 | Bacteria | 2963 |
| 532 | Ga0495671_0064012 | 3300046692 | Bacteria | 1811 |
| 533 | Ga0495649_0055835 | 3300046694 | Bacteria | 2133 |
| 534 | Ga0495581_0000215 | 3300047315 | Bacteria | 27092 |
| 535 | Ga0495581_0028632 | 3300047315 | Bacteria | 3230 |
| 536 | Ga0495604_0039547 | 3300047317 | Bacteria | 3706 |
| 537 | Ga0495604_0156580 | 3300047317 | Bacteria | 1613 |
| 538 | Ga0495674_0057386 | 3300047319 | Bacteria | 3407 |
| 539 | Ga0495672_0007893 | 3300047320 | Bacteria | 7938 |
| 540 | Ga0495676_0001102 | 3300047321 | Bacteria | 22909 |
| 541 | Ga0495676_0001503 | 3300047321 | Bacteria | 20169 |
| 542 | Ga0495676_0014528 | 3300047321 | Bacteria | 7045 |
| 543 | Ga0495680_0047336 | 3300047322 | Bacteria | 3383 |
| 544 | Ga0495680_0086605 | 3300047322 | Bacteria | 2357 |
| 545 | Ga0495683_0055034 | 3300047323 | Bacteria | 1981 |
| 546 | Ga0495683_0073936 | 3300047323 | Bacteria | 1671 |
| 547 | Ga0495687_002707 | 3300047443 | Bacteria | 13752 |
| 548 | Ga0495684_0031594 | 3300047471 | Bacteria | 4066 |
| 549 | Ga0495684_0090398 | 3300047471 | Bacteria | 2319 |
| 550 | Ga0495686_0179441 | 3300047472 | Bacteria | 1228 |
| 551 | Ga0495593_0060777 | 3300047673 | Bacteria | 1978 |
| 552 | Ga0495602_0119845 | 3300048088 | Bacteria | 2119 |
| 553 | Ga0496100_0200756 | 3300048903 | Bacteria | 1453 |
| 554 | Ga0496101_0310336 | 3300048904 | Bacteria | 1236 |
| 555 | Ga0496102_0226549 | 3300048905 | Bacteria | 1762 |
| 556 | Ga0496102_0362803 | 3300048905 | Bacteria | 1364 |
| 557 | Ga0496103_0118490 | 3300048906 | Bacteria | 1685 |
| 558 | Ga0496103_0225630 | 3300048906 | Bacteria | 1205 |
| 559 | Ga0496104_0001100 | 3300048907 | Bacteria | 23122 |
| 560 | Ga0496104_0019891 | 3300048907 | Bacteria | 6148 |
| 561 | Ga0496104_0054854 | 3300048907 | Bacteria | 3767 |
| 562 | Ga0496104_0145826 | 3300048907 | Bacteria | 2273 |
| 563 | Ga0496105_0001328 | 3300048908 | Bacteria | 17320 |
| 564 | Ga0496105_0028575 | 3300048908 | Bacteria | 4560 |
| 565 | Ga0496105_0340748 | 3300048908 | Bacteria | 1199 |
| 566 | Ga0496106_0000790 | 3300048909 | Bacteria | 22889 |
| 567 | Ga0496108_0174484 | 3300048911 | Bacteria | 1860 |
| 568 | Ga0496109_0020657 | 3300048912 | Bacteria | 5817 |
| 569 | Ga0496109_0174024 | 3300048912 | Bacteria | 2020 |
| 570 | Ga0496109_0247428 | 3300048912 | Bacteria | 1679 |
| 571 | Ga0496109_0366271 | 3300048912 | Bacteria | 1361 |
| 572 | Ga0496110_0018064 | 3300048913 | Bacteria | 5907 |
| 573 | Ga0496110_0122141 | 3300048913 | Bacteria | 2347 |
| 574 | Ga0496110_0247899 | 3300048913 | Bacteria | 1621 |
| 575 | Ga0496111_0099208 | 3300048914 | Bacteria | 2139 |
| 576 | Ga0496112_0022886 | 3300048915 | Bacteria | 5961 |
| 577 | Ga0496112_0147312 | 3300048915 | Bacteria | 2322 |
| 578 | Ga0496112_0287943 | 3300048915 | Bacteria | 1589 |
| 579 | Ga0496113_0013688 | 3300048916 | Bacteria | 5508 |
| 580 | Ga0496113_0096975 | 3300048916 | Bacteria | 2280 |
| 581 | Ga0496115_0081514 | 3300048918 | Bacteria | 2635 |
| 582 | Ga0496117_0039826 | 3300048920 | Bacteria | 3464 |
| 583 | Ga0496117_0064200 | 3300048920 | Bacteria | 2505 |
| 584 | Ga0496117_0088948 | 3300048920 | Bacteria | 1996 |
| 585 | Ga0496117_0100016 | 3300048920 | Bacteria | 1838 |
| 586 | Ga0496117_0193540 | 3300048920 | Bacteria | 1155 |
| 587 | Ga0496118_0058896 | 3300048921 | Bacteria | 2866 |
| 588 | Ga0496118_0072504 | 3300048921 | Bacteria | 2473 |
| 589 | Ga0496118_0192147 | 3300048921 | Bacteria | 1219 |
| 590 | Ga0496119_0002808 | 3300048922 | Bacteria | 18643 |
| 591 | Ga0496119_0017343 | 3300048922 | Bacteria | 5419 |
| 592 | Ga0496119_0071497 | 3300048922 | Bacteria | 2030 |
| 593 | Ga0496119_0136104 | 3300048922 | Bacteria | 1332 |
| 594 | Ga0496120_0002057 | 3300048923 | Bacteria | 21720 |
| 595 | Ga0496120_0003504 | 3300048923 | Bacteria | 14221 |
| 596 | Ga0496121_0001681 | 3300048924 | Bacteria | 36391 |
| 597 | Ga0496121_0003198 | 3300048924 | Bacteria | 23590 |
| 598 | Ga0496121_0013165 | 3300048924 | Bacteria | 8921 |
| 599 | Ga0496121_0039756 | 3300048924 | Bacteria | 4137 |
| 600 | Ga0496122_0005867 | 3300048925 | Bacteria | 14392 |
| 601 | Ga0496122_0012846 | 3300048925 | Bacteria | 8282 |
| 602 | Ga0496123_0020115 | 3300048926 | Bacteria | 5235 |
| 603 | Ga0496124_0002423 | 3300048927 | Bacteria | 24474 |
| 604 | Ga0496125_0005360 | 3300048928 | Bacteria | 14304 |
| 605 | Ga0496125_0031413 | 3300048928 | Bacteria | 4734 |
| 606 | Ga0496125_0048054 | 3300048928 | Bacteria | 3562 |
| 607 | Ga0496126_0018165 | 3300048929 | Bacteria | 6977 |
| 608 | Ga0496126_0039823 | 3300048929 | Bacteria | 4358 |
| 609 | Ga0496126_0094472 | 3300048929 | Bacteria | 2624 |
| 610 | Ga0496126_0127584 | 3300048929 | Bacteria | 2200 |
| 611 | Ga0496126_0196048 | 3300048929 | Bacteria | 1708 |
| 612 | Ga0495682_0036994 | 3300049460 | Bacteria | 1796 |
| 613 | Ga0501031_0017580 | 3300049568 | Bacteria | 4648 |
| 614 | Ga0501033_0000590 | 3300049570 | Bacteria | 33630 |
| 615 | Ga0501034_0000076 | 3300049571 | Bacteria | 174683 |
| 616 | Ga0501034_0376913 | 3300049571 | Bacteria | 1344 |
| 617 | Ga0501034_0401557 | 3300049571 | Bacteria | 1293 |
| 618 | Ga0501036_0211551 | 3300049572 | Bacteria | 1629 |
| 619 | Ga0501037_0008987 | 3300049573 | Bacteria | 7319 |
| 620 | Ga0501037_0010911 | 3300049573 | Bacteria | 6677 |
| 621 | Ga0501038_0037761 | 3300049574 | Bacteria | 4234 |
| 622 | Ga0501039_0013969 | 3300049575 | Bacteria | 6145 |
| 623 | Ga0501039_0136096 | 3300049575 | Bacteria | 1929 |
| 624 | Ga0501043_0052081 | 3300049579 | Bacteria | 3216 |
| 625 | Ga0501047_0014216 | 3300049581 | Bacteria | 7566 |
| 626 | Ga0501047_0022387 | 3300049581 | Bacteria | 6069 |
| 627 | Ga0501047_0088578 | 3300049581 | Bacteria | 2972 |
| 628 | Ga0501048_0014790 | 3300049582 | Bacteria | 5772 |
| 629 | Ga0501070_0094918 | 3300049586 | Bacteria | 2468 |
| 630 | Ga0501073_0025069 | 3300049589 | Bacteria | 4281 |
| 631 | Ga0501080_0000004 | 3300049742 | Bacteria | 180905 |
| 632 | Ga0501080_0195352 | 3300049742 | Bacteria | 1859 |
| 633 | Ga0501081_0075408 | 3300049743 | Bacteria | 2355 |
| 634 | Ga0501035_0000191 | 3300049822 | Bacteria | 75056 |
| 635 | Ga0501044_0000227 | 3300049823 | Bacteria | 70875 |
| 636 | Ga0501044_0004541 | 3300049823 | Bacteria | 15516 |
| 637 | Ga0501044_0256981 | 3300049823 | Bacteria | 1686 |
| 638 | nmdc:mga03n38_204_c1 | 3300050490 | Bacteria | 13570 |
| 639 | nmdc:mga0yw44_132069_c1 | 3300050492 | Bacteria | 1617 |
| 640 | nmdc:mga0yw44_15076_c1 | 3300050492 | Bacteria | 4127 |
| 641 | nmdc:mga0yw44_170290_c1 | 3300050492 | Bacteria | 1430 |
| 642 | nmdc:mga0yw44_181974_c1 | 3300050492 | Bacteria | 1384 |
| 643 | nmdc:mga0yw44_72652_c1 | 3300050492 | Bacteria | 2139 |
| 644 | nmdc:mga0k408_42943_c1 | 3300050493 | Bacteria | 2604 |
| 645 | nmdc:mga0k408_82863_c1 | 3300050493 | Bacteria | 1880 |
| 646 | nmdc:mga06z11_205046_c1 | 3300050494 | Bacteria | 1147 |
| 647 | nmdc:mga06z11_24442_c1 | 3300050494 | Bacteria | 2850 |
| 648 | nmdc:mga06z11_38395_c1 | 3300050494 | Bacteria | 2378 |
| 649 | nmdc:mga04h51_15680_c1 | 3300050495 | Bacteria | 2187 |
| 650 | nmdc:mga04h51_65800_c1 | 3300050495 | Bacteria | 1254 |
| 651 | nmdc:mga07m45_33634_c1 | 3300050496 | Bacteria | 2848 |
| 652 | nmdc:mga07m45_751_c1 | 3300050496 | Bacteria | 5066 |
| 653 | nmdc:mga0qj67_291146_c1 | 3300050509 | Bacteria | 1323 |
| 654 | nmdc:mga06r32_109674_c1 | 3300050510 | Bacteria | 2714 |
| 655 | nmdc:mga08y16_164079_c1 | 3300050511 | Bacteria | 2308 |
| 656 | nmdc:mga08y16_514_c1 | 3300050511 | Bacteria | 35764 |
| 657 | nmdc:mga0rr50_170102_c1 | 3300050513 | Bacteria | 1775 |
| 658 | nmdc:mga0sz30_18837_c1 | 3300050516 | Bacteria | 2767 |
| 659 | Ga0500643_001125 | 3300053087 | Bacteria | 15957 |
| 660 | Ga0500646_0025209 | 3300053090 | Bacteria | 1605 |
| 661 | Ga0500651_0013310 | 3300053093 | Bacteria | 5010 |
| 662 | Ga0500566_0000232 | 3300053094 | Bacteria | 29876 |
| 663 | Ga0500640_023559 | 3300053095 | Bacteria | 2668 |
| 664 | Ga0500555_011850 | 3300053103 | Bacteria | 2508 |
| 665 | Ga0500557_000036 | 3300053105 | Bacteria | 71169 |
| 666 | Ga0500562_015703 | 3300053108 | Bacteria | 1943 |
| 667 | Ga0500572_004823 | 3300053111 | Bacteria | 3056 |
| 668 | Ga0500595_000218 | 3300053119 | Bacteria | 39105 |
| 669 | Ga0500607_093658 | 3300053121 | Bacteria | 1506 |
| 670 | Ga0500642_0000122 | 3300053130 | Bacteria | 35651 |
| 671 | Ga0500642_0001048 | 3300053130 | Bacteria | 7975 |
| 672 | Ga0500655_009118 | 3300053133 | Bacteria | 1786 |
| 673 | Ga0500658_0032893 | 3300053134 | Bacteria | 2036 |
| 674 | Ga0500658_0048764 | 3300053134 | Bacteria | 1723 |
| 675 | Ga0500568_0011572 | 3300053139 | Bacteria | 4085 |
| 676 | Ga0500573_0000003 | 3300053140 | Bacteria | 355643 |
| 677 | Ga0500586_000362 | 3300053145 | Bacteria | 9030 |
| 678 | Ga0500590_062055 | 3300053148 | Bacteria | 1876 |
| 679 | Ga0500603_001454 | 3300053150 | Bacteria | 5401 |
| 680 | Ga0500604_0002821 | 3300053151 | Bacteria | 4717 |
| 681 | Ga0500616_0020064 | 3300053153 | Bacteria | 3757 |
| 682 | Ga0500622_0012277 | 3300053156 | Bacteria | 4644 |
| 683 | Ga0500630_012678 | 3300053159 | Bacteria | 4153 |
| 684 | Ga0500638_000841 | 3300053162 | Bacteria | 8559 |
| 685 | Ga0500638_070655 | 3300053162 | Bacteria | 1669 |
| 686 | Ga0500639_027833 | 3300053163 | Bacteria | 2986 |
| 687 | Ga0500636_0044126 | 3300053177 | Bacteria | 2630 |
| 688 | Ga0500637_0120120 | 3300053178 | Bacteria | 1524 |
| 689 | Ga0500645_010068 | 3300053730 | Bacteria | 3145 |
| 690 | Ga0500596_000723 | 3300053735 | Bacteria | 6467 |
| 691 | Ga0500596_004089 | 3300053735 | Bacteria | 2704 |
| 692 | Ga0501082_0029242 | 3300060353 | Bacteria | 4746 |
| 693 | Ga0466962_0057131 | 3300061719 | Bacteria | 1863 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048928 | Ga0496125_0031413 | Ga0496125_0031413_2391_3245 | 270 |
| 2 | 3300050492 | nmdc:mga0yw44_15076_c1 | nmdc:mga0yw44_15076_c1_18_935 | 284 |
| 3 | 3300044673 | Ga0453683_0074572 | Ga0453683_0074572_61_1035 | 311 |
| 4 | 3300047321 | Ga0495676_0001102 | Ga0495676_0001102_13619_14572 | 315 |
| 5 | 3300046459 | Ga0495629_0000802 | Ga0495629_0000802_7717_8676 | 317 |
| 6 | 3300046461 | Ga0495641_0010430 | Ga0495641_0010430_3558_4517 | 317 |
| 7 | 3300046476 | Ga0495662_0000007 | Ga0495662_0000007_15790_16749 | 317 |
| 8 | 3300046477 | Ga0495664_0069271 | Ga0495664_0069271_992_1951 | 317 |
| 9 | 3300046517 | Ga0495630_0000084 | Ga0495630_0000084_4868_5827 | 317 |
| 10 | 3300046535 | Ga0495586_0001213 | Ga0495586_0001213_8293_9252 | 317 |
| 11 | 3300046642 | Ga0495634_0025791 | Ga0495634_0025791_2062_3021 | 317 |
| 12 | 3300046690 | Ga0495624_0005463 | Ga0495624_0005463_1469_2428 | 317 |
| 13 | 3300047315 | Ga0495581_0000215 | Ga0495581_0000215_23796_24755 | 317 |
| 14 | 3300047319 | Ga0495674_0057386 | Ga0495674_0057386_1155_2114 | 317 |
| 15 | 3300047321 | Ga0495676_0001503 | Ga0495676_0001503_3897_4856 | 317 |
| 16 | 3300047322 | Ga0495680_0086605 | Ga0495680_0086605_142_1101 | 317 |
| 17 | 3300005616 | Ga0068852_100289984 | Ga0068852_1002899842 | 319 |
| 18 | iso_pu_bacteria | 2513237137 | 2513862239 | 321 |
| 19 | iso_pu_bacteria | 2513237137 | 2513864074 | 321 |
| 20 | iso_pu_bacteria | 2513237101 | 2513695350 | 322 |
| 21 | iso_pu_bacteria | 2513237101 | 2513698568 | 322 |
| 22 | iso_pu_bacteria | 8016622563 | 8016624576 | 322 |
| 23 | iso_pu_bacteria | 8019678201 | 8019686532 | 322 |
| 24 | 3300044842 | Ga0466957_0299000 | Ga0466957_0299000_83_1066 | 326 |
| 25 | 3300046517 | Ga0495630_0132205 | Ga0495630_0132205_902_1885 | 326 |
| 26 | iso_pu_bacteria | 2885409591 | 2885414063 | 326 |
| 27 | iso_pu_bacteria | 2956939328 | 2956941609 | 326 |
| 28 | iso_pu_bacteria | 3001119090 | 3001119977 | 326 |
| 29 | 3300006846 | Ga0075430_100140342 | Ga0075430_1001403421 | 328 |
| 30 | 3300009094 | Ga0111539_10043845 | Ga0111539_100438452 | 328 |
| 31 | 3300050511 | nmdc:mga08y16_164079_c1 | nmdc:mga08y16_164079_c1_356_1393 | 328 |
| 32 | 3300009553 | Ga0105249_10000013 | Ga0105249_10000013162 | 329 |
| 33 | 3300025961 | Ga0207712_10000018 | Ga0207712_10000018130 | 329 |
| 34 | 3300005471 | Ga0070698_100026493 | Ga0070698_1000264937 | 330 |
| 35 | 3300006178 | Ga0075367_10104626 | Ga0075367_101046262 | 330 |
| 36 | 3300031903 | Ga0307407_10169319 | Ga0307407_101693192 | 330 |
| 37 | 3300031995 | Ga0307409_100215466 | Ga0307409_1002154661 | 330 |
| 38 | 3300032004 | Ga0307414_10085914 | Ga0307414_100859143 | 330 |
| 39 | 3300032126 | Ga0307415_100143713 | Ga0307415_1001437132 | 330 |
| 40 | 3300044683 | Ga0466965_0011225 | Ga0466965_0011225_2618_3658 | 330 |
| 41 | 3300044694 | Ga0466963_0164962 | Ga0466963_0164962_374_1420 | 330 |
| 42 | 3300045976 | Ga0466967_0128217 | Ga0466967_0128217_537_1583 | 330 |
| 43 | 3300045976 | Ga0466967_0354963 | Ga0466967_0354963_289_1332 | 330 |
| 44 | 3300048922 | Ga0496119_0071497 | Ga0496119_0071497_506_1504 | 330 |
| 45 | iso_pu_bacteria | 2885409591 | 2885412410 | 330 |
| 46 | 3300021361 | Ga0213872_10002000 | Ga0213872_100020003 | 335 |
| 47 | 3300031712 | Ga0265342_10177626 | Ga0265342_101776261 | 335 |
| 48 | 3300039447 | Ga0436361_0032524 | Ga0436361_0032524_1364_2371 | 335 |
| 49 | 3300021361 | Ga0213872_10062062 | Ga0213872_100620622 | 336 |
| 50 | 3300039447 | Ga0436361_1018093 | Ga0436361_1018093_7466_8476 | 336 |
| 51 | 3300006844 | Ga0075428_100336341 | Ga0075428_1003363412 | 337 |
| 52 | 3300050509 | nmdc:mga0qj67_291146_c1 | nmdc:mga0qj67_291146_c1_11_1108 | 337 |
| 53 | 3300005563 | Ga0068855_100079863 | Ga0068855_1000798634 | 338 |
| 54 | 3300003214 | JGI25165J46597_1000013 | JGI25165J46597_100001372 | 340 |
| 55 | 3300025261 | Ga0209233_1000013 | Ga0209233_1000013326 | 340 |
| 56 | iso_pu_bacteria | 2879142872 | 2879144577 | 341 |
| 57 | 3300025913 | Ga0207695_10089189 | Ga0207695_100891892 | 343 |
| 58 | iso_pu_bacteria | 2876761206 | 2876762135 | 344 |
| 59 | iso_pu_bacteria | 2876761206 | 2876768620 | 344 |
| 60 | iso_pu_bacteria | 8019608314 | 8019608886 | 344 |
| 61 | 3300009094 | Ga0111539_10007940 | Ga0111539_100079405 | 345 |
| 62 | 3300025961 | Ga0207712_10008001 | Ga0207712_100080016 | 345 |
| 63 | 3300027907 | Ga0207428_10002040 | Ga0207428_1000204012 | 345 |
| 64 | 3300046616 | Ga0495668_0001264 | Ga0495668_0001264_11418_12485 | 345 |
| 65 | 3300050511 | nmdc:mga08y16_514_c1 | nmdc:mga08y16_514_c1_11547_12587 | 345 |
| 66 | iso_pu_bacteria | 2744054633 | 2745082491 | 345 |
| 67 | 3300005329 | Ga0070683_100065692 | Ga0070683_1000656922 | 346 |
| 68 | 3300005535 | Ga0070684_100051351 | Ga0070684_1000513512 | 346 |
| 69 | 3300005564 | Ga0070664_100167199 | Ga0070664_1001671992 | 346 |
| 70 | 3300025944 | Ga0207661_10286876 | Ga0207661_102868762 | 346 |
| 71 | 3300025945 | Ga0207679_10172774 | Ga0207679_101727742 | 346 |
| 72 | 3300031711 | Ga0265314_10008989 | Ga0265314_100089894 | 346 |
| 73 | 3300061719 | Ga0466962_0057131 | Ga0466962_0057131_340_1380 | 346 |
| 74 | 3300049742 | Ga0501080_0195352 | Ga0501080_0195352_625_1677 | 347 |
| 75 | 3300050510 | nmdc:mga06r32_109674_c1 | nmdc:mga06r32_109674_c1_968_2023 | 347 |
| 76 | iso_pu_bacteria | 2721755755 | 2723847429 | 347 |
| 77 | iso_pu_bacteria | 2919166419 | 2919169399 | 347 |
| 78 | iso_pu_bacteria | 8019638758 | 8019647649 | 347 |
| 79 | 3300005985 | Ga0081539_10017941 | Ga0081539_100179414 | 348 |
| 80 | iso_pu_bacteria | 2513237084 | 2513570684 | 348 |
| 81 | iso_pu_bacteria | 2513237093 | 2513632189 | 348 |
| 82 | iso_pu_bacteria | 2643221580 | 2643911506 | 348 |
| 83 | iso_pu_bacteria | 2643221674 | 2644410284 | 348 |
| 84 | iso_pu_bacteria | 2791355265 | 2793356519 | 348 |
| 85 | iso_pu_bacteria | 2838680041 | 2838680629 | 348 |
| 86 | iso_pu_bacteria | 2838694306 | 2838695338 | 348 |
| 87 | iso_pu_bacteria | 2838707686 | 2838708714 | 348 |
| 88 | iso_pu_bacteria | 2842077413 | 2842080051 | 348 |
| 89 | iso_pu_bacteria | 2842118031 | 2842120670 | 348 |
| 90 | iso_pu_bacteria | 2842237096 | 2842238126 | 348 |
| 91 | iso_pu_bacteria | 2842291075 | 2842293711 | 348 |
| 92 | iso_pu_bacteria | 2842370503 | 2842371092 | 348 |
| 93 | iso_pu_bacteria | 2842377471 | 2842380108 | 348 |
| 94 | iso_pu_bacteria | 2842384541 | 2842387179 | 348 |
| 95 | iso_pu_bacteria | 2935894831 | 2935895861 | 348 |
| 96 | iso_pu_bacteria | 8018127388 | 8018133170 | 348 |
| 97 | 3300003323 | rootH1_10176606 | rootH1_101766065 | 349 |
| 98 | 3300013306 | Ga0163162_10163423 | Ga0163162_101634232 | 349 |
| 99 | 3300013308 | Ga0157375_10187982 | Ga0157375_101879822 | 349 |
| 100 | 3300046491 | Ga0495584_0035572 | Ga0495584_0035572_1191_2249 | 349 |
| 101 | iso_pu_bacteria | 2713897090 | 2715499199 | 349 |
| 102 | iso_pu_bacteria | 2920822456 | 2920828869 | 349 |
| 103 | iso_pu_bacteria | 2939669807 | 2939669940 | 349 |
| 104 | iso_pu_bacteria | 2996887358 | 2996891329 | 349 |
| 105 | iso_pu_bacteria | 8005258706 | 8005263873 | 349 |
| 106 | iso_pu_bacteria | 8005321885 | 8005325856 | 349 |
| 107 | iso_pu_bacteria | 8049293176 | 8049299043 | 349 |
| 108 | 3300002773 | JGI25152J39213_1001710 | JGI25152J39213_100171010 | 350 |
| 109 | 3300003215 | JGI25153J46596_10009473 | JGI25153J46596_100094732 | 350 |
| 110 | 3300003771 | Ga0055526_1002123 | Ga0055526_100212315 | 350 |
| 111 | 3300003775 | Ga0055524_1005522 | Ga0055524_10055222 | 350 |
| 112 | 3300003775 | Ga0055524_1008938 | Ga0055524_10089382 | 350 |
| 113 | 3300003790 | Ga0055528_1003908 | Ga0055528_10039082 | 350 |
| 114 | 3300003792 | Ga0055540_1016113 | Ga0055540_10161133 | 350 |
| 115 | 3300003792 | Ga0055540_1018664 | Ga0055540_10186642 | 350 |
| 116 | 3300005262 | Ga0065165_1040874 | Ga0065165_10408741 | 350 |
| 117 | 3300005327 | Ga0070658_10013687 | Ga0070658_100136875 | 350 |
| 118 | 3300005353 | Ga0070669_100069635 | Ga0070669_1000696352 | 350 |
| 119 | 3300006186 | Ga0075369_10021966 | Ga0075369_100219662 | 350 |
| 120 | 3300009093 | Ga0105240_10004736 | Ga0105240_100047364 | 350 |
| 121 | 3300010375 | Ga0105239_10027032 | Ga0105239_100270326 | 350 |
| 122 | 3300025258 | Ga0209129_1000508 | Ga0209129_100050824 | 350 |
| 123 | 3300025273 | Ga0209673_1002931 | Ga0209673_10029317 | 350 |
| 124 | 3300025273 | Ga0209673_1026617 | Ga0209673_10266172 | 350 |
| 125 | 3300025295 | Ga0209564_1000262 | Ga0209564_100026241 | 350 |
| 126 | 3300025295 | Ga0209564_1003511 | Ga0209564_10035115 | 350 |
| 127 | 3300025297 | Ga0209758_1000774 | Ga0209758_100077417 | 350 |
| 128 | 3300025299 | Ga0209256_1004330 | Ga0209256_10043305 | 350 |
| 129 | 3300025299 | Ga0209256_1017028 | Ga0209256_10170282 | 350 |
| 130 | 3300025302 | Ga0207426_1030563 | Ga0207426_10305631 | 350 |
| 131 | 3300025303 | Ga0209051_1004348 | Ga0209051_10043487 | 350 |
| 132 | 3300025909 | Ga0207705_10009587 | Ga0207705_100095873 | 350 |
| 133 | 3300025913 | Ga0207695_10006751 | Ga0207695_100067519 | 350 |
| 134 | 3300048920 | Ga0496117_0039826 | Ga0496117_0039826_532_1608 | 350 |
| 135 | 3300048921 | Ga0496118_0192147 | Ga0496118_0192147_97_1173 | 350 |
| 136 | 3300048922 | Ga0496119_0017343 | Ga0496119_0017343_3020_4126 | 350 |
| 137 | 3300048923 | Ga0496120_0002057 | Ga0496120_0002057_7868_8974 | 350 |
| 138 | 3300048924 | Ga0496121_0013165 | Ga0496121_0013165_5457_6533 | 350 |
| 139 | 3300048925 | Ga0496122_0005867 | Ga0496122_0005867_9999_11075 | 350 |
| 140 | 3300048926 | Ga0496123_0020115 | Ga0496123_0020115_2264_3340 | 350 |
| 141 | 3300048928 | Ga0496125_0005360 | Ga0496125_0005360_6332_7408 | 350 |
| 142 | iso_pu_bacteria | 2510917030 | 2511194002 | 350 |
| 143 | iso_pu_bacteria | 2582581298 | 2585223301 | 350 |
| 144 | iso_pu_bacteria | 2585427529 | 2585546103 | 350 |
| 145 | iso_pu_bacteria | 2903727486 | 2903731960 | 350 |
| 146 | iso_pu_bacteria | 2919100787 | 2919101820 | 350 |
| 147 | iso_pu_bacteria | 2935769743 | 2935777514 | 350 |
| 148 | iso_pu_bacteria | 2935777560 | 2935781075 | 350 |
| 149 | 3300026118 | Ga0207675_100133256 | Ga0207675_1001332562 | 351 |
| 150 | 3300031344 | Ga0265316_10095519 | Ga0265316_100955192 | 351 |
| 151 | 3300042993 | Ga0439440_0011149 | Ga0439440_0011149_816_1874 | 351 |
| 152 | 3300046477 | Ga0495664_0143167 | Ga0495664_0143167_380_1438 | 351 |
| 153 | 3300049568 | Ga0501031_0017580 | Ga0501031_0017580_1067_2140 | 351 |
| 154 | 3300049573 | Ga0501037_0008987 | Ga0501037_0008987_2441_3514 | 351 |
| 155 | 3300049574 | Ga0501038_0037761 | Ga0501038_0037761_2929_4002 | 351 |
| 156 | 3300049575 | Ga0501039_0013969 | Ga0501039_0013969_378_1451 | 351 |
| 157 | iso_pu_bacteria | 2507262055 | 2507507092 | 351 |
| 158 | iso_pu_bacteria | 2508501009 | 2508541071 | 351 |
| 159 | iso_pu_bacteria | 2511231028 | 2511399068 | 351 |
| 160 | iso_pu_bacteria | 2513237092 | 2513628095 | 351 |
| 161 | iso_pu_bacteria | 2513237095 | 2513646089 | 351 |
| 162 | iso_pu_bacteria | 2517093001 | 2517103451 | 351 |
| 163 | iso_pu_bacteria | 2517093001 | 2517106454 | 351 |
| 164 | iso_pu_bacteria | 2524023205 | 2524440984 | 351 |
| 165 | iso_pu_bacteria | 2524023205 | 2524443045 | 351 |
| 166 | iso_pu_bacteria | 2744054633 | 2745079700 | 351 |
| 167 | iso_pu_bacteria | 2816332527 | 2818243858 | 351 |
| 168 | iso_pu_bacteria | 2824600985 | 2824603203 | 351 |
| 169 | iso_pu_bacteria | 2824609381 | 2824613697 | 351 |
| 170 | iso_pu_bacteria | 2824617872 | 2824620616 | 351 |
| 171 | iso_pu_bacteria | 2824617872 | 2824621209 | 351 |
| 172 | iso_pu_bacteria | 2824626560 | 2824629678 | 351 |
| 173 | iso_pu_bacteria | 2824626560 | 2824630212 | 351 |
| 174 | iso_pu_bacteria | 2824635225 | 2824636412 | 351 |
| 175 | iso_pu_bacteria | 2824635225 | 2824636987 | 351 |
| 176 | iso_pu_bacteria | 2824644064 | 2824644831 | 351 |
| 177 | iso_pu_bacteria | 2824644064 | 2824646030 | 351 |
| 178 | iso_pu_bacteria | 2824661429 | 2824664415 | 351 |
| 179 | iso_pu_bacteria | 2824661429 | 2824669234 | 351 |
| 180 | iso_pu_bacteria | 2824696289 | 2824696687 | 351 |
| 181 | iso_pu_bacteria | 2824714736 | 2824715305 | 351 |
| 182 | iso_pu_bacteria | 2824714736 | 2824716933 | 351 |
| 183 | iso_pu_bacteria | 2824723954 | 2824724618 | 351 |
| 184 | iso_pu_bacteria | 2824723954 | 2824725418 | 351 |
| 185 | iso_pu_bacteria | 2824746037 | 2824747884 | 351 |
| 186 | iso_pu_bacteria | 2824753945 | 2824755332 | 351 |
| 187 | iso_pu_bacteria | 2824773399 | 2824776843 | 351 |
| 188 | iso_pu_bacteria | 2841957949 | 2841959165 | 351 |
| 189 | iso_pu_bacteria | 2844315083 | 2844322502 | 351 |
| 190 | iso_pu_bacteria | 2849076700 | 2849077680 | 351 |
| 191 | iso_pu_bacteria | 2849076700 | 2849077757 | 351 |
| 192 | iso_pu_bacteria | 2857509624 | 2857510911 | 351 |
| 193 | iso_pu_bacteria | 2876761206 | 2876761804 | 351 |
| 194 | iso_pu_bacteria | 2876761206 | 2876761830 | 351 |
| 195 | iso_pu_bacteria | 2879099564 | 2879102801 | 351 |
| 196 | iso_pu_bacteria | 2879127579 | 2879128053 | 351 |
| 197 | iso_pu_bacteria | 2879142872 | 2879143381 | 351 |
| 198 | iso_pu_bacteria | 2881364244 | 2881364409 | 351 |
| 199 | iso_pu_bacteria | 2881665667 | 2881667554 | 351 |
| 200 | iso_pu_bacteria | 2888378607 | 2888382749 | 351 |
| 201 | iso_pu_bacteria | 2888388044 | 2888388557 | 351 |
| 202 | iso_pu_bacteria | 2888388044 | 2888395026 | 351 |
| 203 | iso_pu_bacteria | 2903727486 | 2903733672 | 351 |
| 204 | iso_pu_bacteria | 2906602504 | 2906609030 | 351 |
| 205 | iso_pu_bacteria | 2906626472 | 2906628713 | 351 |
| 206 | iso_pu_bacteria | 2922368715 | 2922376414 | 351 |
| 207 | iso_pu_bacteria | 2922393267 | 2922399211 | 351 |
| 208 | iso_pu_bacteria | 2932784394 | 2932792610 | 351 |
| 209 | iso_pu_bacteria | 2932794094 | 2932800968 | 351 |
| 210 | iso_pu_bacteria | 2932801729 | 2932804620 | 351 |
| 211 | iso_pu_bacteria | 2932809354 | 2932809779 | 351 |
| 212 | iso_pu_bacteria | 2932809354 | 2932815283 | 351 |
| 213 | iso_pu_bacteria | 2932818245 | 2932818476 | 351 |
| 214 | iso_pu_bacteria | 2932818245 | 2932824437 | 351 |
| 215 | iso_pu_bacteria | 2932818245 | 2932827284 | 351 |
| 216 | iso_pu_bacteria | 2932828146 | 2932828583 | 351 |
| 217 | iso_pu_bacteria | 2932828146 | 2932832164 | 351 |
| 218 | iso_pu_bacteria | 2935608549 | 2935610538 | 351 |
| 219 | iso_pu_bacteria | 2935616580 | 2935622102 | 351 |
| 220 | iso_pu_bacteria | 2935638405 | 2935638977 | 351 |
| 221 | iso_pu_bacteria | 2935665750 | 2935666171 | 351 |
| 222 | iso_pu_bacteria | 2935665750 | 2935669197 | 351 |
| 223 | iso_pu_bacteria | 2935675223 | 2935676783 | 351 |
| 224 | iso_pu_bacteria | 2935675223 | 2935683245 | 351 |
| 225 | iso_pu_bacteria | 2935675223 | 2935684376 | 351 |
| 226 | iso_pu_bacteria | 2935684952 | 2935685172 | 351 |
| 227 | iso_pu_bacteria | 2935684952 | 2935692186 | 351 |
| 228 | iso_pu_bacteria | 2935694250 | 2935694861 | 351 |
| 229 | iso_pu_bacteria | 2935694250 | 2935702409 | 351 |
| 230 | iso_pu_bacteria | 2935703347 | 2935703984 | 351 |
| 231 | iso_pu_bacteria | 2935703347 | 2935708727 | 351 |
| 232 | iso_pu_bacteria | 2935713505 | 2935713725 | 351 |
| 233 | iso_pu_bacteria | 2935713505 | 2935720576 | 351 |
| 234 | iso_pu_bacteria | 2935722832 | 2935724344 | 351 |
| 235 | iso_pu_bacteria | 2935722832 | 2935729857 | 351 |
| 236 | iso_pu_bacteria | 2935732158 | 2935733298 | 351 |
| 237 | iso_pu_bacteria | 2935732158 | 2935739161 | 351 |
| 238 | iso_pu_bacteria | 2935741537 | 2935742677 | 351 |
| 239 | iso_pu_bacteria | 2935741537 | 2935748298 | 351 |
| 240 | iso_pu_bacteria | 2935750917 | 2935751137 | 351 |
| 241 | iso_pu_bacteria | 2935750917 | 2935758501 | 351 |
| 242 | iso_pu_bacteria | 2935760218 | 2935760339 | 351 |
| 243 | iso_pu_bacteria | 2935760218 | 2935766073 | 351 |
| 244 | iso_pu_bacteria | 2935785616 | 2935786392 | 351 |
| 245 | iso_pu_bacteria | 2935793552 | 2935793810 | 351 |
| 246 | iso_pu_bacteria | 2935801545 | 2935805913 | 351 |
| 247 | iso_pu_bacteria | 2935810662 | 2935810890 | 351 |
| 248 | iso_pu_bacteria | 2935810662 | 2935815528 | 351 |
| 249 | iso_pu_bacteria | 2935819856 | 2935820239 | 351 |
| 250 | iso_pu_bacteria | 2935819856 | 2935823698 | 351 |
| 251 | iso_pu_bacteria | 2935827899 | 2935828472 | 351 |
| 252 | iso_pu_bacteria | 2935837841 | 2935843290 | 351 |
| 253 | iso_pu_bacteria | 2935847175 | 2935849225 | 351 |
| 254 | iso_pu_bacteria | 2935855204 | 2935860349 | 351 |
| 255 | iso_pu_bacteria | 2935864058 | 2935867747 | 351 |
| 256 | iso_pu_bacteria | 2935873716 | 2935878444 | 351 |
| 257 | iso_pu_bacteria | 2935883170 | 2935885149 | 351 |
| 258 | iso_pu_bacteria | 2935908558 | 2935915877 | 351 |
| 259 | iso_pu_bacteria | 2935916978 | 2935923010 | 351 |
| 260 | iso_pu_bacteria | 2935926038 | 2935934209 | 351 |
| 261 | iso_pu_bacteria | 2935934488 | 2935942685 | 351 |
| 262 | iso_pu_bacteria | 2935942939 | 2935951126 | 351 |
| 263 | iso_pu_bacteria | 2935951376 | 2935958615 | 351 |
| 264 | iso_pu_bacteria | 2935967501 | 2935975676 | 351 |
| 265 | iso_pu_bacteria | 2935984226 | 2935991761 | 351 |
| 266 | iso_pu_bacteria | 2935992306 | 2935998673 | 351 |
| 267 | iso_pu_bacteria | 2936002035 | 2936002603 | 351 |
| 268 | iso_pu_bacteria | 2936002035 | 2936006979 | 351 |
| 269 | iso_pu_bacteria | 2936037263 | 2936037690 | 351 |
| 270 | iso_pu_bacteria | 2936037263 | 2936040766 | 351 |
| 271 | iso_pu_bacteria | 2940556831 | 2940558061 | 351 |
| 272 | iso_pu_bacteria | 2940556831 | 2940564405 | 351 |
| 273 | iso_pu_bacteria | 2941531003 | 2941536498 | 351 |
| 274 | iso_pu_bacteria | 2941538514 | 2941544836 | 351 |
| 275 | iso_pu_bacteria | 3005483717 | 3005485233 | 351 |
| 276 | iso_pu_bacteria | 3005506211 | 3005507976 | 351 |
| 277 | iso_pu_bacteria | 3005594810 | 3005598021 | 351 |
| 278 | iso_pu_bacteria | 3005710791 | 3005713705 | 351 |
| 279 | iso_pu_bacteria | 3005718088 | 3005721217 | 351 |
| 280 | iso_pu_bacteria | 8016511872 | 8016519993 | 351 |
| 281 | iso_pu_bacteria | 8016511872 | 8016520909 | 351 |
| 282 | iso_pu_bacteria | 8017057580 | 8017064688 | 351 |
| 283 | iso_pu_bacteria | 8017057580 | 8017065554 | 351 |
| 284 | iso_pu_bacteria | 8019547302 | 8019551611 | 351 |
| 285 | iso_pu_bacteria | 8019576017 | 8019584052 | 351 |
| 286 | iso_pu_bacteria | 8019576017 | 8019584957 | 351 |
| 287 | iso_pu_bacteria | 8019586578 | 8019592914 | 351 |
| 288 | iso_pu_bacteria | 8019597564 | 8019598542 | 351 |
| 289 | iso_pu_bacteria | 8019597564 | 8019599482 | 351 |
| 290 | iso_pu_bacteria | 8019608314 | 8019609834 | 351 |
| 291 | iso_pu_bacteria | 8019648815 | 8019656945 | 351 |
| 292 | iso_pu_bacteria | 8019659431 | 8019664086 | 351 |
| 293 | iso_pu_bacteria | 8019687851 | 8019692329 | 351 |
| 294 | iso_pu_bacteria | 8056967851 | 8056973409 | 351 |
| 295 | 3300005327 | Ga0070658_10080716 | Ga0070658_100807162 | 352 |
| 296 | 3300005329 | Ga0070683_100115242 | Ga0070683_1001152422 | 352 |
| 297 | 3300005331 | Ga0070670_100040501 | Ga0070670_1000405013 | 352 |
| 298 | 3300005334 | Ga0068869_100028731 | Ga0068869_1000287314 | 352 |
| 299 | 3300005334 | Ga0068869_100061092 | Ga0068869_1000610922 | 352 |
| 300 | 3300005335 | Ga0070666_10064965 | Ga0070666_100649652 | 352 |
| 301 | 3300005339 | Ga0070660_100023504 | Ga0070660_1000235042 | 352 |
| 302 | 3300005340 | Ga0070689_100343932 | Ga0070689_1003439321 | 352 |
| 303 | 3300005347 | Ga0070668_100000830 | Ga0070668_10000083010 | 352 |
| 304 | 3300005355 | Ga0070671_100005278 | Ga0070671_1000052786 | 352 |
| 305 | 3300005365 | Ga0070688_100072138 | Ga0070688_1000721383 | 352 |
| 306 | 3300005367 | Ga0070667_100008652 | Ga0070667_1000086526 | 352 |
| 307 | 3300005435 | Ga0070714_100136283 | Ga0070714_1001362831 | 352 |
| 308 | 3300005445 | Ga0070708_100027800 | Ga0070708_1000278002 | 352 |
| 309 | 3300005456 | Ga0070678_100015416 | Ga0070678_1000154163 | 352 |
| 310 | 3300005458 | Ga0070681_10097487 | Ga0070681_100974872 | 352 |
| 311 | 3300005459 | Ga0068867_100176825 | Ga0068867_1001768252 | 352 |
| 312 | 3300005467 | Ga0070706_100003127 | Ga0070706_1000031277 | 352 |
| 313 | 3300005468 | Ga0070707_100001574 | Ga0070707_1000015742 | 352 |
| 314 | 3300005518 | Ga0070699_100002004 | Ga0070699_1000020047 | 352 |
| 315 | 3300005536 | Ga0070697_100045516 | Ga0070697_1000455162 | 352 |
| 316 | 3300005548 | Ga0070665_100005930 | Ga0070665_1000059304 | 352 |
| 317 | 3300005548 | Ga0070665_100014283 | Ga0070665_1000142832 | 352 |
| 318 | 3300005548 | Ga0070665_100048130 | Ga0070665_1000481302 | 352 |
| 319 | 3300005548 | Ga0070665_100147621 | Ga0070665_1001476212 | 352 |
| 320 | 3300005614 | Ga0068856_100043689 | Ga0068856_1000436893 | 352 |
| 321 | 3300005614 | Ga0068856_100183040 | Ga0068856_1001830402 | 352 |
| 322 | 3300005618 | Ga0068864_100094104 | Ga0068864_1000941042 | 352 |
| 323 | 3300005840 | Ga0068870_10088629 | Ga0068870_100886292 | 352 |
| 324 | 3300005841 | Ga0068863_100005808 | Ga0068863_1000058083 | 352 |
| 325 | 3300005842 | Ga0068858_100001857 | Ga0068858_1000018577 | 352 |
| 326 | 3300005842 | Ga0068858_100222422 | Ga0068858_1002224222 | 352 |
| 327 | 3300005843 | Ga0068860_100057032 | Ga0068860_1000570322 | 352 |
| 328 | 3300006237 | Ga0097621_100025068 | Ga0097621_1000250683 | 352 |
| 329 | 3300006358 | Ga0068871_100165789 | Ga0068871_1001657892 | 352 |
| 330 | 3300006881 | Ga0068865_100141238 | Ga0068865_1001412381 | 352 |
| 331 | 3300009093 | Ga0105240_10024496 | Ga0105240_100244967 | 352 |
| 332 | 3300009148 | Ga0105243_10039043 | Ga0105243_100390432 | 352 |
| 333 | 3300009148 | Ga0105243_10277624 | Ga0105243_102776242 | 352 |
| 334 | 3300009174 | Ga0105241_10059936 | Ga0105241_100599362 | 352 |
| 335 | 3300009174 | Ga0105241_10108987 | Ga0105241_101089872 | 352 |
| 336 | 3300009177 | Ga0105248_10005020 | Ga0105248_1000502013 | 352 |
| 337 | 3300009545 | Ga0105237_10000110 | Ga0105237_1000011098 | 352 |
| 338 | 3300009545 | Ga0105237_10326038 | Ga0105237_103260382 | 352 |
| 339 | 3300009551 | Ga0105238_10009029 | Ga0105238_100090297 | 352 |
| 340 | 3300009551 | Ga0105238_10227732 | Ga0105238_102277322 | 352 |
| 341 | 3300009553 | Ga0105249_10383316 | Ga0105249_103833161 | 352 |
| 342 | 3300009553 | Ga0105249_10387255 | Ga0105249_103872551 | 352 |
| 343 | 3300010375 | Ga0105239_10000552 | Ga0105239_1000055252 | 352 |
| 344 | 3300010375 | Ga0105239_10122883 | Ga0105239_101228833 | 352 |
| 345 | 3300011119 | Ga0105246_10025513 | Ga0105246_100255132 | 352 |
| 346 | 3300013104 | Ga0157370_10007573 | Ga0157370_1000757311 | 352 |
| 347 | 3300013306 | Ga0163162_10346060 | Ga0163162_103460602 | 352 |
| 348 | 3300013307 | Ga0157372_10010497 | Ga0157372_100104978 | 352 |
| 349 | 3300014968 | Ga0157379_10004730 | Ga0157379_1000473011 | 352 |
| 350 | 3300014968 | Ga0157379_10052024 | Ga0157379_100520243 | 352 |
| 351 | 3300025297 | Ga0209758_1051482 | Ga0209758_10514822 | 352 |
| 352 | 3300025908 | Ga0207643_10207571 | Ga0207643_102075711 | 352 |
| 353 | 3300025909 | Ga0207705_10003846 | Ga0207705_100038465 | 352 |
| 354 | 3300025910 | Ga0207684_10005362 | Ga0207684_100053623 | 352 |
| 355 | 3300025911 | Ga0207654_10016332 | Ga0207654_100163322 | 352 |
| 356 | 3300025911 | Ga0207654_10120237 | Ga0207654_101202372 | 352 |
| 357 | 3300025912 | Ga0207707_10166254 | Ga0207707_101662542 | 352 |
| 358 | 3300025912 | Ga0207707_10332096 | Ga0207707_103320961 | 352 |
| 359 | 3300025914 | Ga0207671_10020739 | Ga0207671_100207394 | 352 |
| 360 | 3300025914 | Ga0207671_10064118 | Ga0207671_100641182 | 352 |
| 361 | 3300025919 | Ga0207657_10040912 | Ga0207657_100409123 | 352 |
| 362 | 3300025919 | Ga0207657_10112775 | Ga0207657_101127752 | 352 |
| 363 | 3300025922 | Ga0207646_10005593 | Ga0207646_100055935 | 352 |
| 364 | 3300025923 | Ga0207681_10003375 | Ga0207681_1000337510 | 352 |
| 365 | 3300025924 | Ga0207694_10027701 | Ga0207694_100277012 | 352 |
| 366 | 3300025925 | Ga0207650_10239190 | Ga0207650_102391901 | 352 |
| 367 | 3300025929 | Ga0207664_10119514 | Ga0207664_101195143 | 352 |
| 368 | 3300025935 | Ga0207709_10175472 | Ga0207709_101754722 | 352 |
| 369 | 3300025937 | Ga0207669_10074426 | Ga0207669_100744262 | 352 |
| 370 | 3300025938 | Ga0207704_10121996 | Ga0207704_101219961 | 352 |
| 371 | 3300025941 | Ga0207711_10004369 | Ga0207711_1000436911 | 352 |
| 372 | 3300025941 | Ga0207711_10041091 | Ga0207711_100410914 | 352 |
| 373 | 3300025942 | Ga0207689_10034422 | Ga0207689_100344224 | 352 |
| 374 | 3300025942 | Ga0207689_10132655 | Ga0207689_101326552 | 352 |
| 375 | 3300025949 | Ga0207667_10117268 | Ga0207667_101172682 | 352 |
| 376 | 3300025949 | Ga0207667_10172994 | Ga0207667_101729942 | 352 |
| 377 | 3300025972 | Ga0207668_10001436 | Ga0207668_1000143610 | 352 |
| 378 | 3300025986 | Ga0207658_10084049 | Ga0207658_100840492 | 352 |
| 379 | 3300025986 | Ga0207658_10085883 | Ga0207658_100858833 | 352 |
| 380 | 3300026023 | Ga0207677_10052852 | Ga0207677_100528523 | 352 |
| 381 | 3300026035 | Ga0207703_10002787 | Ga0207703_100027877 | 352 |
| 382 | 3300026035 | Ga0207703_10306795 | Ga0207703_103067952 | 352 |
| 383 | 3300026067 | Ga0207678_10114197 | Ga0207678_101141972 | 352 |
| 384 | 3300026088 | Ga0207641_10003920 | Ga0207641_1000392011 | 352 |
| 385 | 3300026089 | Ga0207648_10220726 | Ga0207648_102207262 | 352 |
| 386 | 3300026095 | Ga0207676_10069241 | Ga0207676_100692413 | 352 |
| 387 | 3300026121 | Ga0207683_10038042 | Ga0207683_100380422 | 352 |
| 388 | 3300028379 | Ga0268266_10000753 | Ga0268266_100007534 | 352 |
| 389 | 3300028379 | Ga0268266_10004630 | Ga0268266_100046309 | 352 |
| 390 | 3300028379 | Ga0268266_10006566 | Ga0268266_100065665 | 352 |
| 391 | 3300028381 | Ga0268264_10134897 | Ga0268264_101348971 | 352 |
| 392 | 3300028800 | Ga0265338_10003763 | Ga0265338_1000376312 | 352 |
| 393 | 3300031730 | Ga0307516_10278264 | Ga0307516_102782642 | 352 |
| 394 | 3300038443 | Ga0395901_0147427 | Ga0395901_0147427_626_1699 | 352 |
| 395 | 3300038443 | Ga0395901_0409343 | Ga0395901_0409343_175_1263 | 352 |
| 396 | 3300044712 | Ga0453684_0000015 | Ga0453684_0000015_443900_444964 | 352 |
| 397 | 3300044712 | Ga0453684_0000020 | Ga0453684_0000020_464556_465620 | 352 |
| 398 | 3300048906 | Ga0496103_0225630 | Ga0496103_0225630_99_1178 | 352 |
| 399 | 3300048907 | Ga0496104_0145826 | Ga0496104_0145826_199_1278 | 352 |
| 400 | 3300048908 | Ga0496105_0028575 | Ga0496105_0028575_1709_2788 | 352 |
| 401 | 3300048911 | Ga0496108_0174484 | Ga0496108_0174484_358_1437 | 352 |
| 402 | 3300048912 | Ga0496109_0366271 | Ga0496109_0366271_237_1316 | 352 |
| 403 | 3300048913 | Ga0496110_0122141 | Ga0496110_0122141_780_1859 | 352 |
| 404 | 3300048914 | Ga0496111_0099208 | Ga0496111_0099208_211_1290 | 352 |
| 405 | 3300048916 | Ga0496113_0096975 | Ga0496113_0096975_196_1275 | 352 |
| 406 | 3300049570 | Ga0501033_0000590 | Ga0501033_0000590_28284_29342 | 352 |
| 407 | 3300049571 | Ga0501034_0000076 | Ga0501034_0000076_4590_5663 | 352 |
| 408 | 3300049571 | Ga0501034_0376913 | Ga0501034_0376913_247_1308 | 352 |
| 409 | 3300049571 | Ga0501034_0401557 | Ga0501034_0401557_139_1212 | 352 |
| 410 | 3300049572 | Ga0501036_0211551 | Ga0501036_0211551_494_1552 | 352 |
| 411 | 3300049573 | Ga0501037_0010911 | Ga0501037_0010911_5183_6256 | 352 |
| 412 | 3300049575 | Ga0501039_0136096 | Ga0501039_0136096_811_1884 | 352 |
| 413 | 3300049579 | Ga0501043_0052081 | Ga0501043_0052081_1536_2594 | 352 |
| 414 | 3300049581 | Ga0501047_0014216 | Ga0501047_0014216_5300_6373 | 352 |
| 415 | 3300049581 | Ga0501047_0088578 | Ga0501047_0088578_389_1447 | 352 |
| 416 | 3300049582 | Ga0501048_0014790 | Ga0501048_0014790_1823_2896 | 352 |
| 417 | 3300049586 | Ga0501070_0094918 | Ga0501070_0094918_991_2064 | 352 |
| 418 | 3300049742 | Ga0501080_0000004 | Ga0501080_0000004_5968_7041 | 352 |
| 419 | 3300049743 | Ga0501081_0075408 | Ga0501081_0075408_541_1614 | 352 |
| 420 | 3300049822 | Ga0501035_0000191 | Ga0501035_0000191_69923_70996 | 352 |
| 421 | 3300049823 | Ga0501044_0000227 | Ga0501044_0000227_5219_6292 | 352 |
| 422 | 3300049823 | Ga0501044_0004541 | Ga0501044_0004541_8159_9217 | 352 |
| 423 | 3300053140 | Ga0500573_0000003 | Ga0500573_0000003_217692_218750 | 352 |
| 424 | 3300053730 | Ga0500645_010068 | Ga0500645_010068_666_1724 | 352 |
| 425 | 3300060353 | Ga0501082_0029242 | Ga0501082_0029242_1927_3000 | 352 |
| 426 | 3300005366 | Ga0070659_100187211 | Ga0070659_1001872111 | 353 |
| 427 | 3300005548 | Ga0070665_100051472 | Ga0070665_1000514724 | 353 |
| 428 | 3300005841 | Ga0068863_100054034 | Ga0068863_1000540343 | 353 |
| 429 | 3300005842 | Ga0068858_100141044 | Ga0068858_1001410442 | 353 |
| 430 | 3300005937 | Ga0081455_10011948 | Ga0081455_100119484 | 353 |
| 431 | 3300005983 | Ga0081540_1000353 | Ga0081540_10003537 | 353 |
| 432 | 3300005983 | Ga0081540_1009106 | Ga0081540_10091064 | 353 |
| 433 | 3300005983 | Ga0081540_1023238 | Ga0081540_10232383 | 353 |
| 434 | 3300005985 | Ga0081539_10001561 | Ga0081539_1000156127 | 353 |
| 435 | 3300005985 | Ga0081539_10026626 | Ga0081539_100266263 | 353 |
| 436 | 3300006195 | Ga0075366_10114547 | Ga0075366_101145472 | 353 |
| 437 | 3300007076 | Ga0075435_100071665 | Ga0075435_1000716652 | 353 |
| 438 | 3300021361 | Ga0213872_10012123 | Ga0213872_100121233 | 353 |
| 439 | 3300025297 | Ga0209758_1050777 | Ga0209758_10507771 | 353 |
| 440 | 3300025904 | Ga0207647_10101551 | Ga0207647_101015512 | 353 |
| 441 | 3300025914 | Ga0207671_10052904 | Ga0207671_100529042 | 353 |
| 442 | 3300025918 | Ga0207662_10022826 | Ga0207662_100228262 | 353 |
| 443 | 3300025940 | Ga0207691_10188391 | Ga0207691_101883912 | 353 |
| 444 | 3300028379 | Ga0268266_10034991 | Ga0268266_100349913 | 353 |
| 445 | 3300028379 | Ga0268266_10209867 | Ga0268266_102098672 | 353 |
| 446 | 3300028380 | Ga0268265_10353526 | Ga0268265_103535261 | 353 |
| 447 | 3300031824 | Ga0307413_10045378 | Ga0307413_100453782 | 353 |
| 448 | 3300032005 | Ga0307411_10050896 | Ga0307411_100508963 | 353 |
| 449 | 3300039447 | Ga0436361_0530867 | Ga0436361_0530867_4387_5484 | 353 |
| 450 | 3300039447 | Ga0436361_0722566 | Ga0436361_0722566_3120_4220 | 353 |
| 451 | 3300046457 | Ga0495590_0015942 | Ga0495590_0015942_814_1896 | 353 |
| 452 | 3300046492 | Ga0495585_0039034 | Ga0495585_0039034_918_2000 | 353 |
| 453 | 3300046519 | Ga0495632_0011028 | Ga0495632_0011028_2661_3743 | 353 |
| 454 | 3300046660 | Ga0495625_0065166 | Ga0495625_0065166_760_1842 | 353 |
| 455 | 3300046684 | Ga0495669_0081029 | Ga0495669_0081029_19_1101 | 353 |
| 456 | 3300046692 | Ga0495671_0027080 | Ga0495671_0027080_748_1830 | 353 |
| 457 | 3300046692 | Ga0495671_0064012 | Ga0495671_0064012_677_1759 | 353 |
| 458 | 3300047323 | Ga0495683_0055034 | Ga0495683_0055034_723_1805 | 353 |
| 459 | 3300048912 | Ga0496109_0247428 | Ga0496109_0247428_567_1649 | 353 |
| 460 | 3300050493 | nmdc:mga0k408_42943_c1 | nmdc:mga0k408_42943_c1_1009_2091 | 353 |
| 461 | 3300050494 | nmdc:mga06z11_205046_c1 | nmdc:mga06z11_205046_c1_52_1134 | 353 |
| 462 | 3300050496 | nmdc:mga07m45_33634_c1 | nmdc:mga07m45_33634_c1_452_1534 | 353 |
| 463 | 3300053151 | Ga0500604_0002821 | Ga0500604_0002821_3261_4346 | 353 |
| 464 | iso_pu_bacteria | 2889033259 | 2889042115 | 353 |
| 465 | iso_pu_bacteria | 8006984368 | 8006992190 | 353 |
| 466 | 3300001904 | JGI24736J21556_1011716 | JGI24736J21556_10117161 | 354 |
| 467 | 3300001990 | JGI24737J22298_10005764 | JGI24737J22298_100057643 | 354 |
| 468 | 3300002067 | JGI24735J21928_10010572 | JGI24735J21928_100105721 | 354 |
| 469 | 3300003203 | JGI25406J46586_10000014 | JGI25406J46586_100000148 | 354 |
| 470 | 3300003215 | JGI25153J46596_10000127 | JGI25153J46596_100001275 | 354 |
| 471 | 3300003215 | JGI25153J46596_10000168 | JGI25153J46596_1000016845 | 354 |
| 472 | 3300003215 | JGI25153J46596_10000247 | JGI25153J46596_1000024715 | 354 |
| 473 | 3300003215 | JGI25153J46596_10011513 | JGI25153J46596_100115132 | 354 |
| 474 | 3300003354 | JGI25160J50197_1000411 | JGI25160J50197_100041122 | 354 |
| 475 | 3300003354 | JGI25160J50197_1001248 | JGI25160J50197_10012482 | 354 |
| 476 | 3300003794 | Ga0055531_10005857 | Ga0055531_100058572 | 354 |
| 477 | 3300004625 | Ga0055543_1001498 | Ga0055543_10014987 | 354 |
| 478 | 3300004625 | Ga0055543_1003748 | Ga0055543_10037481 | 354 |
| 479 | 3300005262 | Ga0065165_1000134 | Ga0065165_100013452 | 354 |
| 480 | 3300005262 | Ga0065165_1000664 | Ga0065165_100066435 | 354 |
| 481 | 3300005262 | Ga0065165_1000976 | Ga0065165_100097624 | 354 |
| 482 | 3300005262 | Ga0065165_1003936 | Ga0065165_10039364 | 354 |
| 483 | 3300005262 | Ga0065165_1005285 | Ga0065165_10052854 | 354 |
| 484 | 3300005329 | Ga0070683_100047943 | Ga0070683_1000479434 | 354 |
| 485 | 3300005336 | Ga0070680_100082137 | Ga0070680_1000821372 | 354 |
| 486 | 3300005347 | Ga0070668_100128901 | Ga0070668_1001289012 | 354 |
| 487 | 3300005355 | Ga0070671_100239408 | Ga0070671_1002394082 | 354 |
| 488 | 3300005367 | Ga0070667_100019485 | Ga0070667_1000194853 | 354 |
| 489 | 3300005434 | Ga0070709_10007842 | Ga0070709_100078426 | 354 |
| 490 | 3300005434 | Ga0070709_10011973 | Ga0070709_100119734 | 354 |
| 491 | 3300005434 | Ga0070709_10033440 | Ga0070709_100334402 | 354 |
| 492 | 3300005434 | Ga0070709_10041881 | Ga0070709_100418813 | 354 |
| 493 | 3300005435 | Ga0070714_100022799 | Ga0070714_1000227993 | 354 |
| 494 | 3300005436 | Ga0070713_100003900 | Ga0070713_1000039003 | 354 |
| 495 | 3300005436 | Ga0070713_100016156 | Ga0070713_1000161562 | 354 |
| 496 | 3300005436 | Ga0070713_100128758 | Ga0070713_1001287582 | 354 |
| 497 | 3300005437 | Ga0070710_10006621 | Ga0070710_100066214 | 354 |
| 498 | 3300005437 | Ga0070710_10041028 | Ga0070710_100410282 | 354 |
| 499 | 3300005439 | Ga0070711_100016347 | Ga0070711_1000163473 | 354 |
| 500 | 3300005439 | Ga0070711_100031629 | Ga0070711_1000316293 | 354 |
| 501 | 3300005455 | Ga0070663_100035066 | Ga0070663_1000350663 | 354 |
| 502 | 3300005530 | Ga0070679_100014351 | Ga0070679_1000143512 | 354 |
| 503 | 3300005530 | Ga0070679_100019705 | Ga0070679_1000197053 | 354 |
| 504 | 3300005535 | Ga0070684_100018169 | Ga0070684_1000181695 | 354 |
| 505 | 3300005535 | Ga0070684_100064413 | Ga0070684_1000644132 | 354 |
| 506 | 3300005539 | Ga0068853_100089356 | Ga0068853_1000893562 | 354 |
| 507 | 3300005539 | Ga0068853_100094702 | Ga0068853_1000947024 | 354 |
| 508 | 3300005539 | Ga0068853_100171598 | Ga0068853_1001715982 | 354 |
| 509 | 3300005543 | Ga0070672_100268238 | Ga0070672_1002682382 | 354 |
| 510 | 3300005548 | Ga0070665_100004109 | Ga0070665_10000410911 | 354 |
| 511 | 3300005563 | Ga0068855_100085960 | Ga0068855_1000859603 | 354 |
| 512 | 3300005563 | Ga0068855_100191931 | Ga0068855_1001919312 | 354 |
| 513 | 3300005577 | Ga0068857_100003812 | Ga0068857_1000038124 | 354 |
| 514 | 3300005577 | Ga0068857_100010456 | Ga0068857_1000104567 | 354 |
| 515 | 3300005577 | Ga0068857_100252907 | Ga0068857_1002529071 | 354 |
| 516 | 3300005578 | Ga0068854_100027274 | Ga0068854_1000272743 | 354 |
| 517 | 3300005614 | Ga0068856_100039969 | Ga0068856_1000399692 | 354 |
| 518 | 3300005614 | Ga0068856_100115733 | Ga0068856_1001157332 | 354 |
| 519 | 3300005614 | Ga0068856_100137315 | Ga0068856_1001373152 | 354 |
| 520 | 3300005614 | Ga0068856_100393435 | Ga0068856_1003934351 | 354 |
| 521 | 3300005616 | Ga0068852_100004160 | Ga0068852_1000041602 | 354 |
| 522 | 3300005616 | Ga0068852_100007043 | Ga0068852_1000070433 | 354 |
| 523 | 3300005618 | Ga0068864_100247880 | Ga0068864_1002478801 | 354 |
| 524 | 3300005834 | Ga0068851_10001214 | Ga0068851_100012142 | 354 |
| 525 | 3300005834 | Ga0068851_10014266 | Ga0068851_100142662 | 354 |
| 526 | 3300005840 | Ga0068870_10067631 | Ga0068870_100676312 | 354 |
| 527 | 3300005841 | Ga0068863_100014635 | Ga0068863_1000146353 | 354 |
| 528 | 3300005842 | Ga0068858_100341322 | Ga0068858_1003413222 | 354 |
| 529 | 3300005843 | Ga0068860_100000409 | Ga0068860_1000004093 | 354 |
| 530 | 3300005844 | Ga0068862_100120445 | Ga0068862_1001204452 | 354 |
| 531 | 3300005937 | Ga0081455_10004847 | Ga0081455_1000484712 | 354 |
| 532 | 3300005937 | Ga0081455_10066157 | Ga0081455_100661571 | 354 |
| 533 | 3300005983 | Ga0081540_1001385 | Ga0081540_10013858 | 354 |
| 534 | 3300005983 | Ga0081540_1017917 | Ga0081540_10179175 | 354 |
| 535 | 3300005985 | Ga0081539_10000008 | Ga0081539_10000008150 | 354 |
| 536 | 3300006028 | Ga0070717_10006203 | Ga0070717_100062034 | 354 |
| 537 | 3300006028 | Ga0070717_10040726 | Ga0070717_100407263 | 354 |
| 538 | 3300006028 | Ga0070717_10172669 | Ga0070717_101726692 | 354 |
| 539 | 3300006038 | Ga0075365_10170202 | Ga0075365_101702022 | 354 |
| 540 | 3300006042 | Ga0075368_10024318 | Ga0075368_100243182 | 354 |
| 541 | 3300006042 | Ga0075368_10071452 | Ga0075368_100714521 | 354 |
| 542 | 3300006173 | Ga0070716_100004406 | Ga0070716_1000044062 | 354 |
| 543 | 3300006173 | Ga0070716_100083383 | Ga0070716_1000833831 | 354 |
| 544 | 3300006175 | Ga0070712_100012336 | Ga0070712_1000123364 | 354 |
| 545 | 3300006177 | Ga0075362_10116894 | Ga0075362_101168942 | 354 |
| 546 | 3300006178 | Ga0075367_10018774 | Ga0075367_100187743 | 354 |
| 547 | 3300006195 | Ga0075366_10005853 | Ga0075366_100058535 | 354 |
| 548 | 3300006237 | Ga0097621_100238325 | Ga0097621_1002383252 | 354 |
| 549 | 3300006941 | Ga0099825_1028685 | Ga0099825_10286852 | 354 |
| 550 | 3300009093 | Ga0105240_10022611 | Ga0105240_100226112 | 354 |
| 551 | 3300009093 | Ga0105240_10028339 | Ga0105240_100283396 | 354 |
| 552 | 3300009093 | Ga0105240_10081017 | Ga0105240_100810172 | 354 |
| 553 | 3300009093 | Ga0105240_10090942 | Ga0105240_100909423 | 354 |
| 554 | 3300009098 | Ga0105245_10308093 | Ga0105245_103080932 | 354 |
| 555 | 3300009101 | Ga0105247_10043573 | Ga0105247_100435732 | 354 |
| 556 | 3300009174 | Ga0105241_10004255 | Ga0105241_100042552 | 354 |
| 557 | 3300009177 | Ga0105248_10006945 | Ga0105248_100069451 | 354 |
| 558 | 3300009545 | Ga0105237_10004743 | Ga0105237_1000474314 | 354 |
| 559 | 3300009545 | Ga0105237_10031433 | Ga0105237_100314336 | 354 |
| 560 | 3300009551 | Ga0105238_10002076 | Ga0105238_100020762 | 354 |
| 561 | 3300009551 | Ga0105238_10010980 | Ga0105238_100109806 | 354 |
| 562 | 3300009551 | Ga0105238_10011639 | Ga0105238_100116397 | 354 |
| 563 | 3300009551 | Ga0105238_10193262 | Ga0105238_101932622 | 354 |
| 564 | 3300010375 | Ga0105239_10013891 | Ga0105239_100138918 | 354 |
| 565 | 3300010375 | Ga0105239_10016664 | Ga0105239_100166643 | 354 |
| 566 | 3300010375 | Ga0105239_10036477 | Ga0105239_100364773 | 354 |
| 567 | 3300010375 | Ga0105239_10043844 | Ga0105239_100438442 | 354 |
| 568 | 3300010375 | Ga0105239_10064956 | Ga0105239_100649562 | 354 |
| 569 | 3300013104 | Ga0157370_10018659 | Ga0157370_100186594 | 354 |
| 570 | 3300013104 | Ga0157370_10024085 | Ga0157370_100240852 | 354 |
| 571 | 3300013105 | Ga0157369_10066040 | Ga0157369_100660404 | 354 |
| 572 | 3300013105 | Ga0157369_10108377 | Ga0157369_101083773 | 354 |
| 573 | 3300013296 | Ga0157374_10112901 | Ga0157374_101129013 | 354 |
| 574 | 3300013308 | Ga0157375_10261647 | Ga0157375_102616471 | 354 |
| 575 | 3300014325 | Ga0163163_10016527 | Ga0163163_100165274 | 354 |
| 576 | 3300014968 | Ga0157379_10035381 | Ga0157379_100353812 | 354 |
| 577 | 3300021320 | Ga0214544_1000005 | Ga0214544_1000005226 | 354 |
| 578 | 3300021321 | Ga0214542_1000004 | Ga0214542_1000004230 | 354 |
| 579 | 3300021324 | Ga0214545_1000005 | Ga0214545_1000005165 | 354 |
| 580 | 3300021327 | Ga0214543_1000030 | Ga0214543_100003019 | 354 |
| 581 | 3300021384 | Ga0213876_10003009 | Ga0213876_100030097 | 354 |
| 582 | 3300021384 | Ga0213876_10077260 | Ga0213876_100772602 | 354 |
| 583 | 3300025245 | Ga0207425_1001246 | Ga0207425_100124610 | 354 |
| 584 | 3300025245 | Ga0207425_1003832 | Ga0207425_10038321 | 354 |
| 585 | 3300025254 | Ga0209148_1000239 | Ga0209148_100023937 | 354 |
| 586 | 3300025261 | Ga0209233_1000855 | Ga0209233_100085511 | 354 |
| 587 | 3300025261 | Ga0209233_1011291 | Ga0209233_10112913 | 354 |
| 588 | 3300025261 | Ga0209233_1013934 | Ga0209233_10139342 | 354 |
| 589 | 3300025272 | Ga0209455_1002439 | Ga0209455_10024393 | 354 |
| 590 | 3300025295 | Ga0209564_1002361 | Ga0209564_10023613 | 354 |
| 591 | 3300025295 | Ga0209564_1010509 | Ga0209564_10105092 | 354 |
| 592 | 3300025297 | Ga0209758_1000075 | Ga0209758_1000075164 | 354 |
| 593 | 3300025297 | Ga0209758_1000187 | Ga0209758_100018787 | 354 |
| 594 | 3300025297 | Ga0209758_1000611 | Ga0209758_10006116 | 354 |
| 595 | 3300025297 | Ga0209758_1003883 | Ga0209758_100388312 | 354 |
| 596 | 3300025302 | Ga0207426_1000138 | Ga0207426_1000138162 | 354 |
| 597 | 3300025302 | Ga0207426_1000160 | Ga0207426_1000160118 | 354 |
| 598 | 3300025302 | Ga0207426_1000375 | Ga0207426_100037525 | 354 |
| 599 | 3300025302 | Ga0207426_1002253 | Ga0207426_10022531 | 354 |
| 600 | 3300025302 | Ga0207426_1002824 | Ga0207426_10028247 | 354 |
| 601 | 3300025302 | Ga0207426_1015016 | Ga0207426_10150163 | 354 |
| 602 | 3300025302 | Ga0207426_1034907 | Ga0207426_10349071 | 354 |
| 603 | 3300025304 | Ga0209257_1000652 | Ga0209257_10006526 | 354 |
| 604 | 3300025315 | Ga0207697_10026850 | Ga0207697_100268503 | 354 |
| 605 | 3300025321 | Ga0207656_10008380 | Ga0207656_100083802 | 354 |
| 606 | 3300025898 | Ga0207692_10027888 | Ga0207692_100278882 | 354 |
| 607 | 3300025903 | Ga0207680_10073038 | Ga0207680_100730382 | 354 |
| 608 | 3300025904 | Ga0207647_10000985 | Ga0207647_1000098511 | 354 |
| 609 | 3300025905 | Ga0207685_10004384 | Ga0207685_100043842 | 354 |
| 610 | 3300025906 | Ga0207699_10001145 | Ga0207699_100011456 | 354 |
| 611 | 3300025906 | Ga0207699_10037144 | Ga0207699_100371442 | 354 |
| 612 | 3300025911 | Ga0207654_10000136 | Ga0207654_100001367 | 354 |
| 613 | 3300025911 | Ga0207654_10010748 | Ga0207654_100107483 | 354 |
| 614 | 3300025913 | Ga0207695_10002311 | Ga0207695_1000231113 | 354 |
| 615 | 3300025913 | Ga0207695_10011572 | Ga0207695_100115722 | 354 |
| 616 | 3300025913 | Ga0207695_10318913 | Ga0207695_103189131 | 354 |
| 617 | 3300025914 | Ga0207671_10007380 | Ga0207671_100073809 | 354 |
| 618 | 3300025914 | Ga0207671_10128058 | Ga0207671_101280582 | 354 |
| 619 | 3300025914 | Ga0207671_10231136 | Ga0207671_102311361 | 354 |
| 620 | 3300025915 | Ga0207693_10001764 | Ga0207693_1000176414 | 354 |
| 621 | 3300025915 | Ga0207693_10046474 | Ga0207693_100464742 | 354 |
| 622 | 3300025915 | Ga0207693_10060693 | Ga0207693_100606933 | 354 |
| 623 | 3300025916 | Ga0207663_10006336 | Ga0207663_100063364 | 354 |
| 624 | 3300025916 | Ga0207663_10022943 | Ga0207663_100229434 | 354 |
| 625 | 3300025917 | Ga0207660_10025057 | Ga0207660_100250571 | 354 |
| 626 | 3300025921 | Ga0207652_10055811 | Ga0207652_100558113 | 354 |
| 627 | 3300025921 | Ga0207652_10180441 | Ga0207652_101804412 | 354 |
| 628 | 3300025924 | Ga0207694_10000135 | Ga0207694_1000013520 | 354 |
| 629 | 3300025924 | Ga0207694_10014853 | Ga0207694_100148531 | 354 |
| 630 | 3300025924 | Ga0207694_10079235 | Ga0207694_100792352 | 354 |
| 631 | 3300025925 | Ga0207650_10088589 | Ga0207650_100885892 | 354 |
| 632 | 3300025926 | Ga0207659_10112415 | Ga0207659_101124152 | 354 |
| 633 | 3300025928 | Ga0207700_10024668 | Ga0207700_100246684 | 354 |
| 634 | 3300025928 | Ga0207700_10281927 | Ga0207700_102819272 | 354 |
| 635 | 3300025933 | Ga0207706_10087080 | Ga0207706_100870802 | 354 |
| 636 | 3300025939 | Ga0207665_10004976 | Ga0207665_100049767 | 354 |
| 637 | 3300025939 | Ga0207665_10012045 | Ga0207665_100120453 | 354 |
| 638 | 3300025939 | Ga0207665_10052651 | Ga0207665_100526512 | 354 |
| 639 | 3300025941 | Ga0207711_10175558 | Ga0207711_101755581 | 354 |
| 640 | 3300025941 | Ga0207711_10303840 | Ga0207711_103038401 | 354 |
| 641 | 3300025942 | Ga0207689_10218714 | Ga0207689_102187141 | 354 |
| 642 | 3300025944 | Ga0207661_10020327 | Ga0207661_100203272 | 354 |
| 643 | 3300025944 | Ga0207661_10166684 | Ga0207661_101666842 | 354 |
| 644 | 3300025944 | Ga0207661_10224847 | Ga0207661_102248472 | 354 |
| 645 | 3300025945 | Ga0207679_10196813 | Ga0207679_101968132 | 354 |
| 646 | 3300025949 | Ga0207667_10018495 | Ga0207667_100184957 | 354 |
| 647 | 3300025949 | Ga0207667_10092955 | Ga0207667_100929552 | 354 |
| 648 | 3300025972 | Ga0207668_10186219 | Ga0207668_101862192 | 354 |
| 649 | 3300025981 | Ga0207640_10003325 | Ga0207640_100033259 | 354 |
| 650 | 3300026041 | Ga0207639_10050318 | Ga0207639_100503182 | 354 |
| 651 | 3300026041 | Ga0207639_10052367 | Ga0207639_100523672 | 354 |
| 652 | 3300026041 | Ga0207639_10078554 | Ga0207639_100785543 | 354 |
| 653 | 3300026041 | Ga0207639_10184216 | Ga0207639_101842162 | 354 |
| 654 | 3300026078 | Ga0207702_10000026 | Ga0207702_10000026124 | 354 |
| 655 | 3300026078 | Ga0207702_10013080 | Ga0207702_100130802 | 354 |
| 656 | 3300026078 | Ga0207702_10036603 | Ga0207702_100366033 | 354 |
| 657 | 3300026078 | Ga0207702_10143451 | Ga0207702_101434512 | 354 |
| 658 | 3300026078 | Ga0207702_10433508 | Ga0207702_104335081 | 354 |
| 659 | 3300026088 | Ga0207641_10229803 | Ga0207641_102298031 | 354 |
| 660 | 3300026116 | Ga0207674_10007361 | Ga0207674_1000736111 | 354 |
| 661 | 3300026116 | Ga0207674_10013128 | Ga0207674_100131284 | 354 |
| 662 | 3300026116 | Ga0207674_10016608 | Ga0207674_100166082 | 354 |
| 663 | 3300026118 | Ga0207675_100144548 | Ga0207675_1001445482 | 354 |
| 664 | 3300026142 | Ga0207698_10019685 | Ga0207698_100196851 | 354 |
| 665 | 3300026142 | Ga0207698_10026970 | Ga0207698_100269702 | 354 |
| 666 | 3300027296 | Ga0209389_1000073 | Ga0209389_100007364 | 354 |
| 667 | 3300027296 | Ga0209389_1000499 | Ga0209389_10004999 | 354 |
| 668 | 3300027296 | Ga0209389_1022906 | Ga0209389_10229063 | 354 |
| 669 | 3300027357 | Ga0209589_1000109 | Ga0209589_10001097 | 354 |
| 670 | 3300027357 | Ga0209589_1010873 | Ga0209589_10108732 | 354 |
| 671 | 3300027357 | Ga0209589_1022228 | Ga0209589_10222283 | 354 |
| 672 | 3300027361 | Ga0209489_100324 | Ga0209489_1003247 | 354 |
| 673 | 3300027361 | Ga0209489_102828 | Ga0209489_10282828 | 354 |
| 674 | 3300027361 | Ga0209489_103645 | Ga0209489_10364520 | 354 |
| 675 | 3300027363 | Ga0209700_100020 | Ga0209700_100020205 | 354 |
| 676 | 3300027363 | Ga0209700_100067 | Ga0209700_10006764 | 354 |
| 677 | 3300027363 | Ga0209700_100355 | Ga0209700_1003557 | 354 |
| 678 | 3300027866 | Ga0209813_10035300 | Ga0209813_100353002 | 354 |
| 679 | 3300027866 | Ga0209813_10055054 | Ga0209813_100550542 | 354 |
| 680 | 3300028379 | Ga0268266_10005789 | Ga0268266_1000578911 | 354 |
| 681 | 3300028379 | Ga0268266_10078465 | Ga0268266_100784653 | 354 |
| 682 | 3300028379 | Ga0268266_10408797 | Ga0268266_104087972 | 354 |
| 683 | 3300028380 | Ga0268265_10021152 | Ga0268265_100211522 | 354 |
| 684 | 3300028380 | Ga0268265_10279408 | Ga0268265_102794082 | 354 |
| 685 | 3300028381 | Ga0268264_10000020 | Ga0268264_1000002015 | 354 |
| 686 | 3300028794 | Ga0307515_10035428 | Ga0307515_100354285 | 354 |
| 687 | 3300028794 | Ga0307515_10202499 | Ga0307515_102024992 | 354 |
| 688 | 3300031249 | Ga0265339_10004949 | Ga0265339_100049492 | 354 |
| 689 | 3300031456 | Ga0307513_10101376 | Ga0307513_101013763 | 354 |
| 690 | 3300031456 | Ga0307513_10138748 | Ga0307513_101387481 | 354 |
| 691 | 3300031507 | Ga0307509_10110283 | Ga0307509_101102833 | 354 |
| 692 | 3300031616 | Ga0307508_10079818 | Ga0307508_100798183 | 354 |
| 693 | 3300031730 | Ga0307516_10095609 | Ga0307516_100956092 | 354 |
| 694 | 3300032126 | Ga0307415_100211728 | Ga0307415_1002117281 | 354 |
| 695 | 3300033180 | Ga0307510_10005921 | Ga0307510_100059211 | 354 |
| 696 | 3300033180 | Ga0307510_10020259 | Ga0307510_100202597 | 354 |
| 697 | 3300033180 | Ga0307510_10037404 | Ga0307510_100374041 | 354 |
| 698 | 3300033180 | Ga0307510_10045259 | Ga0307510_100452594 | 354 |
| 699 | 3300033180 | Ga0307510_10096754 | Ga0307510_100967542 | 354 |
| 700 | 3300035111 | Ga0373923_0029849 | Ga0373923_0029849_269_1354 | 354 |
| 701 | 3300035113 | Ga0373936_0029461 | Ga0373936_0029461_925_2010 | 354 |
| 702 | 3300035116 | Ga0373945_0024596 | Ga0373945_0024596_790_1875 | 354 |
| 703 | 3300035695 | Ga0373927_0006364 | Ga0373927_0006364_2311_3396 | 354 |
| 704 | 3300035695 | Ga0373927_0187066 | Ga0373927_0187066_135_1220 | 354 |
| 705 | 3300035724 | Ga0373933_0000631 | Ga0373933_0000631_7105_8190 | 354 |
| 706 | 3300035725 | Ga0373947_0042928 | Ga0373947_0042928_392_1477 | 354 |
| 707 | 3300036401 | Ga0373937_0092287 | Ga0373937_0092287_335_1420 | 354 |
| 708 | 3300037068 | Ga0373925_0015322 | Ga0373925_0015322_1231_2316 | 354 |
| 709 | 3300037068 | Ga0373925_0041371 | Ga0373925_0041371_1518_2603 | 354 |
| 710 | 3300037068 | Ga0373925_0096883 | Ga0373925_0096883_1046_2134 | 354 |
| 711 | 3300037068 | Ga0373925_0232545 | Ga0373925_0232545_298_1383 | 354 |
| 712 | 3300037466 | Ga0395898_0010290 | Ga0395898_0010290_415_1503 | 354 |
| 713 | 3300037853 | Ga0436364_1398367 | Ga0436364_1398367_1845_2930 | 354 |
| 714 | 3300038443 | Ga0395901_0385094 | Ga0395901_0385094_75_1160 | 354 |
| 715 | 3300039437 | Ga0436365_0260840 | Ga0436365_0260840_17048_18136 | 354 |
| 716 | 3300039437 | Ga0436365_1937261 | Ga0436365_1937261_1005_2093 | 354 |
| 717 | 3300039438 | Ga0436360_0043776 | Ga0436360_0043776_359_1444 | 354 |
| 718 | 3300039438 | Ga0436360_1037574 | Ga0436360_1037574_1757_2842 | 354 |
| 719 | 3300039450 | Ga0436363_0266154 | Ga0436363_0266154_341_1426 | 354 |
| 720 | 3300039453 | Ga0436362_0276427 | Ga0436362_0276427_1512_2597 | 354 |
| 721 | 3300044656 | Ga0466969_0067574 | Ga0466969_0067574_196_1266 | 354 |
| 722 | 3300044658 | Ga0466972_0006316 | Ga0466972_0006316_2694_3764 | 354 |
| 723 | 3300044658 | Ga0466972_0049620 | Ga0466972_0049620_837_1907 | 354 |
| 724 | 3300044684 | Ga0466966_0027865 | Ga0466966_0027865_312_1382 | 354 |
| 725 | 3300044693 | Ga0466961_0000650 | Ga0466961_0000650_3021_4091 | 354 |
| 726 | 3300044693 | Ga0466961_0082998 | Ga0466961_0082998_323_1408 | 354 |
| 727 | 3300044712 | Ga0453684_0000189 | Ga0453684_0000189_183893_184984 | 354 |
| 728 | 3300044735 | Ga0466968_0014484 | Ga0466968_0014484_1037_2107 | 354 |
| 729 | 3300044901 | Ga0466960_0076811 | Ga0466960_0076811_348_1418 | 354 |
| 730 | 3300045049 | Ga0466959_0029074 | Ga0466959_0029074_2919_3989 | 354 |
| 731 | 3300045051 | Ga0451576_0082586 | Ga0451576_0082586_54_1148 | 354 |
| 732 | 3300045976 | Ga0466967_0107400 | Ga0466967_0107400_975_2057 | 354 |
| 733 | 3300045976 | Ga0466967_0109755 | Ga0466967_0109755_797_1882 | 354 |
| 734 | 3300046459 | Ga0495629_0021757 | Ga0495629_0021757_933_2003 | 354 |
| 735 | 3300046459 | Ga0495629_0060639 | Ga0495629_0060639_697_1782 | 354 |
| 736 | 3300046459 | Ga0495629_0162149 | Ga0495629_0162149_338_1423 | 354 |
| 737 | 3300046460 | Ga0495638_0002608 | Ga0495638_0002608_2918_3988 | 354 |
| 738 | 3300046460 | Ga0495638_0176896 | Ga0495638_0176896_16_1101 | 354 |
| 739 | 3300046462 | Ga0495651_0040589 | Ga0495651_0040589_1252_2337 | 354 |
| 740 | 3300046462 | Ga0495651_0149874 | Ga0495651_0149874_159_1244 | 354 |
| 741 | 3300046472 | Ga0495580_0027757 | Ga0495580_0027757_1912_2997 | 354 |
| 742 | 3300046476 | Ga0495662_0118781 | Ga0495662_0118781_135_1220 | 354 |
| 743 | 3300046477 | Ga0495664_0178979 | Ga0495664_0178979_50_1135 | 354 |
| 744 | 3300046501 | Ga0495607_0089407 | Ga0495607_0089407_577_1647 | 354 |
| 745 | 3300046507 | Ga0495606_0063710 | Ga0495606_0063710_211_1281 | 354 |
| 746 | 3300046514 | Ga0495618_0067517 | Ga0495618_0067517_907_1977 | 354 |
| 747 | 3300046522 | Ga0495643_0040821 | Ga0495643_0040821_1185_2255 | 354 |
| 748 | 3300046524 | Ga0495648_0040512 | Ga0495648_0040512_1514_2584 | 354 |
| 749 | 3300046533 | Ga0495640_0008550 | Ga0495640_0008550_2598_3668 | 354 |
| 750 | 3300046533 | Ga0495640_0072701 | Ga0495640_0072701_340_1425 | 354 |
| 751 | 3300046535 | Ga0495586_0022557 | Ga0495586_0022557_1876_2961 | 354 |
| 752 | 3300046536 | Ga0495587_0018343 | Ga0495587_0018343_1405_2490 | 354 |
| 753 | 3300046542 | Ga0495597_0069534 | Ga0495597_0069534_116_1186 | 354 |
| 754 | 3300046616 | Ga0495668_0085005 | Ga0495668_0085005_97_1167 | 354 |
| 755 | 3300046642 | Ga0495634_0046164 | Ga0495634_0046164_1098_2168 | 354 |
| 756 | 3300046660 | Ga0495625_0117708 | Ga0495625_0117708_20_1090 | 354 |
| 757 | 3300046663 | Ga0495635_0002250 | Ga0495635_0002250_10082_11152 | 354 |
| 758 | 3300046663 | Ga0495635_0235717 | Ga0495635_0235717_78_1163 | 354 |
| 759 | 3300046675 | Ga0495657_0005609 | Ga0495657_0005609_4475_5545 | 354 |
| 760 | 3300046683 | Ga0495658_0030781 | Ga0495658_0030781_1229_2314 | 354 |
| 761 | 3300046689 | Ga0495613_0046879 | Ga0495613_0046879_1112_2182 | 354 |
| 762 | 3300046694 | Ga0495649_0055835 | Ga0495649_0055835_681_1751 | 354 |
| 763 | 3300047315 | Ga0495581_0028632 | Ga0495581_0028632_299_1369 | 354 |
| 764 | 3300047317 | Ga0495604_0039547 | Ga0495604_0039547_68_1138 | 354 |
| 765 | 3300047317 | Ga0495604_0156580 | Ga0495604_0156580_53_1138 | 354 |
| 766 | 3300047320 | Ga0495672_0007893 | Ga0495672_0007893_5379_6464 | 354 |
| 767 | 3300047321 | Ga0495676_0014528 | Ga0495676_0014528_4591_5661 | 354 |
| 768 | 3300047322 | Ga0495680_0047336 | Ga0495680_0047336_82_1167 | 354 |
| 769 | 3300047323 | Ga0495683_0073936 | Ga0495683_0073936_120_1190 | 354 |
| 770 | 3300047443 | Ga0495687_002707 | Ga0495687_002707_1284_2354 | 354 |
| 771 | 3300047471 | Ga0495684_0031594 | Ga0495684_0031594_205_1290 | 354 |
| 772 | 3300047471 | Ga0495684_0090398 | Ga0495684_0090398_972_2057 | 354 |
| 773 | 3300047472 | Ga0495686_0179441 | Ga0495686_0179441_20_1105 | 354 |
| 774 | 3300047673 | Ga0495593_0060777 | Ga0495593_0060777_346_1431 | 354 |
| 775 | 3300048088 | Ga0495602_0119845 | Ga0495602_0119845_460_1530 | 354 |
| 776 | 3300048903 | Ga0496100_0200756 | Ga0496100_0200756_172_1242 | 354 |
| 777 | 3300048904 | Ga0496101_0310336 | Ga0496101_0310336_58_1128 | 354 |
| 778 | 3300048905 | Ga0496102_0226549 | Ga0496102_0226549_497_1567 | 354 |
| 779 | 3300048905 | Ga0496102_0362803 | Ga0496102_0362803_187_1272 | 354 |
| 780 | 3300048906 | Ga0496103_0118490 | Ga0496103_0118490_383_1453 | 354 |
| 781 | 3300048907 | Ga0496104_0001100 | Ga0496104_0001100_16807_17877 | 354 |
| 782 | 3300048907 | Ga0496104_0019891 | Ga0496104_0019891_4080_5165 | 354 |
| 783 | 3300048907 | Ga0496104_0054854 | Ga0496104_0054854_2169_3239 | 354 |
| 784 | 3300048908 | Ga0496105_0001328 | Ga0496105_0001328_4086_5156 | 354 |
| 785 | 3300048908 | Ga0496105_0340748 | Ga0496105_0340748_49_1134 | 354 |
| 786 | 3300048909 | Ga0496106_0000790 | Ga0496106_0000790_17656_18741 | 354 |
| 787 | 3300048912 | Ga0496109_0020657 | Ga0496109_0020657_1217_2302 | 354 |
| 788 | 3300048912 | Ga0496109_0174024 | Ga0496109_0174024_698_1768 | 354 |
| 789 | 3300048913 | Ga0496110_0018064 | Ga0496110_0018064_3805_4890 | 354 |
| 790 | 3300048913 | Ga0496110_0247899 | Ga0496110_0247899_311_1381 | 354 |
| 791 | 3300048915 | Ga0496112_0022886 | Ga0496112_0022886_1169_2254 | 354 |
| 792 | 3300048915 | Ga0496112_0147312 | Ga0496112_0147312_1072_2142 | 354 |
| 793 | 3300048916 | Ga0496113_0013688 | Ga0496113_0013688_3446_4531 | 354 |
| 794 | 3300048918 | Ga0496115_0081514 | Ga0496115_0081514_545_1630 | 354 |
| 795 | 3300048920 | Ga0496117_0064200 | Ga0496117_0064200_41_1111 | 354 |
| 796 | 3300048920 | Ga0496117_0088948 | Ga0496117_0088948_76_1161 | 354 |
| 797 | 3300048920 | Ga0496117_0100016 | Ga0496117_0100016_288_1373 | 354 |
| 798 | 3300048920 | Ga0496117_0193540 | Ga0496117_0193540_64_1134 | 354 |
| 799 | 3300048921 | Ga0496118_0058896 | Ga0496118_0058896_1215_2300 | 354 |
| 800 | 3300048921 | Ga0496118_0072504 | Ga0496118_0072504_512_1582 | 354 |
| 801 | 3300048922 | Ga0496119_0002808 | Ga0496119_0002808_5354_6424 | 354 |
| 802 | 3300048922 | Ga0496119_0136104 | Ga0496119_0136104_170_1255 | 354 |
| 803 | 3300048923 | Ga0496120_0003504 | Ga0496120_0003504_1347_2417 | 354 |
| 804 | 3300048924 | Ga0496121_0001681 | Ga0496121_0001681_28776_29861 | 354 |
| 805 | 3300048924 | Ga0496121_0003198 | Ga0496121_0003198_4214_5299 | 354 |
| 806 | 3300048924 | Ga0496121_0039756 | Ga0496121_0039756_1776_2846 | 354 |
| 807 | 3300048925 | Ga0496122_0012846 | Ga0496122_0012846_4797_5882 | 354 |
| 808 | 3300048927 | Ga0496124_0002423 | Ga0496124_0002423_4125_5210 | 354 |
| 809 | 3300048928 | Ga0496125_0048054 | Ga0496125_0048054_2311_3381 | 354 |
| 810 | 3300048929 | Ga0496126_0018165 | Ga0496126_0018165_4737_5825 | 354 |
| 811 | 3300048929 | Ga0496126_0039823 | Ga0496126_0039823_2301_3386 | 354 |
| 812 | 3300048929 | Ga0496126_0094472 | Ga0496126_0094472_68_1138 | 354 |
| 813 | 3300048929 | Ga0496126_0127584 | Ga0496126_0127584_79_1164 | 354 |
| 814 | 3300048929 | Ga0496126_0196048 | Ga0496126_0196048_553_1638 | 354 |
| 815 | 3300049460 | Ga0495682_0036994 | Ga0495682_0036994_419_1489 | 354 |
| 816 | 3300049581 | Ga0501047_0022387 | Ga0501047_0022387_4939_6024 | 354 |
| 817 | 3300049589 | Ga0501073_0025069 | Ga0501073_0025069_392_1477 | 354 |
| 818 | 3300049823 | Ga0501044_0256981 | Ga0501044_0256981_562_1644 | 354 |
| 819 | 3300050492 | nmdc:mga0yw44_170290_c1 | nmdc:mga0yw44_170290_c1_33_1103 | 354 |
| 820 | 3300050492 | nmdc:mga0yw44_181974_c1 | nmdc:mga0yw44_181974_c1_296_1366 | 354 |
| 821 | 3300050492 | nmdc:mga0yw44_72652_c1 | nmdc:mga0yw44_72652_c1_69_1139 | 354 |
| 822 | 3300050493 | nmdc:mga0k408_82863_c1 | nmdc:mga0k408_82863_c1_485_1555 | 354 |
| 823 | 3300050494 | nmdc:mga06z11_24442_c1 | nmdc:mga06z11_24442_c1_1490_2575 | 354 |
| 824 | 3300050494 | nmdc:mga06z11_38395_c1 | nmdc:mga06z11_38395_c1_1231_2316 | 354 |
| 825 | 3300050495 | nmdc:mga04h51_65800_c1 | nmdc:mga04h51_65800_c1_120_1205 | 354 |
| 826 | 3300050513 | nmdc:mga0rr50_170102_c1 | nmdc:mga0rr50_170102_c1_238_1395 | 354 |
| 827 | 3300050516 | nmdc:mga0sz30_18837_c1 | nmdc:mga0sz30_18837_c1_253_1323 | 354 |
| 828 | 3300053087 | Ga0500643_001125 | Ga0500643_001125_9663_10748 | 354 |
| 829 | 3300053090 | Ga0500646_0025209 | Ga0500646_0025209_401_1471 | 354 |
| 830 | 3300053093 | Ga0500651_0013310 | Ga0500651_0013310_779_1849 | 354 |
| 831 | 3300053094 | Ga0500566_0000232 | Ga0500566_0000232_19692_20777 | 354 |
| 832 | 3300053095 | Ga0500640_023559 | Ga0500640_023559_760_1830 | 354 |
| 833 | 3300053103 | Ga0500555_011850 | Ga0500555_011850_935_2020 | 354 |
| 834 | 3300053105 | Ga0500557_000036 | Ga0500557_000036_1218_2288 | 354 |
| 835 | 3300053108 | Ga0500562_015703 | Ga0500562_015703_554_1624 | 354 |
| 836 | 3300053111 | Ga0500572_004823 | Ga0500572_004823_384_1454 | 354 |
| 837 | 3300053119 | Ga0500595_000218 | Ga0500595_000218_26469_27554 | 354 |
| 838 | 3300053121 | Ga0500607_093658 | Ga0500607_093658_203_1288 | 354 |
| 839 | 3300053130 | Ga0500642_0000122 | Ga0500642_0000122_1853_2923 | 354 |
| 840 | 3300053130 | Ga0500642_0001048 | Ga0500642_0001048_5476_6561 | 354 |
| 841 | 3300053133 | Ga0500655_009118 | Ga0500655_009118_701_1771 | 354 |
| 842 | 3300053134 | Ga0500658_0032893 | Ga0500658_0032893_339_1424 | 354 |
| 843 | 3300053145 | Ga0500586_000362 | Ga0500586_000362_6774_7859 | 354 |
| 844 | 3300053148 | Ga0500590_062055 | Ga0500590_062055_465_1580 | 354 |
| 845 | 3300053150 | Ga0500603_001454 | Ga0500603_001454_3469_4554 | 354 |
| 846 | 3300053153 | Ga0500616_0020064 | Ga0500616_0020064_1451_2521 | 354 |
| 847 | 3300053156 | Ga0500622_0012277 | Ga0500622_0012277_3343_4428 | 354 |
| 848 | 3300053159 | Ga0500630_012678 | Ga0500630_012678_587_1672 | 354 |
| 849 | 3300053162 | Ga0500638_000841 | Ga0500638_000841_2593_3678 | 354 |
| 850 | 3300053162 | Ga0500638_070655 | Ga0500638_070655_117_1187 | 354 |
| 851 | 3300053163 | Ga0500639_027833 | Ga0500639_027833_1516_2601 | 354 |
| 852 | 3300053177 | Ga0500636_0044126 | Ga0500636_0044126_185_1270 | 354 |
| 853 | 3300053178 | Ga0500637_0120120 | Ga0500637_0120120_46_1134 | 354 |
| 854 | 3300053735 | Ga0500596_000723 | Ga0500596_000723_2324_3412 | 354 |
| 855 | 3300053735 | Ga0500596_004089 | Ga0500596_004089_860_1945 | 354 |
| 856 | iso_pu_bacteria | 2507262055 | 2507506583 | 354 |
| 857 | iso_pu_bacteria | 2508501009 | 2508540433 | 354 |
| 858 | iso_pu_bacteria | 2508501042 | 2508693540 | 354 |
| 859 | iso_pu_bacteria | 2508501042 | 2508696467 | 354 |
| 860 | iso_pu_bacteria | 2513237095 | 2513648662 | 354 |
| 861 | iso_pu_bacteria | 2513237095 | 2513652212 | 354 |
| 862 | iso_pu_bacteria | 2513237098 | 2513674773 | 354 |
| 863 | iso_pu_bacteria | 2513237101 | 2513698332 | 354 |
| 864 | iso_pu_bacteria | 2513237139 | 2513879883 | 354 |
| 865 | iso_pu_bacteria | 2513237141 | 2513893859 | 354 |
| 866 | iso_pu_bacteria | 2513237145 | 2513921336 | 354 |
| 867 | iso_pu_bacteria | 2513237145 | 2513923408 | 354 |
| 868 | iso_pu_bacteria | 2513237161 | 2514013168 | 354 |
| 869 | iso_pu_bacteria | 2515154112 | 2515629371 | 354 |
| 870 | iso_pu_bacteria | 2517093001 | 2517108622 | 354 |
| 871 | iso_pu_bacteria | 2617270735 | 2617348520 | 354 |
| 872 | iso_pu_bacteria | 2617270735 | 2617349923 | 354 |
| 873 | iso_pu_bacteria | 2721755755 | 2723844652 | 354 |
| 874 | iso_pu_bacteria | 2728368998 | 2728748670 | 354 |
| 875 | iso_pu_bacteria | 2791355196 | 2793065833 | 354 |
| 876 | iso_pu_bacteria | 2791355199 | 2793082495 | 354 |
| 877 | iso_pu_bacteria | 2791355199 | 2793084066 | 354 |
| 878 | iso_pu_bacteria | 2816332527 | 2818241924 | 354 |
| 879 | iso_pu_bacteria | 2816332527 | 2818243769 | 354 |
| 880 | iso_pu_bacteria | 2824600985 | 2824601440 | 354 |
| 881 | iso_pu_bacteria | 2824626560 | 2824629017 | 354 |
| 882 | iso_pu_bacteria | 2824635225 | 2824635684 | 354 |
| 883 | iso_pu_bacteria | 2824644064 | 2824644669 | 354 |
| 884 | iso_pu_bacteria | 2824653114 | 2824657889 | 354 |
| 885 | iso_pu_bacteria | 2824704595 | 2824704854 | 354 |
| 886 | iso_pu_bacteria | 2824714736 | 2824715116 | 354 |
| 887 | iso_pu_bacteria | 2824723954 | 2824724353 | 354 |
| 888 | iso_pu_bacteria | 2824753945 | 2824754138 | 354 |
| 889 | iso_pu_bacteria | 2824763712 | 2824765698 | 354 |
| 890 | iso_pu_bacteria | 2824773399 | 2824777578 | 354 |
| 891 | iso_pu_bacteria | 2841941048 | 2841941849 | 354 |
| 892 | iso_pu_bacteria | 2841941048 | 2841948295 | 354 |
| 893 | iso_pu_bacteria | 2841949485 | 2841957204 | 354 |
| 894 | iso_pu_bacteria | 2841957949 | 2841961481 | 354 |
| 895 | iso_pu_bacteria | 2841966195 | 2841968695 | 354 |
| 896 | iso_pu_bacteria | 2841966195 | 2841970149 | 354 |
| 897 | iso_pu_bacteria | 2841974524 | 2841977202 | 354 |
| 898 | iso_pu_bacteria | 2841983080 | 2841985666 | 354 |
| 899 | iso_pu_bacteria | 2847930680 | 2847932719 | 354 |
| 900 | iso_pu_bacteria | 2847930680 | 2847934215 | 354 |
| 901 | iso_pu_bacteria | 2847930680 | 2847938151 | 354 |
| 902 | iso_pu_bacteria | 2847939898 | 2847940991 | 354 |
| 903 | iso_pu_bacteria | 2857509624 | 2857516250 | 354 |
| 904 | iso_pu_bacteria | 2874590934 | 2874593904 | 354 |
| 905 | iso_pu_bacteria | 2874604998 | 2874605783 | 354 |
| 906 | iso_pu_bacteria | 2874612657 | 2874613902 | 354 |
| 907 | iso_pu_bacteria | 2874628541 | 2874634470 | 354 |
| 908 | iso_pu_bacteria | 2874645413 | 2874646388 | 354 |
| 909 | iso_pu_bacteria | 2876771140 | 2876773536 | 354 |
| 910 | iso_pu_bacteria | 2876808645 | 2876815129 | 354 |
| 911 | iso_pu_bacteria | 2876818435 | 2876821757 | 354 |
| 912 | iso_pu_bacteria | 2879074833 | 2879077450 | 354 |
| 913 | iso_pu_bacteria | 2879083081 | 2879084303 | 354 |
| 914 | iso_pu_bacteria | 2879099564 | 2879102079 | 354 |
| 915 | iso_pu_bacteria | 2879110137 | 2879117819 | 354 |
| 916 | iso_pu_bacteria | 2879127579 | 2879129022 | 354 |
| 917 | iso_pu_bacteria | 2881364244 | 2881368984 | 354 |
| 918 | iso_pu_bacteria | 2881665667 | 2881666186 | 354 |
| 919 | iso_pu_bacteria | 2885374607 | 2885382073 | 354 |
| 920 | iso_pu_bacteria | 2885383462 | 2885385796 | 354 |
| 921 | iso_pu_bacteria | 2889033259 | 2889042137 | 354 |
| 922 | iso_pu_bacteria | 2903748898 | 2903757936 | 354 |
| 923 | iso_pu_bacteria | 2903768456 | 2903772808 | 354 |
| 924 | iso_pu_bacteria | 2904666416 | 2904673490 | 354 |
| 925 | iso_pu_bacteria | 2904699407 | 2904710505 | 354 |
| 926 | iso_pu_bacteria | 2906602504 | 2906609779 | 354 |
| 927 | iso_pu_bacteria | 2906626472 | 2906629389 | 354 |
| 928 | iso_pu_bacteria | 2906643746 | 2906644008 | 354 |
| 929 | iso_pu_bacteria | 2906643746 | 2906648086 | 354 |
| 930 | iso_pu_bacteria | 2908739725 | 2908745490 | 354 |
| 931 | iso_pu_bacteria | 2908775508 | 2908778325 | 354 |
| 932 | iso_pu_bacteria | 2922361189 | 2922368661 | 354 |
| 933 | iso_pu_bacteria | 2922386360 | 2922388673 | 354 |
| 934 | iso_pu_bacteria | 2922386360 | 2922388691 | 354 |
| 935 | iso_pu_bacteria | 2922386360 | 2922393102 | 354 |
| 936 | iso_pu_bacteria | 2922393267 | 2922394175 | 354 |
| 937 | iso_pu_bacteria | 2922425934 | 2922428280 | 354 |
| 938 | iso_pu_bacteria | 2929615660 | 2929621331 | 354 |
| 939 | iso_pu_bacteria | 2929615660 | 2929623419 | 354 |
| 940 | iso_pu_bacteria | 2929624759 | 2929631855 | 354 |
| 941 | iso_pu_bacteria | 2929624759 | 2929632839 | 354 |
| 942 | iso_pu_bacteria | 2932784394 | 2932785443 | 354 |
| 943 | iso_pu_bacteria | 2932794094 | 2932800915 | 354 |
| 944 | iso_pu_bacteria | 2932801729 | 2932809272 | 354 |
| 945 | iso_pu_bacteria | 2932809354 | 2932816073 | 354 |
| 946 | iso_pu_bacteria | 2932818245 | 2932825407 | 354 |
| 947 | iso_pu_bacteria | 2932828146 | 2932835016 | 354 |
| 948 | iso_pu_bacteria | 2933577622 | 2933583642 | 354 |
| 949 | iso_pu_bacteria | 2933577622 | 2933585425 | 354 |
| 950 | iso_pu_bacteria | 2935608549 | 2935616199 | 354 |
| 951 | iso_pu_bacteria | 2935616580 | 2935625203 | 354 |
| 952 | iso_pu_bacteria | 2935638405 | 2935647145 | 354 |
| 953 | iso_pu_bacteria | 2935648319 | 2935652777 | 354 |
| 954 | iso_pu_bacteria | 2935648319 | 2935655668 | 354 |
| 955 | iso_pu_bacteria | 2935656913 | 2935661237 | 354 |
| 956 | iso_pu_bacteria | 2935656913 | 2935664546 | 354 |
| 957 | iso_pu_bacteria | 2935665750 | 2935673864 | 354 |
| 958 | iso_pu_bacteria | 2935675223 | 2935681076 | 354 |
| 959 | iso_pu_bacteria | 2935684952 | 2935690708 | 354 |
| 960 | iso_pu_bacteria | 2935694250 | 2935703027 | 354 |
| 961 | iso_pu_bacteria | 2935713505 | 2935717596 | 354 |
| 962 | iso_pu_bacteria | 2935722832 | 2935727254 | 354 |
| 963 | iso_pu_bacteria | 2935732158 | 2935741330 | 354 |
| 964 | iso_pu_bacteria | 2935741537 | 2935750705 | 354 |
| 965 | iso_pu_bacteria | 2935750917 | 2935755717 | 354 |
| 966 | iso_pu_bacteria | 2935760218 | 2935769450 | 354 |
| 967 | iso_pu_bacteria | 2935769743 | 2935776240 | 354 |
| 968 | iso_pu_bacteria | 2935777560 | 2935784596 | 354 |
| 969 | iso_pu_bacteria | 2935777560 | 2935784745 | 354 |
| 970 | iso_pu_bacteria | 2935785616 | 2935790577 | 354 |
| 971 | iso_pu_bacteria | 2935793552 | 2935799015 | 354 |
| 972 | iso_pu_bacteria | 2935801545 | 2935809547 | 354 |
| 973 | iso_pu_bacteria | 2935810662 | 2935818698 | 354 |
| 974 | iso_pu_bacteria | 2935819856 | 2935827177 | 354 |
| 975 | iso_pu_bacteria | 2935827899 | 2935836526 | 354 |
| 976 | iso_pu_bacteria | 2935837841 | 2935846337 | 354 |
| 977 | iso_pu_bacteria | 2935847175 | 2935854546 | 354 |
| 978 | iso_pu_bacteria | 2935855204 | 2935863831 | 354 |
| 979 | iso_pu_bacteria | 2935864058 | 2935871933 | 354 |
| 980 | iso_pu_bacteria | 2935873716 | 2935882755 | 354 |
| 981 | iso_pu_bacteria | 2935883170 | 2935890517 | 354 |
| 982 | iso_pu_bacteria | 2935908558 | 2935915266 | 354 |
| 983 | iso_pu_bacteria | 2935926038 | 2935932523 | 354 |
| 984 | iso_pu_bacteria | 2935934488 | 2935941152 | 354 |
| 985 | iso_pu_bacteria | 2935942939 | 2935949193 | 354 |
| 986 | iso_pu_bacteria | 2935951376 | 2935957919 | 354 |
| 987 | iso_pu_bacteria | 2935959822 | 2935963155 | 354 |
| 988 | iso_pu_bacteria | 2935967501 | 2935974199 | 354 |
| 989 | iso_pu_bacteria | 2935975950 | 2935983427 | 354 |
| 990 | iso_pu_bacteria | 2935984226 | 2935986559 | 354 |
| 991 | iso_pu_bacteria | 2935984226 | 2935988819 | 354 |
| 992 | iso_pu_bacteria | 2935992306 | 2936000914 | 354 |
| 993 | iso_pu_bacteria | 2935992306 | 2936001499 | 354 |
| 994 | iso_pu_bacteria | 2936002035 | 2936010480 | 354 |
| 995 | iso_pu_bacteria | 2936011229 | 2936015525 | 354 |
| 996 | iso_pu_bacteria | 2936011229 | 2936018618 | 354 |
| 997 | iso_pu_bacteria | 2936019824 | 2936024159 | 354 |
| 998 | iso_pu_bacteria | 2936019824 | 2936027135 | 354 |
| 999 | iso_pu_bacteria | 2936028420 | 2936033411 | 354 |
| 1000 | iso_pu_bacteria | 2936028420 | 2936036017 | 354 |
| 1001 | iso_pu_bacteria | 2936037263 | 2936045420 | 354 |
| 1002 | iso_pu_bacteria | 2936046547 | 2936051267 | 354 |
| 1003 | iso_pu_bacteria | 2936046547 | 2936054096 | 354 |
| 1004 | iso_pu_bacteria | 2936055302 | 2936060054 | 354 |
| 1005 | iso_pu_bacteria | 2936055302 | 2936062505 | 354 |
| 1006 | iso_pu_bacteria | 2936055302 | 2936063446 | 354 |
| 1007 | iso_pu_bacteria | 2940556831 | 2940561002 | 354 |
| 1008 | iso_pu_bacteria | 2941531003 | 2941537169 | 354 |
| 1009 | iso_pu_bacteria | 2941538514 | 2941546801 | 354 |
| 1010 | iso_pu_bacteria | 3005594810 | 3005597071 | 354 |
| 1011 | iso_pu_bacteria | 3005594810 | 3005602906 | 354 |
| 1012 | iso_pu_bacteria | 3005718088 | 3005720545 | 354 |
| 1013 | iso_pu_bacteria | 3005718088 | 3005725378 | 354 |
| 1014 | iso_pu_bacteria | 8006933436 | 8006942951 | 354 |
| 1015 | iso_pu_bacteria | 8006973647 | 8006982671 | 354 |
| 1016 | iso_pu_bacteria | 8006994254 | 8006994411 | 354 |
| 1017 | iso_pu_bacteria | 8016511872 | 8016512300 | 354 |
| 1018 | iso_pu_bacteria | 8016522445 | 8016527606 | 354 |
| 1019 | iso_pu_bacteria | 8016530956 | 8016532703 | 354 |
| 1020 | iso_pu_bacteria | 8016539877 | 8016545930 | 354 |
| 1021 | iso_pu_bacteria | 8016548790 | 8016556179 | 354 |
| 1022 | iso_pu_bacteria | 8016557553 | 8016564547 | 354 |
| 1023 | iso_pu_bacteria | 8016566248 | 8016571009 | 354 |
| 1024 | iso_pu_bacteria | 8016575299 | 8016583514 | 354 |
| 1025 | iso_pu_bacteria | 8016583857 | 8016584480 | 354 |
| 1026 | iso_pu_bacteria | 8016583857 | 8016595133 | 354 |
| 1027 | iso_pu_bacteria | 8016595262 | 8016602204 | 354 |
| 1028 | iso_pu_bacteria | 8016603502 | 8016605199 | 354 |
| 1029 | iso_pu_bacteria | 8016613128 | 8016617040 | 354 |
| 1030 | iso_pu_bacteria | 8016630954 | 8016634172 | 354 |
| 1031 | iso_pu_bacteria | 8017057580 | 8017066734 | 354 |
| 1032 | iso_pu_bacteria | 8019538911 | 8019542168 | 354 |
| 1033 | iso_pu_bacteria | 8019547302 | 8019547478 | 354 |
| 1034 | iso_pu_bacteria | 8019547302 | 8019547666 | 354 |
| 1035 | iso_pu_bacteria | 8019576017 | 8019585361 | 354 |
| 1036 | iso_pu_bacteria | 8019586578 | 8019593355 | 354 |
| 1037 | iso_pu_bacteria | 8019597564 | 8019598128 | 354 |
| 1038 | iso_pu_bacteria | 8019629233 | 8019632202 | 354 |
| 1039 | iso_pu_bacteria | 8019629233 | 8019632661 | 354 |
| 1040 | iso_pu_bacteria | 8019648815 | 8019654307 | 354 |
| 1041 | iso_pu_bacteria | 8019659431 | 8019660118 | 354 |
| 1042 | iso_pu_bacteria | 8019668869 | 8019669545 | 354 |
| 1043 | iso_pu_bacteria | 8019687851 | 8019692622 | 354 |
| 1044 | iso_pu_bacteria | 8055742211 | 8055743744 | 354 |
| 1045 | iso_pu_bacteria | 8055742211 | 8055744464 | 354 |
| 1046 | iso_pu_bacteria | 8056673599 | 8056677130 | 354 |
| 1047 | iso_pu_bacteria | 8056681323 | 8056684396 | 354 |
| 1048 | iso_pu_bacteria | 8056689827 | 8056694333 | 354 |
| 1049 | iso_pu_bacteria | 8056967851 | 8056973379 | 354 |
| 1050 | 3300021384 | Ga0213876_10009215 | Ga0213876_100092154 | 355 |
| 1051 | 3300039437 | Ga0436365_0709051 | Ga0436365_0709051_24502_25584 | 355 |
| 1052 | 3300039437 | Ga0436365_0776418 | Ga0436365_0776418_180_1310 | 355 |
| 1053 | 3300044712 | Ga0453684_0001541 | Ga0453684_0001541_58173_59273 | 355 |
| 1054 | 3300045051 | Ga0451576_0000064 | Ga0451576_0000064_5247_6347 | 355 |
| 1055 | 3300053134 | Ga0500658_0048764 | Ga0500658_0048764_510_1592 | 355 |
| 1056 | 3300053139 | Ga0500568_0011572 | Ga0500568_0011572_2433_3515 | 355 |
| 1057 | 3300005548 | Ga0070665_100106254 | Ga0070665_1001062542 | 357 |
| 1058 | 3300005844 | Ga0068862_100372379 | Ga0068862_1003723792 | 357 |
| 1059 | 3300006353 | Ga0075370_10058041 | Ga0075370_100580412 | 357 |
| 1060 | 3300014326 | Ga0157380_10013096 | Ga0157380_100130962 | 357 |
| 1061 | 3300025937 | Ga0207669_10217684 | Ga0207669_102176842 | 357 |
| 1062 | 3300050495 | nmdc:mga04h51_15680_c1 | nmdc:mga04h51_15680_c1_535_1629 | 357 |
| 1063 | 3300005455 | Ga0070663_100001338 | Ga0070663_10000133811 | 359 |
| 1064 | 3300005548 | Ga0070665_100003271 | Ga0070665_10000327113 | 359 |
| 1065 | 3300006038 | Ga0075365_10196091 | Ga0075365_101960912 | 359 |
| 1066 | 3300006178 | Ga0075367_10016272 | Ga0075367_100162722 | 359 |
| 1067 | 3300006353 | Ga0075370_10007506 | Ga0075370_100075067 | 359 |
| 1068 | 3300009101 | Ga0105247_10031386 | Ga0105247_100313863 | 359 |
| 1069 | 3300026067 | Ga0207678_10012336 | Ga0207678_100123366 | 359 |
| 1070 | 3300028379 | Ga0268266_10000988 | Ga0268266_1000098826 | 359 |
| 1071 | 3300048915 | Ga0496112_0287943 | Ga0496112_0287943_30_1133 | 359 |
| 1072 | 3300050490 | nmdc:mga03n38_204_c1 | nmdc:mga03n38_204_c1_6796_7899 | 359 |
| 1073 | 3300050492 | nmdc:mga0yw44_132069_c1 | nmdc:mga0yw44_132069_c1_172_1275 | 359 |
| 1074 | 3300050496 | nmdc:mga07m45_751_c1 | nmdc:mga07m45_751_c1_433_1536 | 359 |
| 1075 | 2162886007 | SwRhRL2b_contig_3482130 | SwRhRL2b_0287.00004930 | 360 |
| 1076 | 3300005289 | Ga0065704_10072745 | Ga0065704_100727454 | 360 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6gpj-assembly1.cif.gz_A | crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4f-man | 0.9791 | 3 | 347 |
| 6gpl-assembly1.cif.gz_B | crystal structure of human gdp-d-mannose 4,6-dehydratase in complex with gdp-4k6d-man | 0.9784 | 3 | 347 |
| 6q94-assembly3.cif.gz_H-2 | crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man | 0.9732 | 3 | 349 |
| 6gpk-assembly1.cif.gz_C | crystal structure of human gdp-d-mannose 4,6-dehydratase (e157q) in complex with gdp-man | 0.9727 | 3 | 347 |
| 6q94-assembly1.cif.gz_B-3 | crystal structure of human gdp-d-mannose 4,6-dehydratase (s156d) in complex with gdp-man | 0.9713 | 3 | 347 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4D941_50_182_3.90.25.10 | Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 | 0.9883 | 193 | 323 | 3.90.25.10 |
| af_P0AC88_3_270_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9825 | 3 | 268 | 3.40.50.720 |
| af_P0AC88_3_270_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9717 | 3 | 268 | 3.40.50.720 |
| af_F1QPT3_45_368_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9696 | 26 | 340 | 3.40.50.720 |
| af_Q4D941_50_182_3.90.25.10 | Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 | 0.9663 | 193 | 323 | 3.90.25.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A357FXF0-F1-model_v4 | GDP-mannose 4,6-dehydratase (EC 4.2.1.47) | 0.998 | 192 | 296 |
GO:0008446
GO:0042351 |
| AF-A0A5J4NJV4-F1-model_v4 | GDP-mannose 4,6-dehydratase (EC 4.2.1.47) (GDP-D-mannose dehydratase) | 0.9954 | 213 | 345 |
GO:0008446
GO:0042351 |
| AF-A0A730K5U1-F1-model_v4 | GDP-mannose 4,6-dehydratase (EC 4.2.1.47) | 0.9953 | 185 | 289 |
GO:0008446
GO:0042351 |
| AF-A0A382VIM8-F1-model_v4 | GDP-mannose 4,6-dehydratase (EC 4.2.1.47) | 0.9952 | 171 | 342 |
GO:0008446
GO:0042351 |
| AF-A0A3D0JWK2-F1-model_v4 | GDP-mannose 4,6-dehydratase (EC 4.2.1.47) | 0.9945 | 185 | 345 |
GO:0008446
GO:0042351 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar