F489538

General Info

Members Datasets Scaffolds Average Seq Length
1074 568 890 298

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100035992|Ga0070683_1000359924
Length 356
Sequence MKGTVLEPPPRGVPDDIETFSLGRTAAITDNARSPKASRFWRHGPVQRSRPGRDPKGRRLTMIPFDGELPPPFEIVEPAEWRAPIIFNSPHSGSVYPEDFLNASRIDLPTLRRSEDSFMDELIADLAAHGFPVVRVNFPRSYVDVNREPYELDPRMFAGRLPSFANTRSMRVAGGLGTIPRVVGDGQEIYRERLSVDDALTRVETLYKPYHRALRRLINRVHQSFGTVVVVDCHSMPSIGVSRDEPRRPDIVIGDRYGTSCAPLLPNRVEQTMSRLGYSVGRNKPYAGGFITEHYGNPASGLHAIQLELNRAIYMDERRREKGPRFAQVAADFAALADALATVPFGDLGPFQAAAE

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
12 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
13 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
14 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
15 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
16 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
17 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
18 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
19 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
20 2643221651 Afipia sp. Root123D2 Isolate Unclassified
21 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
22 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
23 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
24 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
25 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
26 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
27 2791355199
28 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
29 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
30 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
31 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
32 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
33 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
34 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
35 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
36 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
37 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
38 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
39 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
40 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
41 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
42 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
43 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
44 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
45 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
46 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
47 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
48 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
49 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
50 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
51 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
52 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
53 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
54 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
55 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
56 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
57 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
58 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
59 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
60 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
61 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
62 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
63 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
64 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
65 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
66 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
67 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
68 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
69 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
70 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
71 2904699407
72 2906610324
73 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
74 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
75 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
76 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
77 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
78 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
79 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
80 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
81 2922368715
82 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
83 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
84 2922425934
85 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
86 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
87 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
88 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
89 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
90 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
91 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
92 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
93 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
94 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
95 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
96 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
97 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
98 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
99 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
100 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
101 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
102 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
103 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
104 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
105 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
106 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
107 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
108 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
109 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
110 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
111 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
112 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
113 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
114 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
115 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
116 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
117 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
118 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
119 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
120 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
121 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
122 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
123 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
124 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
125 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
126 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
127 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
128 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
129 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
130 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
131 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
132 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
133 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
134 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
135 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
136 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
137 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
138 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
139 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
140 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
141 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
142 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
143 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
144 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
145 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
146 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
147 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
148 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
149 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
150 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
151 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
152 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
153 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
154 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
155 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
156 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
157 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
158 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
159 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
160 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
161 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
162 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
163 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
164 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
165 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
166 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
167 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
168 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
169 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
170 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
171 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
172 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
173 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
174 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
175 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
176 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
177 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
178 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
179 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
180 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
181 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
182 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
183 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
184 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
185 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
186 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
187 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
188 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
189 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
190 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
191 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
192 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
193 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
194 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
195 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
196 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
197 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
198 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
199 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
200 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
201 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
202 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
203 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
204 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
205 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
206 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
207 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
208 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
209 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
210 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
211 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
212 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
213 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
214 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
215 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
216 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
217 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
218 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
219 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
220 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
221 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
222 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
223 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
224 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
225 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
226 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
227 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
228 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
229 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
230 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
231 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
232 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
233 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
234 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
235 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
236 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
237 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
238 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
239 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
240 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
241 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
242 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
243 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
244 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
245 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
246 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
247 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
248 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
249 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
250 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
251 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
254 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
255 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
257 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
306 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
307 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
308 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
309 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
314 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
315 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
316 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
317 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
318 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
319 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
320 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
321 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
322 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
323 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
324 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
325 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
326 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
327 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
328 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
329 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
330 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
331 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
332 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
333 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
334 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
335 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
336 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
337 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
338 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
339 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
340 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
341 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
342 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
343 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
344 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
345 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
346 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
347 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
348 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
349 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
350 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
351 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
352 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
353 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
354 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
355 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
356 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
357 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
358 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
359 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
360 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
361 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
362 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
363 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
364 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
365 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
366 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
367 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
368 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
369 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
370 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
371 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
372 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
373 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
374 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
375 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
376 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
377 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
378 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
379 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
380 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
381 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
382 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
383 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
384 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
385 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
386 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
387 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
388 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
389 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
390 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
391 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
392 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
393 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
394 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
395 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
396 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
397 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
398 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
399 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
400 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
401 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
402 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
403 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
404 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
405 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
406 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
407 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
408 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
409 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
410 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
411 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
412 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
413 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
414 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
415 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
416 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
417 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
418 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
419 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
420 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
421 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
422 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
423 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
424 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
425 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
426 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
427 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
428 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
429 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
430 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
431 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
432 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
433 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
434 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
435 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
436 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
437 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
438 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
439 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
440 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
441 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
442 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
443 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
444 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
445 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
446 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
447 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
448 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
449 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
450 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
451 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
452 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
453 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
454 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
455 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
456 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
457 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
458 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
459 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
460 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
461 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
462 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
463 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
464 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
472 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
474 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
476 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
478 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
479 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
480 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
481 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
482 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
483 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
484 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
485 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
486 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
487 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
488 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
489 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
490 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
491 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
492 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
493 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
494 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
495 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
496 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
497 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
498 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
499 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
500 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
501 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
502 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
503 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
504 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
505 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
506 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
507 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
508 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
509 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
510 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
511 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
512 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
513 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
514 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
515 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
516 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
517 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
518 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
519 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
520 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
521 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
522 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
523 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
524 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
525 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
526 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
527 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
528 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
529 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
530 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
531 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
532 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
533 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
534 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
535 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
536 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
537 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
538 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
539 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
540 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
541 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
542 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
543 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
544 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
545 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
546 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
547 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
548 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
549 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
550 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
551 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
552 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
553 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
554 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
555 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
556 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
557 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
558 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
559 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
560 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
561 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
562 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
563 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
564 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
565 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
566 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
567 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
568 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.26
Metatranscriptomes 0
Isolates 16.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.94
Nodule 14.53
Rhizoplane 7.54
Rhizosphere 59.22
Stem 0
Stem Tuber 0
Unclassified 9.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10006073 3300003203 Bacteria 5580
2 JGI25153J46596_10004803 3300003215 Bacteria 7199
3 JGI25153J46596_10028115 3300003215 Bacteria 1957
4 JGI25160J50197_1024331 3300003354 Bacteria 1720
5 JGI25404J52841_10001048 3300003659 Bacteria 4603
6 Ga0055531_10020619 3300003794 Bacteria 2599
7 Ga0055543_1012260 3300004625 Bacteria 1730
8 Ga0065165_1030520 3300005262 Bacteria 1713
9 Ga0070658_10011197 3300005327 Bacteria 7189
10 Ga0070658_10064095 3300005327 Bacteria 2997
11 Ga0070658_10355905 3300005327 Bacteria 1253
12 Ga0070683_100035992 3300005329 Bacteria 4528
13 Ga0070683_100046881 3300005329 Bacteria 3994
14 Ga0070683_100110710 3300005329 Bacteria 2590
15 Ga0070680_100020407 3300005336 Bacteria 5259
16 Ga0070680_100034052 3300005336 Bacteria 4107
17 Ga0070680_100104526 3300005336 Bacteria 2353
18 Ga0070680_100132343 3300005336 Bacteria 2087
19 Ga0070682_100294312 3300005337 Bacteria 1188
20 Ga0068868_100235674 3300005338 Bacteria 1536
21 Ga0070660_100019955 3300005339 Bacteria 4917
22 Ga0070660_100052201 3300005339 Bacteria 3151
23 Ga0070668_100110800 3300005347 Bacteria 2184
24 Ga0070671_100166203 3300005355 Bacteria 1866
25 Ga0070671_100307646 3300005355 Bacteria 1350
26 Ga0070674_100170542 3300005356 Bacteria 1659
27 Ga0070659_100128407 3300005366 Bacteria 2057
28 Ga0070667_100143556 3300005367 Bacteria 2092
29 Ga0070709_10009651 3300005434 Bacteria 5330
30 Ga0070709_10056134 3300005434 Bacteria 2489
31 Ga0070709_10116826 3300005434 Bacteria 1802
32 Ga0070714_100169165 3300005435 Bacteria 1982
33 Ga0070713_100007733 3300005436 Bacteria 7568
34 Ga0070713_100044539 3300005436 Bacteria 3632
35 Ga0070713_100056937 3300005436 Bacteria 3252
36 Ga0070713_100593325 3300005436 Bacteria 1052
37 Ga0070710_10000707 3300005437 Bacteria 15878
38 Ga0070710_10015339 3300005437 Bacteria 3876
39 Ga0070701_10146990 3300005438 Bacteria 1353
40 Ga0070711_100006676 3300005439 Bacteria 6977
41 Ga0070711_100016881 3300005439 Bacteria 4641
42 Ga0070711_100067059 3300005439 Bacteria 2516
43 Ga0070711_100380914 3300005439 Bacteria 1141
44 Ga0070705_100096817 3300005440 Bacteria 1853
45 Ga0070700_100420737 3300005441 Bacteria 1009
46 Ga0070708_100685664 3300005445 Bacteria 965
47 Ga0070663_100049756 3300005455 Bacteria 2978
48 Ga0070678_100067611 3300005456 Bacteria 2660
49 Ga0070678_100112722 3300005456 Bacteria 2130
50 Ga0070681_10209901 3300005458 Bacteria 1863
51 Ga0070698_100154937 3300005471 Bacteria 2237
52 Ga0070679_100020129 3300005530 Bacteria 6502
53 Ga0070679_100042976 3300005530 Bacteria 4501
54 Ga0070679_100445048 3300005530 Bacteria 1240
55 Ga0070684_100018149 3300005535 Bacteria 5789
56 Ga0070684_100021264 3300005535 Bacteria 5395
57 Ga0070684_100083447 3300005535 Bacteria 2831
58 Ga0070684_100252410 3300005535 Bacteria 1612
59 Ga0070697_100090441 3300005536 Bacteria 2530
60 Ga0070697_100326297 3300005536 Bacteria 1322
61 Ga0068853_100007083 3300005539 Bacteria 8970
62 Ga0068853_100007085 3300005539 Bacteria 8969
63 Ga0068853_100082352 3300005539 Bacteria 2818
64 Ga0068853_100097672 3300005539 Bacteria 2593
65 Ga0068853_100289547 3300005539 Bacteria 1512
66 Ga0070665_100038638 3300005548 Bacteria 4798
67 Ga0070665_100176196 3300005548 Bacteria 2139
68 Ga0070665_100176978 3300005548 Bacteria 2134
69 Ga0070665_100197527 3300005548 Bacteria 2012
70 Ga0070665_100286751 3300005548 Bacteria 1648
71 Ga0070665_100430113 3300005548 Bacteria 1329
72 Ga0068855_100048105 3300005563 Bacteria 5035
73 Ga0068855_100054394 3300005563 Bacteria 4704
74 Ga0068855_100064837 3300005563 Bacteria 4260
75 Ga0068855_100113485 3300005563 Bacteria 3108
76 Ga0068855_100488585 3300005563 Bacteria 1339
77 Ga0068855_100512354 3300005563 Bacteria 1302
78 Ga0070664_100222862 3300005564 Bacteria 1688
79 Ga0070664_100268983 3300005564 Bacteria 1535
80 Ga0068857_100045081 3300005577 Bacteria 3912
81 Ga0068857_100110228 3300005577 Bacteria 2473
82 Ga0068854_100126267 3300005578 Bacteria 1948
83 Ga0068856_100000522 3300005614 Bacteria 42457
84 Ga0068856_100010527 3300005614 Bacteria 8980
85 Ga0068856_100172156 3300005614 Bacteria 2177
86 Ga0068856_100265444 3300005614 Bacteria 1732
87 Ga0068856_100426722 3300005614 Bacteria 1346
88 Ga0068852_100021761 3300005616 Bacteria 5129
89 Ga0068852_100041617 3300005616 Bacteria 3884
90 Ga0068852_100047847 3300005616 Bacteria 3651
91 Ga0068852_100365435 3300005616 Bacteria 1412
92 Ga0068864_100037310 3300005618 Bacteria 4147
93 Ga0068864_100159098 3300005618 Bacteria 2052
94 Ga0068864_100200349 3300005618 Bacteria 1833
95 Ga0068861_100222100 3300005719 Bacteria 1597
96 Ga0068861_100517647 3300005719 Bacteria 1081
97 Ga0068863_100119367 3300005841 Bacteria 2514
98 Ga0068858_100150021 3300005842 Bacteria 2192
99 Ga0068858_100183632 3300005842 Bacteria 1975
100 Ga0068858_100339526 3300005842 Bacteria 1437
101 Ga0068860_100000441 3300005843 Bacteria 52446
102 Ga0068860_100177701 3300005843 Bacteria 2057
103 Ga0081455_10034005 3300005937 Bacteria 4573
104 Ga0081455_10105365 3300005937 Bacteria 2254
105 Ga0081540_1017509 3300005983 Bacteria 4433
106 Ga0081540_1018219 3300005983 Bacteria 4316
107 Ga0081540_1025852 3300005983 Bacteria 3367
108 Ga0081540_1026432 3300005983 Bacteria 3313
109 Ga0081540_1048367 3300005983 Bacteria 2131
110 Ga0081540_1048528 3300005983 Bacteria 2126
111 Ga0081539_10000425 3300005985 Bacteria 89942
112 Ga0081539_10001114 3300005985 Bacteria 48756
113 Ga0081539_10032892 3300005985 Bacteria 3168
114 Ga0081539_10053402 3300005985 Bacteria 2263
115 Ga0070717_10000325 3300006028 Bacteria 31034
116 Ga0070717_10123243 3300006028 Bacteria 2222
117 Ga0070717_10147620 3300006028 Bacteria 2032
118 Ga0075365_10128266 3300006038 Bacteria 1754
119 Ga0075365_10183961 3300006038 Bacteria 1461
120 Ga0075363_100012045 3300006048 Bacteria 4157
121 Ga0075363_100064202 3300006048 Bacteria 1983
122 Ga0075363_100100340 3300006048 Bacteria 1601
123 Ga0075364_10083494 3300006051 Bacteria 2114
124 Ga0075364_10207465 3300006051 Bacteria 1328
125 Ga0070715_10026071 3300006163 Bacteria 2321
126 Ga0070716_100005608 3300006173 Bacteria 6093
127 Ga0070716_100019072 3300006173 Bacteria 3581
128 Ga0070712_100087985 3300006175 Bacteria 2268
129 Ga0070712_100089696 3300006175 Bacteria 2249
130 Ga0075362_10055144 3300006177 Bacteria 1788
131 Ga0075367_10067480 3300006178 Bacteria 2144
132 Ga0075367_10136013 3300006178 Bacteria 1520
133 Ga0075367_10222803 3300006178 Bacteria 1181
134 Ga0075369_10042648 3300006186 Bacteria 1945
135 Ga0075366_10107625 3300006195 Bacteria 1676
136 Ga0097621_100143110 3300006237 Bacteria 2045
137 Ga0075370_10087982 3300006353 Bacteria 1790
138 Ga0075370_10118448 3300006353 Bacteria 1540
139 Ga0068871_100158319 3300006358 Bacteria 1935
140 Ga0068871_100211502 3300006358 Bacteria 1677
141 Ga0075434_100004469 3300006871 Bacteria 12614
142 Ga0075434_100096067 3300006871 Bacteria 2969
143 Ga0075434_100362343 3300006871 Bacteria 1471
144 Ga0068865_100073449 3300006881 Bacteria 2432
145 Ga0099825_1020668 3300006941 Bacteria 4628
146 Ga0099824_1035813 3300006942 Bacteria 1485
147 Ga0099822_1007626 3300006943 Bacteria 13973
148 Ga0099822_1056766 3300006943 Bacteria 1415
149 Ga0099823_1072928 3300006944 Bacteria 1483
150 Ga0099794_10012991 3300007265 Bacteria 3613
151 Ga0099795_10025691 3300007788 Bacteria 1977
152 Ga0105240_10002968 3300009093 Bacteria 26700
153 Ga0105240_10017804 3300009093 Bacteria 9563
154 Ga0105240_10190410 3300009093 Bacteria 2413
155 Ga0105240_10227269 3300009093 Bacteria 2171
156 Ga0105240_10407263 3300009093 Bacteria 1530
157 Ga0105247_10043858 3300009101 Bacteria 2741
158 Ga0105241_10001388 3300009174 Bacteria 18512
159 Ga0105248_10269872 3300009177 Bacteria 1916
160 Ga0105248_10496058 3300009177 Bacteria 1376
161 Ga0105237_10020853 3300009545 Bacteria 6748
162 Ga0105237_10123107 3300009545 Bacteria 2588
163 Ga0105237_10208382 3300009545 Bacteria 1955
164 Ga0105237_10237353 3300009545 Bacteria 1824
165 Ga0105237_10341691 3300009545 Bacteria 1501
166 Ga0105238_10010451 3300009551 Bacteria 9315
167 Ga0105238_10025037 3300009551 Bacteria 6083
168 Ga0105238_10066453 3300009551 Bacteria 3607
169 Ga0105238_10334186 3300009551 Bacteria 1502
170 Ga0105238_10451722 3300009551 Bacteria 1282
171 Ga0105238_10680530 3300009551 Bacteria 1040
172 Ga0105249_10194985 3300009553 Bacteria 1979
173 Ga0105249_10361636 3300009553 Bacteria 1473
174 Ga0099796_10038085 3300010159 Bacteria 1611
175 Ga0099796_10082867 3300010159 Bacteria 1179
176 Ga0105239_10131032 3300010375 Bacteria 2789
177 Ga0105239_10201586 3300010375 Bacteria 2229
178 Ga0105239_10276817 3300010375 Bacteria 1888
179 Ga0157371_10015904 3300013102 Bacteria 5627
180 Ga0157370_10108237 3300013104 Bacteria 2599
181 Ga0157370_10124721 3300013104 Bacteria 2404
182 Ga0157370_10180609 3300013104 Bacteria 1961
183 Ga0157369_10009007 3300013105 Bacteria 11431
184 Ga0157369_10009927 3300013105 Bacteria 10878
185 Ga0157369_10218728 3300013105 Bacteria 1994
186 Ga0157369_10343522 3300013105 Bacteria 1550
187 Ga0157374_10041978 3300013296 Bacteria 4218
188 Ga0163162_10149747 3300013306 Bacteria 2450
189 Ga0157372_10079888 3300013307 Bacteria 3700
190 Ga0157372_10310985 3300013307 Bacteria 1834
191 Ga0157372_10363327 3300013307 Bacteria 1687
192 Ga0157372_10418999 3300013307 Bacteria 1561
193 Ga0157372_10453038 3300013307 Bacteria 1495
194 Ga0157375_10133986 3300013308 Bacteria 2599
195 Ga0157375_10212208 3300013308 Bacteria 2094
196 Ga0163163_10081730 3300014325 Bacteria 3233
197 Ga0163163_10230508 3300014325 Bacteria 1901
198 Ga0157377_10091376 3300014745 Bacteria 1798
199 Ga0157376_10110571 3300014969 Bacteria 2418
200 Ga0157376_10311911 3300014969 Bacteria 1493
201 Ga0214544_1000011 3300021320 Bacteria 262952
202 Ga0214542_1000009 3300021321 Bacteria 262861
203 Ga0214545_1000007 3300021324 Bacteria 262984
204 Ga0214543_1000020 3300021327 Bacteria 262861
205 Ga0213872_10019823 3300021361 Bacteria 3097
206 Ga0213874_10013098 3300021377 Bacteria 2141
207 Ga0213874_10013163 3300021377 Bacteria 2137
208 Ga0213876_10001735 3300021384 Bacteria 13237
209 Ga0228598_1032947 3300024227 Bacteria 1021
210 Ga0209677_100470 3300025253 Bacteria 23130
211 Ga0209455_1007332 3300025272 Bacteria 3128
212 Ga0209564_1008389 3300025295 Bacteria 5104
213 Ga0209758_1000106 3300025297 Bacteria 218450
214 Ga0209758_1001683 3300025297 Bacteria 24919
215 Ga0209758_1002332 3300025297 Bacteria 19594
216 Ga0209758_1006430 3300025297 Bacteria 8450
217 Ga0209758_1037291 3300025297 Bacteria 1881
218 Ga0209050_1022586 3300025298 Bacteria 2249
219 Ga0207426_1003263 3300025302 Bacteria 9067
220 Ga0209257_1001741 3300025304 Bacteria 24170
221 Ga0207656_10034217 3300025321 Bacteria 2121
222 Ga0207692_10005117 3300025898 Bacteria 5231
223 Ga0207692_10008782 3300025898 Bacteria 4196
224 Ga0207692_10063539 3300025898 Bacteria 1919
225 Ga0207710_10011534 3300025900 Bacteria 3719
226 Ga0207710_10072188 3300025900 Bacteria 1585
227 Ga0207710_10126377 3300025900 Bacteria 1225
228 Ga0207680_10164264 3300025903 Bacteria 1491
229 Ga0207685_10003939 3300025905 Bacteria 3692
230 Ga0207685_10015299 3300025905 Bacteria 2428
231 Ga0207699_10000740 3300025906 Bacteria 15576
232 Ga0207699_10006844 3300025906 Bacteria 5545
233 Ga0207699_10055566 3300025906 Bacteria 2356
234 Ga0207705_10038645 3300025909 Bacteria 3418
235 Ga0207684_10262085 3300025910 Bacteria 1491
236 Ga0207654_10000729 3300025911 Bacteria 18348
237 Ga0207654_10184902 3300025911 Bacteria 1362
238 Ga0207707_10000541 3300025912 Bacteria 38481
239 Ga0207707_10000582 3300025912 Bacteria 37091
240 Ga0207707_10064900 3300025912 Bacteria 3179
241 Ga0207695_10000478 3300025913 Bacteria 86076
242 Ga0207695_10004497 3300025913 Bacteria 18978
243 Ga0207695_10018101 3300025913 Bacteria 8154
244 Ga0207695_10031949 3300025913 Bacteria 5766
245 Ga0207671_10003084 3300025914 Bacteria 17008
246 Ga0207671_10030076 3300025914 Bacteria 4051
247 Ga0207671_10044416 3300025914 Bacteria 3287
248 Ga0207671_10156052 3300025914 Bacteria 1765
249 Ga0207671_10162138 3300025914 Bacteria 1732
250 Ga0207671_10183495 3300025914 Bacteria 1629
251 Ga0207693_10005512 3300025915 Bacteria 10533
252 Ga0207693_10008208 3300025915 Bacteria 8554
253 Ga0207693_10014476 3300025915 Bacteria 6340
254 Ga0207693_10090801 3300025915 Bacteria 2394
255 Ga0207693_10105078 3300025915 Bacteria 2214
256 Ga0207693_10288729 3300025915 Bacteria 1285
257 Ga0207663_10000425 3300025916 Bacteria 18308
258 Ga0207663_10057794 3300025916 Bacteria 2445
259 Ga0207663_10072056 3300025916 Bacteria 2232
260 Ga0207663_10110833 3300025916 Bacteria 1862
261 Ga0207663_10138454 3300025916 Bacteria 1692
262 Ga0207660_10022911 3300025917 Bacteria 4211
263 Ga0207660_10074692 3300025917 Bacteria 2475
264 Ga0207657_10002950 3300025919 Bacteria 18254
265 Ga0207657_10136726 3300025919 Bacteria 2005
266 Ga0207649_10123275 3300025920 Bacteria 1750
267 Ga0207652_10004959 3300025921 Bacteria 10782
268 Ga0207652_10005910 3300025921 Bacteria 9899
269 Ga0207652_10138958 3300025921 Bacteria 2171
270 Ga0207681_10136395 3300025923 Bacteria 1822
271 Ga0207681_10277034 3300025923 Bacteria 1319
272 Ga0207694_10000849 3300025924 Bacteria 27168
273 Ga0207694_10015749 3300025924 Bacteria 5703
274 Ga0207694_10159501 3300025924 Bacteria 1821
275 Ga0207694_10433030 3300025924 Bacteria 1096
276 Ga0207687_10320813 3300025927 Bacteria 1254
277 Ga0207700_10004824 3300025928 Bacteria 8005
278 Ga0207700_10107598 3300025928 Bacteria 2238
279 Ga0207700_10308074 3300025928 Bacteria 1369
280 Ga0207664_10150991 3300025929 Bacteria 1973
281 Ga0207664_10293691 3300025929 Bacteria 1429
282 Ga0207644_10160881 3300025931 Bacteria 1745
283 Ga0207644_10200252 3300025931 Bacteria 1575
284 Ga0207690_10112687 3300025932 Bacteria 1962
285 Ga0207690_10151692 3300025932 Bacteria 1718
286 Ga0207669_10014908 3300025937 Bacteria 3909
287 Ga0207704_10009478 3300025938 Bacteria 4700
288 Ga0207665_10003367 3300025939 Bacteria 10702
289 Ga0207665_10003573 3300025939 Bacteria 10395
290 Ga0207691_10412079 3300025940 Bacteria 1152
291 Ga0207711_10293994 3300025941 Bacteria 1497
292 Ga0207689_10155732 3300025942 Bacteria 1884
293 Ga0207689_10174428 3300025942 Bacteria 1773
294 Ga0207689_10343299 3300025942 Bacteria 1240
295 Ga0207661_10000109 3300025944 Bacteria 52179
296 Ga0207661_10081608 3300025944 Bacteria 2671
297 Ga0207667_10021686 3300025949 Bacteria 7116
298 Ga0207667_10083996 3300025949 Bacteria 3297
299 Ga0207667_10123692 3300025949 Bacteria 2665
300 Ga0207667_10125735 3300025949 Bacteria 2641
301 Ga0207667_10215053 3300025949 Bacteria 1970
302 Ga0207667_10432994 3300025949 Bacteria 1338
303 Ga0207667_10481998 3300025949 Bacteria 1259
304 Ga0207668_10015127 3300025972 Bacteria 4789
305 Ga0207668_10405550 3300025972 Bacteria 1153
306 Ga0207640_10053654 3300025981 Bacteria 2632
307 Ga0207677_10067744 3300026023 Bacteria 2502
308 Ga0207677_10080223 3300026023 Bacteria 2337
309 Ga0207703_10087840 3300026035 Bacteria 2608
310 Ga0207703_10104833 3300026035 Bacteria 2403
311 Ga0207703_10253798 3300026035 Bacteria 1586
312 Ga0207703_10425232 3300026035 Bacteria 1237
313 Ga0207703_10471963 3300026035 Bacteria 1175
314 Ga0207639_10007486 3300026041 Bacteria 7448
315 Ga0207639_10032132 3300026041 Bacteria 3862
316 Ga0207639_10223000 3300026041 Bacteria 1629
317 Ga0207639_10260091 3300026041 Bacteria 1518
318 Ga0207639_10312378 3300026041 Bacteria 1393
319 Ga0207678_10046082 3300026067 Bacteria 3771
320 Ga0207678_10148445 3300026067 Bacteria 2001
321 Ga0207678_10195442 3300026067 Bacteria 1729
322 Ga0207708_10106601 3300026075 Bacteria 2173
323 Ga0207702_10000003 3300026078 Bacteria 434196
324 Ga0207702_10000014 3300026078 Bacteria 253304
325 Ga0207702_10254153 3300026078 Bacteria 1652
326 Ga0207702_10681322 3300026078 Bacteria 1012
327 Ga0207641_10574202 3300026088 Bacteria 1102
328 Ga0207648_10106662 3300026089 Bacteria 2458
329 Ga0207676_10059522 3300026095 Bacteria 3017
330 Ga0207676_10284789 3300026095 Bacteria 1502
331 Ga0207674_10012928 3300026116 Bacteria 9309
332 Ga0207674_10057148 3300026116 Bacteria 3956
333 Ga0207674_10065509 3300026116 Bacteria 3662
334 Ga0207674_10108590 3300026116 Bacteria 2751
335 Ga0207683_10117668 3300026121 Bacteria 2383
336 Ga0207683_10220341 3300026121 Bacteria 1729
337 Ga0207698_10063823 3300026142 Bacteria 2884
338 Ga0207698_10159850 3300026142 Bacteria 1969
339 Ga0209389_1000016 3300027296 Bacteria 184844
340 Ga0209389_1000027 3300027296 Bacteria 146917
341 Ga0209589_1000005 3300027357 Bacteria 530958
342 Ga0209589_1000031 3300027357 Bacteria 147054
343 Ga0209489_100005 3300027361 Bacteria 530958
344 Ga0209489_100057 3300027361 Bacteria 147398
345 Ga0209489_100063 3300027361 Bacteria 144408
346 Ga0209700_100006 3300027363 Bacteria 530958
347 Ga0209700_100012 3300027363 Bacteria 357892
348 Ga0209588_1004211 3300027671 Bacteria 4044
349 Ga0268266_10001346 3300028379 Bacteria 29681
350 Ga0268266_10068805 3300028379 Bacteria 3066
351 Ga0268266_10199533 3300028379 Bacteria 1830
352 Ga0268266_10548464 3300028379 Bacteria 1107
353 Ga0268265_10034105 3300028380 Bacteria 3707
354 Ga0268265_10199546 3300028380 Bacteria 1734
355 Ga0268264_10000042 3300028381 Bacteria 372069
356 Ga0268264_10135286 3300028381 Bacteria 2190
357 Ga0268264_10198150 3300028381 Bacteria 1835
358 Ga0265337_1045356 3300028556 Bacteria 1251
359 Ga0265336_10000348 3300028666 Bacteria 30334
360 Ga0307517_10000176 3300028786 Bacteria 105402
361 Ga0307515_10317759 3300028794 Bacteria 1226
362 Ga0265338_10000018 3300028800 Bacteria 338910
363 Ga0307511_10050299 3300030521 Bacteria 3358
364 Ga0265332_10016978 3300031238 Bacteria 3211
365 Ga0265328_10001180 3300031239 Bacteria 12085
366 Ga0265339_10000383 3300031249 Bacteria 34934
367 Ga0265316_10103031 3300031344 Bacteria 2167
368 Ga0307509_10025042 3300031507 Bacteria 6669
369 Ga0307509_10251156 3300031507 Bacteria 1552
370 Ga0307509_10333330 3300031507 Bacteria 1248
371 Ga0307508_10000029 3300031616 Bacteria 168411
372 Ga0307508_10024413 3300031616 Bacteria 5486
373 Ga0265314_10010200 3300031711 Bacteria 7866
374 Ga0265314_10229713 3300031711 Bacteria 1077
375 Ga0265342_10055988 3300031712 Bacteria 2339
376 Ga0307516_10088341 3300031730 Bacteria 2932
377 Ga0307516_10161240 3300031730 Bacteria 1992
378 Ga0307412_10204058 3300031911 Bacteria 1503
379 Ga0307409_100317876 3300031995 Bacteria 1456
380 Ga0307414_10178805 3300032004 Bacteria 1704
381 Ga0307415_100123019 3300032126 Bacteria 1949
382 Ga0307507_10021924 3300033179 Bacteria 7087
383 Ga0307510_10024826 3300033180 Bacteria 6921
384 Ga0307510_10026321 3300033180 Bacteria 6688
385 Ga0307510_10138078 3300033180 Bacteria 2089
386 Ga0315911_1000005 3300033442 Bacteria 426255
387 Ga0373926_0060001 3300035083 Bacteria 1385
388 Ga0373934_0018347 3300035086 Bacteria 2676
389 Ga0373934_0056364 3300035086 Bacteria 1563
390 Ga0373923_0010360 3300035111 Bacteria 3389
391 Ga0373923_0070889 3300035111 Bacteria 1496
392 Ga0373932_0076262 3300035112 Bacteria 1050
393 Ga0373936_0006737 3300035113 Bacteria 4323
394 Ga0373936_0085224 3300035113 Bacteria 1319
395 Ga0373936_0114482 3300035113 Bacteria 1147
396 Ga0373945_0016664 3300035116 Bacteria 2481
397 Ga0373953_0009510 3300035117 Bacteria 3349
398 Ga0373954_0002278 3300035118 Bacteria 7991
399 Ga0373954_0009920 3300035118 Bacteria 4193
400 Ga0373956_0004148 3300035119 Bacteria 5813
401 Ga0373956_0019733 3300035119 Bacteria 2861
402 Ga0373957_0001409 3300035120 Bacteria 6498
403 Ga0373957_0005477 3300035120 Bacteria 3937
404 Ga0373957_0034103 3300035120 Bacteria 1883
405 Ga0373943_0060746 3300035170 Bacteria 1887
406 Ga0373946_0006137 3300035171 Bacteria 4353
407 Ga0373946_0045097 3300035171 Bacteria 1823
408 Ga0373946_0155733 3300035171 Bacteria 1069
409 Ga0373955_0000395 3300035172 Bacteria 18509
410 Ga0373955_0042757 3300035172 Bacteria 2434
411 Ga0373924_0008165 3300035410 Bacteria 3794
412 Ga0373924_0055653 3300035410 Bacteria 1646
413 Ga0373924_0071304 3300035410 Bacteria 1466
414 Ga0373931_0001048 3300035691 Bacteria 11695
415 Ga0373931_0030584 3300035691 Bacteria 2773
416 Ga0373931_0179784 3300035691 Bacteria 1252
417 Ga0373935_0004219 3300035692 Bacteria 8427
418 Ga0373927_0002702 3300035695 Bacteria 12926
419 Ga0373927_0004563 3300035695 Bacteria 9675
420 Ga0373927_0023782 3300035695 Bacteria 4010
421 Ga0373927_0084381 3300035695 Bacteria 2060
422 Ga0373927_0143006 3300035695 Bacteria 1565
423 Ga0373933_0003364 3300035724 Bacteria 8915
424 Ga0373933_0007313 3300035724 Bacteria 6024
425 Ga0373933_0007540 3300035724 Bacteria 5945
426 Ga0373933_0091286 3300035724 Bacteria 1879
427 Ga0373947_0007364 3300035725 Bacteria 6372
428 Ga0373947_0027701 3300035725 Bacteria 3317
429 Ga0373947_0065680 3300035725 Bacteria 2213
430 Ga0373947_0157668 3300035725 Bacteria 1466
431 Ga0373937_0011914 3300036401 Bacteria 7630
432 Ga0373937_0022128 3300036401 Bacteria 5711
433 Ga0373937_0049502 3300036401 Bacteria 3848
434 Ga0373925_0007592 3300037068 Bacteria 7899
435 Ga0373925_0018541 3300037068 Bacteria 5059
436 Ga0373925_0034208 3300037068 Bacteria 3745
437 Ga0373925_0049760 3300037068 Bacteria 3124
438 Ga0373925_0092541 3300037068 Bacteria 2313
439 Ga0373925_0104706 3300037068 Bacteria 2179
440 Ga0395900_0007140 3300037418 Bacteria 11574
441 Ga0395900_0044885 3300037418 Bacteria 4552
442 Ga0395900_0105951 3300037418 Bacteria 2888
443 Ga0395898_0067033 3300037466 Bacteria 3476
444 Ga0395898_0138367 3300037466 Bacteria 2331
445 Ga0395905_0028290 3300037471 Bacteria 5283
446 Ga0395905_0246935 3300037471 Bacteria 1667
447 Ga0395905_0547190 3300037471 Bacteria 1059
448 Ga0436364_0776445 3300037853 Bacteria 2528
449 Ga0395901_0129075 3300038443 Bacteria 2657
450 Ga0436365_0657970 3300039437 Bacteria 1203
451 Ga0436365_0931463 3300039437 Bacteria 1210
452 Ga0436365_1364744 3300039437 Bacteria 1882
453 Ga0436365_1778823 3300039437 Bacteria 2251
454 Ga0436360_0202944 3300039438 Bacteria 1417
455 Ga0436361_0764338 3300039447 Bacteria 2381
456 Ga0436361_1007400 3300039447 Bacteria 4239
457 Ga0436363_0187212 3300039450 Bacteria 5083
458 Ga0436363_1164297 3300039450 Bacteria 3420
459 Ga0436363_1664076 3300039450 Bacteria 1800
460 Ga0451839_1296627 3300041496 Bacteria 1039
461 Ga0451849_1550937 3300041505 Bacteria 1913
462 Ga0466969_0038171 3300044656 Bacteria 2418
463 Ga0466972_0000177 3300044658 Bacteria 49318
464 Ga0466972_0005224 3300044658 Bacteria 6498
465 Ga0466965_0032138 3300044683 Bacteria 2563
466 Ga0466965_0199123 3300044683 Bacteria 1062
467 Ga0466966_0000474 3300044684 Bacteria 25834
468 Ga0466961_0000023 3300044693 Bacteria 97134
469 Ga0466961_0115673 3300044693 Bacteria 1686
470 Ga0466968_0006075 3300044735 Bacteria 4535
471 Ga0466968_0041477 3300044735 Bacteria 1943
472 Ga0466957_0119170 3300044842 Bacteria 1681
473 Ga0466957_0312438 3300044842 Bacteria 1058
474 Ga0466959_0000726 3300045049 Bacteria 19220
475 Ga0466967_0189767 3300045976 Bacteria 1942
476 Ga0466967_0628871 3300045976 Bacteria 1060
477 Ga0495592_0020908 3300046454 Bacteria 4978
478 Ga0495592_0021820 3300046454 Bacteria 4871
479 Ga0495592_0084009 3300046454 Bacteria 2298
480 Ga0495592_0301622 3300046454 Bacteria 1041
481 Ga0495603_0001935 3300046455 Bacteria 12200
482 Ga0495603_0006284 3300046455 Bacteria 7104
483 Ga0495603_0020664 3300046455 Bacteria 3988
484 Ga0495603_0049526 3300046455 Bacteria 2501
485 Ga0495603_0062862 3300046455 Bacteria 2191
486 Ga0495603_0118366 3300046455 Bacteria 1544
487 Ga0495603_0224158 3300046455 Bacteria 1084
488 Ga0495629_0000416 3300046459 Bacteria 35794
489 Ga0495629_0000655 3300046459 Bacteria 27984
490 Ga0495641_0002593 3300046461 Bacteria 14172
491 Ga0495641_0101626 3300046461 Bacteria 1283
492 Ga0495651_0010752 3300046462 Bacteria 7037
493 Ga0495651_0144620 3300046462 Bacteria 1720
494 Ga0495653_0004854 3300046463 Bacteria 10903
495 Ga0495653_0259246 3300046463 Bacteria 1150
496 Ga0495650_0025806 3300046471 Bacteria 2746
497 Ga0495580_0055436 3300046472 Bacteria 2793
498 Ga0495582_0032876 3300046473 Bacteria 2850
499 Ga0495639_0001046 3300046475 Bacteria 12485
500 Ga0495639_0084132 3300046475 Bacteria 1485
501 Ga0495639_0129966 3300046475 Bacteria 1205
502 Ga0495662_0003282 3300046476 Bacteria 8189
503 Ga0495664_0114940 3300046477 Bacteria 1626
504 Ga0495585_0113023 3300046492 Bacteria 1442
505 Ga0495585_0147552 3300046492 Bacteria 1228
506 Ga0495594_0051840 3300046499 Bacteria 2258
507 Ga0495606_0066283 3300046507 Bacteria 2290
508 Ga0495608_0107848 3300046511 Bacteria 1791
509 Ga0495618_0110921 3300046514 Bacteria 1756
510 Ga0495620_0117244 3300046515 Bacteria 1052
511 Ga0495628_0011825 3300046516 Bacteria 7365
512 Ga0495628_0030845 3300046516 Bacteria 4339
513 Ga0495628_0117808 3300046516 Bacteria 2039
514 Ga0495628_0136125 3300046516 Bacteria 1877
515 Ga0495630_0009444 3300046517 Bacteria 7014
516 Ga0495643_0014428 3300046522 Bacteria 4701
517 Ga0495648_0000640 3300046524 Bacteria 37287
518 Ga0495666_0016886 3300046526 Bacteria 3634
519 Ga0495666_0030220 3300046526 Bacteria 2661
520 Ga0495642_0121770 3300046528 Bacteria 1120
521 Ga0495652_0026522 3300046529 Bacteria 5118
522 Ga0495652_0082257 3300046529 Bacteria 2654
523 Ga0495665_0003441 3300046531 Bacteria 8598
524 Ga0495665_0056047 3300046531 Bacteria 2081
525 Ga0495640_0045167 3300046533 Bacteria 3058
526 Ga0495640_0045731 3300046533 Bacteria 3037
527 Ga0495640_0073507 3300046533 Bacteria 2289
528 Ga0495640_0085105 3300046533 Bacteria 2096
529 Ga0495586_0085300 3300046535 Bacteria 1740
530 Ga0495587_0007940 3300046536 Bacteria 6854
531 Ga0495587_0011794 3300046536 Bacteria 5526
532 Ga0495587_0016331 3300046536 Bacteria 4619
533 Ga0495598_0010333 3300046537 Bacteria 2234
534 Ga0495598_0023933 3300046537 Bacteria 1650
535 Ga0495621_0078806 3300046539 Bacteria 1225
536 Ga0495645_0002973 3300046543 Bacteria 11471
537 Ga0495645_0133459 3300046543 Bacteria 1738
538 Ga0495622_0023686 3300046557 Bacteria 2863
539 Ga0495622_0026482 3300046557 Bacteria 2707
540 Ga0495622_0088749 3300046557 Bacteria 1421
541 Ga0495667_0032457 3300046559 Bacteria 3499
542 Ga0495667_0036654 3300046559 Bacteria 3271
543 Ga0495667_0044661 3300046559 Bacteria 2934
544 Ga0495667_0060623 3300046559 Bacteria 2481
545 Ga0495656_0118066 3300046615 Bacteria 1248
546 Ga0495656_0127886 3300046615 Bacteria 1206
547 Ga0495668_0073358 3300046616 Bacteria 1880
548 Ga0495668_0191459 3300046616 Bacteria 1120
549 Ga0495634_0000602 3300046642 Bacteria 34812
550 Ga0495634_0074164 3300046642 Bacteria 2236
551 Ga0495634_0159003 3300046642 Bacteria 1425
552 Ga0495634_0223408 3300046642 Bacteria 1161
553 Ga0495635_0000380 3300046663 Bacteria 28177
554 Ga0495635_0012975 3300046663 Bacteria 5832
555 Ga0495635_0042493 3300046663 Bacteria 3138
556 Ga0495635_0243080 3300046663 Bacteria 1214
557 Ga0495659_0030136 3300046664 Bacteria 1886
558 Ga0495588_0003413 3300046674 Bacteria 6905
559 Ga0495657_0005248 3300046675 Bacteria 10255
560 Ga0495657_0019627 3300046675 Bacteria 4875
561 Ga0495657_0050390 3300046675 Bacteria 2799
562 Ga0495599_0004515 3300046678 Bacteria 8252
563 Ga0495599_0025467 3300046678 Bacteria 3703
564 Ga0495599_0026173 3300046678 Bacteria 3655
565 Ga0495599_0079124 3300046678 Bacteria 2053
566 Ga0495623_0002235 3300046679 Bacteria 12884
567 Ga0495623_0015456 3300046679 Bacteria 4934
568 Ga0495646_0046242 3300046680 Bacteria 2654
569 Ga0495646_0048567 3300046680 Bacteria 2577
570 Ga0495646_0070850 3300046680 Bacteria 2052
571 Ga0495646_0131009 3300046680 Bacteria 1412
572 Ga0495647_0021626 3300046681 Bacteria 2317
573 Ga0495647_0030022 3300046681 Bacteria 2014
574 Ga0495658_0005105 3300046683 Bacteria 6451
575 Ga0495658_0053507 3300046683 Bacteria 2293
576 Ga0495669_0076437 3300046684 Bacteria 1533
577 Ga0495613_0032956 3300046689 Bacteria 3849
578 Ga0495613_0057599 3300046689 Bacteria 2853
579 Ga0495624_0003072 3300046690 Bacteria 12498
580 Ga0495589_0157788 3300046794 Bacteria 1081
581 Ga0495600_0029981 3300046809 Bacteria 3523
582 Ga0495600_0035125 3300046809 Bacteria 3255
583 Ga0495600_0114920 3300046809 Bacteria 1752
584 Ga0495581_0020748 3300047315 Bacteria 3810
585 Ga0495581_0036506 3300047315 Bacteria 2843
586 Ga0495581_0097104 3300047315 Bacteria 1711
587 Ga0495581_0198853 3300047315 Bacteria 1172
588 Ga0495604_0007336 3300047317 Bacteria 8732
589 Ga0495604_0008886 3300047317 Bacteria 7941
590 Ga0495604_0054854 3300047317 Bacteria 3073
591 Ga0495604_0127221 3300047317 Bacteria 1835
592 Ga0495604_0201844 3300047317 Bacteria 1379
593 Ga0495674_0008020 3300047319 Bacteria 10083
594 Ga0495674_0022101 3300047319 Bacteria 5871
595 Ga0495674_0066148 3300047319 Bacteria 3137
596 Ga0495674_0160752 3300047319 Bacteria 1879
597 Ga0495674_0305009 3300047319 Bacteria 1300
598 Ga0495672_0124289 3300047320 Bacteria 1367
599 Ga0495676_0069277 3300047321 Bacteria 2722
600 Ga0495676_0122028 3300047321 Bacteria 1894
601 Ga0495676_0123320 3300047321 Bacteria 1881
602 Ga0495680_0002016 3300047322 Bacteria 21294
603 Ga0495680_0025159 3300047322 Bacteria 4930
604 Ga0495680_0085244 3300047322 Bacteria 2379
605 Ga0495680_0261857 3300047322 Bacteria 1223
606 Ga0495675_0001856 3300047444 Bacteria 12578
607 Ga0495675_0127716 3300047444 Bacteria 1581
608 Ga0495679_059730 3300047446 Bacteria 1121
609 Ga0495681_0121593 3300047470 Bacteria 1120
610 Ga0495684_0000294 3300047471 Bacteria 40596
611 Ga0495684_0096973 3300047471 Bacteria 2231
612 Ga0495684_0138880 3300047471 Bacteria 1822
613 Ga0495593_0000022 3300047673 Bacteria 69741
614 Ga0495593_0000744 3300047673 Bacteria 18938
615 Ga0495602_0062578 3300048088 Bacteria 3228
616 Ga0495602_0155583 3300048088 Bacteria 1790
617 Ga0496100_0027259 3300048903 Bacteria 3512
618 Ga0496100_0079153 3300048903 Bacteria 2214
619 Ga0496101_0063193 3300048904 Bacteria 2694
620 Ga0496101_0088147 3300048904 Bacteria 2304
621 Ga0496101_0106347 3300048904 Bacteria 2107
622 Ga0496101_0116245 3300048904 Bacteria 2018
623 Ga0496102_0014293 3300048905 Bacteria 6898
624 Ga0496102_0059266 3300048905 Bacteria 3500
625 Ga0496102_0076480 3300048905 Bacteria 3079
626 Ga0496102_0334862 3300048905 Bacteria 1425
627 Ga0496103_0101444 3300048906 Bacteria 1822
628 Ga0496104_0000948 3300048907 Bacteria 24943
629 Ga0496104_0002005 3300048907 Bacteria 17670
630 Ga0496104_0023320 3300048907 Bacteria 5689
631 Ga0496104_0033610 3300048907 Bacteria 4779
632 Ga0496104_0235301 3300048907 Bacteria 1744
633 Ga0496105_0001280 3300048908 Bacteria 17590
634 Ga0496105_0009772 3300048908 Bacteria 7513
635 Ga0496105_0011036 3300048908 Bacteria 7121
636 Ga0496105_0012416 3300048908 Bacteria 6743
637 Ga0496105_0391803 3300048908 Bacteria 1104
638 Ga0496106_0001262 3300048909 Bacteria 18951
639 Ga0496106_0003691 3300048909 Bacteria 11418
640 Ga0496106_0014884 3300048909 Bacteria 5755
641 Ga0496106_0137472 3300048909 Bacteria 1920
642 Ga0496106_0139912 3300048909 Bacteria 1903
643 Ga0496106_0151458 3300048909 Bacteria 1830
644 Ga0496106_0489794 3300048909 Bacteria 988
645 Ga0496107_0021225 3300048910 Bacteria 4590
646 Ga0496108_0000479 3300048911 Bacteria 32030
647 Ga0496108_0084458 3300048911 Bacteria 2694
648 Ga0496108_0141737 3300048911 Bacteria 2071
649 Ga0496108_0155553 3300048911 Bacteria 1974
650 Ga0496108_0199656 3300048911 Bacteria 1735
651 Ga0496108_0247223 3300048911 Bacteria 1551
652 Ga0496109_0000910 3300048912 Bacteria 24624
653 Ga0496109_0009376 3300048912 Bacteria 8339
654 Ga0496109_0117615 3300048912 Bacteria 2474
655 Ga0496109_0142527 3300048912 Bacteria 2241
656 Ga0496109_0147156 3300048912 Bacteria 2204
657 Ga0496109_0155298 3300048912 Bacteria 2143
658 Ga0496109_0166533 3300048912 Bacteria 2067
659 Ga0496109_0168061 3300048912 Bacteria 2057
660 Ga0496109_0293113 3300048912 Bacteria 1534
661 Ga0496110_0025120 3300048913 Bacteria 5087
662 Ga0496110_0056560 3300048913 Bacteria 3452
663 Ga0496110_0101486 3300048913 Bacteria 2579
664 Ga0496110_0105664 3300048913 Bacteria 2526
665 Ga0496110_0118704 3300048913 Bacteria 2382
666 Ga0496110_0206343 3300048913 Bacteria 1786
667 Ga0496111_0000112 3300048914 Bacteria 35886
668 Ga0496111_0034388 3300048914 Bacteria 3619
669 Ga0496111_0116502 3300048914 Bacteria 1970
670 Ga0496111_0259119 3300048914 Bacteria 1290
671 Ga0496111_0452236 3300048914 Bacteria 947
672 Ga0496112_0000022 3300048915 Bacteria 156255
673 Ga0496112_0023710 3300048915 Bacteria 5870
674 Ga0496112_0032020 3300048915 Bacteria 5104
675 Ga0496112_0034500 3300048915 Bacteria 4924
676 Ga0496112_0043988 3300048915 Bacteria 4373
677 Ga0496112_0118773 3300048915 Bacteria 2614
678 Ga0496112_0170514 3300048915 Bacteria 2141
679 Ga0496112_0261545 3300048915 Bacteria 1680
680 Ga0496112_0266577 3300048915 Bacteria 1661
681 Ga0496112_0402327 3300048915 Bacteria 1309
682 Ga0496112_0539679 3300048915 Bacteria 1100
683 Ga0496113_0000762 3300048916 Bacteria 16562
684 Ga0496113_0009540 3300048916 Bacteria 6365
685 Ga0496113_0072238 3300048916 Bacteria 2625
686 Ga0496113_0108196 3300048916 Bacteria 2161
687 Ga0496113_0129870 3300048916 Bacteria 1976
688 Ga0496114_0009367 3300048917 Bacteria 7773
689 Ga0496114_0245788 3300048917 Bacteria 1574
690 Ga0496115_0014569 3300048918 Bacteria 5952
691 Ga0496115_0032437 3300048918 Bacteria 4121
692 Ga0496115_0033888 3300048918 Bacteria 4034
693 Ga0496115_0081033 3300048918 Bacteria 2643
694 Ga0496115_0189664 3300048918 Bacteria 1698
695 Ga0496115_0238742 3300048918 Bacteria 1498
696 Ga0496115_0422078 3300048918 Bacteria 1080
697 Ga0496116_0077687 3300048919 Bacteria 2073
698 Ga0496117_0043940 3300048920 Bacteria 3241
699 Ga0496117_0088506 3300048920 Bacteria 2003
700 Ga0496118_0036454 3300048921 Bacteria 3976
701 Ga0496118_0083539 3300048921 Bacteria 2232
702 Ga0496118_0136393 3300048921 Bacteria 1565
703 Ga0496119_0068858 3300048922 Bacteria 2082
704 Ga0496119_0123246 3300048922 Bacteria 1422
705 Ga0496119_0127019 3300048922 Bacteria 1394
706 Ga0496120_0022888 3300048923 Bacteria 3923
707 Ga0496121_0000254 3300048924 Bacteria 113314
708 Ga0496121_0002114 3300048924 Bacteria 31228
709 Ga0496121_0011243 3300048924 Bacteria 9975
710 Ga0496121_0012395 3300048924 Bacteria 9307
711 Ga0496121_0055262 3300048924 Bacteria 3309
712 Ga0496121_0090630 3300048924 Bacteria 2389
713 Ga0496121_0113432 3300048924 Bacteria 2062
714 Ga0496121_0128284 3300048924 Bacteria 1903
715 Ga0496121_0222224 3300048924 Bacteria 1329
716 Ga0496124_0001351 3300048927 Bacteria 36722
717 Ga0496124_0054938 3300048927 Bacteria 3368
718 Ga0496125_0025529 3300048928 Bacteria 5408
719 Ga0496125_0065882 3300048928 Bacteria 2866
720 Ga0496125_0099784 3300048928 Bacteria 2143
721 Ga0496126_0007801 3300048929 Bacteria 11669
722 Ga0496126_0012548 3300048929 Bacteria 8674
723 Ga0496126_0022598 3300048929 Bacteria 6113
724 Ga0496126_0024830 3300048929 Bacteria 5779
725 Ga0496126_0026051 3300048929 Bacteria 5614
726 Ga0496126_0049875 3300048929 Bacteria 3819
727 Ga0496126_0155068 3300048929 Bacteria 1960
728 Ga0496126_0222802 3300048929 Bacteria 1583
729 Ga0496126_0368862 3300048929 Bacteria 1171
730 Ga0501031_0001005 3300049568 Bacteria 17104
731 Ga0501031_0020264 3300049568 Bacteria 4335
732 Ga0501032_0000161 3300049569 Bacteria 54292
733 Ga0501032_0017757 3300049569 Bacteria 4993
734 Ga0501032_0053496 3300049569 Bacteria 2718
735 Ga0501033_0000111 3300049570 Bacteria 78688
736 Ga0501033_0000672 3300049570 Bacteria 31550
737 Ga0501034_0000072 3300049571 Bacteria 179824
738 Ga0501034_0071554 3300049571 Bacteria 3477
739 Ga0501034_0144499 3300049571 Bacteria 2356
740 Ga0501034_0260391 3300049571 Bacteria 1677
741 Ga0501036_0011119 3300049572 Bacteria 7443
742 Ga0501036_0053940 3300049572 Bacteria 3403
743 Ga0501036_0073036 3300049572 Bacteria 2900
744 Ga0501036_0129667 3300049572 Bacteria 2129
745 Ga0501036_0446357 3300049572 Bacteria 1078
746 Ga0501037_0000030 3300049573 Bacteria 136148
747 Ga0501037_0055311 3300049573 Bacteria 2901
748 Ga0501037_0062319 3300049573 Bacteria 2718
749 Ga0501037_0126387 3300049573 Bacteria 1835
750 Ga0501038_0000060 3300049574 Bacteria 92314
751 Ga0501038_0003347 3300049574 Bacteria 14952
752 Ga0501038_0019562 3300049574 Bacteria 6101
753 Ga0501038_0023061 3300049574 Bacteria 5569
754 Ga0501038_0144142 3300049574 Bacteria 1946
755 Ga0501038_0203591 3300049574 Bacteria 1587
756 Ga0501039_0003983 3300049575 Bacteria 11104
757 Ga0501039_0014332 3300049575 Bacteria 6069
758 Ga0501039_0155791 3300049575 Bacteria 1794
759 Ga0501040_0118117 3300049576 Bacteria 1859
760 Ga0501042_0053990 3300049578 Bacteria 2866
761 Ga0501042_0112143 3300049578 Bacteria 1963
762 Ga0501043_0000357 3300049579 Bacteria 41554
763 Ga0501046_0002205 3300049580 Bacteria 18409
764 Ga0501046_0050507 3300049580 Bacteria 3286
765 Ga0501046_0236188 3300049580 Bacteria 1349
766 Ga0501047_0000140 3300049581 Bacteria 88265
767 Ga0501047_0026961 3300049581 Bacteria 5533
768 Ga0501047_0068547 3300049581 Bacteria 3416
769 Ga0501047_0241726 3300049581 Bacteria 1656
770 Ga0501047_0338958 3300049581 Bacteria 1341
771 Ga0501048_0000812 3300049582 Bacteria 22948
772 Ga0501048_0144939 3300049582 Bacteria 1680
773 Ga0501067_0000697 3300049583 Bacteria 18107
774 Ga0501067_0002459 3300049583 Bacteria 10222
775 Ga0501067_0067838 3300049583 Bacteria 1975
776 Ga0501068_0015057 3300049584 Bacteria 4434
777 Ga0501069_0062846 3300049585 Bacteria 2073
778 Ga0501069_0066501 3300049585 Bacteria 2016
779 Ga0501070_0000602 3300049586 Bacteria 32900
780 Ga0501070_0010155 3300049586 Bacteria 7969
781 Ga0501070_0058337 3300049586 Bacteria 3199
782 Ga0501070_0138152 3300049586 Bacteria 2012
783 Ga0501070_0180023 3300049586 Bacteria 1740
784 Ga0501072_0084380 3300049588 Bacteria 2518
785 Ga0501072_0401974 3300049588 Bacteria 1086
786 Ga0501073_0000009 3300049589 Bacteria 195649
787 Ga0501073_0009578 3300049589 Bacteria 7144
788 Ga0501073_0035565 3300049589 Bacteria 3539
789 Ga0501073_0106062 3300049589 Bacteria 1950
790 Ga0501074_0000137 3300049590 Bacteria 37950
791 Ga0501077_0095551 3300049593 Bacteria 1884
792 Ga0501079_0017212 3300049741 Bacteria 5519
793 Ga0501079_0209186 3300049741 Bacteria 1524
794 Ga0501080_0000088 3300049742 Bacteria 61753
795 Ga0501080_0037211 3300049742 Bacteria 4543
796 Ga0501080_0054964 3300049742 Bacteria 3708
797 Ga0501083_0013621 3300049744 Bacteria 5684
798 Ga0501083_0050365 3300049744 Bacteria 2803
799 Ga0501035_0022354 3300049822 Bacteria 5807
800 Ga0501035_0057070 3300049822 Bacteria 3481
801 Ga0501035_0116770 3300049822 Bacteria 2335
802 Ga0501035_0204141 3300049822 Bacteria 1694
803 Ga0501035_0242617 3300049822 Bacteria 1532
804 Ga0501035_0302376 3300049822 Bacteria 1347
805 Ga0501044_0002346 3300049823 Bacteria 21600
806 Ga0501044_0013964 3300049823 Bacteria 8676
807 Ga0501044_0019722 3300049823 Bacteria 7205
808 Ga0501044_0022171 3300049823 Bacteria 6770
809 Ga0501045_0024317 3300049824 Bacteria 4348
810 nmdc:mga03683_51497_c1 3300050489 Bacteria 1719
811 nmdc:mga03n38_4303_c1 3300050490 Bacteria 4695
812 nmdc:mga00v17_32663_c1 3300050491 Bacteria 3078
813 nmdc:mga0yw44_13579_c1 3300050492 Bacteria 3996
814 nmdc:mga0yw44_194539_c1 3300050492 Bacteria 1338
815 nmdc:mga0yw44_78840_c1 3300050492 Bacteria 2060
816 nmdc:mga0yw44_8656_c1 3300050492 Bacteria 5086
817 nmdc:mga0yw44_93034_c1 3300050492 Bacteria 1909
818 nmdc:mga0k408_6488_c1 3300050493 Bacteria 6235
819 nmdc:mga06z11_182462_c1 3300050494 Bacteria 1211
820 nmdc:mga06z11_21687_c1 3300050494 Bacteria 2989
821 nmdc:mga06z11_47781_c1 3300050494 Bacteria 2175
822 nmdc:mga06z11_7412_c1 3300050494 Bacteria 4511
823 nmdc:mga04h51_43933_c1 3300050495 Bacteria 1471
824 nmdc:mga07m45_19689_c1 3300050496 Bacteria 2864
825 nmdc:mga07m45_25952_c1 3300050496 Bacteria 3218
826 nmdc:mga05p37_338976_c1 3300050507 Bacteria 1773
827 nmdc:mga0n895_2476_c1 3300050512 Bacteria 14436
828 nmdc:mga0n895_47793_c1 3300050512 Bacteria 4185
829 nmdc:mga0n895_95111_c1 3300050512 Bacteria 2984
830 nmdc:mga0n895_95260_c1 3300050512 Bacteria 2981
831 nmdc:mga0rr50_82341_c1 3300050513 Bacteria 2485
832 nmdc:mga0sz30_59207_c1 3300050516 Bacteria 1634
833 Ga0495601_0047714 3300053077 Bacteria 2697
834 Ga0495601_0159031 3300053077 Bacteria 1476
835 Ga0495612_0045607 3300053078 Bacteria 1794
836 Ga0495595_0021212 3300053084 Bacteria 2835
837 Ga0495595_0032285 3300053084 Bacteria 2358
838 Ga0495619_0003855 3300053085 Bacteria 9655
839 Ga0495619_0112518 3300053085 Bacteria 1861
840 Ga0500578_0186649 3300053086 Bacteria 1275
841 Ga0500651_0018002 3300053093 Bacteria 4369
842 Ga0500651_0023015 3300053093 Bacteria 3898
843 Ga0500566_0007702 3300053094 Bacteria 6385
844 Ga0500566_0033416 3300053094 Bacteria 2997
845 Ga0500566_0043140 3300053094 Bacteria 2599
846 Ga0500566_0134479 3300053094 Bacteria 1319
847 Ga0500640_002809 3300053095 Bacteria 5881
848 Ga0500557_000057 3300053105 Bacteria 47849
849 Ga0500557_090483 3300053105 Bacteria 1014
850 Ga0500569_059070 3300053109 Bacteria 1179
851 Ga0500572_000383 3300053111 Bacteria 15750
852 Ga0500572_001892 3300053111 Bacteria 5274
853 Ga0500595_004172 3300053119 Bacteria 6550
854 Ga0500595_009841 3300053119 Bacteria 3837
855 Ga0500595_022825 3300053119 Bacteria 2208
856 Ga0500607_073306 3300053121 Bacteria 1762
857 Ga0500608_068887 3300053122 Bacteria 1684
858 Ga0500642_0000263 3300053130 Bacteria 19627
859 Ga0500559_0000486 3300053136 Bacteria 28052
860 Ga0500559_0049727 3300053136 Bacteria 1847
861 Ga0500559_0051797 3300053136 Bacteria 1813
862 Ga0500559_0055710 3300053136 Bacteria 1754
863 Ga0500568_0037793 3300053139 Bacteria 1957
864 Ga0500573_0045454 3300053140 Bacteria 2531
865 Ga0500577_0000035 3300053142 Bacteria 31742
866 Ga0500603_000335 3300053150 Bacteria 12321
867 Ga0500603_000740 3300053150 Bacteria 7963
868 Ga0500603_021454 3300053150 Bacteria 1589
869 Ga0500603_035785 3300053150 Bacteria 1303
870 Ga0500620_005833 3300053155 Bacteria 2890
871 Ga0500630_016635 3300053159 Bacteria 3620
872 Ga0500638_062254 3300053162 Bacteria 1792
873 Ga0500639_001074 3300053163 Bacteria 13945
874 Ga0500639_028645 3300053163 Bacteria 2943
875 Ga0500636_0001378 3300053177 Bacteria 13188
876 Ga0500636_0017028 3300053177 Bacteria 4287
877 Ga0500636_0042827 3300053177 Bacteria 2675
878 Ga0500636_0148333 3300053177 Bacteria 1290
879 Ga0500576_113008 3300053725 Bacteria 1085
880 Ga0500657_084075 3300053728 Bacteria 1359
881 Ga0500645_065959 3300053730 Bacteria 1042
882 Ga0500596_001060 3300053735 Bacteria 5540
883 Ga0500596_004321 3300053735 Bacteria 2614
884 Ga0500596_015230 3300053735 Bacteria 1155
885 Ga0500601_001101 3300053737 Bacteria 3057
886 Ga0500601_005147 3300053737 Bacteria 1430
887 Ga0501084_0005438 3300054114 Bacteria 10447
888 Ga0501084_0036315 3300054114 Bacteria 4116
889 Ga0501082_0018483 3300060353 Bacteria 6004
890 Ga0501082_0025748 3300060353 Bacteria 5069

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025924 Ga0207694_10433030 Ga0207694_104330301 275
2 3300031239 Ga0265328_10001180 Ga0265328_1000118011 275
3 3300026088 Ga0207641_10574202 Ga0207641_105742021 283
4 3300035120 Ga0373957_0005477 Ga0373957_0005477_2988_3884 283
5 3300035724 Ga0373933_0007540 Ga0373933_0007540_1771_2667 283
6 3300036401 Ga0373937_0022128 Ga0373937_0022128_3737_4633 283
7 3300046463 Ga0495653_0259246 Ga0495653_0259246_162_1058 283
8 3300046536 Ga0495587_0011794 Ga0495587_0011794_4318_5214 283
9 3300047317 Ga0495604_0201844 Ga0495604_0201844_214_1110 283
10 iso_pu_bacteria 8019687851 8019695223 286
11 3300025915 Ga0207693_10105078 Ga0207693_101050782 289
12 3300046615 Ga0495656_0127886 Ga0495656_0127886_171_1040 289
13 3300047320 Ga0495672_0124289 Ga0495672_0124289_219_1100 290
14 iso_pu_bacteria 2508501009 2508545754 291
15 iso_pu_bacteria 2508501042 2508694579 291
16 iso_pu_bacteria 2508501128 2509151292 291
17 iso_pu_bacteria 2511231028 2511398417 291
18 iso_pu_bacteria 2513237092 2513624509 291
19 iso_pu_bacteria 2513237094 2513638628 291
20 iso_pu_bacteria 2513237095 2513649984 291
21 iso_pu_bacteria 2513237104 2513716830 291
22 iso_pu_bacteria 2515154112 2515624493 291
23 iso_pu_bacteria 2517093001 2517104578 291
24 iso_pu_bacteria 2524023210 2524470524 291
25 iso_pu_bacteria 2528768022 2528850381 291
26 iso_pu_bacteria 2643221651 2644290200 291
27 iso_pu_bacteria 2728368998 2728749179 291
28 iso_pu_bacteria 2791355196 2793059412 291
29 iso_pu_bacteria 2816332527 2818240984 291
30 iso_pu_bacteria 2824600985 2824604435 291
31 iso_pu_bacteria 2824609381 2824615024 291
32 iso_pu_bacteria 2824617872 2824624923 291
33 iso_pu_bacteria 2824626560 2824633219 291
34 iso_pu_bacteria 2824635225 2824640945 291
35 iso_pu_bacteria 2824644064 2824651053 291
36 iso_pu_bacteria 2824653114 2824659192 291
37 iso_pu_bacteria 2824661429 2824665215 291
38 iso_pu_bacteria 2824679649 2824687118 291
39 iso_pu_bacteria 2824714736 2824721057 291
40 iso_pu_bacteria 2824723954 2824728264 291
41 iso_pu_bacteria 2824732956 2824738358 291
42 iso_pu_bacteria 2824746037 2824751277 291
43 iso_pu_bacteria 2841957949 2841960691 291
44 iso_pu_bacteria 2842038055 2842041792 291
45 iso_pu_bacteria 2842045827 2842049834 291
46 iso_pu_bacteria 2847930680 2847932085 291
47 iso_pu_bacteria 2849076700 2849077049 291
48 iso_pu_bacteria 2857509624 2857514665 291
49 iso_pu_bacteria 2874590934 2874595724 291
50 iso_pu_bacteria 2874612657 2874614994 291
51 iso_pu_bacteria 2874620515 2874624213 291
52 iso_pu_bacteria 2874645413 2874651644 291
53 iso_pu_bacteria 2876771140 2876775919 291
54 iso_pu_bacteria 2876808645 2876808657 291
55 iso_pu_bacteria 2876818435 2876821539 291
56 iso_pu_bacteria 2879074833 2879080010 291
57 iso_pu_bacteria 2879083081 2879085762 291
58 iso_pu_bacteria 2879099564 2879100593 291
59 iso_pu_bacteria 2879110137 2879111929 291
60 iso_pu_bacteria 2879127579 2879134092 291
61 iso_pu_bacteria 2879142872 2879148577 291
62 iso_pu_bacteria 2881364244 2881367712 291
63 iso_pu_bacteria 2881665667 2881669304 291
64 iso_pu_bacteria 2885366525 2885374493 291
65 iso_pu_bacteria 2885374607 2885379437 291
66 iso_pu_bacteria 2888378607 2888387623 291
67 iso_pu_bacteria 2888419890 2888426838 291
68 iso_pu_bacteria 2889033259 2889034123 291
69 iso_pu_bacteria 2903748898 2903755849 291
70 iso_pu_bacteria 2904666416 2904670924 291
71 iso_pu_bacteria 2904690495 2904692641 291
72 iso_pu_bacteria 2904699407 2904711110 291
73 iso_pu_bacteria 2906610324 2906612352 291
74 iso_pu_bacteria 2906626472 2906633093 291
75 iso_pu_bacteria 2906635258 2906638320 291
76 iso_pu_bacteria 2906643746 2906650117 291
77 iso_pu_bacteria 2906660503 2906663395 291
78 iso_pu_bacteria 2908739725 2908739774 291
79 iso_pu_bacteria 2908756301 2908757852 291
80 iso_pu_bacteria 2908775508 2908777160 291
81 iso_pu_bacteria 2922361189 2922367521 291
82 iso_pu_bacteria 2922368715 2922376606 291
83 iso_pu_bacteria 2922386360 2922391499 291
84 iso_pu_bacteria 2922393267 2922398558 291
85 iso_pu_bacteria 2922425934 2922426942 291
86 iso_pu_bacteria 2929615660 2929619890 291
87 iso_pu_bacteria 2929624759 2929629202 291
88 iso_pu_bacteria 2932784394 2932789667 291
89 iso_pu_bacteria 2932794094 2932796664 291
90 iso_pu_bacteria 2932801729 2932802556 291
91 iso_pu_bacteria 2932809354 2932814827 291
92 iso_pu_bacteria 2932818245 2932824316 291
93 iso_pu_bacteria 2932828146 2932833956 291
94 iso_pu_bacteria 2933577622 2933581808 291
95 iso_pu_bacteria 2935608549 2935613265 291
96 iso_pu_bacteria 2935616580 2935623654 291
97 iso_pu_bacteria 2935638405 2935645041 291
98 iso_pu_bacteria 2935648319 2935656621 291
99 iso_pu_bacteria 2935656913 2935665455 291
100 iso_pu_bacteria 2935665750 2935672090 291
101 iso_pu_bacteria 2935675223 2935684104 291
102 iso_pu_bacteria 2935684952 2935689153 291
103 iso_pu_bacteria 2935694250 2935697587 291
104 iso_pu_bacteria 2935703347 2935711387 291
105 iso_pu_bacteria 2935713505 2935720099 291
106 iso_pu_bacteria 2935722832 2935728284 291
107 iso_pu_bacteria 2935732158 2935737119 291
108 iso_pu_bacteria 2935741537 2935746820 291
109 iso_pu_bacteria 2935750917 2935757787 291
110 iso_pu_bacteria 2935760218 2935764167 291
111 iso_pu_bacteria 2935777560 2935780106 291
112 iso_pu_bacteria 2935785616 2935790228 291
113 iso_pu_bacteria 2935793552 2935798730 291
114 iso_pu_bacteria 2935801545 2935808753 291
115 iso_pu_bacteria 2935810662 2935817550 291
116 iso_pu_bacteria 2935819856 2935824881 291
117 iso_pu_bacteria 2935827899 2935834113 291
118 iso_pu_bacteria 2935837841 2935844715 291
119 iso_pu_bacteria 2935847175 2935852101 291
120 iso_pu_bacteria 2935855204 2935861739 291
121 iso_pu_bacteria 2935864058 2935868625 291
122 iso_pu_bacteria 2935873716 2935879399 291
123 iso_pu_bacteria 2935883170 2935887004 291
124 iso_pu_bacteria 2935908558 2935911448 291
125 iso_pu_bacteria 2935916978 2935920983 291
126 iso_pu_bacteria 2935926038 2935928477 291
127 iso_pu_bacteria 2935934488 2935938122 291
128 iso_pu_bacteria 2935942939 2935945404 291
129 iso_pu_bacteria 2935951376 2935954090 291
130 iso_pu_bacteria 2935959822 2935965470 291
131 iso_pu_bacteria 2935967501 2935971642 291
132 iso_pu_bacteria 2935975950 2935980046 291
133 iso_pu_bacteria 2935984226 2935989474 291
134 iso_pu_bacteria 2935992306 2935998433 291
135 iso_pu_bacteria 2936002035 2936009106 291
136 iso_pu_bacteria 2936011229 2936019484 291
137 iso_pu_bacteria 2936019824 2936028106 291
138 iso_pu_bacteria 2936028420 2936036940 291
139 iso_pu_bacteria 2936037263 2936044347 291
140 iso_pu_bacteria 2936046547 2936054963 291
141 iso_pu_bacteria 2936055302 2936060730 291
142 iso_pu_bacteria 2940556831 2940563391 291
143 iso_pu_bacteria 2941531003 2941531899 291
144 iso_pu_bacteria 2941538514 2941545390 291
145 iso_pu_bacteria 3005587118 3005592751 291
146 iso_pu_bacteria 8006926726 8006929532 291
147 iso_pu_bacteria 8006984368 8006989993 291
148 iso_pu_bacteria 8016511872 8016519231 291
149 iso_pu_bacteria 8016530956 8016538669 291
150 iso_pu_bacteria 8016539877 8016542956 291
151 iso_pu_bacteria 8016548790 8016550335 291
152 iso_pu_bacteria 8016557553 8016558742 291
153 iso_pu_bacteria 8016566248 8016568353 291
154 iso_pu_bacteria 8016575299 8016581012 291
155 iso_pu_bacteria 8016595262 8016596718 291
156 iso_pu_bacteria 8016613128 8016619388 291
157 iso_pu_bacteria 8016622563 8016630205 291
158 iso_pu_bacteria 8016630954 8016636945 291
159 iso_pu_bacteria 8017057580 8017066279 291
160 iso_pu_bacteria 8019530166 8019538341 291
161 iso_pu_bacteria 8019538911 8019541481 291
162 iso_pu_bacteria 8019547302 8019549146 291
163 iso_pu_bacteria 8019576017 8019578344 291
164 iso_pu_bacteria 8019586578 8019596382 291
165 iso_pu_bacteria 8019597564 8019605319 291
166 iso_pu_bacteria 8019619141 8019623905 291
167 iso_pu_bacteria 8019629233 8019638134 291
168 iso_pu_bacteria 8019638758 8019641501 291
169 iso_pu_bacteria 8019648815 8019651542 291
170 iso_pu_bacteria 8019659431 8019666049 291
171 iso_pu_bacteria 8019668869 8019675568 291
172 iso_pu_bacteria 8055742211 8055750358 291
173 iso_pu_bacteria 8056689827 8056691978 291
174 3300005539 Ga0068853_100007083 Ga0068853_1000070835 293
175 3300005578 Ga0068854_100126267 Ga0068854_1001262673 293
176 3300005614 Ga0068856_100010527 Ga0068856_1000105275 293
177 3300005616 Ga0068852_100041617 Ga0068852_1000416175 293
178 3300009093 Ga0105240_10017804 Ga0105240_100178044 293
179 3300009174 Ga0105241_10001388 Ga0105241_1000138811 293
180 3300009545 Ga0105237_10208382 Ga0105237_102083821 293
181 3300009551 Ga0105238_10066453 Ga0105238_100664531 293
182 3300010375 Ga0105239_10276817 Ga0105239_102768173 293
183 3300021377 Ga0213874_10013098 Ga0213874_100130983 293
184 3300025321 Ga0207656_10034217 Ga0207656_100342174 293
185 3300025911 Ga0207654_10000729 Ga0207654_100007293 293
186 3300025913 Ga0207695_10004497 Ga0207695_100044978 293
187 3300025924 Ga0207694_10000849 Ga0207694_1000084914 293
188 3300025949 Ga0207667_10021686 Ga0207667_100216863 293
189 3300025981 Ga0207640_10053654 Ga0207640_100536544 293
190 3300026041 Ga0207639_10032132 Ga0207639_100321323 293
191 3300026078 Ga0207702_10000003 Ga0207702_1000000359 293
192 3300026116 Ga0207674_10012928 Ga0207674_100129282 293
193 3300005539 Ga0068853_100289547 Ga0068853_1002895471 294
194 3300005548 Ga0070665_100430113 Ga0070665_1004301132 294
195 3300009101 Ga0105247_10043858 Ga0105247_100438582 294
196 3300010159 Ga0099796_10038085 Ga0099796_100380851 294
197 3300010375 Ga0105239_10201586 Ga0105239_102015862 294
198 3300025253 Ga0209677_100470 Ga0209677_10047029 294
199 3300025272 Ga0209455_1007332 Ga0209455_10073322 294
200 3300025297 Ga0209758_1037291 Ga0209758_10372911 294
201 3300025900 Ga0207710_10011534 Ga0207710_100115342 294
202 3300026035 Ga0207703_10087840 Ga0207703_100878404 294
203 3300026041 Ga0207639_10312378 Ga0207639_103123782 294
204 3300028556 Ga0265337_1045356 Ga0265337_10453561 294
205 3300028666 Ga0265336_10000348 Ga0265336_100003489 294
206 3300028800 Ga0265338_10000018 Ga0265338_10000018315 294
207 3300035725 Ga0373947_0157668 Ga0373947_0157668_93_1040 294
208 3300039437 Ga0436365_0657970 Ga0436365_0657970_186_1070 294
209 3300039437 Ga0436365_0931463 Ga0436365_0931463_182_1129 294
210 3300044842 Ga0466957_0119170 Ga0466957_0119170_718_1602 294
211 3300048903 Ga0496100_0079153 Ga0496100_0079153_994_1941 294
212 3300048904 Ga0496101_0106347 Ga0496101_0106347_345_1292 294
213 3300048907 Ga0496104_0000948 Ga0496104_0000948_6418_7365 294
214 3300048908 Ga0496105_0001280 Ga0496105_0001280_1213_2160 294
215 3300048909 Ga0496106_0151458 Ga0496106_0151458_261_1208 294
216 3300048911 Ga0496108_0000479 Ga0496108_0000479_3343_4290 294
217 3300048912 Ga0496109_0009376 Ga0496109_0009376_939_1886 294
218 3300048913 Ga0496110_0025120 Ga0496110_0025120_1514_2461 294
219 3300048913 Ga0496110_0056560 Ga0496110_0056560_688_1635 294
220 3300048914 Ga0496111_0000112 Ga0496111_0000112_20560_21507 294
221 3300048915 Ga0496112_0032020 Ga0496112_0032020_2036_2983 294
222 3300048916 Ga0496113_0000762 Ga0496113_0000762_11958_12905 294
223 3300048918 Ga0496115_0014569 Ga0496115_0014569_327_1274 294
224 3300048921 Ga0496118_0036454 Ga0496118_0036454_464_1348 294
225 3300048921 Ga0496118_0136393 Ga0496118_0136393_652_1536 294
226 3300048924 Ga0496121_0113432 Ga0496121_0113432_1117_2001 294
227 3300048927 Ga0496124_0054938 Ga0496124_0054938_1461_2345 294
228 3300048928 Ga0496125_0025529 Ga0496125_0025529_2020_2904 294
229 3300049568 Ga0501031_0020264 Ga0501031_0020264_2637_3521 294
230 3300049569 Ga0501032_0017757 Ga0501032_0017757_713_1597 294
231 3300049570 Ga0501033_0000672 Ga0501033_0000672_6824_7708 294
232 3300049572 Ga0501036_0129667 Ga0501036_0129667_631_1515 294
233 3300049573 Ga0501037_0055311 Ga0501037_0055311_954_1838 294
234 3300049574 Ga0501038_0023061 Ga0501038_0023061_3644_4528 294
235 3300049574 Ga0501038_0144142 Ga0501038_0144142_1045_1929 294
236 3300049575 Ga0501039_0014332 Ga0501039_0014332_384_1268 294
237 3300049578 Ga0501042_0053990 Ga0501042_0053990_1951_2835 294
238 3300049580 Ga0501046_0050507 Ga0501046_0050507_731_1615 294
239 3300049580 Ga0501046_0236188 Ga0501046_0236188_361_1245 294
240 3300049589 Ga0501073_0106062 Ga0501073_0106062_177_1061 294
241 3300049741 Ga0501079_0209186 Ga0501079_0209186_24_908 294
242 3300049742 Ga0501080_0054964 Ga0501080_0054964_2282_3166 294
243 3300049822 Ga0501035_0022354 Ga0501035_0022354_2506_3390 294
244 3300049823 Ga0501044_0019722 Ga0501044_0019722_749_1633 294
245 3300053111 Ga0500572_000383 Ga0500572_000383_1418_2302 294
246 3300053136 Ga0500559_0000486 Ga0500559_0000486_6385_7269 294
247 3300053150 Ga0500603_021454 Ga0500603_021454_62_946 294
248 3300053163 Ga0500639_028645 Ga0500639_028645_789_1673 294
249 3300053177 Ga0500636_0042827 Ga0500636_0042827_107_991 294
250 3300053735 Ga0500596_015230 Ga0500596_015230_63_947 294
251 3300053737 Ga0500601_005147 Ga0500601_005147_438_1322 294
252 iso_pu_bacteria 2738541281 2738746396 294
253 iso_pu_bacteria 2738543032 2739355626 294
254 3300003203 JGI25406J46586_10006073 JGI25406J46586_100060733 295
255 3300003215 JGI25153J46596_10004803 JGI25153J46596_100048039 295
256 3300003215 JGI25153J46596_10028115 JGI25153J46596_100281151 295
257 3300003354 JGI25160J50197_1024331 JGI25160J50197_10243311 295
258 3300003659 JGI25404J52841_10001048 JGI25404J52841_100010482 295
259 3300003794 Ga0055531_10020619 Ga0055531_100206191 295
260 3300004625 Ga0055543_1012260 Ga0055543_10122601 295
261 3300005262 Ga0065165_1030520 Ga0065165_10305202 295
262 3300005327 Ga0070658_10011197 Ga0070658_100111976 295
263 3300005327 Ga0070658_10064095 Ga0070658_100640954 295
264 3300005327 Ga0070658_10355905 Ga0070658_103559051 295
265 3300005329 Ga0070683_100035992 Ga0070683_1000359924 295
266 3300005329 Ga0070683_100046881 Ga0070683_1000468815 295
267 3300005329 Ga0070683_100110710 Ga0070683_1001107102 295
268 3300005336 Ga0070680_100020407 Ga0070680_1000204076 295
269 3300005336 Ga0070680_100034052 Ga0070680_1000340521 295
270 3300005336 Ga0070680_100104526 Ga0070680_1001045262 295
271 3300005336 Ga0070680_100132343 Ga0070680_1001323432 295
272 3300005337 Ga0070682_100294312 Ga0070682_1002943121 295
273 3300005338 Ga0068868_100235674 Ga0068868_1002356742 295
274 3300005339 Ga0070660_100019955 Ga0070660_1000199557 295
275 3300005339 Ga0070660_100052201 Ga0070660_1000522012 295
276 3300005347 Ga0070668_100110800 Ga0070668_1001108001 295
277 3300005355 Ga0070671_100166203 Ga0070671_1001662032 295
278 3300005355 Ga0070671_100307646 Ga0070671_1003076462 295
279 3300005356 Ga0070674_100170542 Ga0070674_1001705421 295
280 3300005366 Ga0070659_100128407 Ga0070659_1001284072 295
281 3300005367 Ga0070667_100143556 Ga0070667_1001435562 295
282 3300005434 Ga0070709_10009651 Ga0070709_100096514 295
283 3300005434 Ga0070709_10056134 Ga0070709_100561343 295
284 3300005434 Ga0070709_10116826 Ga0070709_101168263 295
285 3300005435 Ga0070714_100169165 Ga0070714_1001691651 295
286 3300005436 Ga0070713_100007733 Ga0070713_1000077338 295
287 3300005436 Ga0070713_100044539 Ga0070713_1000445394 295
288 3300005436 Ga0070713_100056937 Ga0070713_1000569372 295
289 3300005436 Ga0070713_100593325 Ga0070713_1005933251 295
290 3300005437 Ga0070710_10000707 Ga0070710_1000070718 295
291 3300005437 Ga0070710_10015339 Ga0070710_100153396 295
292 3300005438 Ga0070701_10146990 Ga0070701_101469901 295
293 3300005439 Ga0070711_100006676 Ga0070711_1000066761 295
294 3300005439 Ga0070711_100016881 Ga0070711_1000168813 295
295 3300005439 Ga0070711_100067059 Ga0070711_1000670593 295
296 3300005439 Ga0070711_100380914 Ga0070711_1003809141 295
297 3300005440 Ga0070705_100096817 Ga0070705_1000968172 295
298 3300005441 Ga0070700_100420737 Ga0070700_1004207371 295
299 3300005445 Ga0070708_100685664 Ga0070708_1006856641 295
300 3300005455 Ga0070663_100049756 Ga0070663_1000497565 295
301 3300005456 Ga0070678_100067611 Ga0070678_1000676114 295
302 3300005456 Ga0070678_100112722 Ga0070678_1001127222 295
303 3300005458 Ga0070681_10209901 Ga0070681_102099012 295
304 3300005471 Ga0070698_100154937 Ga0070698_1001549371 295
305 3300005530 Ga0070679_100020129 Ga0070679_1000201296 295
306 3300005530 Ga0070679_100042976 Ga0070679_1000429765 295
307 3300005530 Ga0070679_100445048 Ga0070679_1004450481 295
308 3300005535 Ga0070684_100018149 Ga0070684_1000181493 295
309 3300005535 Ga0070684_100021264 Ga0070684_1000212646 295
310 3300005535 Ga0070684_100083447 Ga0070684_1000834472 295
311 3300005535 Ga0070684_100252410 Ga0070684_1002524102 295
312 3300005536 Ga0070697_100090441 Ga0070697_1000904411 295
313 3300005536 Ga0070697_100326297 Ga0070697_1003262971 295
314 3300005539 Ga0068853_100007085 Ga0068853_1000070853 295
315 3300005539 Ga0068853_100082352 Ga0068853_1000823521 295
316 3300005539 Ga0068853_100097672 Ga0068853_1000976721 295
317 3300005548 Ga0070665_100038638 Ga0070665_1000386382 295
318 3300005548 Ga0070665_100176196 Ga0070665_1001761962 295
319 3300005548 Ga0070665_100176978 Ga0070665_1001769782 295
320 3300005548 Ga0070665_100197527 Ga0070665_1001975273 295
321 3300005548 Ga0070665_100286751 Ga0070665_1002867512 295
322 3300005563 Ga0068855_100048105 Ga0068855_1000481055 295
323 3300005563 Ga0068855_100054394 Ga0068855_1000543942 295
324 3300005563 Ga0068855_100064837 Ga0068855_1000648374 295
325 3300005563 Ga0068855_100113485 Ga0068855_1001134854 295
326 3300005563 Ga0068855_100488585 Ga0068855_1004885852 295
327 3300005563 Ga0068855_100512354 Ga0068855_1005123541 295
328 3300005564 Ga0070664_100222862 Ga0070664_1002228623 295
329 3300005564 Ga0070664_100268983 Ga0070664_1002689832 295
330 3300005577 Ga0068857_100045081 Ga0068857_1000450813 295
331 3300005577 Ga0068857_100110228 Ga0068857_1001102281 295
332 3300005614 Ga0068856_100000522 Ga0068856_10000052225 295
333 3300005614 Ga0068856_100172156 Ga0068856_1001721562 295
334 3300005614 Ga0068856_100265444 Ga0068856_1002654442 295
335 3300005614 Ga0068856_100426722 Ga0068856_1004267222 295
336 3300005616 Ga0068852_100021761 Ga0068852_1000217612 295
337 3300005616 Ga0068852_100047847 Ga0068852_1000478473 295
338 3300005616 Ga0068852_100365435 Ga0068852_1003654351 295
339 3300005618 Ga0068864_100037310 Ga0068864_1000373102 295
340 3300005618 Ga0068864_100159098 Ga0068864_1001590982 295
341 3300005618 Ga0068864_100200349 Ga0068864_1002003493 295
342 3300005719 Ga0068861_100222100 Ga0068861_1002221002 295
343 3300005719 Ga0068861_100517647 Ga0068861_1005176471 295
344 3300005841 Ga0068863_100119367 Ga0068863_1001193672 295
345 3300005842 Ga0068858_100150021 Ga0068858_1001500212 295
346 3300005842 Ga0068858_100183632 Ga0068858_1001836323 295
347 3300005842 Ga0068858_100339526 Ga0068858_1003395262 295
348 3300005843 Ga0068860_100000441 Ga0068860_10000044128 295
349 3300005843 Ga0068860_100177701 Ga0068860_1001777012 295
350 3300005937 Ga0081455_10034005 Ga0081455_100340052 295
351 3300005937 Ga0081455_10105365 Ga0081455_101053652 295
352 3300005983 Ga0081540_1017509 Ga0081540_10175093 295
353 3300005983 Ga0081540_1018219 Ga0081540_10182195 295
354 3300005983 Ga0081540_1025852 Ga0081540_10258524 295
355 3300005983 Ga0081540_1026432 Ga0081540_10264322 295
356 3300005983 Ga0081540_1048367 Ga0081540_10483672 295
357 3300005983 Ga0081540_1048528 Ga0081540_10485283 295
358 3300005985 Ga0081539_10000425 Ga0081539_1000042574 295
359 3300005985 Ga0081539_10001114 Ga0081539_1000111438 295
360 3300005985 Ga0081539_10032892 Ga0081539_100328923 295
361 3300005985 Ga0081539_10053402 Ga0081539_100534022 295
362 3300006028 Ga0070717_10000325 Ga0070717_100003253 295
363 3300006028 Ga0070717_10123243 Ga0070717_101232434 295
364 3300006028 Ga0070717_10147620 Ga0070717_101476202 295
365 3300006038 Ga0075365_10128266 Ga0075365_101282662 295
366 3300006038 Ga0075365_10183961 Ga0075365_101839611 295
367 3300006048 Ga0075363_100012045 Ga0075363_1000120452 295
368 3300006048 Ga0075363_100064202 Ga0075363_1000642023 295
369 3300006048 Ga0075363_100100340 Ga0075363_1001003403 295
370 3300006051 Ga0075364_10083494 Ga0075364_100834942 295
371 3300006051 Ga0075364_10207465 Ga0075364_102074651 295
372 3300006163 Ga0070715_10026071 Ga0070715_100260713 295
373 3300006173 Ga0070716_100005608 Ga0070716_1000056087 295
374 3300006173 Ga0070716_100019072 Ga0070716_1000190723 295
375 3300006175 Ga0070712_100087985 Ga0070712_1000879853 295
376 3300006175 Ga0070712_100089696 Ga0070712_1000896961 295
377 3300006177 Ga0075362_10055144 Ga0075362_100551443 295
378 3300006178 Ga0075367_10067480 Ga0075367_100674803 295
379 3300006178 Ga0075367_10136013 Ga0075367_101360132 295
380 3300006178 Ga0075367_10222803 Ga0075367_102228031 295
381 3300006186 Ga0075369_10042648 Ga0075369_100426481 295
382 3300006195 Ga0075366_10107625 Ga0075366_101076252 295
383 3300006237 Ga0097621_100143110 Ga0097621_1001431102 295
384 3300006353 Ga0075370_10087982 Ga0075370_100879822 295
385 3300006353 Ga0075370_10118448 Ga0075370_101184483 295
386 3300006358 Ga0068871_100158319 Ga0068871_1001583192 295
387 3300006358 Ga0068871_100211502 Ga0068871_1002115021 295
388 3300006871 Ga0075434_100004469 Ga0075434_1000044697 295
389 3300006871 Ga0075434_100096067 Ga0075434_1000960673 295
390 3300006871 Ga0075434_100362343 Ga0075434_1003623432 295
391 3300006881 Ga0068865_100073449 Ga0068865_1000734492 295
392 3300006941 Ga0099825_1020668 Ga0099825_10206681 295
393 3300006942 Ga0099824_1035813 Ga0099824_10358132 295
394 3300006943 Ga0099822_1007626 Ga0099822_10076261 295
395 3300006943 Ga0099822_1056766 Ga0099822_10567661 295
396 3300006944 Ga0099823_1072928 Ga0099823_10729281 295
397 3300007265 Ga0099794_10012991 Ga0099794_100129911 295
398 3300007788 Ga0099795_10025691 Ga0099795_100256911 295
399 3300009093 Ga0105240_10002968 Ga0105240_1000296813 295
400 3300009093 Ga0105240_10190410 Ga0105240_101904101 295
401 3300009093 Ga0105240_10227269 Ga0105240_102272692 295
402 3300009093 Ga0105240_10407263 Ga0105240_104072632 295
403 3300009177 Ga0105248_10269872 Ga0105248_102698722 295
404 3300009177 Ga0105248_10496058 Ga0105248_104960581 295
405 3300009545 Ga0105237_10020853 Ga0105237_1002085310 295
406 3300009545 Ga0105237_10123107 Ga0105237_101231073 295
407 3300009545 Ga0105237_10237353 Ga0105237_102373532 295
408 3300009545 Ga0105237_10341691 Ga0105237_103416911 295
409 3300009551 Ga0105238_10010451 Ga0105238_1001045111 295
410 3300009551 Ga0105238_10025037 Ga0105238_100250376 295
411 3300009551 Ga0105238_10334186 Ga0105238_103341861 295
412 3300009551 Ga0105238_10451722 Ga0105238_104517222 295
413 3300009551 Ga0105238_10680530 Ga0105238_106805301 295
414 3300009553 Ga0105249_10194985 Ga0105249_101949852 295
415 3300009553 Ga0105249_10361636 Ga0105249_103616361 295
416 3300010159 Ga0099796_10082867 Ga0099796_100828671 295
417 3300010375 Ga0105239_10131032 Ga0105239_101310322 295
418 3300013102 Ga0157371_10015904 Ga0157371_100159044 295
419 3300013104 Ga0157370_10108237 Ga0157370_101082372 295
420 3300013104 Ga0157370_10124721 Ga0157370_101247214 295
421 3300013104 Ga0157370_10180609 Ga0157370_101806092 295
422 3300013105 Ga0157369_10009007 Ga0157369_100090073 295
423 3300013105 Ga0157369_10009927 Ga0157369_1000992710 295
424 3300013105 Ga0157369_10218728 Ga0157369_102187281 295
425 3300013105 Ga0157369_10343522 Ga0157369_103435222 295
426 3300013296 Ga0157374_10041978 Ga0157374_100419782 295
427 3300013306 Ga0163162_10149747 Ga0163162_101497472 295
428 3300013307 Ga0157372_10079888 Ga0157372_100798885 295
429 3300013307 Ga0157372_10310985 Ga0157372_103109851 295
430 3300013307 Ga0157372_10363327 Ga0157372_103633272 295
431 3300013307 Ga0157372_10418999 Ga0157372_104189991 295
432 3300013307 Ga0157372_10453038 Ga0157372_104530382 295
433 3300013308 Ga0157375_10133986 Ga0157375_101339863 295
434 3300013308 Ga0157375_10212208 Ga0157375_102122082 295
435 3300014325 Ga0163163_10081730 Ga0163163_100817302 295
436 3300014325 Ga0163163_10230508 Ga0163163_102305081 295
437 3300014745 Ga0157377_10091376 Ga0157377_100913761 295
438 3300014969 Ga0157376_10110571 Ga0157376_101105712 295
439 3300014969 Ga0157376_10311911 Ga0157376_103119112 295
440 3300021320 Ga0214544_1000011 Ga0214544_100001164 295
441 3300021321 Ga0214542_1000009 Ga0214542_1000009178 295
442 3300021324 Ga0214545_1000007 Ga0214545_100000764 295
443 3300021327 Ga0214543_1000020 Ga0214543_1000020178 295
444 3300021361 Ga0213872_10019823 Ga0213872_100198231 295
445 3300021377 Ga0213874_10013163 Ga0213874_100131633 295
446 3300021384 Ga0213876_10001735 Ga0213876_100017351 295
447 3300024227 Ga0228598_1032947 Ga0228598_10329471 295
448 3300025295 Ga0209564_1008389 Ga0209564_10083892 295
449 3300025297 Ga0209758_1000106 Ga0209758_1000106120 295
450 3300025297 Ga0209758_1001683 Ga0209758_100168316 295
451 3300025297 Ga0209758_1002332 Ga0209758_100233210 295
452 3300025297 Ga0209758_1006430 Ga0209758_10064304 295
453 3300025298 Ga0209050_1022586 Ga0209050_10225862 295
454 3300025302 Ga0207426_1003263 Ga0207426_10032637 295
455 3300025304 Ga0209257_1001741 Ga0209257_100174111 295
456 3300025898 Ga0207692_10005117 Ga0207692_100051173 295
457 3300025898 Ga0207692_10008782 Ga0207692_100087823 295
458 3300025898 Ga0207692_10063539 Ga0207692_100635391 295
459 3300025900 Ga0207710_10072188 Ga0207710_100721881 295
460 3300025900 Ga0207710_10126377 Ga0207710_101263772 295
461 3300025903 Ga0207680_10164264 Ga0207680_101642641 295
462 3300025905 Ga0207685_10003939 Ga0207685_100039391 295
463 3300025905 Ga0207685_10015299 Ga0207685_100152993 295
464 3300025906 Ga0207699_10000740 Ga0207699_1000074010 295
465 3300025906 Ga0207699_10006844 Ga0207699_100068445 295
466 3300025906 Ga0207699_10055566 Ga0207699_100555663 295
467 3300025909 Ga0207705_10038645 Ga0207705_100386452 295
468 3300025910 Ga0207684_10262085 Ga0207684_102620851 295
469 3300025911 Ga0207654_10184902 Ga0207654_101849021 295
470 3300025912 Ga0207707_10000541 Ga0207707_1000054123 295
471 3300025912 Ga0207707_10000582 Ga0207707_1000058228 295
472 3300025912 Ga0207707_10064900 Ga0207707_100649003 295
473 3300025913 Ga0207695_10000478 Ga0207695_1000047852 295
474 3300025913 Ga0207695_10018101 Ga0207695_100181015 295
475 3300025913 Ga0207695_10031949 Ga0207695_100319496 295
476 3300025914 Ga0207671_10003084 Ga0207671_1000308411 295
477 3300025914 Ga0207671_10030076 Ga0207671_100300761 295
478 3300025914 Ga0207671_10044416 Ga0207671_100444163 295
479 3300025914 Ga0207671_10156052 Ga0207671_101560522 295
480 3300025914 Ga0207671_10162138 Ga0207671_101621381 295
481 3300025914 Ga0207671_10183495 Ga0207671_101834952 295
482 3300025915 Ga0207693_10005512 Ga0207693_1000551211 295
483 3300025915 Ga0207693_10008208 Ga0207693_100082083 295
484 3300025915 Ga0207693_10014476 Ga0207693_100144765 295
485 3300025915 Ga0207693_10090801 Ga0207693_100908013 295
486 3300025915 Ga0207693_10288729 Ga0207693_102887291 295
487 3300025916 Ga0207663_10000425 Ga0207663_1000042515 295
488 3300025916 Ga0207663_10057794 Ga0207663_100577943 295
489 3300025916 Ga0207663_10072056 Ga0207663_100720563 295
490 3300025916 Ga0207663_10110833 Ga0207663_101108331 295
491 3300025916 Ga0207663_10138454 Ga0207663_101384541 295
492 3300025917 Ga0207660_10022911 Ga0207660_100229114 295
493 3300025917 Ga0207660_10074692 Ga0207660_100746924 295
494 3300025919 Ga0207657_10002950 Ga0207657_1000295010 295
495 3300025919 Ga0207657_10136726 Ga0207657_101367262 295
496 3300025920 Ga0207649_10123275 Ga0207649_101232752 295
497 3300025921 Ga0207652_10004959 Ga0207652_100049592 295
498 3300025921 Ga0207652_10005910 Ga0207652_100059109 295
499 3300025921 Ga0207652_10138958 Ga0207652_101389583 295
500 3300025923 Ga0207681_10136395 Ga0207681_101363952 295
501 3300025923 Ga0207681_10277034 Ga0207681_102770342 295
502 3300025924 Ga0207694_10015749 Ga0207694_100157495 295
503 3300025924 Ga0207694_10159501 Ga0207694_101595012 295
504 3300025927 Ga0207687_10320813 Ga0207687_103208131 295
505 3300025928 Ga0207700_10004824 Ga0207700_100048241 295
506 3300025928 Ga0207700_10107598 Ga0207700_101075982 295
507 3300025928 Ga0207700_10308074 Ga0207700_103080742 295
508 3300025929 Ga0207664_10150991 Ga0207664_101509913 295
509 3300025929 Ga0207664_10293691 Ga0207664_102936911 295
510 3300025931 Ga0207644_10160881 Ga0207644_101608811 295
511 3300025931 Ga0207644_10200252 Ga0207644_102002522 295
512 3300025932 Ga0207690_10112687 Ga0207690_101126871 295
513 3300025932 Ga0207690_10151692 Ga0207690_101516921 295
514 3300025937 Ga0207669_10014908 Ga0207669_100149083 295
515 3300025938 Ga0207704_10009478 Ga0207704_100094784 295
516 3300025939 Ga0207665_10003367 Ga0207665_1000336711 295
517 3300025939 Ga0207665_10003573 Ga0207665_100035733 295
518 3300025940 Ga0207691_10412079 Ga0207691_104120791 295
519 3300025941 Ga0207711_10293994 Ga0207711_102939942 295
520 3300025942 Ga0207689_10155732 Ga0207689_101557321 295
521 3300025942 Ga0207689_10174428 Ga0207689_101744282 295
522 3300025942 Ga0207689_10343299 Ga0207689_103432992 295
523 3300025944 Ga0207661_10000109 Ga0207661_1000010921 295
524 3300025944 Ga0207661_10081608 Ga0207661_100816084 295
525 3300025949 Ga0207667_10083996 Ga0207667_100839961 295
526 3300025949 Ga0207667_10123692 Ga0207667_101236922 295
527 3300025949 Ga0207667_10125735 Ga0207667_101257352 295
528 3300025949 Ga0207667_10215053 Ga0207667_102150532 295
529 3300025949 Ga0207667_10432994 Ga0207667_104329942 295
530 3300025949 Ga0207667_10481998 Ga0207667_104819981 295
531 3300025972 Ga0207668_10015127 Ga0207668_100151271 295
532 3300025972 Ga0207668_10405550 Ga0207668_104055501 295
533 3300026023 Ga0207677_10067744 Ga0207677_100677442 295
534 3300026023 Ga0207677_10080223 Ga0207677_100802231 295
535 3300026035 Ga0207703_10104833 Ga0207703_101048331 295
536 3300026035 Ga0207703_10253798 Ga0207703_102537981 295
537 3300026035 Ga0207703_10425232 Ga0207703_104252321 295
538 3300026035 Ga0207703_10471963 Ga0207703_104719631 295
539 3300026041 Ga0207639_10007486 Ga0207639_100074867 295
540 3300026041 Ga0207639_10223000 Ga0207639_102230002 295
541 3300026041 Ga0207639_10260091 Ga0207639_102600911 295
542 3300026067 Ga0207678_10046082 Ga0207678_100460822 295
543 3300026067 Ga0207678_10148445 Ga0207678_101484453 295
544 3300026067 Ga0207678_10195442 Ga0207678_101954421 295
545 3300026075 Ga0207708_10106601 Ga0207708_101066013 295
546 3300026078 Ga0207702_10000014 Ga0207702_10000014223 295
547 3300026078 Ga0207702_10254153 Ga0207702_102541532 295
548 3300026078 Ga0207702_10681322 Ga0207702_106813221 295
549 3300026089 Ga0207648_10106662 Ga0207648_101066623 295
550 3300026095 Ga0207676_10059522 Ga0207676_100595222 295
551 3300026095 Ga0207676_10284789 Ga0207676_102847892 295
552 3300026116 Ga0207674_10057148 Ga0207674_100571483 295
553 3300026116 Ga0207674_10065509 Ga0207674_100655092 295
554 3300026116 Ga0207674_10108590 Ga0207674_101085901 295
555 3300026121 Ga0207683_10117668 Ga0207683_101176682 295
556 3300026121 Ga0207683_10220341 Ga0207683_102203412 295
557 3300026142 Ga0207698_10063823 Ga0207698_100638233 295
558 3300026142 Ga0207698_10159850 Ga0207698_101598501 295
559 3300027296 Ga0209389_1000016 Ga0209389_100001684 295
560 3300027296 Ga0209389_1000027 Ga0209389_100002760 295
561 3300027357 Ga0209589_1000005 Ga0209589_1000005342 295
562 3300027357 Ga0209589_1000031 Ga0209589_100003172 295
563 3300027361 Ga0209489_100005 Ga0209489_100005342 295
564 3300027361 Ga0209489_100057 Ga0209489_10005775 295
565 3300027361 Ga0209489_100063 Ga0209489_10006342 295
566 3300027363 Ga0209700_100006 Ga0209700_100006342 295
567 3300027363 Ga0209700_100012 Ga0209700_10001285 295
568 3300027671 Ga0209588_1004211 Ga0209588_10042112 295
569 3300028379 Ga0268266_10001346 Ga0268266_100013466 295
570 3300028379 Ga0268266_10068805 Ga0268266_100688051 295
571 3300028379 Ga0268266_10199533 Ga0268266_101995332 295
572 3300028379 Ga0268266_10548464 Ga0268266_105484641 295
573 3300028380 Ga0268265_10034105 Ga0268265_100341052 295
574 3300028380 Ga0268265_10199546 Ga0268265_101995462 295
575 3300028381 Ga0268264_10000042 Ga0268264_1000004277 295
576 3300028381 Ga0268264_10135286 Ga0268264_101352861 295
577 3300028381 Ga0268264_10198150 Ga0268264_101981503 295
578 3300028786 Ga0307517_10000176 Ga0307517_1000017632 295
579 3300028794 Ga0307515_10317759 Ga0307515_103177591 295
580 3300030521 Ga0307511_10050299 Ga0307511_100502991 295
581 3300031238 Ga0265332_10016978 Ga0265332_100169784 295
582 3300031249 Ga0265339_10000383 Ga0265339_100003839 295
583 3300031344 Ga0265316_10103031 Ga0265316_101030312 295
584 3300031507 Ga0307509_10025042 Ga0307509_100250427 295
585 3300031507 Ga0307509_10251156 Ga0307509_102511562 295
586 3300031507 Ga0307509_10333330 Ga0307509_103333301 295
587 3300031616 Ga0307508_10000029 Ga0307508_10000029119 295
588 3300031616 Ga0307508_10024413 Ga0307508_100244137 295
589 3300031711 Ga0265314_10010200 Ga0265314_100102003 295
590 3300031711 Ga0265314_10229713 Ga0265314_102297131 295
591 3300031712 Ga0265342_10055988 Ga0265342_100559883 295
592 3300031730 Ga0307516_10088341 Ga0307516_100883414 295
593 3300031730 Ga0307516_10161240 Ga0307516_101612401 295
594 3300031911 Ga0307412_10204058 Ga0307412_102040582 295
595 3300031995 Ga0307409_100317876 Ga0307409_1003178762 295
596 3300032004 Ga0307414_10178805 Ga0307414_101788052 295
597 3300032126 Ga0307415_100123019 Ga0307415_1001230192 295
598 3300033179 Ga0307507_10021924 Ga0307507_100219242 295
599 3300033180 Ga0307510_10024826 Ga0307510_100248266 295
600 3300033180 Ga0307510_10026321 Ga0307510_100263217 295
601 3300033180 Ga0307510_10138078 Ga0307510_101380782 295
602 3300033442 Ga0315911_1000005 Ga0315911_1000005306 295
603 3300035083 Ga0373926_0060001 Ga0373926_0060001_299_1186 295
604 3300035086 Ga0373934_0018347 Ga0373934_0018347_1267_2154 295
605 3300035086 Ga0373934_0056364 Ga0373934_0056364_479_1366 295
606 3300035111 Ga0373923_0010360 Ga0373923_0010360_866_1753 295
607 3300035111 Ga0373923_0070889 Ga0373923_0070889_209_1096 295
608 3300035112 Ga0373932_0076262 Ga0373932_0076262_136_1023 295
609 3300035113 Ga0373936_0006737 Ga0373936_0006737_1906_2793 295
610 3300035113 Ga0373936_0085224 Ga0373936_0085224_402_1289 295
611 3300035113 Ga0373936_0114482 Ga0373936_0114482_48_935 295
612 3300035116 Ga0373945_0016664 Ga0373945_0016664_963_1850 295
613 3300035117 Ga0373953_0009510 Ga0373953_0009510_609_1496 295
614 3300035118 Ga0373954_0002278 Ga0373954_0002278_441_1328 295
615 3300035118 Ga0373954_0009920 Ga0373954_0009920_1356_2411 295
616 3300035119 Ga0373956_0004148 Ga0373956_0004148_4091_4978 295
617 3300035119 Ga0373956_0019733 Ga0373956_0019733_568_1623 295
618 3300035120 Ga0373957_0001409 Ga0373957_0001409_294_1181 295
619 3300035120 Ga0373957_0034103 Ga0373957_0034103_910_1797 295
620 3300035170 Ga0373943_0060746 Ga0373943_0060746_158_1045 295
621 3300035171 Ga0373946_0006137 Ga0373946_0006137_2610_3497 295
622 3300035171 Ga0373946_0045097 Ga0373946_0045097_28_915 295
623 3300035171 Ga0373946_0155733 Ga0373946_0155733_99_1028 295
624 3300035172 Ga0373955_0000395 Ga0373955_0000395_4556_5443 295
625 3300035172 Ga0373955_0042757 Ga0373955_0042757_193_1248 295
626 3300035410 Ga0373924_0008165 Ga0373924_0008165_833_1720 295
627 3300035410 Ga0373924_0055653 Ga0373924_0055653_265_1320 295
628 3300035410 Ga0373924_0071304 Ga0373924_0071304_93_980 295
629 3300035691 Ga0373931_0001048 Ga0373931_0001048_2089_2976 295
630 3300035691 Ga0373931_0030584 Ga0373931_0030584_411_1340 295
631 3300035691 Ga0373931_0179784 Ga0373931_0179784_332_1219 295
632 3300035692 Ga0373935_0004219 Ga0373935_0004219_1043_1930 295
633 3300035695 Ga0373927_0002702 Ga0373927_0002702_862_1749 295
634 3300035695 Ga0373927_0004563 Ga0373927_0004563_6617_7504 295
635 3300035695 Ga0373927_0023782 Ga0373927_0023782_2903_3805 295
636 3300035695 Ga0373927_0084381 Ga0373927_0084381_1058_1945 295
637 3300035695 Ga0373927_0143006 Ga0373927_0143006_202_1089 295
638 3300035724 Ga0373933_0003364 Ga0373933_0003364_6220_7107 295
639 3300035724 Ga0373933_0007313 Ga0373933_0007313_1050_2105 295
640 3300035724 Ga0373933_0091286 Ga0373933_0091286_793_1680 295
641 3300035725 Ga0373947_0007364 Ga0373947_0007364_3742_4629 295
642 3300035725 Ga0373947_0027701 Ga0373947_0027701_1482_2369 295
643 3300035725 Ga0373947_0065680 Ga0373947_0065680_779_1666 295
644 3300036401 Ga0373937_0011914 Ga0373937_0011914_313_1200 295
645 3300036401 Ga0373937_0049502 Ga0373937_0049502_450_1337 295
646 3300037068 Ga0373925_0007592 Ga0373925_0007592_4647_5534 295
647 3300037068 Ga0373925_0018541 Ga0373925_0018541_4108_4995 295
648 3300037068 Ga0373925_0034208 Ga0373925_0034208_2632_3534 295
649 3300037068 Ga0373925_0049760 Ga0373925_0049760_1541_2428 295
650 3300037068 Ga0373925_0092541 Ga0373925_0092541_1195_2082 295
651 3300037068 Ga0373925_0104706 Ga0373925_0104706_1252_2139 295
652 3300037418 Ga0395900_0007140 Ga0395900_0007140_1845_2735 295
653 3300037418 Ga0395900_0044885 Ga0395900_0044885_2885_3772 295
654 3300037418 Ga0395900_0105951 Ga0395900_0105951_1315_2202 295
655 3300037466 Ga0395898_0067033 Ga0395898_0067033_560_1447 295
656 3300037466 Ga0395898_0138367 Ga0395898_0138367_694_1584 295
657 3300037471 Ga0395905_0028290 Ga0395905_0028290_3200_4090 295
658 3300037471 Ga0395905_0246935 Ga0395905_0246935_204_1094 295
659 3300037471 Ga0395905_0547190 Ga0395905_0547190_135_1025 295
660 3300037853 Ga0436364_0776445 Ga0436364_0776445_872_1837 295
661 3300038443 Ga0395901_0129075 Ga0395901_0129075_207_1094 295
662 3300039437 Ga0436365_1364744 Ga0436365_1364744_533_1420 295
663 3300039437 Ga0436365_1778823 Ga0436365_1778823_708_1595 295
664 3300039438 Ga0436360_0202944 Ga0436360_0202944_112_999 295
665 3300039447 Ga0436361_0764338 Ga0436361_0764338_473_1360 295
666 3300039447 Ga0436361_1007400 Ga0436361_1007400_1193_2080 295
667 3300039450 Ga0436363_0187212 Ga0436363_0187212_1500_2450 295
668 3300039450 Ga0436363_1164297 Ga0436363_1164297_2362_3285 295
669 3300039450 Ga0436363_1664076 Ga0436363_1664076_35_922 295
670 3300041496 Ga0451839_1296627 Ga0451839_1296627_83_970 295
671 3300041505 Ga0451849_1550937 Ga0451849_1550937_152_1042 295
672 3300044656 Ga0466969_0038171 Ga0466969_0038171_340_1230 295
673 3300044658 Ga0466972_0000177 Ga0466972_0000177_32528_33418 295
674 3300044658 Ga0466972_0005224 Ga0466972_0005224_4415_5305 295
675 3300044683 Ga0466965_0032138 Ga0466965_0032138_885_1775 295
676 3300044683 Ga0466965_0199123 Ga0466965_0199123_93_980 295
677 3300044684 Ga0466966_0000474 Ga0466966_0000474_9334_10224 295
678 3300044693 Ga0466961_0000023 Ga0466961_0000023_74809_75699 295
679 3300044693 Ga0466961_0115673 Ga0466961_0115673_767_1654 295
680 3300044735 Ga0466968_0006075 Ga0466968_0006075_2709_3599 295
681 3300044735 Ga0466968_0041477 Ga0466968_0041477_727_1614 295
682 3300044842 Ga0466957_0312438 Ga0466957_0312438_79_966 295
683 3300045049 Ga0466959_0000726 Ga0466959_0000726_8312_9202 295
684 3300045976 Ga0466967_0189767 Ga0466967_0189767_244_1131 295
685 3300045976 Ga0466967_0628871 Ga0466967_0628871_155_1042 295
686 3300046454 Ga0495592_0020908 Ga0495592_0020908_3931_4818 295
687 3300046454 Ga0495592_0021820 Ga0495592_0021820_437_1324 295
688 3300046454 Ga0495592_0084009 Ga0495592_0084009_1044_2099 295
689 3300046454 Ga0495592_0301622 Ga0495592_0301622_50_937 295
690 3300046455 Ga0495603_0001935 Ga0495603_0001935_2890_3777 295
691 3300046455 Ga0495603_0006284 Ga0495603_0006284_5669_6556 295
692 3300046455 Ga0495603_0020664 Ga0495603_0020664_1122_2009 295
693 3300046455 Ga0495603_0049526 Ga0495603_0049526_856_1743 295
694 3300046455 Ga0495603_0062862 Ga0495603_0062862_1196_2083 295
695 3300046455 Ga0495603_0118366 Ga0495603_0118366_561_1448 295
696 3300046455 Ga0495603_0224158 Ga0495603_0224158_180_1067 295
697 3300046459 Ga0495629_0000416 Ga0495629_0000416_32823_33710 295
698 3300046459 Ga0495629_0000655 Ga0495629_0000655_19595_20482 295
699 3300046461 Ga0495641_0002593 Ga0495641_0002593_12393_13280 295
700 3300046461 Ga0495641_0101626 Ga0495641_0101626_45_935 295
701 3300046462 Ga0495651_0010752 Ga0495651_0010752_5416_6306 295
702 3300046462 Ga0495651_0144620 Ga0495651_0144620_92_979 295
703 3300046463 Ga0495653_0004854 Ga0495653_0004854_6638_7525 295
704 3300046471 Ga0495650_0025806 Ga0495650_0025806_1816_2706 295
705 3300046472 Ga0495580_0055436 Ga0495580_0055436_847_1734 295
706 3300046473 Ga0495582_0032876 Ga0495582_0032876_933_1820 295
707 3300046475 Ga0495639_0001046 Ga0495639_0001046_10012_10899 295
708 3300046475 Ga0495639_0084132 Ga0495639_0084132_159_1046 295
709 3300046475 Ga0495639_0129966 Ga0495639_0129966_236_1123 295
710 3300046476 Ga0495662_0003282 Ga0495662_0003282_1017_1904 295
711 3300046477 Ga0495664_0114940 Ga0495664_0114940_575_1462 295
712 3300046492 Ga0495585_0113023 Ga0495585_0113023_109_996 295
713 3300046492 Ga0495585_0147552 Ga0495585_0147552_10_897 295
714 3300046499 Ga0495594_0051840 Ga0495594_0051840_236_1123 295
715 3300046507 Ga0495606_0066283 Ga0495606_0066283_762_1652 295
716 3300046511 Ga0495608_0107848 Ga0495608_0107848_25_1080 295
717 3300046514 Ga0495618_0110921 Ga0495618_0110921_638_1693 295
718 3300046515 Ga0495620_0117244 Ga0495620_0117244_43_930 295
719 3300046516 Ga0495628_0011825 Ga0495628_0011825_934_1824 295
720 3300046516 Ga0495628_0030845 Ga0495628_0030845_2490_3377 295
721 3300046516 Ga0495628_0117808 Ga0495628_0117808_347_1402 295
722 3300046516 Ga0495628_0136125 Ga0495628_0136125_313_1200 295
723 3300046517 Ga0495630_0009444 Ga0495630_0009444_1043_1930 295
724 3300046522 Ga0495643_0014428 Ga0495643_0014428_2366_3256 295
725 3300046524 Ga0495648_0000640 Ga0495648_0000640_3771_4658 295
726 3300046526 Ga0495666_0016886 Ga0495666_0016886_934_1821 295
727 3300046526 Ga0495666_0030220 Ga0495666_0030220_1388_2275 295
728 3300046528 Ga0495642_0121770 Ga0495642_0121770_19_906 295
729 3300046529 Ga0495652_0026522 Ga0495652_0026522_3745_4635 295
730 3300046529 Ga0495652_0082257 Ga0495652_0082257_527_1582 295
731 3300046531 Ga0495665_0003441 Ga0495665_0003441_6740_7627 295
732 3300046531 Ga0495665_0056047 Ga0495665_0056047_1168_2055 295
733 3300046533 Ga0495640_0045167 Ga0495640_0045167_850_1737 295
734 3300046533 Ga0495640_0045731 Ga0495640_0045731_55_996 295
735 3300046533 Ga0495640_0073507 Ga0495640_0073507_527_1414 295
736 3300046533 Ga0495640_0085105 Ga0495640_0085105_964_1851 295
737 3300046535 Ga0495586_0085300 Ga0495586_0085300_121_1176 295
738 3300046536 Ga0495587_0007940 Ga0495587_0007940_4522_5577 295
739 3300046536 Ga0495587_0016331 Ga0495587_0016331_313_1200 295
740 3300046537 Ga0495598_0010333 Ga0495598_0010333_145_1032 295
741 3300046537 Ga0495598_0023933 Ga0495598_0023933_69_956 295
742 3300046539 Ga0495621_0078806 Ga0495621_0078806_191_1078 295
743 3300046543 Ga0495645_0002973 Ga0495645_0002973_10082_10969 295
744 3300046543 Ga0495645_0133459 Ga0495645_0133459_776_1663 295
745 3300046557 Ga0495622_0023686 Ga0495622_0023686_983_1870 295
746 3300046557 Ga0495622_0026482 Ga0495622_0026482_307_1209 295
747 3300046557 Ga0495622_0088749 Ga0495622_0088749_326_1213 295
748 3300046559 Ga0495667_0032457 Ga0495667_0032457_511_1566 295
749 3300046559 Ga0495667_0036654 Ga0495667_0036654_441_1328 295
750 3300046559 Ga0495667_0044661 Ga0495667_0044661_1121_2008 295
751 3300046559 Ga0495667_0060623 Ga0495667_0060623_102_992 295
752 3300046615 Ga0495656_0118066 Ga0495656_0118066_148_1035 295
753 3300046616 Ga0495668_0073358 Ga0495668_0073358_267_1154 295
754 3300046616 Ga0495668_0191459 Ga0495668_0191459_198_1085 295
755 3300046642 Ga0495634_0000602 Ga0495634_0000602_1143_2030 295
756 3300046642 Ga0495634_0074164 Ga0495634_0074164_266_1321 295
757 3300046642 Ga0495634_0159003 Ga0495634_0159003_430_1317 295
758 3300046642 Ga0495634_0223408 Ga0495634_0223408_73_960 295
759 3300046663 Ga0495635_0000380 Ga0495635_0000380_3507_4394 295
760 3300046663 Ga0495635_0012975 Ga0495635_0012975_3934_4821 295
761 3300046663 Ga0495635_0042493 Ga0495635_0042493_740_1681 295
762 3300046663 Ga0495635_0243080 Ga0495635_0243080_16_903 295
763 3300046664 Ga0495659_0030136 Ga0495659_0030136_69_956 295
764 3300046674 Ga0495588_0003413 Ga0495588_0003413_1071_1958 295
765 3300046675 Ga0495657_0005248 Ga0495657_0005248_4570_5457 295
766 3300046675 Ga0495657_0019627 Ga0495657_0019627_1693_2634 295
767 3300046675 Ga0495657_0050390 Ga0495657_0050390_1045_2100 295
768 3300046678 Ga0495599_0004515 Ga0495599_0004515_222_1112 295
769 3300046678 Ga0495599_0025467 Ga0495599_0025467_883_1770 295
770 3300046678 Ga0495599_0026173 Ga0495599_0026173_666_1721 295
771 3300046678 Ga0495599_0079124 Ga0495599_0079124_828_1715 295
772 3300046679 Ga0495623_0002235 Ga0495623_0002235_5980_6870 295
773 3300046679 Ga0495623_0015456 Ga0495623_0015456_1944_2831 295
774 3300046680 Ga0495646_0046242 Ga0495646_0046242_1301_2188 295
775 3300046680 Ga0495646_0048567 Ga0495646_0048567_1304_2359 295
776 3300046680 Ga0495646_0070850 Ga0495646_0070850_819_1709 295
777 3300046680 Ga0495646_0131009 Ga0495646_0131009_99_1040 295
778 3300046681 Ga0495647_0021626 Ga0495647_0021626_876_1763 295
779 3300046681 Ga0495647_0030022 Ga0495647_0030022_901_1788 295
780 3300046683 Ga0495658_0005105 Ga0495658_0005105_4339_5226 295
781 3300046683 Ga0495658_0053507 Ga0495658_0053507_1052_1939 295
782 3300046684 Ga0495669_0076437 Ga0495669_0076437_53_940 295
783 3300046689 Ga0495613_0032956 Ga0495613_0032956_2111_2998 295
784 3300046689 Ga0495613_0057599 Ga0495613_0057599_1035_1922 295
785 3300046690 Ga0495624_0003072 Ga0495624_0003072_9753_10640 295
786 3300046794 Ga0495589_0157788 Ga0495589_0157788_28_915 295
787 3300046809 Ga0495600_0029981 Ga0495600_0029981_2072_2959 295
788 3300046809 Ga0495600_0035125 Ga0495600_0035125_1047_1934 295
789 3300046809 Ga0495600_0114920 Ga0495600_0114920_722_1663 295
790 3300047315 Ga0495581_0020748 Ga0495581_0020748_998_1885 295
791 3300047315 Ga0495581_0036506 Ga0495581_0036506_963_1850 295
792 3300047315 Ga0495581_0097104 Ga0495581_0097104_669_1556 295
793 3300047315 Ga0495581_0198853 Ga0495581_0198853_112_999 295
794 3300047317 Ga0495604_0007336 Ga0495604_0007336_1294_2184 295
795 3300047317 Ga0495604_0008886 Ga0495604_0008886_3507_4394 295
796 3300047317 Ga0495604_0054854 Ga0495604_0054854_1286_2227 295
797 3300047317 Ga0495604_0127221 Ga0495604_0127221_111_1166 295
798 3300047319 Ga0495674_0008020 Ga0495674_0008020_1417_2304 295
799 3300047319 Ga0495674_0022101 Ga0495674_0022101_4096_4983 295
800 3300047319 Ga0495674_0066148 Ga0495674_0066148_982_1869 295
801 3300047319 Ga0495674_0160752 Ga0495674_0160752_40_1095 295
802 3300047319 Ga0495674_0305009 Ga0495674_0305009_314_1252 295
803 3300047321 Ga0495676_0069277 Ga0495676_0069277_368_1255 295
804 3300047321 Ga0495676_0122028 Ga0495676_0122028_742_1629 295
805 3300047321 Ga0495676_0123320 Ga0495676_0123320_54_941 295
806 3300047322 Ga0495680_0002016 Ga0495680_0002016_8728_9618 295
807 3300047322 Ga0495680_0025159 Ga0495680_0025159_313_1200 295
808 3300047322 Ga0495680_0085244 Ga0495680_0085244_1278_2165 295
809 3300047322 Ga0495680_0261857 Ga0495680_0261857_254_1141 295
810 3300047444 Ga0495675_0001856 Ga0495675_0001856_209_1099 295
811 3300047444 Ga0495675_0127716 Ga0495675_0127716_200_1255 295
812 3300047446 Ga0495679_059730 Ga0495679_059730_28_915 295
813 3300047470 Ga0495681_0121593 Ga0495681_0121593_194_1081 295
814 3300047471 Ga0495684_0000294 Ga0495684_0000294_19554_20441 295
815 3300047471 Ga0495684_0096973 Ga0495684_0096973_112_999 295
816 3300047471 Ga0495684_0138880 Ga0495684_0138880_63_1118 295
817 3300047673 Ga0495593_0000022 Ga0495593_0000022_895_1782 295
818 3300047673 Ga0495593_0000744 Ga0495593_0000744_6602_7489 295
819 3300048088 Ga0495602_0062578 Ga0495602_0062578_624_1514 295
820 3300048088 Ga0495602_0155583 Ga0495602_0155583_559_1614 295
821 3300048903 Ga0496100_0027259 Ga0496100_0027259_714_1601 295
822 3300048904 Ga0496101_0063193 Ga0496101_0063193_1595_2482 295
823 3300048904 Ga0496101_0088147 Ga0496101_0088147_581_1471 295
824 3300048904 Ga0496101_0116245 Ga0496101_0116245_162_1049 295
825 3300048905 Ga0496102_0014293 Ga0496102_0014293_2386_3273 295
826 3300048905 Ga0496102_0059266 Ga0496102_0059266_517_1407 295
827 3300048905 Ga0496102_0076480 Ga0496102_0076480_2065_2982 295
828 3300048905 Ga0496102_0334862 Ga0496102_0334862_383_1270 295
829 3300048906 Ga0496103_0101444 Ga0496103_0101444_239_1126 295
830 3300048907 Ga0496104_0002005 Ga0496104_0002005_1673_2614 295
831 3300048907 Ga0496104_0023320 Ga0496104_0023320_899_1786 295
832 3300048907 Ga0496104_0033610 Ga0496104_0033610_18_905 295
833 3300048907 Ga0496104_0235301 Ga0496104_0235301_609_1499 295
834 3300048908 Ga0496105_0009772 Ga0496105_0009772_336_1223 295
835 3300048908 Ga0496105_0011036 Ga0496105_0011036_4838_5725 295
836 3300048908 Ga0496105_0012416 Ga0496105_0012416_3685_4626 295
837 3300048908 Ga0496105_0391803 Ga0496105_0391803_153_1040 295
838 3300048909 Ga0496106_0001262 Ga0496106_0001262_15784_16686 295
839 3300048909 Ga0496106_0003691 Ga0496106_0003691_1545_2618 295
840 3300048909 Ga0496106_0014884 Ga0496106_0014884_3900_4787 295
841 3300048909 Ga0496106_0137472 Ga0496106_0137472_569_1456 295
842 3300048909 Ga0496106_0139912 Ga0496106_0139912_706_1593 295
843 3300048909 Ga0496106_0489794 Ga0496106_0489794_71_958 295
844 3300048910 Ga0496107_0021225 Ga0496107_0021225_2870_3757 295
845 3300048911 Ga0496108_0084458 Ga0496108_0084458_1166_2056 295
846 3300048911 Ga0496108_0141737 Ga0496108_0141737_639_1529 295
847 3300048911 Ga0496108_0155553 Ga0496108_0155553_120_1007 295
848 3300048911 Ga0496108_0199656 Ga0496108_0199656_168_1055 295
849 3300048911 Ga0496108_0247223 Ga0496108_0247223_181_1068 295
850 3300048912 Ga0496109_0000910 Ga0496109_0000910_1947_3020 295
851 3300048912 Ga0496109_0117615 Ga0496109_0117615_1243_2130 295
852 3300048912 Ga0496109_0142527 Ga0496109_0142527_586_1476 295
853 3300048912 Ga0496109_0147156 Ga0496109_0147156_242_1129 295
854 3300048912 Ga0496109_0155298 Ga0496109_0155298_149_1036 295
855 3300048912 Ga0496109_0166533 Ga0496109_0166533_401_1288 295
856 3300048912 Ga0496109_0168061 Ga0496109_0168061_951_1838 295
857 3300048912 Ga0496109_0293113 Ga0496109_0293113_239_1126 295
858 3300048913 Ga0496110_0101486 Ga0496110_0101486_36_923 295
859 3300048913 Ga0496110_0105664 Ga0496110_0105664_856_1746 295
860 3300048913 Ga0496110_0118704 Ga0496110_0118704_1290_2177 295
861 3300048913 Ga0496110_0206343 Ga0496110_0206343_514_1401 295
862 3300048914 Ga0496111_0034388 Ga0496111_0034388_27_914 295
863 3300048914 Ga0496111_0116502 Ga0496111_0116502_1038_1925 295
864 3300048914 Ga0496111_0259119 Ga0496111_0259119_365_1255 295
865 3300048914 Ga0496111_0452236 Ga0496111_0452236_44_931 295
866 3300048915 Ga0496112_0000022 Ga0496112_0000022_37574_38461 295
867 3300048915 Ga0496112_0023710 Ga0496112_0023710_2101_2988 295
868 3300048915 Ga0496112_0034500 Ga0496112_0034500_855_1928 295
869 3300048915 Ga0496112_0043988 Ga0496112_0043988_91_978 295
870 3300048915 Ga0496112_0118773 Ga0496112_0118773_1613_2503 295
871 3300048915 Ga0496112_0170514 Ga0496112_0170514_646_1533 295
872 3300048915 Ga0496112_0261545 Ga0496112_0261545_464_1375 295
873 3300048915 Ga0496112_0266577 Ga0496112_0266577_46_933 295
874 3300048915 Ga0496112_0402327 Ga0496112_0402327_279_1166 295
875 3300048915 Ga0496112_0539679 Ga0496112_0539679_101_988 295
876 3300048916 Ga0496113_0009540 Ga0496113_0009540_5405_6292 295
877 3300048916 Ga0496113_0072238 Ga0496113_0072238_1017_1904 295
878 3300048916 Ga0496113_0108196 Ga0496113_0108196_1252_2142 295
879 3300048916 Ga0496113_0129870 Ga0496113_0129870_647_1720 295
880 3300048917 Ga0496114_0009367 Ga0496114_0009367_490_1377 295
881 3300048917 Ga0496114_0245788 Ga0496114_0245788_222_1154 295
882 3300048918 Ga0496115_0032437 Ga0496115_0032437_1661_2551 295
883 3300048918 Ga0496115_0033888 Ga0496115_0033888_1695_2582 295
884 3300048918 Ga0496115_0081033 Ga0496115_0081033_1497_2384 295
885 3300048918 Ga0496115_0189664 Ga0496115_0189664_563_1504 295
886 3300048918 Ga0496115_0238742 Ga0496115_0238742_18_905 295
887 3300048918 Ga0496115_0422078 Ga0496115_0422078_166_1053 295
888 3300048919 Ga0496116_0077687 Ga0496116_0077687_983_1873 295
889 3300048920 Ga0496117_0043940 Ga0496117_0043940_1561_2448 295
890 3300048920 Ga0496117_0088506 Ga0496117_0088506_218_1108 295
891 3300048921 Ga0496118_0083539 Ga0496118_0083539_1318_2205 295
892 3300048922 Ga0496119_0068858 Ga0496119_0068858_267_1154 295
893 3300048922 Ga0496119_0123246 Ga0496119_0123246_279_1166 295
894 3300048922 Ga0496119_0127019 Ga0496119_0127019_308_1198 295
895 3300048923 Ga0496120_0022888 Ga0496120_0022888_1308_2249 295
896 3300048924 Ga0496121_0000254 Ga0496121_0000254_71339_72226 295
897 3300048924 Ga0496121_0002114 Ga0496121_0002114_27908_28810 295
898 3300048924 Ga0496121_0011243 Ga0496121_0011243_143_1030 295
899 3300048924 Ga0496121_0012395 Ga0496121_0012395_2887_3774 295
900 3300048924 Ga0496121_0055262 Ga0496121_0055262_1495_2385 295
901 3300048924 Ga0496121_0090630 Ga0496121_0090630_1311_2198 295
902 3300048924 Ga0496121_0128284 Ga0496121_0128284_862_1749 295
903 3300048924 Ga0496121_0222224 Ga0496121_0222224_163_1050 295
904 3300048927 Ga0496124_0001351 Ga0496124_0001351_6962_7864 295
905 3300048928 Ga0496125_0065882 Ga0496125_0065882_523_1425 295
906 3300048928 Ga0496125_0099784 Ga0496125_0099784_112_999 295
907 3300048929 Ga0496126_0007801 Ga0496126_0007801_7583_8470 295
908 3300048929 Ga0496126_0012548 Ga0496126_0012548_1146_2033 295
909 3300048929 Ga0496126_0022598 Ga0496126_0022598_1280_2182 295
910 3300048929 Ga0496126_0024830 Ga0496126_0024830_57_944 295
911 3300048929 Ga0496126_0026051 Ga0496126_0026051_632_1534 295
912 3300048929 Ga0496126_0049875 Ga0496126_0049875_975_1916 295
913 3300048929 Ga0496126_0155068 Ga0496126_0155068_863_1750 295
914 3300048929 Ga0496126_0222802 Ga0496126_0222802_424_1311 295
915 3300048929 Ga0496126_0368862 Ga0496126_0368862_33_920 295
916 3300049568 Ga0501031_0001005 Ga0501031_0001005_6508_7395 295
917 3300049569 Ga0501032_0000161 Ga0501032_0000161_19435_20322 295
918 3300049569 Ga0501032_0053496 Ga0501032_0053496_695_1582 295
919 3300049570 Ga0501033_0000111 Ga0501033_0000111_73076_73963 295
920 3300049571 Ga0501034_0000072 Ga0501034_0000072_115755_116642 295
921 3300049571 Ga0501034_0071554 Ga0501034_0071554_37_924 295
922 3300049571 Ga0501034_0144499 Ga0501034_0144499_1258_2145 295
923 3300049571 Ga0501034_0260391 Ga0501034_0260391_709_1596 295
924 3300049572 Ga0501036_0011119 Ga0501036_0011119_2560_3447 295
925 3300049572 Ga0501036_0053940 Ga0501036_0053940_2205_3092 295
926 3300049572 Ga0501036_0073036 Ga0501036_0073036_1457_2434 295
927 3300049572 Ga0501036_0446357 Ga0501036_0446357_28_915 295
928 3300049573 Ga0501037_0000030 Ga0501037_0000030_121238_122125 295
929 3300049573 Ga0501037_0062319 Ga0501037_0062319_695_1582 295
930 3300049573 Ga0501037_0126387 Ga0501037_0126387_70_1047 295
931 3300049574 Ga0501038_0000060 Ga0501038_0000060_22554_23441 295
932 3300049574 Ga0501038_0003347 Ga0501038_0003347_39_926 295
933 3300049574 Ga0501038_0019562 Ga0501038_0019562_4469_5356 295
934 3300049574 Ga0501038_0203591 Ga0501038_0203591_430_1317 295
935 3300049575 Ga0501039_0003983 Ga0501039_0003983_284_1171 295
936 3300049575 Ga0501039_0155791 Ga0501039_0155791_447_1334 295
937 3300049576 Ga0501040_0118117 Ga0501040_0118117_714_1601 295
938 3300049578 Ga0501042_0112143 Ga0501042_0112143_355_1242 295
939 3300049579 Ga0501043_0000357 Ga0501043_0000357_36372_37259 295
940 3300049580 Ga0501046_0002205 Ga0501046_0002205_7204_8091 295
941 3300049581 Ga0501047_0000140 Ga0501047_0000140_4726_5613 295
942 3300049581 Ga0501047_0026961 Ga0501047_0026961_3230_4117 295
943 3300049581 Ga0501047_0068547 Ga0501047_0068547_2083_2970 295
944 3300049581 Ga0501047_0241726 Ga0501047_0241726_699_1586 295
945 3300049581 Ga0501047_0338958 Ga0501047_0338958_146_1036 295
946 3300049582 Ga0501048_0000812 Ga0501048_0000812_20133_21020 295
947 3300049582 Ga0501048_0144939 Ga0501048_0144939_145_1125 295
948 3300049583 Ga0501067_0000697 Ga0501067_0000697_5220_6107 295
949 3300049583 Ga0501067_0002459 Ga0501067_0002459_8144_9031 295
950 3300049583 Ga0501067_0067838 Ga0501067_0067838_368_1255 295
951 3300049584 Ga0501068_0015057 Ga0501068_0015057_3365_4252 295
952 3300049585 Ga0501069_0062846 Ga0501069_0062846_994_1881 295
953 3300049585 Ga0501069_0066501 Ga0501069_0066501_966_1853 295
954 3300049586 Ga0501070_0000602 Ga0501070_0000602_17686_18573 295
955 3300049586 Ga0501070_0010155 Ga0501070_0010155_4478_5365 295
956 3300049586 Ga0501070_0058337 Ga0501070_0058337_2136_3023 295
957 3300049586 Ga0501070_0138152 Ga0501070_0138152_187_1077 295
958 3300049586 Ga0501070_0180023 Ga0501070_0180023_286_1173 295
959 3300049588 Ga0501072_0084380 Ga0501072_0084380_915_1802 295
960 3300049588 Ga0501072_0401974 Ga0501072_0401974_177_1064 295
961 3300049589 Ga0501073_0000009 Ga0501073_0000009_131580_132467 295
962 3300049589 Ga0501073_0009578 Ga0501073_0009578_1849_2736 295
963 3300049589 Ga0501073_0035565 Ga0501073_0035565_1516_2403 295
964 3300049590 Ga0501074_0000137 Ga0501074_0000137_32184_33071 295
965 3300049593 Ga0501077_0095551 Ga0501077_0095551_410_1297 295
966 3300049741 Ga0501079_0017212 Ga0501079_0017212_252_1139 295
967 3300049742 Ga0501080_0000088 Ga0501080_0000088_53415_54302 295
968 3300049742 Ga0501080_0037211 Ga0501080_0037211_1063_1950 295
969 3300049744 Ga0501083_0013621 Ga0501083_0013621_4552_5439 295
970 3300049744 Ga0501083_0050365 Ga0501083_0050365_781_1668 295
971 3300049822 Ga0501035_0057070 Ga0501035_0057070_2560_3447 295
972 3300049822 Ga0501035_0116770 Ga0501035_0116770_798_1685 295
973 3300049822 Ga0501035_0204141 Ga0501035_0204141_636_1523 295
974 3300049822 Ga0501035_0242617 Ga0501035_0242617_302_1189 295
975 3300049822 Ga0501035_0302376 Ga0501035_0302376_447_1334 295
976 3300049823 Ga0501044_0002346 Ga0501044_0002346_8577_9464 295
977 3300049823 Ga0501044_0013964 Ga0501044_0013964_7530_8417 295
978 3300049823 Ga0501044_0022171 Ga0501044_0022171_2148_3035 295
979 3300049824 Ga0501045_0024317 Ga0501045_0024317_2321_3208 295
980 3300050489 nmdc:mga03683_51497_c1 nmdc:mga03683_51497_c1_678_1565 295
981 3300050490 nmdc:mga03n38_4303_c1 nmdc:mga03n38_4303_c1_1537_2424 295
982 3300050491 nmdc:mga00v17_32663_c1 nmdc:mga00v17_32663_c1_752_1642 295
983 3300050492 nmdc:mga0yw44_13579_c1 nmdc:mga0yw44_13579_c1_632_1519 295
984 3300050492 nmdc:mga0yw44_194539_c1 nmdc:mga0yw44_194539_c1_282_1169 295
985 3300050492 nmdc:mga0yw44_78840_c1 nmdc:mga0yw44_78840_c1_289_1230 295
986 3300050492 nmdc:mga0yw44_8656_c1 nmdc:mga0yw44_8656_c1_3692_4579 295
987 3300050492 nmdc:mga0yw44_93034_c1 nmdc:mga0yw44_93034_c1_383_1273 295
988 3300050493 nmdc:mga0k408_6488_c1 nmdc:mga0k408_6488_c1_1208_2095 295
989 3300050494 nmdc:mga06z11_182462_c1 nmdc:mga06z11_182462_c1_274_1161 295
990 3300050494 nmdc:mga06z11_21687_c1 nmdc:mga06z11_21687_c1_1515_2402 295
991 3300050494 nmdc:mga06z11_47781_c1 nmdc:mga06z11_47781_c1_1149_2036 295
992 3300050494 nmdc:mga06z11_7412_c1 nmdc:mga06z11_7412_c1_242_1129 295
993 3300050495 nmdc:mga04h51_43933_c1 nmdc:mga04h51_43933_c1_172_1113 295
994 3300050496 nmdc:mga07m45_19689_c1 nmdc:mga07m45_19689_c1_189_1079 295
995 3300050496 nmdc:mga07m45_25952_c1 nmdc:mga07m45_25952_c1_206_1093 295
996 3300050507 nmdc:mga05p37_338976_c1 nmdc:mga05p37_338976_c1_533_1420 295
997 3300050512 nmdc:mga0n895_2476_c1 nmdc:mga0n895_2476_c1_7044_7931 295
998 3300050512 nmdc:mga0n895_47793_c1 nmdc:mga0n895_47793_c1_2190_3077 295
999 3300050512 nmdc:mga0n895_95111_c1 nmdc:mga0n895_95111_c1_1115_2002 295
1000 3300050512 nmdc:mga0n895_95260_c1 nmdc:mga0n895_95260_c1_247_1134 295
1001 3300050513 nmdc:mga0rr50_82341_c1 nmdc:mga0rr50_82341_c1_734_1621 295
1002 3300050516 nmdc:mga0sz30_59207_c1 nmdc:mga0sz30_59207_c1_277_1167 295
1003 3300053077 Ga0495601_0047714 Ga0495601_0047714_865_1755 295
1004 3300053077 Ga0495601_0159031 Ga0495601_0159031_365_1252 295
1005 3300053078 Ga0495612_0045607 Ga0495612_0045607_785_1672 295
1006 3300053084 Ga0495595_0021212 Ga0495595_0021212_659_1714 295
1007 3300053084 Ga0495595_0032285 Ga0495595_0032285_194_1084 295
1008 3300053085 Ga0495619_0003855 Ga0495619_0003855_4556_5443 295
1009 3300053085 Ga0495619_0112518 Ga0495619_0112518_16_957 295
1010 3300053086 Ga0500578_0186649 Ga0500578_0186649_220_1110 295
1011 3300053093 Ga0500651_0018002 Ga0500651_0018002_118_1005 295
1012 3300053093 Ga0500651_0023015 Ga0500651_0023015_148_1035 295
1013 3300053094 Ga0500566_0007702 Ga0500566_0007702_5033_5920 295
1014 3300053094 Ga0500566_0033416 Ga0500566_0033416_1325_2215 295
1015 3300053094 Ga0500566_0043140 Ga0500566_0043140_98_1000 295
1016 3300053094 Ga0500566_0134479 Ga0500566_0134479_275_1162 295
1017 3300053095 Ga0500640_002809 Ga0500640_002809_3616_4503 295
1018 3300053105 Ga0500557_000057 Ga0500557_000057_38266_39156 295
1019 3300053105 Ga0500557_090483 Ga0500557_090483_107_997 295
1020 3300053109 Ga0500569_059070 Ga0500569_059070_273_1160 295
1021 3300053111 Ga0500572_001892 Ga0500572_001892_3140_4027 295
1022 3300053119 Ga0500595_004172 Ga0500595_004172_5107_5994 295
1023 3300053119 Ga0500595_009841 Ga0500595_009841_2589_3476 295
1024 3300053119 Ga0500595_022825 Ga0500595_022825_302_1204 295
1025 3300053121 Ga0500607_073306 Ga0500607_073306_482_1372 295
1026 3300053122 Ga0500608_068887 Ga0500608_068887_640_1530 295
1027 3300053130 Ga0500642_0000263 Ga0500642_0000263_18289_19179 295
1028 3300053136 Ga0500559_0049727 Ga0500559_0049727_306_1208 295
1029 3300053136 Ga0500559_0051797 Ga0500559_0051797_720_1607 295
1030 3300053136 Ga0500559_0055710 Ga0500559_0055710_620_1507 295
1031 3300053139 Ga0500568_0037793 Ga0500568_0037793_420_1310 295
1032 3300053140 Ga0500573_0045454 Ga0500573_0045454_1216_2118 295
1033 3300053142 Ga0500577_0000035 Ga0500577_0000035_13117_14004 295
1034 3300053150 Ga0500603_000335 Ga0500603_000335_8088_8975 295
1035 3300053150 Ga0500603_000740 Ga0500603_000740_6514_7401 295
1036 3300053150 Ga0500603_035785 Ga0500603_035785_161_1063 295
1037 3300053155 Ga0500620_005833 Ga0500620_005833_1032_1922 295
1038 3300053159 Ga0500630_016635 Ga0500630_016635_284_1171 295
1039 3300053162 Ga0500638_062254 Ga0500638_062254_85_987 295
1040 3300053163 Ga0500639_001074 Ga0500639_001074_238_1125 295
1041 3300053177 Ga0500636_0001378 Ga0500636_0001378_7278_8168 295
1042 3300053177 Ga0500636_0017028 Ga0500636_0017028_2278_3165 295
1043 3300053177 Ga0500636_0148333 Ga0500636_0148333_118_1020 295
1044 3300053725 Ga0500576_113008 Ga0500576_113008_59_946 295
1045 3300053728 Ga0500657_084075 Ga0500657_084075_406_1308 295
1046 3300053730 Ga0500645_065959 Ga0500645_065959_46_987 295
1047 3300053735 Ga0500596_001060 Ga0500596_001060_3276_4163 295
1048 3300053735 Ga0500596_004321 Ga0500596_004321_256_1158 295
1049 3300053737 Ga0500601_001101 Ga0500601_001101_2052_2942 295
1050 3300054114 Ga0501084_0005438 Ga0501084_0005438_4944_5831 295
1051 3300054114 Ga0501084_0036315 Ga0501084_0036315_2978_3865 295
1052 3300060353 Ga0501082_0018483 Ga0501082_0018483_714_1601 295
1053 3300060353 Ga0501082_0025748 Ga0501082_0025748_1414_2301 295
1054 iso_pu_bacteria 2507262055 2507504320 295
1055 iso_pu_bacteria 2513237096 2513655421 295
1056 iso_pu_bacteria 2513237137 2513860015 295
1057 iso_pu_bacteria 2513237145 2513916501 295
1058 iso_pu_bacteria 2517572143 2517889908 295
1059 iso_pu_bacteria 2524023228 2524532903 295
1060 iso_pu_bacteria 2617270741 2617374679 295
1061 iso_pu_bacteria 2667528175 2671121068 295
1062 iso_pu_bacteria 2791355197 2793068143 295
1063 iso_pu_bacteria 2791355199 2793078539 295
1064 iso_pu_bacteria 2935630451 2935633100 295
1065 iso_pu_bacteria 2941507105 2941509598 295
1066 iso_pu_bacteria 2941515067 2941517427 295
1067 iso_pu_bacteria 2941523033 2941526620 295
1068 iso_pu_bacteria 3005474847 3005476126 295
1069 iso_pu_bacteria 3005483717 3005486013 295
1070 iso_pu_bacteria 3005710791 3005717414 295
1071 iso_pu_bacteria 8006933436 8006937439 295
1072 iso_pu_bacteria 8006973647 8006977468 295
1073 iso_pu_bacteria 8016583857 8016587716 295
1074 iso_pu_bacteria 8019555841 8019561185 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05013

FGase

N-formylglutamate amidohydrolase

83

315

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q7s-assembly1.cif.gz_A crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.8329 9 280
2q7s-assembly1.cif.gz_A crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.8127 9 280
2q7s-assembly2.cif.gz_B crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.8109 9 280
2q7s-assembly2.cif.gz_B crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution 0.7864 9 280
2odf-assembly3.cif.gz_C the crystal structure of gene product atu2144 from agrobacterium tumefaciens 0.7553 9 281
ID Description Score Start End Superfamily
2q7sA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.8192 9 280 3.40.630.40
2q7sA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.799 9 280 3.40.630.40
af_Q21515_35_411_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7219 144 174 3.40.50.1820
2odfB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.7206 12 282 3.40.630.40
2odfB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.7155 12 282 3.40.630.40
ID Description Score Start End GO Terms
AF-A0A327VBP4-F1-model_v4 N-formylglutamate amidohydrolase 0.8897 125 278 GO:0016787
AF-A0A382QXK2-F1-model_v4 N-formylglutamate amidohydrolase 0.8855 152 283
AF-A0A7K3FDL9-F1-model_v4 deleted 0.8851 135 254
AF-A0A2G1YZ59-F1-model_v4 N-formylglutamate amidohydrolase 0.8753 155 282 GO:0016787
AF-A0A2G1YT19-F1-model_v4 deleted 0.8745 130 281

Feature Viewer

pLDDT pTM Quality
78.17 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map