F489538
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1074 | 568 | 890 | 298 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100035992|Ga0070683_1000359924 |
| Length | 356 |
| Sequence | MKGTVLEPPPRGVPDDIETFSLGRTAAITDNARSPKASRFWRHGPVQRSRPGRDPKGRRLTMIPFDGELPPPFEIVEPAEWRAPIIFNSPHSGSVYPEDFLNASRIDLPTLRRSEDSFMDELIADLAAHGFPVVRVNFPRSYVDVNREPYELDPRMFAGRLPSFANTRSMRVAGGLGTIPRVVGDGQEIYRERLSVDDALTRVETLYKPYHRALRRLINRVHQSFGTVVVVDCHSMPSIGVSRDEPRRPDIVIGDRYGTSCAPLLPNRVEQTMSRLGYSVGRNKPYAGGFITEHYGNPASGLHAIQLELNRAIYMDERRREKGPRFAQVAADFAALADALATVPFGDLGPFQAAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 12 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 13 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 14 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 15 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 16 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 17 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 18 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 19 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 20 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 21 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 22 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 23 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 24 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 25 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 26 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 27 | 2791355199 | |||
| 28 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 29 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 30 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 31 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 32 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 33 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 34 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 35 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 36 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 37 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 38 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 39 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 40 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 41 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 42 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 43 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 44 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 45 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 46 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 47 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 48 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 49 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 50 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 51 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 52 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 53 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 54 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 55 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 56 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 57 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 58 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 59 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 60 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 61 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 62 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 63 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 64 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 65 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 66 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 67 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 68 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 69 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 70 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 71 | 2904699407 | |||
| 72 | 2906610324 | |||
| 73 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 74 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 75 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 76 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 77 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 78 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 79 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 80 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 81 | 2922368715 | |||
| 82 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 83 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 84 | 2922425934 | |||
| 85 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 86 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 87 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 88 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 89 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 90 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 91 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 92 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 93 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 94 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 95 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 96 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 97 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 98 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 99 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 100 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 101 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 102 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 103 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 104 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 105 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 106 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 107 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 108 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 109 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 110 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 111 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 112 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 113 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 114 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 115 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 116 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 117 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 118 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 119 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 120 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 121 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 122 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 123 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 124 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 125 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 126 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 127 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 128 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 129 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 130 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 131 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 132 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 133 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 134 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 135 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 136 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 137 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 138 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 139 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 140 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 141 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 142 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 143 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 144 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 145 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 146 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 147 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 148 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 149 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 150 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 151 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 152 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 153 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 154 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 155 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 156 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 157 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 158 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 159 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 161 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 162 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 163 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 164 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 171 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 173 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 174 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 175 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 178 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 182 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 183 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 184 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 185 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 186 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 187 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 189 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 191 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 192 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 193 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 194 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 195 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 196 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 197 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 198 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 199 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 200 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 201 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 202 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 204 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 205 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 206 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 207 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 208 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 209 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 210 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 211 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 212 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 213 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 215 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 216 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 217 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 218 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 219 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 220 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 221 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 222 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 223 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 224 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 225 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 226 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 227 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 232 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 234 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 235 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 236 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 237 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 244 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 245 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 246 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 247 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 248 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 249 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 250 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 251 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 254 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 306 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 307 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 308 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 309 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 314 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 315 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 316 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 317 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 318 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 319 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 320 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 321 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 322 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 323 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 324 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 325 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 326 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 327 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 328 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 329 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 330 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 331 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 332 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 333 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 334 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 335 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 336 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 337 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 338 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 339 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 340 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 341 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 342 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 343 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 344 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 345 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 346 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 347 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 348 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 349 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 350 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 351 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 352 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 353 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 354 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 355 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 356 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 357 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 358 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 359 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 360 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 361 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 362 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 363 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 364 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 365 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 366 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 367 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 368 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 369 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 370 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 371 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 372 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 373 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 374 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 375 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 376 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 440 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 441 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 442 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 443 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 444 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 445 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 446 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 447 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 448 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 449 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 450 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 451 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 452 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 453 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 454 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 455 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 456 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 457 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 458 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 459 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 460 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 461 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 462 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 463 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 464 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 482 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 491 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 493 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 494 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 495 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 496 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 497 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 498 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 499 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 500 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 504 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 509 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 510 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 511 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 512 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 513 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 514 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 515 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 516 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 517 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 518 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 519 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 520 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 521 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 522 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 523 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 524 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 525 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 526 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 527 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 528 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 529 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 530 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 531 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 532 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 533 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 534 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 535 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 536 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 537 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 538 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 539 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 540 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 541 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 542 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 543 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 544 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 545 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 546 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 547 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 548 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 549 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 550 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 551 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 552 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 553 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 554 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 555 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 556 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 557 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 558 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 559 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 560 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 561 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 562 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 563 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 564 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 565 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 566 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 567 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 568 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.26 |
| Metatranscriptomes | 0 |
| Isolates | 16.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.94 |
| Nodule | 14.53 |
| Rhizoplane | 7.54 |
| Rhizosphere | 59.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10006073 | 3300003203 | Bacteria | 5580 |
| 2 | JGI25153J46596_10004803 | 3300003215 | Bacteria | 7199 |
| 3 | JGI25153J46596_10028115 | 3300003215 | Bacteria | 1957 |
| 4 | JGI25160J50197_1024331 | 3300003354 | Bacteria | 1720 |
| 5 | JGI25404J52841_10001048 | 3300003659 | Bacteria | 4603 |
| 6 | Ga0055531_10020619 | 3300003794 | Bacteria | 2599 |
| 7 | Ga0055543_1012260 | 3300004625 | Bacteria | 1730 |
| 8 | Ga0065165_1030520 | 3300005262 | Bacteria | 1713 |
| 9 | Ga0070658_10011197 | 3300005327 | Bacteria | 7189 |
| 10 | Ga0070658_10064095 | 3300005327 | Bacteria | 2997 |
| 11 | Ga0070658_10355905 | 3300005327 | Bacteria | 1253 |
| 12 | Ga0070683_100035992 | 3300005329 | Bacteria | 4528 |
| 13 | Ga0070683_100046881 | 3300005329 | Bacteria | 3994 |
| 14 | Ga0070683_100110710 | 3300005329 | Bacteria | 2590 |
| 15 | Ga0070680_100020407 | 3300005336 | Bacteria | 5259 |
| 16 | Ga0070680_100034052 | 3300005336 | Bacteria | 4107 |
| 17 | Ga0070680_100104526 | 3300005336 | Bacteria | 2353 |
| 18 | Ga0070680_100132343 | 3300005336 | Bacteria | 2087 |
| 19 | Ga0070682_100294312 | 3300005337 | Bacteria | 1188 |
| 20 | Ga0068868_100235674 | 3300005338 | Bacteria | 1536 |
| 21 | Ga0070660_100019955 | 3300005339 | Bacteria | 4917 |
| 22 | Ga0070660_100052201 | 3300005339 | Bacteria | 3151 |
| 23 | Ga0070668_100110800 | 3300005347 | Bacteria | 2184 |
| 24 | Ga0070671_100166203 | 3300005355 | Bacteria | 1866 |
| 25 | Ga0070671_100307646 | 3300005355 | Bacteria | 1350 |
| 26 | Ga0070674_100170542 | 3300005356 | Bacteria | 1659 |
| 27 | Ga0070659_100128407 | 3300005366 | Bacteria | 2057 |
| 28 | Ga0070667_100143556 | 3300005367 | Bacteria | 2092 |
| 29 | Ga0070709_10009651 | 3300005434 | Bacteria | 5330 |
| 30 | Ga0070709_10056134 | 3300005434 | Bacteria | 2489 |
| 31 | Ga0070709_10116826 | 3300005434 | Bacteria | 1802 |
| 32 | Ga0070714_100169165 | 3300005435 | Bacteria | 1982 |
| 33 | Ga0070713_100007733 | 3300005436 | Bacteria | 7568 |
| 34 | Ga0070713_100044539 | 3300005436 | Bacteria | 3632 |
| 35 | Ga0070713_100056937 | 3300005436 | Bacteria | 3252 |
| 36 | Ga0070713_100593325 | 3300005436 | Bacteria | 1052 |
| 37 | Ga0070710_10000707 | 3300005437 | Bacteria | 15878 |
| 38 | Ga0070710_10015339 | 3300005437 | Bacteria | 3876 |
| 39 | Ga0070701_10146990 | 3300005438 | Bacteria | 1353 |
| 40 | Ga0070711_100006676 | 3300005439 | Bacteria | 6977 |
| 41 | Ga0070711_100016881 | 3300005439 | Bacteria | 4641 |
| 42 | Ga0070711_100067059 | 3300005439 | Bacteria | 2516 |
| 43 | Ga0070711_100380914 | 3300005439 | Bacteria | 1141 |
| 44 | Ga0070705_100096817 | 3300005440 | Bacteria | 1853 |
| 45 | Ga0070700_100420737 | 3300005441 | Bacteria | 1009 |
| 46 | Ga0070708_100685664 | 3300005445 | Bacteria | 965 |
| 47 | Ga0070663_100049756 | 3300005455 | Bacteria | 2978 |
| 48 | Ga0070678_100067611 | 3300005456 | Bacteria | 2660 |
| 49 | Ga0070678_100112722 | 3300005456 | Bacteria | 2130 |
| 50 | Ga0070681_10209901 | 3300005458 | Bacteria | 1863 |
| 51 | Ga0070698_100154937 | 3300005471 | Bacteria | 2237 |
| 52 | Ga0070679_100020129 | 3300005530 | Bacteria | 6502 |
| 53 | Ga0070679_100042976 | 3300005530 | Bacteria | 4501 |
| 54 | Ga0070679_100445048 | 3300005530 | Bacteria | 1240 |
| 55 | Ga0070684_100018149 | 3300005535 | Bacteria | 5789 |
| 56 | Ga0070684_100021264 | 3300005535 | Bacteria | 5395 |
| 57 | Ga0070684_100083447 | 3300005535 | Bacteria | 2831 |
| 58 | Ga0070684_100252410 | 3300005535 | Bacteria | 1612 |
| 59 | Ga0070697_100090441 | 3300005536 | Bacteria | 2530 |
| 60 | Ga0070697_100326297 | 3300005536 | Bacteria | 1322 |
| 61 | Ga0068853_100007083 | 3300005539 | Bacteria | 8970 |
| 62 | Ga0068853_100007085 | 3300005539 | Bacteria | 8969 |
| 63 | Ga0068853_100082352 | 3300005539 | Bacteria | 2818 |
| 64 | Ga0068853_100097672 | 3300005539 | Bacteria | 2593 |
| 65 | Ga0068853_100289547 | 3300005539 | Bacteria | 1512 |
| 66 | Ga0070665_100038638 | 3300005548 | Bacteria | 4798 |
| 67 | Ga0070665_100176196 | 3300005548 | Bacteria | 2139 |
| 68 | Ga0070665_100176978 | 3300005548 | Bacteria | 2134 |
| 69 | Ga0070665_100197527 | 3300005548 | Bacteria | 2012 |
| 70 | Ga0070665_100286751 | 3300005548 | Bacteria | 1648 |
| 71 | Ga0070665_100430113 | 3300005548 | Bacteria | 1329 |
| 72 | Ga0068855_100048105 | 3300005563 | Bacteria | 5035 |
| 73 | Ga0068855_100054394 | 3300005563 | Bacteria | 4704 |
| 74 | Ga0068855_100064837 | 3300005563 | Bacteria | 4260 |
| 75 | Ga0068855_100113485 | 3300005563 | Bacteria | 3108 |
| 76 | Ga0068855_100488585 | 3300005563 | Bacteria | 1339 |
| 77 | Ga0068855_100512354 | 3300005563 | Bacteria | 1302 |
| 78 | Ga0070664_100222862 | 3300005564 | Bacteria | 1688 |
| 79 | Ga0070664_100268983 | 3300005564 | Bacteria | 1535 |
| 80 | Ga0068857_100045081 | 3300005577 | Bacteria | 3912 |
| 81 | Ga0068857_100110228 | 3300005577 | Bacteria | 2473 |
| 82 | Ga0068854_100126267 | 3300005578 | Bacteria | 1948 |
| 83 | Ga0068856_100000522 | 3300005614 | Bacteria | 42457 |
| 84 | Ga0068856_100010527 | 3300005614 | Bacteria | 8980 |
| 85 | Ga0068856_100172156 | 3300005614 | Bacteria | 2177 |
| 86 | Ga0068856_100265444 | 3300005614 | Bacteria | 1732 |
| 87 | Ga0068856_100426722 | 3300005614 | Bacteria | 1346 |
| 88 | Ga0068852_100021761 | 3300005616 | Bacteria | 5129 |
| 89 | Ga0068852_100041617 | 3300005616 | Bacteria | 3884 |
| 90 | Ga0068852_100047847 | 3300005616 | Bacteria | 3651 |
| 91 | Ga0068852_100365435 | 3300005616 | Bacteria | 1412 |
| 92 | Ga0068864_100037310 | 3300005618 | Bacteria | 4147 |
| 93 | Ga0068864_100159098 | 3300005618 | Bacteria | 2052 |
| 94 | Ga0068864_100200349 | 3300005618 | Bacteria | 1833 |
| 95 | Ga0068861_100222100 | 3300005719 | Bacteria | 1597 |
| 96 | Ga0068861_100517647 | 3300005719 | Bacteria | 1081 |
| 97 | Ga0068863_100119367 | 3300005841 | Bacteria | 2514 |
| 98 | Ga0068858_100150021 | 3300005842 | Bacteria | 2192 |
| 99 | Ga0068858_100183632 | 3300005842 | Bacteria | 1975 |
| 100 | Ga0068858_100339526 | 3300005842 | Bacteria | 1437 |
| 101 | Ga0068860_100000441 | 3300005843 | Bacteria | 52446 |
| 102 | Ga0068860_100177701 | 3300005843 | Bacteria | 2057 |
| 103 | Ga0081455_10034005 | 3300005937 | Bacteria | 4573 |
| 104 | Ga0081455_10105365 | 3300005937 | Bacteria | 2254 |
| 105 | Ga0081540_1017509 | 3300005983 | Bacteria | 4433 |
| 106 | Ga0081540_1018219 | 3300005983 | Bacteria | 4316 |
| 107 | Ga0081540_1025852 | 3300005983 | Bacteria | 3367 |
| 108 | Ga0081540_1026432 | 3300005983 | Bacteria | 3313 |
| 109 | Ga0081540_1048367 | 3300005983 | Bacteria | 2131 |
| 110 | Ga0081540_1048528 | 3300005983 | Bacteria | 2126 |
| 111 | Ga0081539_10000425 | 3300005985 | Bacteria | 89942 |
| 112 | Ga0081539_10001114 | 3300005985 | Bacteria | 48756 |
| 113 | Ga0081539_10032892 | 3300005985 | Bacteria | 3168 |
| 114 | Ga0081539_10053402 | 3300005985 | Bacteria | 2263 |
| 115 | Ga0070717_10000325 | 3300006028 | Bacteria | 31034 |
| 116 | Ga0070717_10123243 | 3300006028 | Bacteria | 2222 |
| 117 | Ga0070717_10147620 | 3300006028 | Bacteria | 2032 |
| 118 | Ga0075365_10128266 | 3300006038 | Bacteria | 1754 |
| 119 | Ga0075365_10183961 | 3300006038 | Bacteria | 1461 |
| 120 | Ga0075363_100012045 | 3300006048 | Bacteria | 4157 |
| 121 | Ga0075363_100064202 | 3300006048 | Bacteria | 1983 |
| 122 | Ga0075363_100100340 | 3300006048 | Bacteria | 1601 |
| 123 | Ga0075364_10083494 | 3300006051 | Bacteria | 2114 |
| 124 | Ga0075364_10207465 | 3300006051 | Bacteria | 1328 |
| 125 | Ga0070715_10026071 | 3300006163 | Bacteria | 2321 |
| 126 | Ga0070716_100005608 | 3300006173 | Bacteria | 6093 |
| 127 | Ga0070716_100019072 | 3300006173 | Bacteria | 3581 |
| 128 | Ga0070712_100087985 | 3300006175 | Bacteria | 2268 |
| 129 | Ga0070712_100089696 | 3300006175 | Bacteria | 2249 |
| 130 | Ga0075362_10055144 | 3300006177 | Bacteria | 1788 |
| 131 | Ga0075367_10067480 | 3300006178 | Bacteria | 2144 |
| 132 | Ga0075367_10136013 | 3300006178 | Bacteria | 1520 |
| 133 | Ga0075367_10222803 | 3300006178 | Bacteria | 1181 |
| 134 | Ga0075369_10042648 | 3300006186 | Bacteria | 1945 |
| 135 | Ga0075366_10107625 | 3300006195 | Bacteria | 1676 |
| 136 | Ga0097621_100143110 | 3300006237 | Bacteria | 2045 |
| 137 | Ga0075370_10087982 | 3300006353 | Bacteria | 1790 |
| 138 | Ga0075370_10118448 | 3300006353 | Bacteria | 1540 |
| 139 | Ga0068871_100158319 | 3300006358 | Bacteria | 1935 |
| 140 | Ga0068871_100211502 | 3300006358 | Bacteria | 1677 |
| 141 | Ga0075434_100004469 | 3300006871 | Bacteria | 12614 |
| 142 | Ga0075434_100096067 | 3300006871 | Bacteria | 2969 |
| 143 | Ga0075434_100362343 | 3300006871 | Bacteria | 1471 |
| 144 | Ga0068865_100073449 | 3300006881 | Bacteria | 2432 |
| 145 | Ga0099825_1020668 | 3300006941 | Bacteria | 4628 |
| 146 | Ga0099824_1035813 | 3300006942 | Bacteria | 1485 |
| 147 | Ga0099822_1007626 | 3300006943 | Bacteria | 13973 |
| 148 | Ga0099822_1056766 | 3300006943 | Bacteria | 1415 |
| 149 | Ga0099823_1072928 | 3300006944 | Bacteria | 1483 |
| 150 | Ga0099794_10012991 | 3300007265 | Bacteria | 3613 |
| 151 | Ga0099795_10025691 | 3300007788 | Bacteria | 1977 |
| 152 | Ga0105240_10002968 | 3300009093 | Bacteria | 26700 |
| 153 | Ga0105240_10017804 | 3300009093 | Bacteria | 9563 |
| 154 | Ga0105240_10190410 | 3300009093 | Bacteria | 2413 |
| 155 | Ga0105240_10227269 | 3300009093 | Bacteria | 2171 |
| 156 | Ga0105240_10407263 | 3300009093 | Bacteria | 1530 |
| 157 | Ga0105247_10043858 | 3300009101 | Bacteria | 2741 |
| 158 | Ga0105241_10001388 | 3300009174 | Bacteria | 18512 |
| 159 | Ga0105248_10269872 | 3300009177 | Bacteria | 1916 |
| 160 | Ga0105248_10496058 | 3300009177 | Bacteria | 1376 |
| 161 | Ga0105237_10020853 | 3300009545 | Bacteria | 6748 |
| 162 | Ga0105237_10123107 | 3300009545 | Bacteria | 2588 |
| 163 | Ga0105237_10208382 | 3300009545 | Bacteria | 1955 |
| 164 | Ga0105237_10237353 | 3300009545 | Bacteria | 1824 |
| 165 | Ga0105237_10341691 | 3300009545 | Bacteria | 1501 |
| 166 | Ga0105238_10010451 | 3300009551 | Bacteria | 9315 |
| 167 | Ga0105238_10025037 | 3300009551 | Bacteria | 6083 |
| 168 | Ga0105238_10066453 | 3300009551 | Bacteria | 3607 |
| 169 | Ga0105238_10334186 | 3300009551 | Bacteria | 1502 |
| 170 | Ga0105238_10451722 | 3300009551 | Bacteria | 1282 |
| 171 | Ga0105238_10680530 | 3300009551 | Bacteria | 1040 |
| 172 | Ga0105249_10194985 | 3300009553 | Bacteria | 1979 |
| 173 | Ga0105249_10361636 | 3300009553 | Bacteria | 1473 |
| 174 | Ga0099796_10038085 | 3300010159 | Bacteria | 1611 |
| 175 | Ga0099796_10082867 | 3300010159 | Bacteria | 1179 |
| 176 | Ga0105239_10131032 | 3300010375 | Bacteria | 2789 |
| 177 | Ga0105239_10201586 | 3300010375 | Bacteria | 2229 |
| 178 | Ga0105239_10276817 | 3300010375 | Bacteria | 1888 |
| 179 | Ga0157371_10015904 | 3300013102 | Bacteria | 5627 |
| 180 | Ga0157370_10108237 | 3300013104 | Bacteria | 2599 |
| 181 | Ga0157370_10124721 | 3300013104 | Bacteria | 2404 |
| 182 | Ga0157370_10180609 | 3300013104 | Bacteria | 1961 |
| 183 | Ga0157369_10009007 | 3300013105 | Bacteria | 11431 |
| 184 | Ga0157369_10009927 | 3300013105 | Bacteria | 10878 |
| 185 | Ga0157369_10218728 | 3300013105 | Bacteria | 1994 |
| 186 | Ga0157369_10343522 | 3300013105 | Bacteria | 1550 |
| 187 | Ga0157374_10041978 | 3300013296 | Bacteria | 4218 |
| 188 | Ga0163162_10149747 | 3300013306 | Bacteria | 2450 |
| 189 | Ga0157372_10079888 | 3300013307 | Bacteria | 3700 |
| 190 | Ga0157372_10310985 | 3300013307 | Bacteria | 1834 |
| 191 | Ga0157372_10363327 | 3300013307 | Bacteria | 1687 |
| 192 | Ga0157372_10418999 | 3300013307 | Bacteria | 1561 |
| 193 | Ga0157372_10453038 | 3300013307 | Bacteria | 1495 |
| 194 | Ga0157375_10133986 | 3300013308 | Bacteria | 2599 |
| 195 | Ga0157375_10212208 | 3300013308 | Bacteria | 2094 |
| 196 | Ga0163163_10081730 | 3300014325 | Bacteria | 3233 |
| 197 | Ga0163163_10230508 | 3300014325 | Bacteria | 1901 |
| 198 | Ga0157377_10091376 | 3300014745 | Bacteria | 1798 |
| 199 | Ga0157376_10110571 | 3300014969 | Bacteria | 2418 |
| 200 | Ga0157376_10311911 | 3300014969 | Bacteria | 1493 |
| 201 | Ga0214544_1000011 | 3300021320 | Bacteria | 262952 |
| 202 | Ga0214542_1000009 | 3300021321 | Bacteria | 262861 |
| 203 | Ga0214545_1000007 | 3300021324 | Bacteria | 262984 |
| 204 | Ga0214543_1000020 | 3300021327 | Bacteria | 262861 |
| 205 | Ga0213872_10019823 | 3300021361 | Bacteria | 3097 |
| 206 | Ga0213874_10013098 | 3300021377 | Bacteria | 2141 |
| 207 | Ga0213874_10013163 | 3300021377 | Bacteria | 2137 |
| 208 | Ga0213876_10001735 | 3300021384 | Bacteria | 13237 |
| 209 | Ga0228598_1032947 | 3300024227 | Bacteria | 1021 |
| 210 | Ga0209677_100470 | 3300025253 | Bacteria | 23130 |
| 211 | Ga0209455_1007332 | 3300025272 | Bacteria | 3128 |
| 212 | Ga0209564_1008389 | 3300025295 | Bacteria | 5104 |
| 213 | Ga0209758_1000106 | 3300025297 | Bacteria | 218450 |
| 214 | Ga0209758_1001683 | 3300025297 | Bacteria | 24919 |
| 215 | Ga0209758_1002332 | 3300025297 | Bacteria | 19594 |
| 216 | Ga0209758_1006430 | 3300025297 | Bacteria | 8450 |
| 217 | Ga0209758_1037291 | 3300025297 | Bacteria | 1881 |
| 218 | Ga0209050_1022586 | 3300025298 | Bacteria | 2249 |
| 219 | Ga0207426_1003263 | 3300025302 | Bacteria | 9067 |
| 220 | Ga0209257_1001741 | 3300025304 | Bacteria | 24170 |
| 221 | Ga0207656_10034217 | 3300025321 | Bacteria | 2121 |
| 222 | Ga0207692_10005117 | 3300025898 | Bacteria | 5231 |
| 223 | Ga0207692_10008782 | 3300025898 | Bacteria | 4196 |
| 224 | Ga0207692_10063539 | 3300025898 | Bacteria | 1919 |
| 225 | Ga0207710_10011534 | 3300025900 | Bacteria | 3719 |
| 226 | Ga0207710_10072188 | 3300025900 | Bacteria | 1585 |
| 227 | Ga0207710_10126377 | 3300025900 | Bacteria | 1225 |
| 228 | Ga0207680_10164264 | 3300025903 | Bacteria | 1491 |
| 229 | Ga0207685_10003939 | 3300025905 | Bacteria | 3692 |
| 230 | Ga0207685_10015299 | 3300025905 | Bacteria | 2428 |
| 231 | Ga0207699_10000740 | 3300025906 | Bacteria | 15576 |
| 232 | Ga0207699_10006844 | 3300025906 | Bacteria | 5545 |
| 233 | Ga0207699_10055566 | 3300025906 | Bacteria | 2356 |
| 234 | Ga0207705_10038645 | 3300025909 | Bacteria | 3418 |
| 235 | Ga0207684_10262085 | 3300025910 | Bacteria | 1491 |
| 236 | Ga0207654_10000729 | 3300025911 | Bacteria | 18348 |
| 237 | Ga0207654_10184902 | 3300025911 | Bacteria | 1362 |
| 238 | Ga0207707_10000541 | 3300025912 | Bacteria | 38481 |
| 239 | Ga0207707_10000582 | 3300025912 | Bacteria | 37091 |
| 240 | Ga0207707_10064900 | 3300025912 | Bacteria | 3179 |
| 241 | Ga0207695_10000478 | 3300025913 | Bacteria | 86076 |
| 242 | Ga0207695_10004497 | 3300025913 | Bacteria | 18978 |
| 243 | Ga0207695_10018101 | 3300025913 | Bacteria | 8154 |
| 244 | Ga0207695_10031949 | 3300025913 | Bacteria | 5766 |
| 245 | Ga0207671_10003084 | 3300025914 | Bacteria | 17008 |
| 246 | Ga0207671_10030076 | 3300025914 | Bacteria | 4051 |
| 247 | Ga0207671_10044416 | 3300025914 | Bacteria | 3287 |
| 248 | Ga0207671_10156052 | 3300025914 | Bacteria | 1765 |
| 249 | Ga0207671_10162138 | 3300025914 | Bacteria | 1732 |
| 250 | Ga0207671_10183495 | 3300025914 | Bacteria | 1629 |
| 251 | Ga0207693_10005512 | 3300025915 | Bacteria | 10533 |
| 252 | Ga0207693_10008208 | 3300025915 | Bacteria | 8554 |
| 253 | Ga0207693_10014476 | 3300025915 | Bacteria | 6340 |
| 254 | Ga0207693_10090801 | 3300025915 | Bacteria | 2394 |
| 255 | Ga0207693_10105078 | 3300025915 | Bacteria | 2214 |
| 256 | Ga0207693_10288729 | 3300025915 | Bacteria | 1285 |
| 257 | Ga0207663_10000425 | 3300025916 | Bacteria | 18308 |
| 258 | Ga0207663_10057794 | 3300025916 | Bacteria | 2445 |
| 259 | Ga0207663_10072056 | 3300025916 | Bacteria | 2232 |
| 260 | Ga0207663_10110833 | 3300025916 | Bacteria | 1862 |
| 261 | Ga0207663_10138454 | 3300025916 | Bacteria | 1692 |
| 262 | Ga0207660_10022911 | 3300025917 | Bacteria | 4211 |
| 263 | Ga0207660_10074692 | 3300025917 | Bacteria | 2475 |
| 264 | Ga0207657_10002950 | 3300025919 | Bacteria | 18254 |
| 265 | Ga0207657_10136726 | 3300025919 | Bacteria | 2005 |
| 266 | Ga0207649_10123275 | 3300025920 | Bacteria | 1750 |
| 267 | Ga0207652_10004959 | 3300025921 | Bacteria | 10782 |
| 268 | Ga0207652_10005910 | 3300025921 | Bacteria | 9899 |
| 269 | Ga0207652_10138958 | 3300025921 | Bacteria | 2171 |
| 270 | Ga0207681_10136395 | 3300025923 | Bacteria | 1822 |
| 271 | Ga0207681_10277034 | 3300025923 | Bacteria | 1319 |
| 272 | Ga0207694_10000849 | 3300025924 | Bacteria | 27168 |
| 273 | Ga0207694_10015749 | 3300025924 | Bacteria | 5703 |
| 274 | Ga0207694_10159501 | 3300025924 | Bacteria | 1821 |
| 275 | Ga0207694_10433030 | 3300025924 | Bacteria | 1096 |
| 276 | Ga0207687_10320813 | 3300025927 | Bacteria | 1254 |
| 277 | Ga0207700_10004824 | 3300025928 | Bacteria | 8005 |
| 278 | Ga0207700_10107598 | 3300025928 | Bacteria | 2238 |
| 279 | Ga0207700_10308074 | 3300025928 | Bacteria | 1369 |
| 280 | Ga0207664_10150991 | 3300025929 | Bacteria | 1973 |
| 281 | Ga0207664_10293691 | 3300025929 | Bacteria | 1429 |
| 282 | Ga0207644_10160881 | 3300025931 | Bacteria | 1745 |
| 283 | Ga0207644_10200252 | 3300025931 | Bacteria | 1575 |
| 284 | Ga0207690_10112687 | 3300025932 | Bacteria | 1962 |
| 285 | Ga0207690_10151692 | 3300025932 | Bacteria | 1718 |
| 286 | Ga0207669_10014908 | 3300025937 | Bacteria | 3909 |
| 287 | Ga0207704_10009478 | 3300025938 | Bacteria | 4700 |
| 288 | Ga0207665_10003367 | 3300025939 | Bacteria | 10702 |
| 289 | Ga0207665_10003573 | 3300025939 | Bacteria | 10395 |
| 290 | Ga0207691_10412079 | 3300025940 | Bacteria | 1152 |
| 291 | Ga0207711_10293994 | 3300025941 | Bacteria | 1497 |
| 292 | Ga0207689_10155732 | 3300025942 | Bacteria | 1884 |
| 293 | Ga0207689_10174428 | 3300025942 | Bacteria | 1773 |
| 294 | Ga0207689_10343299 | 3300025942 | Bacteria | 1240 |
| 295 | Ga0207661_10000109 | 3300025944 | Bacteria | 52179 |
| 296 | Ga0207661_10081608 | 3300025944 | Bacteria | 2671 |
| 297 | Ga0207667_10021686 | 3300025949 | Bacteria | 7116 |
| 298 | Ga0207667_10083996 | 3300025949 | Bacteria | 3297 |
| 299 | Ga0207667_10123692 | 3300025949 | Bacteria | 2665 |
| 300 | Ga0207667_10125735 | 3300025949 | Bacteria | 2641 |
| 301 | Ga0207667_10215053 | 3300025949 | Bacteria | 1970 |
| 302 | Ga0207667_10432994 | 3300025949 | Bacteria | 1338 |
| 303 | Ga0207667_10481998 | 3300025949 | Bacteria | 1259 |
| 304 | Ga0207668_10015127 | 3300025972 | Bacteria | 4789 |
| 305 | Ga0207668_10405550 | 3300025972 | Bacteria | 1153 |
| 306 | Ga0207640_10053654 | 3300025981 | Bacteria | 2632 |
| 307 | Ga0207677_10067744 | 3300026023 | Bacteria | 2502 |
| 308 | Ga0207677_10080223 | 3300026023 | Bacteria | 2337 |
| 309 | Ga0207703_10087840 | 3300026035 | Bacteria | 2608 |
| 310 | Ga0207703_10104833 | 3300026035 | Bacteria | 2403 |
| 311 | Ga0207703_10253798 | 3300026035 | Bacteria | 1586 |
| 312 | Ga0207703_10425232 | 3300026035 | Bacteria | 1237 |
| 313 | Ga0207703_10471963 | 3300026035 | Bacteria | 1175 |
| 314 | Ga0207639_10007486 | 3300026041 | Bacteria | 7448 |
| 315 | Ga0207639_10032132 | 3300026041 | Bacteria | 3862 |
| 316 | Ga0207639_10223000 | 3300026041 | Bacteria | 1629 |
| 317 | Ga0207639_10260091 | 3300026041 | Bacteria | 1518 |
| 318 | Ga0207639_10312378 | 3300026041 | Bacteria | 1393 |
| 319 | Ga0207678_10046082 | 3300026067 | Bacteria | 3771 |
| 320 | Ga0207678_10148445 | 3300026067 | Bacteria | 2001 |
| 321 | Ga0207678_10195442 | 3300026067 | Bacteria | 1729 |
| 322 | Ga0207708_10106601 | 3300026075 | Bacteria | 2173 |
| 323 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 324 | Ga0207702_10000014 | 3300026078 | Bacteria | 253304 |
| 325 | Ga0207702_10254153 | 3300026078 | Bacteria | 1652 |
| 326 | Ga0207702_10681322 | 3300026078 | Bacteria | 1012 |
| 327 | Ga0207641_10574202 | 3300026088 | Bacteria | 1102 |
| 328 | Ga0207648_10106662 | 3300026089 | Bacteria | 2458 |
| 329 | Ga0207676_10059522 | 3300026095 | Bacteria | 3017 |
| 330 | Ga0207676_10284789 | 3300026095 | Bacteria | 1502 |
| 331 | Ga0207674_10012928 | 3300026116 | Bacteria | 9309 |
| 332 | Ga0207674_10057148 | 3300026116 | Bacteria | 3956 |
| 333 | Ga0207674_10065509 | 3300026116 | Bacteria | 3662 |
| 334 | Ga0207674_10108590 | 3300026116 | Bacteria | 2751 |
| 335 | Ga0207683_10117668 | 3300026121 | Bacteria | 2383 |
| 336 | Ga0207683_10220341 | 3300026121 | Bacteria | 1729 |
| 337 | Ga0207698_10063823 | 3300026142 | Bacteria | 2884 |
| 338 | Ga0207698_10159850 | 3300026142 | Bacteria | 1969 |
| 339 | Ga0209389_1000016 | 3300027296 | Bacteria | 184844 |
| 340 | Ga0209389_1000027 | 3300027296 | Bacteria | 146917 |
| 341 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 342 | Ga0209589_1000031 | 3300027357 | Bacteria | 147054 |
| 343 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 344 | Ga0209489_100057 | 3300027361 | Bacteria | 147398 |
| 345 | Ga0209489_100063 | 3300027361 | Bacteria | 144408 |
| 346 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 347 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 348 | Ga0209588_1004211 | 3300027671 | Bacteria | 4044 |
| 349 | Ga0268266_10001346 | 3300028379 | Bacteria | 29681 |
| 350 | Ga0268266_10068805 | 3300028379 | Bacteria | 3066 |
| 351 | Ga0268266_10199533 | 3300028379 | Bacteria | 1830 |
| 352 | Ga0268266_10548464 | 3300028379 | Bacteria | 1107 |
| 353 | Ga0268265_10034105 | 3300028380 | Bacteria | 3707 |
| 354 | Ga0268265_10199546 | 3300028380 | Bacteria | 1734 |
| 355 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 356 | Ga0268264_10135286 | 3300028381 | Bacteria | 2190 |
| 357 | Ga0268264_10198150 | 3300028381 | Bacteria | 1835 |
| 358 | Ga0265337_1045356 | 3300028556 | Bacteria | 1251 |
| 359 | Ga0265336_10000348 | 3300028666 | Bacteria | 30334 |
| 360 | Ga0307517_10000176 | 3300028786 | Bacteria | 105402 |
| 361 | Ga0307515_10317759 | 3300028794 | Bacteria | 1226 |
| 362 | Ga0265338_10000018 | 3300028800 | Bacteria | 338910 |
| 363 | Ga0307511_10050299 | 3300030521 | Bacteria | 3358 |
| 364 | Ga0265332_10016978 | 3300031238 | Bacteria | 3211 |
| 365 | Ga0265328_10001180 | 3300031239 | Bacteria | 12085 |
| 366 | Ga0265339_10000383 | 3300031249 | Bacteria | 34934 |
| 367 | Ga0265316_10103031 | 3300031344 | Bacteria | 2167 |
| 368 | Ga0307509_10025042 | 3300031507 | Bacteria | 6669 |
| 369 | Ga0307509_10251156 | 3300031507 | Bacteria | 1552 |
| 370 | Ga0307509_10333330 | 3300031507 | Bacteria | 1248 |
| 371 | Ga0307508_10000029 | 3300031616 | Bacteria | 168411 |
| 372 | Ga0307508_10024413 | 3300031616 | Bacteria | 5486 |
| 373 | Ga0265314_10010200 | 3300031711 | Bacteria | 7866 |
| 374 | Ga0265314_10229713 | 3300031711 | Bacteria | 1077 |
| 375 | Ga0265342_10055988 | 3300031712 | Bacteria | 2339 |
| 376 | Ga0307516_10088341 | 3300031730 | Bacteria | 2932 |
| 377 | Ga0307516_10161240 | 3300031730 | Bacteria | 1992 |
| 378 | Ga0307412_10204058 | 3300031911 | Bacteria | 1503 |
| 379 | Ga0307409_100317876 | 3300031995 | Bacteria | 1456 |
| 380 | Ga0307414_10178805 | 3300032004 | Bacteria | 1704 |
| 381 | Ga0307415_100123019 | 3300032126 | Bacteria | 1949 |
| 382 | Ga0307507_10021924 | 3300033179 | Bacteria | 7087 |
| 383 | Ga0307510_10024826 | 3300033180 | Bacteria | 6921 |
| 384 | Ga0307510_10026321 | 3300033180 | Bacteria | 6688 |
| 385 | Ga0307510_10138078 | 3300033180 | Bacteria | 2089 |
| 386 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 387 | Ga0373926_0060001 | 3300035083 | Bacteria | 1385 |
| 388 | Ga0373934_0018347 | 3300035086 | Bacteria | 2676 |
| 389 | Ga0373934_0056364 | 3300035086 | Bacteria | 1563 |
| 390 | Ga0373923_0010360 | 3300035111 | Bacteria | 3389 |
| 391 | Ga0373923_0070889 | 3300035111 | Bacteria | 1496 |
| 392 | Ga0373932_0076262 | 3300035112 | Bacteria | 1050 |
| 393 | Ga0373936_0006737 | 3300035113 | Bacteria | 4323 |
| 394 | Ga0373936_0085224 | 3300035113 | Bacteria | 1319 |
| 395 | Ga0373936_0114482 | 3300035113 | Bacteria | 1147 |
| 396 | Ga0373945_0016664 | 3300035116 | Bacteria | 2481 |
| 397 | Ga0373953_0009510 | 3300035117 | Bacteria | 3349 |
| 398 | Ga0373954_0002278 | 3300035118 | Bacteria | 7991 |
| 399 | Ga0373954_0009920 | 3300035118 | Bacteria | 4193 |
| 400 | Ga0373956_0004148 | 3300035119 | Bacteria | 5813 |
| 401 | Ga0373956_0019733 | 3300035119 | Bacteria | 2861 |
| 402 | Ga0373957_0001409 | 3300035120 | Bacteria | 6498 |
| 403 | Ga0373957_0005477 | 3300035120 | Bacteria | 3937 |
| 404 | Ga0373957_0034103 | 3300035120 | Bacteria | 1883 |
| 405 | Ga0373943_0060746 | 3300035170 | Bacteria | 1887 |
| 406 | Ga0373946_0006137 | 3300035171 | Bacteria | 4353 |
| 407 | Ga0373946_0045097 | 3300035171 | Bacteria | 1823 |
| 408 | Ga0373946_0155733 | 3300035171 | Bacteria | 1069 |
| 409 | Ga0373955_0000395 | 3300035172 | Bacteria | 18509 |
| 410 | Ga0373955_0042757 | 3300035172 | Bacteria | 2434 |
| 411 | Ga0373924_0008165 | 3300035410 | Bacteria | 3794 |
| 412 | Ga0373924_0055653 | 3300035410 | Bacteria | 1646 |
| 413 | Ga0373924_0071304 | 3300035410 | Bacteria | 1466 |
| 414 | Ga0373931_0001048 | 3300035691 | Bacteria | 11695 |
| 415 | Ga0373931_0030584 | 3300035691 | Bacteria | 2773 |
| 416 | Ga0373931_0179784 | 3300035691 | Bacteria | 1252 |
| 417 | Ga0373935_0004219 | 3300035692 | Bacteria | 8427 |
| 418 | Ga0373927_0002702 | 3300035695 | Bacteria | 12926 |
| 419 | Ga0373927_0004563 | 3300035695 | Bacteria | 9675 |
| 420 | Ga0373927_0023782 | 3300035695 | Bacteria | 4010 |
| 421 | Ga0373927_0084381 | 3300035695 | Bacteria | 2060 |
| 422 | Ga0373927_0143006 | 3300035695 | Bacteria | 1565 |
| 423 | Ga0373933_0003364 | 3300035724 | Bacteria | 8915 |
| 424 | Ga0373933_0007313 | 3300035724 | Bacteria | 6024 |
| 425 | Ga0373933_0007540 | 3300035724 | Bacteria | 5945 |
| 426 | Ga0373933_0091286 | 3300035724 | Bacteria | 1879 |
| 427 | Ga0373947_0007364 | 3300035725 | Bacteria | 6372 |
| 428 | Ga0373947_0027701 | 3300035725 | Bacteria | 3317 |
| 429 | Ga0373947_0065680 | 3300035725 | Bacteria | 2213 |
| 430 | Ga0373947_0157668 | 3300035725 | Bacteria | 1466 |
| 431 | Ga0373937_0011914 | 3300036401 | Bacteria | 7630 |
| 432 | Ga0373937_0022128 | 3300036401 | Bacteria | 5711 |
| 433 | Ga0373937_0049502 | 3300036401 | Bacteria | 3848 |
| 434 | Ga0373925_0007592 | 3300037068 | Bacteria | 7899 |
| 435 | Ga0373925_0018541 | 3300037068 | Bacteria | 5059 |
| 436 | Ga0373925_0034208 | 3300037068 | Bacteria | 3745 |
| 437 | Ga0373925_0049760 | 3300037068 | Bacteria | 3124 |
| 438 | Ga0373925_0092541 | 3300037068 | Bacteria | 2313 |
| 439 | Ga0373925_0104706 | 3300037068 | Bacteria | 2179 |
| 440 | Ga0395900_0007140 | 3300037418 | Bacteria | 11574 |
| 441 | Ga0395900_0044885 | 3300037418 | Bacteria | 4552 |
| 442 | Ga0395900_0105951 | 3300037418 | Bacteria | 2888 |
| 443 | Ga0395898_0067033 | 3300037466 | Bacteria | 3476 |
| 444 | Ga0395898_0138367 | 3300037466 | Bacteria | 2331 |
| 445 | Ga0395905_0028290 | 3300037471 | Bacteria | 5283 |
| 446 | Ga0395905_0246935 | 3300037471 | Bacteria | 1667 |
| 447 | Ga0395905_0547190 | 3300037471 | Bacteria | 1059 |
| 448 | Ga0436364_0776445 | 3300037853 | Bacteria | 2528 |
| 449 | Ga0395901_0129075 | 3300038443 | Bacteria | 2657 |
| 450 | Ga0436365_0657970 | 3300039437 | Bacteria | 1203 |
| 451 | Ga0436365_0931463 | 3300039437 | Bacteria | 1210 |
| 452 | Ga0436365_1364744 | 3300039437 | Bacteria | 1882 |
| 453 | Ga0436365_1778823 | 3300039437 | Bacteria | 2251 |
| 454 | Ga0436360_0202944 | 3300039438 | Bacteria | 1417 |
| 455 | Ga0436361_0764338 | 3300039447 | Bacteria | 2381 |
| 456 | Ga0436361_1007400 | 3300039447 | Bacteria | 4239 |
| 457 | Ga0436363_0187212 | 3300039450 | Bacteria | 5083 |
| 458 | Ga0436363_1164297 | 3300039450 | Bacteria | 3420 |
| 459 | Ga0436363_1664076 | 3300039450 | Bacteria | 1800 |
| 460 | Ga0451839_1296627 | 3300041496 | Bacteria | 1039 |
| 461 | Ga0451849_1550937 | 3300041505 | Bacteria | 1913 |
| 462 | Ga0466969_0038171 | 3300044656 | Bacteria | 2418 |
| 463 | Ga0466972_0000177 | 3300044658 | Bacteria | 49318 |
| 464 | Ga0466972_0005224 | 3300044658 | Bacteria | 6498 |
| 465 | Ga0466965_0032138 | 3300044683 | Bacteria | 2563 |
| 466 | Ga0466965_0199123 | 3300044683 | Bacteria | 1062 |
| 467 | Ga0466966_0000474 | 3300044684 | Bacteria | 25834 |
| 468 | Ga0466961_0000023 | 3300044693 | Bacteria | 97134 |
| 469 | Ga0466961_0115673 | 3300044693 | Bacteria | 1686 |
| 470 | Ga0466968_0006075 | 3300044735 | Bacteria | 4535 |
| 471 | Ga0466968_0041477 | 3300044735 | Bacteria | 1943 |
| 472 | Ga0466957_0119170 | 3300044842 | Bacteria | 1681 |
| 473 | Ga0466957_0312438 | 3300044842 | Bacteria | 1058 |
| 474 | Ga0466959_0000726 | 3300045049 | Bacteria | 19220 |
| 475 | Ga0466967_0189767 | 3300045976 | Bacteria | 1942 |
| 476 | Ga0466967_0628871 | 3300045976 | Bacteria | 1060 |
| 477 | Ga0495592_0020908 | 3300046454 | Bacteria | 4978 |
| 478 | Ga0495592_0021820 | 3300046454 | Bacteria | 4871 |
| 479 | Ga0495592_0084009 | 3300046454 | Bacteria | 2298 |
| 480 | Ga0495592_0301622 | 3300046454 | Bacteria | 1041 |
| 481 | Ga0495603_0001935 | 3300046455 | Bacteria | 12200 |
| 482 | Ga0495603_0006284 | 3300046455 | Bacteria | 7104 |
| 483 | Ga0495603_0020664 | 3300046455 | Bacteria | 3988 |
| 484 | Ga0495603_0049526 | 3300046455 | Bacteria | 2501 |
| 485 | Ga0495603_0062862 | 3300046455 | Bacteria | 2191 |
| 486 | Ga0495603_0118366 | 3300046455 | Bacteria | 1544 |
| 487 | Ga0495603_0224158 | 3300046455 | Bacteria | 1084 |
| 488 | Ga0495629_0000416 | 3300046459 | Bacteria | 35794 |
| 489 | Ga0495629_0000655 | 3300046459 | Bacteria | 27984 |
| 490 | Ga0495641_0002593 | 3300046461 | Bacteria | 14172 |
| 491 | Ga0495641_0101626 | 3300046461 | Bacteria | 1283 |
| 492 | Ga0495651_0010752 | 3300046462 | Bacteria | 7037 |
| 493 | Ga0495651_0144620 | 3300046462 | Bacteria | 1720 |
| 494 | Ga0495653_0004854 | 3300046463 | Bacteria | 10903 |
| 495 | Ga0495653_0259246 | 3300046463 | Bacteria | 1150 |
| 496 | Ga0495650_0025806 | 3300046471 | Bacteria | 2746 |
| 497 | Ga0495580_0055436 | 3300046472 | Bacteria | 2793 |
| 498 | Ga0495582_0032876 | 3300046473 | Bacteria | 2850 |
| 499 | Ga0495639_0001046 | 3300046475 | Bacteria | 12485 |
| 500 | Ga0495639_0084132 | 3300046475 | Bacteria | 1485 |
| 501 | Ga0495639_0129966 | 3300046475 | Bacteria | 1205 |
| 502 | Ga0495662_0003282 | 3300046476 | Bacteria | 8189 |
| 503 | Ga0495664_0114940 | 3300046477 | Bacteria | 1626 |
| 504 | Ga0495585_0113023 | 3300046492 | Bacteria | 1442 |
| 505 | Ga0495585_0147552 | 3300046492 | Bacteria | 1228 |
| 506 | Ga0495594_0051840 | 3300046499 | Bacteria | 2258 |
| 507 | Ga0495606_0066283 | 3300046507 | Bacteria | 2290 |
| 508 | Ga0495608_0107848 | 3300046511 | Bacteria | 1791 |
| 509 | Ga0495618_0110921 | 3300046514 | Bacteria | 1756 |
| 510 | Ga0495620_0117244 | 3300046515 | Bacteria | 1052 |
| 511 | Ga0495628_0011825 | 3300046516 | Bacteria | 7365 |
| 512 | Ga0495628_0030845 | 3300046516 | Bacteria | 4339 |
| 513 | Ga0495628_0117808 | 3300046516 | Bacteria | 2039 |
| 514 | Ga0495628_0136125 | 3300046516 | Bacteria | 1877 |
| 515 | Ga0495630_0009444 | 3300046517 | Bacteria | 7014 |
| 516 | Ga0495643_0014428 | 3300046522 | Bacteria | 4701 |
| 517 | Ga0495648_0000640 | 3300046524 | Bacteria | 37287 |
| 518 | Ga0495666_0016886 | 3300046526 | Bacteria | 3634 |
| 519 | Ga0495666_0030220 | 3300046526 | Bacteria | 2661 |
| 520 | Ga0495642_0121770 | 3300046528 | Bacteria | 1120 |
| 521 | Ga0495652_0026522 | 3300046529 | Bacteria | 5118 |
| 522 | Ga0495652_0082257 | 3300046529 | Bacteria | 2654 |
| 523 | Ga0495665_0003441 | 3300046531 | Bacteria | 8598 |
| 524 | Ga0495665_0056047 | 3300046531 | Bacteria | 2081 |
| 525 | Ga0495640_0045167 | 3300046533 | Bacteria | 3058 |
| 526 | Ga0495640_0045731 | 3300046533 | Bacteria | 3037 |
| 527 | Ga0495640_0073507 | 3300046533 | Bacteria | 2289 |
| 528 | Ga0495640_0085105 | 3300046533 | Bacteria | 2096 |
| 529 | Ga0495586_0085300 | 3300046535 | Bacteria | 1740 |
| 530 | Ga0495587_0007940 | 3300046536 | Bacteria | 6854 |
| 531 | Ga0495587_0011794 | 3300046536 | Bacteria | 5526 |
| 532 | Ga0495587_0016331 | 3300046536 | Bacteria | 4619 |
| 533 | Ga0495598_0010333 | 3300046537 | Bacteria | 2234 |
| 534 | Ga0495598_0023933 | 3300046537 | Bacteria | 1650 |
| 535 | Ga0495621_0078806 | 3300046539 | Bacteria | 1225 |
| 536 | Ga0495645_0002973 | 3300046543 | Bacteria | 11471 |
| 537 | Ga0495645_0133459 | 3300046543 | Bacteria | 1738 |
| 538 | Ga0495622_0023686 | 3300046557 | Bacteria | 2863 |
| 539 | Ga0495622_0026482 | 3300046557 | Bacteria | 2707 |
| 540 | Ga0495622_0088749 | 3300046557 | Bacteria | 1421 |
| 541 | Ga0495667_0032457 | 3300046559 | Bacteria | 3499 |
| 542 | Ga0495667_0036654 | 3300046559 | Bacteria | 3271 |
| 543 | Ga0495667_0044661 | 3300046559 | Bacteria | 2934 |
| 544 | Ga0495667_0060623 | 3300046559 | Bacteria | 2481 |
| 545 | Ga0495656_0118066 | 3300046615 | Bacteria | 1248 |
| 546 | Ga0495656_0127886 | 3300046615 | Bacteria | 1206 |
| 547 | Ga0495668_0073358 | 3300046616 | Bacteria | 1880 |
| 548 | Ga0495668_0191459 | 3300046616 | Bacteria | 1120 |
| 549 | Ga0495634_0000602 | 3300046642 | Bacteria | 34812 |
| 550 | Ga0495634_0074164 | 3300046642 | Bacteria | 2236 |
| 551 | Ga0495634_0159003 | 3300046642 | Bacteria | 1425 |
| 552 | Ga0495634_0223408 | 3300046642 | Bacteria | 1161 |
| 553 | Ga0495635_0000380 | 3300046663 | Bacteria | 28177 |
| 554 | Ga0495635_0012975 | 3300046663 | Bacteria | 5832 |
| 555 | Ga0495635_0042493 | 3300046663 | Bacteria | 3138 |
| 556 | Ga0495635_0243080 | 3300046663 | Bacteria | 1214 |
| 557 | Ga0495659_0030136 | 3300046664 | Bacteria | 1886 |
| 558 | Ga0495588_0003413 | 3300046674 | Bacteria | 6905 |
| 559 | Ga0495657_0005248 | 3300046675 | Bacteria | 10255 |
| 560 | Ga0495657_0019627 | 3300046675 | Bacteria | 4875 |
| 561 | Ga0495657_0050390 | 3300046675 | Bacteria | 2799 |
| 562 | Ga0495599_0004515 | 3300046678 | Bacteria | 8252 |
| 563 | Ga0495599_0025467 | 3300046678 | Bacteria | 3703 |
| 564 | Ga0495599_0026173 | 3300046678 | Bacteria | 3655 |
| 565 | Ga0495599_0079124 | 3300046678 | Bacteria | 2053 |
| 566 | Ga0495623_0002235 | 3300046679 | Bacteria | 12884 |
| 567 | Ga0495623_0015456 | 3300046679 | Bacteria | 4934 |
| 568 | Ga0495646_0046242 | 3300046680 | Bacteria | 2654 |
| 569 | Ga0495646_0048567 | 3300046680 | Bacteria | 2577 |
| 570 | Ga0495646_0070850 | 3300046680 | Bacteria | 2052 |
| 571 | Ga0495646_0131009 | 3300046680 | Bacteria | 1412 |
| 572 | Ga0495647_0021626 | 3300046681 | Bacteria | 2317 |
| 573 | Ga0495647_0030022 | 3300046681 | Bacteria | 2014 |
| 574 | Ga0495658_0005105 | 3300046683 | Bacteria | 6451 |
| 575 | Ga0495658_0053507 | 3300046683 | Bacteria | 2293 |
| 576 | Ga0495669_0076437 | 3300046684 | Bacteria | 1533 |
| 577 | Ga0495613_0032956 | 3300046689 | Bacteria | 3849 |
| 578 | Ga0495613_0057599 | 3300046689 | Bacteria | 2853 |
| 579 | Ga0495624_0003072 | 3300046690 | Bacteria | 12498 |
| 580 | Ga0495589_0157788 | 3300046794 | Bacteria | 1081 |
| 581 | Ga0495600_0029981 | 3300046809 | Bacteria | 3523 |
| 582 | Ga0495600_0035125 | 3300046809 | Bacteria | 3255 |
| 583 | Ga0495600_0114920 | 3300046809 | Bacteria | 1752 |
| 584 | Ga0495581_0020748 | 3300047315 | Bacteria | 3810 |
| 585 | Ga0495581_0036506 | 3300047315 | Bacteria | 2843 |
| 586 | Ga0495581_0097104 | 3300047315 | Bacteria | 1711 |
| 587 | Ga0495581_0198853 | 3300047315 | Bacteria | 1172 |
| 588 | Ga0495604_0007336 | 3300047317 | Bacteria | 8732 |
| 589 | Ga0495604_0008886 | 3300047317 | Bacteria | 7941 |
| 590 | Ga0495604_0054854 | 3300047317 | Bacteria | 3073 |
| 591 | Ga0495604_0127221 | 3300047317 | Bacteria | 1835 |
| 592 | Ga0495604_0201844 | 3300047317 | Bacteria | 1379 |
| 593 | Ga0495674_0008020 | 3300047319 | Bacteria | 10083 |
| 594 | Ga0495674_0022101 | 3300047319 | Bacteria | 5871 |
| 595 | Ga0495674_0066148 | 3300047319 | Bacteria | 3137 |
| 596 | Ga0495674_0160752 | 3300047319 | Bacteria | 1879 |
| 597 | Ga0495674_0305009 | 3300047319 | Bacteria | 1300 |
| 598 | Ga0495672_0124289 | 3300047320 | Bacteria | 1367 |
| 599 | Ga0495676_0069277 | 3300047321 | Bacteria | 2722 |
| 600 | Ga0495676_0122028 | 3300047321 | Bacteria | 1894 |
| 601 | Ga0495676_0123320 | 3300047321 | Bacteria | 1881 |
| 602 | Ga0495680_0002016 | 3300047322 | Bacteria | 21294 |
| 603 | Ga0495680_0025159 | 3300047322 | Bacteria | 4930 |
| 604 | Ga0495680_0085244 | 3300047322 | Bacteria | 2379 |
| 605 | Ga0495680_0261857 | 3300047322 | Bacteria | 1223 |
| 606 | Ga0495675_0001856 | 3300047444 | Bacteria | 12578 |
| 607 | Ga0495675_0127716 | 3300047444 | Bacteria | 1581 |
| 608 | Ga0495679_059730 | 3300047446 | Bacteria | 1121 |
| 609 | Ga0495681_0121593 | 3300047470 | Bacteria | 1120 |
| 610 | Ga0495684_0000294 | 3300047471 | Bacteria | 40596 |
| 611 | Ga0495684_0096973 | 3300047471 | Bacteria | 2231 |
| 612 | Ga0495684_0138880 | 3300047471 | Bacteria | 1822 |
| 613 | Ga0495593_0000022 | 3300047673 | Bacteria | 69741 |
| 614 | Ga0495593_0000744 | 3300047673 | Bacteria | 18938 |
| 615 | Ga0495602_0062578 | 3300048088 | Bacteria | 3228 |
| 616 | Ga0495602_0155583 | 3300048088 | Bacteria | 1790 |
| 617 | Ga0496100_0027259 | 3300048903 | Bacteria | 3512 |
| 618 | Ga0496100_0079153 | 3300048903 | Bacteria | 2214 |
| 619 | Ga0496101_0063193 | 3300048904 | Bacteria | 2694 |
| 620 | Ga0496101_0088147 | 3300048904 | Bacteria | 2304 |
| 621 | Ga0496101_0106347 | 3300048904 | Bacteria | 2107 |
| 622 | Ga0496101_0116245 | 3300048904 | Bacteria | 2018 |
| 623 | Ga0496102_0014293 | 3300048905 | Bacteria | 6898 |
| 624 | Ga0496102_0059266 | 3300048905 | Bacteria | 3500 |
| 625 | Ga0496102_0076480 | 3300048905 | Bacteria | 3079 |
| 626 | Ga0496102_0334862 | 3300048905 | Bacteria | 1425 |
| 627 | Ga0496103_0101444 | 3300048906 | Bacteria | 1822 |
| 628 | Ga0496104_0000948 | 3300048907 | Bacteria | 24943 |
| 629 | Ga0496104_0002005 | 3300048907 | Bacteria | 17670 |
| 630 | Ga0496104_0023320 | 3300048907 | Bacteria | 5689 |
| 631 | Ga0496104_0033610 | 3300048907 | Bacteria | 4779 |
| 632 | Ga0496104_0235301 | 3300048907 | Bacteria | 1744 |
| 633 | Ga0496105_0001280 | 3300048908 | Bacteria | 17590 |
| 634 | Ga0496105_0009772 | 3300048908 | Bacteria | 7513 |
| 635 | Ga0496105_0011036 | 3300048908 | Bacteria | 7121 |
| 636 | Ga0496105_0012416 | 3300048908 | Bacteria | 6743 |
| 637 | Ga0496105_0391803 | 3300048908 | Bacteria | 1104 |
| 638 | Ga0496106_0001262 | 3300048909 | Bacteria | 18951 |
| 639 | Ga0496106_0003691 | 3300048909 | Bacteria | 11418 |
| 640 | Ga0496106_0014884 | 3300048909 | Bacteria | 5755 |
| 641 | Ga0496106_0137472 | 3300048909 | Bacteria | 1920 |
| 642 | Ga0496106_0139912 | 3300048909 | Bacteria | 1903 |
| 643 | Ga0496106_0151458 | 3300048909 | Bacteria | 1830 |
| 644 | Ga0496106_0489794 | 3300048909 | Bacteria | 988 |
| 645 | Ga0496107_0021225 | 3300048910 | Bacteria | 4590 |
| 646 | Ga0496108_0000479 | 3300048911 | Bacteria | 32030 |
| 647 | Ga0496108_0084458 | 3300048911 | Bacteria | 2694 |
| 648 | Ga0496108_0141737 | 3300048911 | Bacteria | 2071 |
| 649 | Ga0496108_0155553 | 3300048911 | Bacteria | 1974 |
| 650 | Ga0496108_0199656 | 3300048911 | Bacteria | 1735 |
| 651 | Ga0496108_0247223 | 3300048911 | Bacteria | 1551 |
| 652 | Ga0496109_0000910 | 3300048912 | Bacteria | 24624 |
| 653 | Ga0496109_0009376 | 3300048912 | Bacteria | 8339 |
| 654 | Ga0496109_0117615 | 3300048912 | Bacteria | 2474 |
| 655 | Ga0496109_0142527 | 3300048912 | Bacteria | 2241 |
| 656 | Ga0496109_0147156 | 3300048912 | Bacteria | 2204 |
| 657 | Ga0496109_0155298 | 3300048912 | Bacteria | 2143 |
| 658 | Ga0496109_0166533 | 3300048912 | Bacteria | 2067 |
| 659 | Ga0496109_0168061 | 3300048912 | Bacteria | 2057 |
| 660 | Ga0496109_0293113 | 3300048912 | Bacteria | 1534 |
| 661 | Ga0496110_0025120 | 3300048913 | Bacteria | 5087 |
| 662 | Ga0496110_0056560 | 3300048913 | Bacteria | 3452 |
| 663 | Ga0496110_0101486 | 3300048913 | Bacteria | 2579 |
| 664 | Ga0496110_0105664 | 3300048913 | Bacteria | 2526 |
| 665 | Ga0496110_0118704 | 3300048913 | Bacteria | 2382 |
| 666 | Ga0496110_0206343 | 3300048913 | Bacteria | 1786 |
| 667 | Ga0496111_0000112 | 3300048914 | Bacteria | 35886 |
| 668 | Ga0496111_0034388 | 3300048914 | Bacteria | 3619 |
| 669 | Ga0496111_0116502 | 3300048914 | Bacteria | 1970 |
| 670 | Ga0496111_0259119 | 3300048914 | Bacteria | 1290 |
| 671 | Ga0496111_0452236 | 3300048914 | Bacteria | 947 |
| 672 | Ga0496112_0000022 | 3300048915 | Bacteria | 156255 |
| 673 | Ga0496112_0023710 | 3300048915 | Bacteria | 5870 |
| 674 | Ga0496112_0032020 | 3300048915 | Bacteria | 5104 |
| 675 | Ga0496112_0034500 | 3300048915 | Bacteria | 4924 |
| 676 | Ga0496112_0043988 | 3300048915 | Bacteria | 4373 |
| 677 | Ga0496112_0118773 | 3300048915 | Bacteria | 2614 |
| 678 | Ga0496112_0170514 | 3300048915 | Bacteria | 2141 |
| 679 | Ga0496112_0261545 | 3300048915 | Bacteria | 1680 |
| 680 | Ga0496112_0266577 | 3300048915 | Bacteria | 1661 |
| 681 | Ga0496112_0402327 | 3300048915 | Bacteria | 1309 |
| 682 | Ga0496112_0539679 | 3300048915 | Bacteria | 1100 |
| 683 | Ga0496113_0000762 | 3300048916 | Bacteria | 16562 |
| 684 | Ga0496113_0009540 | 3300048916 | Bacteria | 6365 |
| 685 | Ga0496113_0072238 | 3300048916 | Bacteria | 2625 |
| 686 | Ga0496113_0108196 | 3300048916 | Bacteria | 2161 |
| 687 | Ga0496113_0129870 | 3300048916 | Bacteria | 1976 |
| 688 | Ga0496114_0009367 | 3300048917 | Bacteria | 7773 |
| 689 | Ga0496114_0245788 | 3300048917 | Bacteria | 1574 |
| 690 | Ga0496115_0014569 | 3300048918 | Bacteria | 5952 |
| 691 | Ga0496115_0032437 | 3300048918 | Bacteria | 4121 |
| 692 | Ga0496115_0033888 | 3300048918 | Bacteria | 4034 |
| 693 | Ga0496115_0081033 | 3300048918 | Bacteria | 2643 |
| 694 | Ga0496115_0189664 | 3300048918 | Bacteria | 1698 |
| 695 | Ga0496115_0238742 | 3300048918 | Bacteria | 1498 |
| 696 | Ga0496115_0422078 | 3300048918 | Bacteria | 1080 |
| 697 | Ga0496116_0077687 | 3300048919 | Bacteria | 2073 |
| 698 | Ga0496117_0043940 | 3300048920 | Bacteria | 3241 |
| 699 | Ga0496117_0088506 | 3300048920 | Bacteria | 2003 |
| 700 | Ga0496118_0036454 | 3300048921 | Bacteria | 3976 |
| 701 | Ga0496118_0083539 | 3300048921 | Bacteria | 2232 |
| 702 | Ga0496118_0136393 | 3300048921 | Bacteria | 1565 |
| 703 | Ga0496119_0068858 | 3300048922 | Bacteria | 2082 |
| 704 | Ga0496119_0123246 | 3300048922 | Bacteria | 1422 |
| 705 | Ga0496119_0127019 | 3300048922 | Bacteria | 1394 |
| 706 | Ga0496120_0022888 | 3300048923 | Bacteria | 3923 |
| 707 | Ga0496121_0000254 | 3300048924 | Bacteria | 113314 |
| 708 | Ga0496121_0002114 | 3300048924 | Bacteria | 31228 |
| 709 | Ga0496121_0011243 | 3300048924 | Bacteria | 9975 |
| 710 | Ga0496121_0012395 | 3300048924 | Bacteria | 9307 |
| 711 | Ga0496121_0055262 | 3300048924 | Bacteria | 3309 |
| 712 | Ga0496121_0090630 | 3300048924 | Bacteria | 2389 |
| 713 | Ga0496121_0113432 | 3300048924 | Bacteria | 2062 |
| 714 | Ga0496121_0128284 | 3300048924 | Bacteria | 1903 |
| 715 | Ga0496121_0222224 | 3300048924 | Bacteria | 1329 |
| 716 | Ga0496124_0001351 | 3300048927 | Bacteria | 36722 |
| 717 | Ga0496124_0054938 | 3300048927 | Bacteria | 3368 |
| 718 | Ga0496125_0025529 | 3300048928 | Bacteria | 5408 |
| 719 | Ga0496125_0065882 | 3300048928 | Bacteria | 2866 |
| 720 | Ga0496125_0099784 | 3300048928 | Bacteria | 2143 |
| 721 | Ga0496126_0007801 | 3300048929 | Bacteria | 11669 |
| 722 | Ga0496126_0012548 | 3300048929 | Bacteria | 8674 |
| 723 | Ga0496126_0022598 | 3300048929 | Bacteria | 6113 |
| 724 | Ga0496126_0024830 | 3300048929 | Bacteria | 5779 |
| 725 | Ga0496126_0026051 | 3300048929 | Bacteria | 5614 |
| 726 | Ga0496126_0049875 | 3300048929 | Bacteria | 3819 |
| 727 | Ga0496126_0155068 | 3300048929 | Bacteria | 1960 |
| 728 | Ga0496126_0222802 | 3300048929 | Bacteria | 1583 |
| 729 | Ga0496126_0368862 | 3300048929 | Bacteria | 1171 |
| 730 | Ga0501031_0001005 | 3300049568 | Bacteria | 17104 |
| 731 | Ga0501031_0020264 | 3300049568 | Bacteria | 4335 |
| 732 | Ga0501032_0000161 | 3300049569 | Bacteria | 54292 |
| 733 | Ga0501032_0017757 | 3300049569 | Bacteria | 4993 |
| 734 | Ga0501032_0053496 | 3300049569 | Bacteria | 2718 |
| 735 | Ga0501033_0000111 | 3300049570 | Bacteria | 78688 |
| 736 | Ga0501033_0000672 | 3300049570 | Bacteria | 31550 |
| 737 | Ga0501034_0000072 | 3300049571 | Bacteria | 179824 |
| 738 | Ga0501034_0071554 | 3300049571 | Bacteria | 3477 |
| 739 | Ga0501034_0144499 | 3300049571 | Bacteria | 2356 |
| 740 | Ga0501034_0260391 | 3300049571 | Bacteria | 1677 |
| 741 | Ga0501036_0011119 | 3300049572 | Bacteria | 7443 |
| 742 | Ga0501036_0053940 | 3300049572 | Bacteria | 3403 |
| 743 | Ga0501036_0073036 | 3300049572 | Bacteria | 2900 |
| 744 | Ga0501036_0129667 | 3300049572 | Bacteria | 2129 |
| 745 | Ga0501036_0446357 | 3300049572 | Bacteria | 1078 |
| 746 | Ga0501037_0000030 | 3300049573 | Bacteria | 136148 |
| 747 | Ga0501037_0055311 | 3300049573 | Bacteria | 2901 |
| 748 | Ga0501037_0062319 | 3300049573 | Bacteria | 2718 |
| 749 | Ga0501037_0126387 | 3300049573 | Bacteria | 1835 |
| 750 | Ga0501038_0000060 | 3300049574 | Bacteria | 92314 |
| 751 | Ga0501038_0003347 | 3300049574 | Bacteria | 14952 |
| 752 | Ga0501038_0019562 | 3300049574 | Bacteria | 6101 |
| 753 | Ga0501038_0023061 | 3300049574 | Bacteria | 5569 |
| 754 | Ga0501038_0144142 | 3300049574 | Bacteria | 1946 |
| 755 | Ga0501038_0203591 | 3300049574 | Bacteria | 1587 |
| 756 | Ga0501039_0003983 | 3300049575 | Bacteria | 11104 |
| 757 | Ga0501039_0014332 | 3300049575 | Bacteria | 6069 |
| 758 | Ga0501039_0155791 | 3300049575 | Bacteria | 1794 |
| 759 | Ga0501040_0118117 | 3300049576 | Bacteria | 1859 |
| 760 | Ga0501042_0053990 | 3300049578 | Bacteria | 2866 |
| 761 | Ga0501042_0112143 | 3300049578 | Bacteria | 1963 |
| 762 | Ga0501043_0000357 | 3300049579 | Bacteria | 41554 |
| 763 | Ga0501046_0002205 | 3300049580 | Bacteria | 18409 |
| 764 | Ga0501046_0050507 | 3300049580 | Bacteria | 3286 |
| 765 | Ga0501046_0236188 | 3300049580 | Bacteria | 1349 |
| 766 | Ga0501047_0000140 | 3300049581 | Bacteria | 88265 |
| 767 | Ga0501047_0026961 | 3300049581 | Bacteria | 5533 |
| 768 | Ga0501047_0068547 | 3300049581 | Bacteria | 3416 |
| 769 | Ga0501047_0241726 | 3300049581 | Bacteria | 1656 |
| 770 | Ga0501047_0338958 | 3300049581 | Bacteria | 1341 |
| 771 | Ga0501048_0000812 | 3300049582 | Bacteria | 22948 |
| 772 | Ga0501048_0144939 | 3300049582 | Bacteria | 1680 |
| 773 | Ga0501067_0000697 | 3300049583 | Bacteria | 18107 |
| 774 | Ga0501067_0002459 | 3300049583 | Bacteria | 10222 |
| 775 | Ga0501067_0067838 | 3300049583 | Bacteria | 1975 |
| 776 | Ga0501068_0015057 | 3300049584 | Bacteria | 4434 |
| 777 | Ga0501069_0062846 | 3300049585 | Bacteria | 2073 |
| 778 | Ga0501069_0066501 | 3300049585 | Bacteria | 2016 |
| 779 | Ga0501070_0000602 | 3300049586 | Bacteria | 32900 |
| 780 | Ga0501070_0010155 | 3300049586 | Bacteria | 7969 |
| 781 | Ga0501070_0058337 | 3300049586 | Bacteria | 3199 |
| 782 | Ga0501070_0138152 | 3300049586 | Bacteria | 2012 |
| 783 | Ga0501070_0180023 | 3300049586 | Bacteria | 1740 |
| 784 | Ga0501072_0084380 | 3300049588 | Bacteria | 2518 |
| 785 | Ga0501072_0401974 | 3300049588 | Bacteria | 1086 |
| 786 | Ga0501073_0000009 | 3300049589 | Bacteria | 195649 |
| 787 | Ga0501073_0009578 | 3300049589 | Bacteria | 7144 |
| 788 | Ga0501073_0035565 | 3300049589 | Bacteria | 3539 |
| 789 | Ga0501073_0106062 | 3300049589 | Bacteria | 1950 |
| 790 | Ga0501074_0000137 | 3300049590 | Bacteria | 37950 |
| 791 | Ga0501077_0095551 | 3300049593 | Bacteria | 1884 |
| 792 | Ga0501079_0017212 | 3300049741 | Bacteria | 5519 |
| 793 | Ga0501079_0209186 | 3300049741 | Bacteria | 1524 |
| 794 | Ga0501080_0000088 | 3300049742 | Bacteria | 61753 |
| 795 | Ga0501080_0037211 | 3300049742 | Bacteria | 4543 |
| 796 | Ga0501080_0054964 | 3300049742 | Bacteria | 3708 |
| 797 | Ga0501083_0013621 | 3300049744 | Bacteria | 5684 |
| 798 | Ga0501083_0050365 | 3300049744 | Bacteria | 2803 |
| 799 | Ga0501035_0022354 | 3300049822 | Bacteria | 5807 |
| 800 | Ga0501035_0057070 | 3300049822 | Bacteria | 3481 |
| 801 | Ga0501035_0116770 | 3300049822 | Bacteria | 2335 |
| 802 | Ga0501035_0204141 | 3300049822 | Bacteria | 1694 |
| 803 | Ga0501035_0242617 | 3300049822 | Bacteria | 1532 |
| 804 | Ga0501035_0302376 | 3300049822 | Bacteria | 1347 |
| 805 | Ga0501044_0002346 | 3300049823 | Bacteria | 21600 |
| 806 | Ga0501044_0013964 | 3300049823 | Bacteria | 8676 |
| 807 | Ga0501044_0019722 | 3300049823 | Bacteria | 7205 |
| 808 | Ga0501044_0022171 | 3300049823 | Bacteria | 6770 |
| 809 | Ga0501045_0024317 | 3300049824 | Bacteria | 4348 |
| 810 | nmdc:mga03683_51497_c1 | 3300050489 | Bacteria | 1719 |
| 811 | nmdc:mga03n38_4303_c1 | 3300050490 | Bacteria | 4695 |
| 812 | nmdc:mga00v17_32663_c1 | 3300050491 | Bacteria | 3078 |
| 813 | nmdc:mga0yw44_13579_c1 | 3300050492 | Bacteria | 3996 |
| 814 | nmdc:mga0yw44_194539_c1 | 3300050492 | Bacteria | 1338 |
| 815 | nmdc:mga0yw44_78840_c1 | 3300050492 | Bacteria | 2060 |
| 816 | nmdc:mga0yw44_8656_c1 | 3300050492 | Bacteria | 5086 |
| 817 | nmdc:mga0yw44_93034_c1 | 3300050492 | Bacteria | 1909 |
| 818 | nmdc:mga0k408_6488_c1 | 3300050493 | Bacteria | 6235 |
| 819 | nmdc:mga06z11_182462_c1 | 3300050494 | Bacteria | 1211 |
| 820 | nmdc:mga06z11_21687_c1 | 3300050494 | Bacteria | 2989 |
| 821 | nmdc:mga06z11_47781_c1 | 3300050494 | Bacteria | 2175 |
| 822 | nmdc:mga06z11_7412_c1 | 3300050494 | Bacteria | 4511 |
| 823 | nmdc:mga04h51_43933_c1 | 3300050495 | Bacteria | 1471 |
| 824 | nmdc:mga07m45_19689_c1 | 3300050496 | Bacteria | 2864 |
| 825 | nmdc:mga07m45_25952_c1 | 3300050496 | Bacteria | 3218 |
| 826 | nmdc:mga05p37_338976_c1 | 3300050507 | Bacteria | 1773 |
| 827 | nmdc:mga0n895_2476_c1 | 3300050512 | Bacteria | 14436 |
| 828 | nmdc:mga0n895_47793_c1 | 3300050512 | Bacteria | 4185 |
| 829 | nmdc:mga0n895_95111_c1 | 3300050512 | Bacteria | 2984 |
| 830 | nmdc:mga0n895_95260_c1 | 3300050512 | Bacteria | 2981 |
| 831 | nmdc:mga0rr50_82341_c1 | 3300050513 | Bacteria | 2485 |
| 832 | nmdc:mga0sz30_59207_c1 | 3300050516 | Bacteria | 1634 |
| 833 | Ga0495601_0047714 | 3300053077 | Bacteria | 2697 |
| 834 | Ga0495601_0159031 | 3300053077 | Bacteria | 1476 |
| 835 | Ga0495612_0045607 | 3300053078 | Bacteria | 1794 |
| 836 | Ga0495595_0021212 | 3300053084 | Bacteria | 2835 |
| 837 | Ga0495595_0032285 | 3300053084 | Bacteria | 2358 |
| 838 | Ga0495619_0003855 | 3300053085 | Bacteria | 9655 |
| 839 | Ga0495619_0112518 | 3300053085 | Bacteria | 1861 |
| 840 | Ga0500578_0186649 | 3300053086 | Bacteria | 1275 |
| 841 | Ga0500651_0018002 | 3300053093 | Bacteria | 4369 |
| 842 | Ga0500651_0023015 | 3300053093 | Bacteria | 3898 |
| 843 | Ga0500566_0007702 | 3300053094 | Bacteria | 6385 |
| 844 | Ga0500566_0033416 | 3300053094 | Bacteria | 2997 |
| 845 | Ga0500566_0043140 | 3300053094 | Bacteria | 2599 |
| 846 | Ga0500566_0134479 | 3300053094 | Bacteria | 1319 |
| 847 | Ga0500640_002809 | 3300053095 | Bacteria | 5881 |
| 848 | Ga0500557_000057 | 3300053105 | Bacteria | 47849 |
| 849 | Ga0500557_090483 | 3300053105 | Bacteria | 1014 |
| 850 | Ga0500569_059070 | 3300053109 | Bacteria | 1179 |
| 851 | Ga0500572_000383 | 3300053111 | Bacteria | 15750 |
| 852 | Ga0500572_001892 | 3300053111 | Bacteria | 5274 |
| 853 | Ga0500595_004172 | 3300053119 | Bacteria | 6550 |
| 854 | Ga0500595_009841 | 3300053119 | Bacteria | 3837 |
| 855 | Ga0500595_022825 | 3300053119 | Bacteria | 2208 |
| 856 | Ga0500607_073306 | 3300053121 | Bacteria | 1762 |
| 857 | Ga0500608_068887 | 3300053122 | Bacteria | 1684 |
| 858 | Ga0500642_0000263 | 3300053130 | Bacteria | 19627 |
| 859 | Ga0500559_0000486 | 3300053136 | Bacteria | 28052 |
| 860 | Ga0500559_0049727 | 3300053136 | Bacteria | 1847 |
| 861 | Ga0500559_0051797 | 3300053136 | Bacteria | 1813 |
| 862 | Ga0500559_0055710 | 3300053136 | Bacteria | 1754 |
| 863 | Ga0500568_0037793 | 3300053139 | Bacteria | 1957 |
| 864 | Ga0500573_0045454 | 3300053140 | Bacteria | 2531 |
| 865 | Ga0500577_0000035 | 3300053142 | Bacteria | 31742 |
| 866 | Ga0500603_000335 | 3300053150 | Bacteria | 12321 |
| 867 | Ga0500603_000740 | 3300053150 | Bacteria | 7963 |
| 868 | Ga0500603_021454 | 3300053150 | Bacteria | 1589 |
| 869 | Ga0500603_035785 | 3300053150 | Bacteria | 1303 |
| 870 | Ga0500620_005833 | 3300053155 | Bacteria | 2890 |
| 871 | Ga0500630_016635 | 3300053159 | Bacteria | 3620 |
| 872 | Ga0500638_062254 | 3300053162 | Bacteria | 1792 |
| 873 | Ga0500639_001074 | 3300053163 | Bacteria | 13945 |
| 874 | Ga0500639_028645 | 3300053163 | Bacteria | 2943 |
| 875 | Ga0500636_0001378 | 3300053177 | Bacteria | 13188 |
| 876 | Ga0500636_0017028 | 3300053177 | Bacteria | 4287 |
| 877 | Ga0500636_0042827 | 3300053177 | Bacteria | 2675 |
| 878 | Ga0500636_0148333 | 3300053177 | Bacteria | 1290 |
| 879 | Ga0500576_113008 | 3300053725 | Bacteria | 1085 |
| 880 | Ga0500657_084075 | 3300053728 | Bacteria | 1359 |
| 881 | Ga0500645_065959 | 3300053730 | Bacteria | 1042 |
| 882 | Ga0500596_001060 | 3300053735 | Bacteria | 5540 |
| 883 | Ga0500596_004321 | 3300053735 | Bacteria | 2614 |
| 884 | Ga0500596_015230 | 3300053735 | Bacteria | 1155 |
| 885 | Ga0500601_001101 | 3300053737 | Bacteria | 3057 |
| 886 | Ga0500601_005147 | 3300053737 | Bacteria | 1430 |
| 887 | Ga0501084_0005438 | 3300054114 | Bacteria | 10447 |
| 888 | Ga0501084_0036315 | 3300054114 | Bacteria | 4116 |
| 889 | Ga0501082_0018483 | 3300060353 | Bacteria | 6004 |
| 890 | Ga0501082_0025748 | 3300060353 | Bacteria | 5069 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025924 | Ga0207694_10433030 | Ga0207694_104330301 | 275 |
| 2 | 3300031239 | Ga0265328_10001180 | Ga0265328_1000118011 | 275 |
| 3 | 3300026088 | Ga0207641_10574202 | Ga0207641_105742021 | 283 |
| 4 | 3300035120 | Ga0373957_0005477 | Ga0373957_0005477_2988_3884 | 283 |
| 5 | 3300035724 | Ga0373933_0007540 | Ga0373933_0007540_1771_2667 | 283 |
| 6 | 3300036401 | Ga0373937_0022128 | Ga0373937_0022128_3737_4633 | 283 |
| 7 | 3300046463 | Ga0495653_0259246 | Ga0495653_0259246_162_1058 | 283 |
| 8 | 3300046536 | Ga0495587_0011794 | Ga0495587_0011794_4318_5214 | 283 |
| 9 | 3300047317 | Ga0495604_0201844 | Ga0495604_0201844_214_1110 | 283 |
| 10 | iso_pu_bacteria | 8019687851 | 8019695223 | 286 |
| 11 | 3300025915 | Ga0207693_10105078 | Ga0207693_101050782 | 289 |
| 12 | 3300046615 | Ga0495656_0127886 | Ga0495656_0127886_171_1040 | 289 |
| 13 | 3300047320 | Ga0495672_0124289 | Ga0495672_0124289_219_1100 | 290 |
| 14 | iso_pu_bacteria | 2508501009 | 2508545754 | 291 |
| 15 | iso_pu_bacteria | 2508501042 | 2508694579 | 291 |
| 16 | iso_pu_bacteria | 2508501128 | 2509151292 | 291 |
| 17 | iso_pu_bacteria | 2511231028 | 2511398417 | 291 |
| 18 | iso_pu_bacteria | 2513237092 | 2513624509 | 291 |
| 19 | iso_pu_bacteria | 2513237094 | 2513638628 | 291 |
| 20 | iso_pu_bacteria | 2513237095 | 2513649984 | 291 |
| 21 | iso_pu_bacteria | 2513237104 | 2513716830 | 291 |
| 22 | iso_pu_bacteria | 2515154112 | 2515624493 | 291 |
| 23 | iso_pu_bacteria | 2517093001 | 2517104578 | 291 |
| 24 | iso_pu_bacteria | 2524023210 | 2524470524 | 291 |
| 25 | iso_pu_bacteria | 2528768022 | 2528850381 | 291 |
| 26 | iso_pu_bacteria | 2643221651 | 2644290200 | 291 |
| 27 | iso_pu_bacteria | 2728368998 | 2728749179 | 291 |
| 28 | iso_pu_bacteria | 2791355196 | 2793059412 | 291 |
| 29 | iso_pu_bacteria | 2816332527 | 2818240984 | 291 |
| 30 | iso_pu_bacteria | 2824600985 | 2824604435 | 291 |
| 31 | iso_pu_bacteria | 2824609381 | 2824615024 | 291 |
| 32 | iso_pu_bacteria | 2824617872 | 2824624923 | 291 |
| 33 | iso_pu_bacteria | 2824626560 | 2824633219 | 291 |
| 34 | iso_pu_bacteria | 2824635225 | 2824640945 | 291 |
| 35 | iso_pu_bacteria | 2824644064 | 2824651053 | 291 |
| 36 | iso_pu_bacteria | 2824653114 | 2824659192 | 291 |
| 37 | iso_pu_bacteria | 2824661429 | 2824665215 | 291 |
| 38 | iso_pu_bacteria | 2824679649 | 2824687118 | 291 |
| 39 | iso_pu_bacteria | 2824714736 | 2824721057 | 291 |
| 40 | iso_pu_bacteria | 2824723954 | 2824728264 | 291 |
| 41 | iso_pu_bacteria | 2824732956 | 2824738358 | 291 |
| 42 | iso_pu_bacteria | 2824746037 | 2824751277 | 291 |
| 43 | iso_pu_bacteria | 2841957949 | 2841960691 | 291 |
| 44 | iso_pu_bacteria | 2842038055 | 2842041792 | 291 |
| 45 | iso_pu_bacteria | 2842045827 | 2842049834 | 291 |
| 46 | iso_pu_bacteria | 2847930680 | 2847932085 | 291 |
| 47 | iso_pu_bacteria | 2849076700 | 2849077049 | 291 |
| 48 | iso_pu_bacteria | 2857509624 | 2857514665 | 291 |
| 49 | iso_pu_bacteria | 2874590934 | 2874595724 | 291 |
| 50 | iso_pu_bacteria | 2874612657 | 2874614994 | 291 |
| 51 | iso_pu_bacteria | 2874620515 | 2874624213 | 291 |
| 52 | iso_pu_bacteria | 2874645413 | 2874651644 | 291 |
| 53 | iso_pu_bacteria | 2876771140 | 2876775919 | 291 |
| 54 | iso_pu_bacteria | 2876808645 | 2876808657 | 291 |
| 55 | iso_pu_bacteria | 2876818435 | 2876821539 | 291 |
| 56 | iso_pu_bacteria | 2879074833 | 2879080010 | 291 |
| 57 | iso_pu_bacteria | 2879083081 | 2879085762 | 291 |
| 58 | iso_pu_bacteria | 2879099564 | 2879100593 | 291 |
| 59 | iso_pu_bacteria | 2879110137 | 2879111929 | 291 |
| 60 | iso_pu_bacteria | 2879127579 | 2879134092 | 291 |
| 61 | iso_pu_bacteria | 2879142872 | 2879148577 | 291 |
| 62 | iso_pu_bacteria | 2881364244 | 2881367712 | 291 |
| 63 | iso_pu_bacteria | 2881665667 | 2881669304 | 291 |
| 64 | iso_pu_bacteria | 2885366525 | 2885374493 | 291 |
| 65 | iso_pu_bacteria | 2885374607 | 2885379437 | 291 |
| 66 | iso_pu_bacteria | 2888378607 | 2888387623 | 291 |
| 67 | iso_pu_bacteria | 2888419890 | 2888426838 | 291 |
| 68 | iso_pu_bacteria | 2889033259 | 2889034123 | 291 |
| 69 | iso_pu_bacteria | 2903748898 | 2903755849 | 291 |
| 70 | iso_pu_bacteria | 2904666416 | 2904670924 | 291 |
| 71 | iso_pu_bacteria | 2904690495 | 2904692641 | 291 |
| 72 | iso_pu_bacteria | 2904699407 | 2904711110 | 291 |
| 73 | iso_pu_bacteria | 2906610324 | 2906612352 | 291 |
| 74 | iso_pu_bacteria | 2906626472 | 2906633093 | 291 |
| 75 | iso_pu_bacteria | 2906635258 | 2906638320 | 291 |
| 76 | iso_pu_bacteria | 2906643746 | 2906650117 | 291 |
| 77 | iso_pu_bacteria | 2906660503 | 2906663395 | 291 |
| 78 | iso_pu_bacteria | 2908739725 | 2908739774 | 291 |
| 79 | iso_pu_bacteria | 2908756301 | 2908757852 | 291 |
| 80 | iso_pu_bacteria | 2908775508 | 2908777160 | 291 |
| 81 | iso_pu_bacteria | 2922361189 | 2922367521 | 291 |
| 82 | iso_pu_bacteria | 2922368715 | 2922376606 | 291 |
| 83 | iso_pu_bacteria | 2922386360 | 2922391499 | 291 |
| 84 | iso_pu_bacteria | 2922393267 | 2922398558 | 291 |
| 85 | iso_pu_bacteria | 2922425934 | 2922426942 | 291 |
| 86 | iso_pu_bacteria | 2929615660 | 2929619890 | 291 |
| 87 | iso_pu_bacteria | 2929624759 | 2929629202 | 291 |
| 88 | iso_pu_bacteria | 2932784394 | 2932789667 | 291 |
| 89 | iso_pu_bacteria | 2932794094 | 2932796664 | 291 |
| 90 | iso_pu_bacteria | 2932801729 | 2932802556 | 291 |
| 91 | iso_pu_bacteria | 2932809354 | 2932814827 | 291 |
| 92 | iso_pu_bacteria | 2932818245 | 2932824316 | 291 |
| 93 | iso_pu_bacteria | 2932828146 | 2932833956 | 291 |
| 94 | iso_pu_bacteria | 2933577622 | 2933581808 | 291 |
| 95 | iso_pu_bacteria | 2935608549 | 2935613265 | 291 |
| 96 | iso_pu_bacteria | 2935616580 | 2935623654 | 291 |
| 97 | iso_pu_bacteria | 2935638405 | 2935645041 | 291 |
| 98 | iso_pu_bacteria | 2935648319 | 2935656621 | 291 |
| 99 | iso_pu_bacteria | 2935656913 | 2935665455 | 291 |
| 100 | iso_pu_bacteria | 2935665750 | 2935672090 | 291 |
| 101 | iso_pu_bacteria | 2935675223 | 2935684104 | 291 |
| 102 | iso_pu_bacteria | 2935684952 | 2935689153 | 291 |
| 103 | iso_pu_bacteria | 2935694250 | 2935697587 | 291 |
| 104 | iso_pu_bacteria | 2935703347 | 2935711387 | 291 |
| 105 | iso_pu_bacteria | 2935713505 | 2935720099 | 291 |
| 106 | iso_pu_bacteria | 2935722832 | 2935728284 | 291 |
| 107 | iso_pu_bacteria | 2935732158 | 2935737119 | 291 |
| 108 | iso_pu_bacteria | 2935741537 | 2935746820 | 291 |
| 109 | iso_pu_bacteria | 2935750917 | 2935757787 | 291 |
| 110 | iso_pu_bacteria | 2935760218 | 2935764167 | 291 |
| 111 | iso_pu_bacteria | 2935777560 | 2935780106 | 291 |
| 112 | iso_pu_bacteria | 2935785616 | 2935790228 | 291 |
| 113 | iso_pu_bacteria | 2935793552 | 2935798730 | 291 |
| 114 | iso_pu_bacteria | 2935801545 | 2935808753 | 291 |
| 115 | iso_pu_bacteria | 2935810662 | 2935817550 | 291 |
| 116 | iso_pu_bacteria | 2935819856 | 2935824881 | 291 |
| 117 | iso_pu_bacteria | 2935827899 | 2935834113 | 291 |
| 118 | iso_pu_bacteria | 2935837841 | 2935844715 | 291 |
| 119 | iso_pu_bacteria | 2935847175 | 2935852101 | 291 |
| 120 | iso_pu_bacteria | 2935855204 | 2935861739 | 291 |
| 121 | iso_pu_bacteria | 2935864058 | 2935868625 | 291 |
| 122 | iso_pu_bacteria | 2935873716 | 2935879399 | 291 |
| 123 | iso_pu_bacteria | 2935883170 | 2935887004 | 291 |
| 124 | iso_pu_bacteria | 2935908558 | 2935911448 | 291 |
| 125 | iso_pu_bacteria | 2935916978 | 2935920983 | 291 |
| 126 | iso_pu_bacteria | 2935926038 | 2935928477 | 291 |
| 127 | iso_pu_bacteria | 2935934488 | 2935938122 | 291 |
| 128 | iso_pu_bacteria | 2935942939 | 2935945404 | 291 |
| 129 | iso_pu_bacteria | 2935951376 | 2935954090 | 291 |
| 130 | iso_pu_bacteria | 2935959822 | 2935965470 | 291 |
| 131 | iso_pu_bacteria | 2935967501 | 2935971642 | 291 |
| 132 | iso_pu_bacteria | 2935975950 | 2935980046 | 291 |
| 133 | iso_pu_bacteria | 2935984226 | 2935989474 | 291 |
| 134 | iso_pu_bacteria | 2935992306 | 2935998433 | 291 |
| 135 | iso_pu_bacteria | 2936002035 | 2936009106 | 291 |
| 136 | iso_pu_bacteria | 2936011229 | 2936019484 | 291 |
| 137 | iso_pu_bacteria | 2936019824 | 2936028106 | 291 |
| 138 | iso_pu_bacteria | 2936028420 | 2936036940 | 291 |
| 139 | iso_pu_bacteria | 2936037263 | 2936044347 | 291 |
| 140 | iso_pu_bacteria | 2936046547 | 2936054963 | 291 |
| 141 | iso_pu_bacteria | 2936055302 | 2936060730 | 291 |
| 142 | iso_pu_bacteria | 2940556831 | 2940563391 | 291 |
| 143 | iso_pu_bacteria | 2941531003 | 2941531899 | 291 |
| 144 | iso_pu_bacteria | 2941538514 | 2941545390 | 291 |
| 145 | iso_pu_bacteria | 3005587118 | 3005592751 | 291 |
| 146 | iso_pu_bacteria | 8006926726 | 8006929532 | 291 |
| 147 | iso_pu_bacteria | 8006984368 | 8006989993 | 291 |
| 148 | iso_pu_bacteria | 8016511872 | 8016519231 | 291 |
| 149 | iso_pu_bacteria | 8016530956 | 8016538669 | 291 |
| 150 | iso_pu_bacteria | 8016539877 | 8016542956 | 291 |
| 151 | iso_pu_bacteria | 8016548790 | 8016550335 | 291 |
| 152 | iso_pu_bacteria | 8016557553 | 8016558742 | 291 |
| 153 | iso_pu_bacteria | 8016566248 | 8016568353 | 291 |
| 154 | iso_pu_bacteria | 8016575299 | 8016581012 | 291 |
| 155 | iso_pu_bacteria | 8016595262 | 8016596718 | 291 |
| 156 | iso_pu_bacteria | 8016613128 | 8016619388 | 291 |
| 157 | iso_pu_bacteria | 8016622563 | 8016630205 | 291 |
| 158 | iso_pu_bacteria | 8016630954 | 8016636945 | 291 |
| 159 | iso_pu_bacteria | 8017057580 | 8017066279 | 291 |
| 160 | iso_pu_bacteria | 8019530166 | 8019538341 | 291 |
| 161 | iso_pu_bacteria | 8019538911 | 8019541481 | 291 |
| 162 | iso_pu_bacteria | 8019547302 | 8019549146 | 291 |
| 163 | iso_pu_bacteria | 8019576017 | 8019578344 | 291 |
| 164 | iso_pu_bacteria | 8019586578 | 8019596382 | 291 |
| 165 | iso_pu_bacteria | 8019597564 | 8019605319 | 291 |
| 166 | iso_pu_bacteria | 8019619141 | 8019623905 | 291 |
| 167 | iso_pu_bacteria | 8019629233 | 8019638134 | 291 |
| 168 | iso_pu_bacteria | 8019638758 | 8019641501 | 291 |
| 169 | iso_pu_bacteria | 8019648815 | 8019651542 | 291 |
| 170 | iso_pu_bacteria | 8019659431 | 8019666049 | 291 |
| 171 | iso_pu_bacteria | 8019668869 | 8019675568 | 291 |
| 172 | iso_pu_bacteria | 8055742211 | 8055750358 | 291 |
| 173 | iso_pu_bacteria | 8056689827 | 8056691978 | 291 |
| 174 | 3300005539 | Ga0068853_100007083 | Ga0068853_1000070835 | 293 |
| 175 | 3300005578 | Ga0068854_100126267 | Ga0068854_1001262673 | 293 |
| 176 | 3300005614 | Ga0068856_100010527 | Ga0068856_1000105275 | 293 |
| 177 | 3300005616 | Ga0068852_100041617 | Ga0068852_1000416175 | 293 |
| 178 | 3300009093 | Ga0105240_10017804 | Ga0105240_100178044 | 293 |
| 179 | 3300009174 | Ga0105241_10001388 | Ga0105241_1000138811 | 293 |
| 180 | 3300009545 | Ga0105237_10208382 | Ga0105237_102083821 | 293 |
| 181 | 3300009551 | Ga0105238_10066453 | Ga0105238_100664531 | 293 |
| 182 | 3300010375 | Ga0105239_10276817 | Ga0105239_102768173 | 293 |
| 183 | 3300021377 | Ga0213874_10013098 | Ga0213874_100130983 | 293 |
| 184 | 3300025321 | Ga0207656_10034217 | Ga0207656_100342174 | 293 |
| 185 | 3300025911 | Ga0207654_10000729 | Ga0207654_100007293 | 293 |
| 186 | 3300025913 | Ga0207695_10004497 | Ga0207695_100044978 | 293 |
| 187 | 3300025924 | Ga0207694_10000849 | Ga0207694_1000084914 | 293 |
| 188 | 3300025949 | Ga0207667_10021686 | Ga0207667_100216863 | 293 |
| 189 | 3300025981 | Ga0207640_10053654 | Ga0207640_100536544 | 293 |
| 190 | 3300026041 | Ga0207639_10032132 | Ga0207639_100321323 | 293 |
| 191 | 3300026078 | Ga0207702_10000003 | Ga0207702_1000000359 | 293 |
| 192 | 3300026116 | Ga0207674_10012928 | Ga0207674_100129282 | 293 |
| 193 | 3300005539 | Ga0068853_100289547 | Ga0068853_1002895471 | 294 |
| 194 | 3300005548 | Ga0070665_100430113 | Ga0070665_1004301132 | 294 |
| 195 | 3300009101 | Ga0105247_10043858 | Ga0105247_100438582 | 294 |
| 196 | 3300010159 | Ga0099796_10038085 | Ga0099796_100380851 | 294 |
| 197 | 3300010375 | Ga0105239_10201586 | Ga0105239_102015862 | 294 |
| 198 | 3300025253 | Ga0209677_100470 | Ga0209677_10047029 | 294 |
| 199 | 3300025272 | Ga0209455_1007332 | Ga0209455_10073322 | 294 |
| 200 | 3300025297 | Ga0209758_1037291 | Ga0209758_10372911 | 294 |
| 201 | 3300025900 | Ga0207710_10011534 | Ga0207710_100115342 | 294 |
| 202 | 3300026035 | Ga0207703_10087840 | Ga0207703_100878404 | 294 |
| 203 | 3300026041 | Ga0207639_10312378 | Ga0207639_103123782 | 294 |
| 204 | 3300028556 | Ga0265337_1045356 | Ga0265337_10453561 | 294 |
| 205 | 3300028666 | Ga0265336_10000348 | Ga0265336_100003489 | 294 |
| 206 | 3300028800 | Ga0265338_10000018 | Ga0265338_10000018315 | 294 |
| 207 | 3300035725 | Ga0373947_0157668 | Ga0373947_0157668_93_1040 | 294 |
| 208 | 3300039437 | Ga0436365_0657970 | Ga0436365_0657970_186_1070 | 294 |
| 209 | 3300039437 | Ga0436365_0931463 | Ga0436365_0931463_182_1129 | 294 |
| 210 | 3300044842 | Ga0466957_0119170 | Ga0466957_0119170_718_1602 | 294 |
| 211 | 3300048903 | Ga0496100_0079153 | Ga0496100_0079153_994_1941 | 294 |
| 212 | 3300048904 | Ga0496101_0106347 | Ga0496101_0106347_345_1292 | 294 |
| 213 | 3300048907 | Ga0496104_0000948 | Ga0496104_0000948_6418_7365 | 294 |
| 214 | 3300048908 | Ga0496105_0001280 | Ga0496105_0001280_1213_2160 | 294 |
| 215 | 3300048909 | Ga0496106_0151458 | Ga0496106_0151458_261_1208 | 294 |
| 216 | 3300048911 | Ga0496108_0000479 | Ga0496108_0000479_3343_4290 | 294 |
| 217 | 3300048912 | Ga0496109_0009376 | Ga0496109_0009376_939_1886 | 294 |
| 218 | 3300048913 | Ga0496110_0025120 | Ga0496110_0025120_1514_2461 | 294 |
| 219 | 3300048913 | Ga0496110_0056560 | Ga0496110_0056560_688_1635 | 294 |
| 220 | 3300048914 | Ga0496111_0000112 | Ga0496111_0000112_20560_21507 | 294 |
| 221 | 3300048915 | Ga0496112_0032020 | Ga0496112_0032020_2036_2983 | 294 |
| 222 | 3300048916 | Ga0496113_0000762 | Ga0496113_0000762_11958_12905 | 294 |
| 223 | 3300048918 | Ga0496115_0014569 | Ga0496115_0014569_327_1274 | 294 |
| 224 | 3300048921 | Ga0496118_0036454 | Ga0496118_0036454_464_1348 | 294 |
| 225 | 3300048921 | Ga0496118_0136393 | Ga0496118_0136393_652_1536 | 294 |
| 226 | 3300048924 | Ga0496121_0113432 | Ga0496121_0113432_1117_2001 | 294 |
| 227 | 3300048927 | Ga0496124_0054938 | Ga0496124_0054938_1461_2345 | 294 |
| 228 | 3300048928 | Ga0496125_0025529 | Ga0496125_0025529_2020_2904 | 294 |
| 229 | 3300049568 | Ga0501031_0020264 | Ga0501031_0020264_2637_3521 | 294 |
| 230 | 3300049569 | Ga0501032_0017757 | Ga0501032_0017757_713_1597 | 294 |
| 231 | 3300049570 | Ga0501033_0000672 | Ga0501033_0000672_6824_7708 | 294 |
| 232 | 3300049572 | Ga0501036_0129667 | Ga0501036_0129667_631_1515 | 294 |
| 233 | 3300049573 | Ga0501037_0055311 | Ga0501037_0055311_954_1838 | 294 |
| 234 | 3300049574 | Ga0501038_0023061 | Ga0501038_0023061_3644_4528 | 294 |
| 235 | 3300049574 | Ga0501038_0144142 | Ga0501038_0144142_1045_1929 | 294 |
| 236 | 3300049575 | Ga0501039_0014332 | Ga0501039_0014332_384_1268 | 294 |
| 237 | 3300049578 | Ga0501042_0053990 | Ga0501042_0053990_1951_2835 | 294 |
| 238 | 3300049580 | Ga0501046_0050507 | Ga0501046_0050507_731_1615 | 294 |
| 239 | 3300049580 | Ga0501046_0236188 | Ga0501046_0236188_361_1245 | 294 |
| 240 | 3300049589 | Ga0501073_0106062 | Ga0501073_0106062_177_1061 | 294 |
| 241 | 3300049741 | Ga0501079_0209186 | Ga0501079_0209186_24_908 | 294 |
| 242 | 3300049742 | Ga0501080_0054964 | Ga0501080_0054964_2282_3166 | 294 |
| 243 | 3300049822 | Ga0501035_0022354 | Ga0501035_0022354_2506_3390 | 294 |
| 244 | 3300049823 | Ga0501044_0019722 | Ga0501044_0019722_749_1633 | 294 |
| 245 | 3300053111 | Ga0500572_000383 | Ga0500572_000383_1418_2302 | 294 |
| 246 | 3300053136 | Ga0500559_0000486 | Ga0500559_0000486_6385_7269 | 294 |
| 247 | 3300053150 | Ga0500603_021454 | Ga0500603_021454_62_946 | 294 |
| 248 | 3300053163 | Ga0500639_028645 | Ga0500639_028645_789_1673 | 294 |
| 249 | 3300053177 | Ga0500636_0042827 | Ga0500636_0042827_107_991 | 294 |
| 250 | 3300053735 | Ga0500596_015230 | Ga0500596_015230_63_947 | 294 |
| 251 | 3300053737 | Ga0500601_005147 | Ga0500601_005147_438_1322 | 294 |
| 252 | iso_pu_bacteria | 2738541281 | 2738746396 | 294 |
| 253 | iso_pu_bacteria | 2738543032 | 2739355626 | 294 |
| 254 | 3300003203 | JGI25406J46586_10006073 | JGI25406J46586_100060733 | 295 |
| 255 | 3300003215 | JGI25153J46596_10004803 | JGI25153J46596_100048039 | 295 |
| 256 | 3300003215 | JGI25153J46596_10028115 | JGI25153J46596_100281151 | 295 |
| 257 | 3300003354 | JGI25160J50197_1024331 | JGI25160J50197_10243311 | 295 |
| 258 | 3300003659 | JGI25404J52841_10001048 | JGI25404J52841_100010482 | 295 |
| 259 | 3300003794 | Ga0055531_10020619 | Ga0055531_100206191 | 295 |
| 260 | 3300004625 | Ga0055543_1012260 | Ga0055543_10122601 | 295 |
| 261 | 3300005262 | Ga0065165_1030520 | Ga0065165_10305202 | 295 |
| 262 | 3300005327 | Ga0070658_10011197 | Ga0070658_100111976 | 295 |
| 263 | 3300005327 | Ga0070658_10064095 | Ga0070658_100640954 | 295 |
| 264 | 3300005327 | Ga0070658_10355905 | Ga0070658_103559051 | 295 |
| 265 | 3300005329 | Ga0070683_100035992 | Ga0070683_1000359924 | 295 |
| 266 | 3300005329 | Ga0070683_100046881 | Ga0070683_1000468815 | 295 |
| 267 | 3300005329 | Ga0070683_100110710 | Ga0070683_1001107102 | 295 |
| 268 | 3300005336 | Ga0070680_100020407 | Ga0070680_1000204076 | 295 |
| 269 | 3300005336 | Ga0070680_100034052 | Ga0070680_1000340521 | 295 |
| 270 | 3300005336 | Ga0070680_100104526 | Ga0070680_1001045262 | 295 |
| 271 | 3300005336 | Ga0070680_100132343 | Ga0070680_1001323432 | 295 |
| 272 | 3300005337 | Ga0070682_100294312 | Ga0070682_1002943121 | 295 |
| 273 | 3300005338 | Ga0068868_100235674 | Ga0068868_1002356742 | 295 |
| 274 | 3300005339 | Ga0070660_100019955 | Ga0070660_1000199557 | 295 |
| 275 | 3300005339 | Ga0070660_100052201 | Ga0070660_1000522012 | 295 |
| 276 | 3300005347 | Ga0070668_100110800 | Ga0070668_1001108001 | 295 |
| 277 | 3300005355 | Ga0070671_100166203 | Ga0070671_1001662032 | 295 |
| 278 | 3300005355 | Ga0070671_100307646 | Ga0070671_1003076462 | 295 |
| 279 | 3300005356 | Ga0070674_100170542 | Ga0070674_1001705421 | 295 |
| 280 | 3300005366 | Ga0070659_100128407 | Ga0070659_1001284072 | 295 |
| 281 | 3300005367 | Ga0070667_100143556 | Ga0070667_1001435562 | 295 |
| 282 | 3300005434 | Ga0070709_10009651 | Ga0070709_100096514 | 295 |
| 283 | 3300005434 | Ga0070709_10056134 | Ga0070709_100561343 | 295 |
| 284 | 3300005434 | Ga0070709_10116826 | Ga0070709_101168263 | 295 |
| 285 | 3300005435 | Ga0070714_100169165 | Ga0070714_1001691651 | 295 |
| 286 | 3300005436 | Ga0070713_100007733 | Ga0070713_1000077338 | 295 |
| 287 | 3300005436 | Ga0070713_100044539 | Ga0070713_1000445394 | 295 |
| 288 | 3300005436 | Ga0070713_100056937 | Ga0070713_1000569372 | 295 |
| 289 | 3300005436 | Ga0070713_100593325 | Ga0070713_1005933251 | 295 |
| 290 | 3300005437 | Ga0070710_10000707 | Ga0070710_1000070718 | 295 |
| 291 | 3300005437 | Ga0070710_10015339 | Ga0070710_100153396 | 295 |
| 292 | 3300005438 | Ga0070701_10146990 | Ga0070701_101469901 | 295 |
| 293 | 3300005439 | Ga0070711_100006676 | Ga0070711_1000066761 | 295 |
| 294 | 3300005439 | Ga0070711_100016881 | Ga0070711_1000168813 | 295 |
| 295 | 3300005439 | Ga0070711_100067059 | Ga0070711_1000670593 | 295 |
| 296 | 3300005439 | Ga0070711_100380914 | Ga0070711_1003809141 | 295 |
| 297 | 3300005440 | Ga0070705_100096817 | Ga0070705_1000968172 | 295 |
| 298 | 3300005441 | Ga0070700_100420737 | Ga0070700_1004207371 | 295 |
| 299 | 3300005445 | Ga0070708_100685664 | Ga0070708_1006856641 | 295 |
| 300 | 3300005455 | Ga0070663_100049756 | Ga0070663_1000497565 | 295 |
| 301 | 3300005456 | Ga0070678_100067611 | Ga0070678_1000676114 | 295 |
| 302 | 3300005456 | Ga0070678_100112722 | Ga0070678_1001127222 | 295 |
| 303 | 3300005458 | Ga0070681_10209901 | Ga0070681_102099012 | 295 |
| 304 | 3300005471 | Ga0070698_100154937 | Ga0070698_1001549371 | 295 |
| 305 | 3300005530 | Ga0070679_100020129 | Ga0070679_1000201296 | 295 |
| 306 | 3300005530 | Ga0070679_100042976 | Ga0070679_1000429765 | 295 |
| 307 | 3300005530 | Ga0070679_100445048 | Ga0070679_1004450481 | 295 |
| 308 | 3300005535 | Ga0070684_100018149 | Ga0070684_1000181493 | 295 |
| 309 | 3300005535 | Ga0070684_100021264 | Ga0070684_1000212646 | 295 |
| 310 | 3300005535 | Ga0070684_100083447 | Ga0070684_1000834472 | 295 |
| 311 | 3300005535 | Ga0070684_100252410 | Ga0070684_1002524102 | 295 |
| 312 | 3300005536 | Ga0070697_100090441 | Ga0070697_1000904411 | 295 |
| 313 | 3300005536 | Ga0070697_100326297 | Ga0070697_1003262971 | 295 |
| 314 | 3300005539 | Ga0068853_100007085 | Ga0068853_1000070853 | 295 |
| 315 | 3300005539 | Ga0068853_100082352 | Ga0068853_1000823521 | 295 |
| 316 | 3300005539 | Ga0068853_100097672 | Ga0068853_1000976721 | 295 |
| 317 | 3300005548 | Ga0070665_100038638 | Ga0070665_1000386382 | 295 |
| 318 | 3300005548 | Ga0070665_100176196 | Ga0070665_1001761962 | 295 |
| 319 | 3300005548 | Ga0070665_100176978 | Ga0070665_1001769782 | 295 |
| 320 | 3300005548 | Ga0070665_100197527 | Ga0070665_1001975273 | 295 |
| 321 | 3300005548 | Ga0070665_100286751 | Ga0070665_1002867512 | 295 |
| 322 | 3300005563 | Ga0068855_100048105 | Ga0068855_1000481055 | 295 |
| 323 | 3300005563 | Ga0068855_100054394 | Ga0068855_1000543942 | 295 |
| 324 | 3300005563 | Ga0068855_100064837 | Ga0068855_1000648374 | 295 |
| 325 | 3300005563 | Ga0068855_100113485 | Ga0068855_1001134854 | 295 |
| 326 | 3300005563 | Ga0068855_100488585 | Ga0068855_1004885852 | 295 |
| 327 | 3300005563 | Ga0068855_100512354 | Ga0068855_1005123541 | 295 |
| 328 | 3300005564 | Ga0070664_100222862 | Ga0070664_1002228623 | 295 |
| 329 | 3300005564 | Ga0070664_100268983 | Ga0070664_1002689832 | 295 |
| 330 | 3300005577 | Ga0068857_100045081 | Ga0068857_1000450813 | 295 |
| 331 | 3300005577 | Ga0068857_100110228 | Ga0068857_1001102281 | 295 |
| 332 | 3300005614 | Ga0068856_100000522 | Ga0068856_10000052225 | 295 |
| 333 | 3300005614 | Ga0068856_100172156 | Ga0068856_1001721562 | 295 |
| 334 | 3300005614 | Ga0068856_100265444 | Ga0068856_1002654442 | 295 |
| 335 | 3300005614 | Ga0068856_100426722 | Ga0068856_1004267222 | 295 |
| 336 | 3300005616 | Ga0068852_100021761 | Ga0068852_1000217612 | 295 |
| 337 | 3300005616 | Ga0068852_100047847 | Ga0068852_1000478473 | 295 |
| 338 | 3300005616 | Ga0068852_100365435 | Ga0068852_1003654351 | 295 |
| 339 | 3300005618 | Ga0068864_100037310 | Ga0068864_1000373102 | 295 |
| 340 | 3300005618 | Ga0068864_100159098 | Ga0068864_1001590982 | 295 |
| 341 | 3300005618 | Ga0068864_100200349 | Ga0068864_1002003493 | 295 |
| 342 | 3300005719 | Ga0068861_100222100 | Ga0068861_1002221002 | 295 |
| 343 | 3300005719 | Ga0068861_100517647 | Ga0068861_1005176471 | 295 |
| 344 | 3300005841 | Ga0068863_100119367 | Ga0068863_1001193672 | 295 |
| 345 | 3300005842 | Ga0068858_100150021 | Ga0068858_1001500212 | 295 |
| 346 | 3300005842 | Ga0068858_100183632 | Ga0068858_1001836323 | 295 |
| 347 | 3300005842 | Ga0068858_100339526 | Ga0068858_1003395262 | 295 |
| 348 | 3300005843 | Ga0068860_100000441 | Ga0068860_10000044128 | 295 |
| 349 | 3300005843 | Ga0068860_100177701 | Ga0068860_1001777012 | 295 |
| 350 | 3300005937 | Ga0081455_10034005 | Ga0081455_100340052 | 295 |
| 351 | 3300005937 | Ga0081455_10105365 | Ga0081455_101053652 | 295 |
| 352 | 3300005983 | Ga0081540_1017509 | Ga0081540_10175093 | 295 |
| 353 | 3300005983 | Ga0081540_1018219 | Ga0081540_10182195 | 295 |
| 354 | 3300005983 | Ga0081540_1025852 | Ga0081540_10258524 | 295 |
| 355 | 3300005983 | Ga0081540_1026432 | Ga0081540_10264322 | 295 |
| 356 | 3300005983 | Ga0081540_1048367 | Ga0081540_10483672 | 295 |
| 357 | 3300005983 | Ga0081540_1048528 | Ga0081540_10485283 | 295 |
| 358 | 3300005985 | Ga0081539_10000425 | Ga0081539_1000042574 | 295 |
| 359 | 3300005985 | Ga0081539_10001114 | Ga0081539_1000111438 | 295 |
| 360 | 3300005985 | Ga0081539_10032892 | Ga0081539_100328923 | 295 |
| 361 | 3300005985 | Ga0081539_10053402 | Ga0081539_100534022 | 295 |
| 362 | 3300006028 | Ga0070717_10000325 | Ga0070717_100003253 | 295 |
| 363 | 3300006028 | Ga0070717_10123243 | Ga0070717_101232434 | 295 |
| 364 | 3300006028 | Ga0070717_10147620 | Ga0070717_101476202 | 295 |
| 365 | 3300006038 | Ga0075365_10128266 | Ga0075365_101282662 | 295 |
| 366 | 3300006038 | Ga0075365_10183961 | Ga0075365_101839611 | 295 |
| 367 | 3300006048 | Ga0075363_100012045 | Ga0075363_1000120452 | 295 |
| 368 | 3300006048 | Ga0075363_100064202 | Ga0075363_1000642023 | 295 |
| 369 | 3300006048 | Ga0075363_100100340 | Ga0075363_1001003403 | 295 |
| 370 | 3300006051 | Ga0075364_10083494 | Ga0075364_100834942 | 295 |
| 371 | 3300006051 | Ga0075364_10207465 | Ga0075364_102074651 | 295 |
| 372 | 3300006163 | Ga0070715_10026071 | Ga0070715_100260713 | 295 |
| 373 | 3300006173 | Ga0070716_100005608 | Ga0070716_1000056087 | 295 |
| 374 | 3300006173 | Ga0070716_100019072 | Ga0070716_1000190723 | 295 |
| 375 | 3300006175 | Ga0070712_100087985 | Ga0070712_1000879853 | 295 |
| 376 | 3300006175 | Ga0070712_100089696 | Ga0070712_1000896961 | 295 |
| 377 | 3300006177 | Ga0075362_10055144 | Ga0075362_100551443 | 295 |
| 378 | 3300006178 | Ga0075367_10067480 | Ga0075367_100674803 | 295 |
| 379 | 3300006178 | Ga0075367_10136013 | Ga0075367_101360132 | 295 |
| 380 | 3300006178 | Ga0075367_10222803 | Ga0075367_102228031 | 295 |
| 381 | 3300006186 | Ga0075369_10042648 | Ga0075369_100426481 | 295 |
| 382 | 3300006195 | Ga0075366_10107625 | Ga0075366_101076252 | 295 |
| 383 | 3300006237 | Ga0097621_100143110 | Ga0097621_1001431102 | 295 |
| 384 | 3300006353 | Ga0075370_10087982 | Ga0075370_100879822 | 295 |
| 385 | 3300006353 | Ga0075370_10118448 | Ga0075370_101184483 | 295 |
| 386 | 3300006358 | Ga0068871_100158319 | Ga0068871_1001583192 | 295 |
| 387 | 3300006358 | Ga0068871_100211502 | Ga0068871_1002115021 | 295 |
| 388 | 3300006871 | Ga0075434_100004469 | Ga0075434_1000044697 | 295 |
| 389 | 3300006871 | Ga0075434_100096067 | Ga0075434_1000960673 | 295 |
| 390 | 3300006871 | Ga0075434_100362343 | Ga0075434_1003623432 | 295 |
| 391 | 3300006881 | Ga0068865_100073449 | Ga0068865_1000734492 | 295 |
| 392 | 3300006941 | Ga0099825_1020668 | Ga0099825_10206681 | 295 |
| 393 | 3300006942 | Ga0099824_1035813 | Ga0099824_10358132 | 295 |
| 394 | 3300006943 | Ga0099822_1007626 | Ga0099822_10076261 | 295 |
| 395 | 3300006943 | Ga0099822_1056766 | Ga0099822_10567661 | 295 |
| 396 | 3300006944 | Ga0099823_1072928 | Ga0099823_10729281 | 295 |
| 397 | 3300007265 | Ga0099794_10012991 | Ga0099794_100129911 | 295 |
| 398 | 3300007788 | Ga0099795_10025691 | Ga0099795_100256911 | 295 |
| 399 | 3300009093 | Ga0105240_10002968 | Ga0105240_1000296813 | 295 |
| 400 | 3300009093 | Ga0105240_10190410 | Ga0105240_101904101 | 295 |
| 401 | 3300009093 | Ga0105240_10227269 | Ga0105240_102272692 | 295 |
| 402 | 3300009093 | Ga0105240_10407263 | Ga0105240_104072632 | 295 |
| 403 | 3300009177 | Ga0105248_10269872 | Ga0105248_102698722 | 295 |
| 404 | 3300009177 | Ga0105248_10496058 | Ga0105248_104960581 | 295 |
| 405 | 3300009545 | Ga0105237_10020853 | Ga0105237_1002085310 | 295 |
| 406 | 3300009545 | Ga0105237_10123107 | Ga0105237_101231073 | 295 |
| 407 | 3300009545 | Ga0105237_10237353 | Ga0105237_102373532 | 295 |
| 408 | 3300009545 | Ga0105237_10341691 | Ga0105237_103416911 | 295 |
| 409 | 3300009551 | Ga0105238_10010451 | Ga0105238_1001045111 | 295 |
| 410 | 3300009551 | Ga0105238_10025037 | Ga0105238_100250376 | 295 |
| 411 | 3300009551 | Ga0105238_10334186 | Ga0105238_103341861 | 295 |
| 412 | 3300009551 | Ga0105238_10451722 | Ga0105238_104517222 | 295 |
| 413 | 3300009551 | Ga0105238_10680530 | Ga0105238_106805301 | 295 |
| 414 | 3300009553 | Ga0105249_10194985 | Ga0105249_101949852 | 295 |
| 415 | 3300009553 | Ga0105249_10361636 | Ga0105249_103616361 | 295 |
| 416 | 3300010159 | Ga0099796_10082867 | Ga0099796_100828671 | 295 |
| 417 | 3300010375 | Ga0105239_10131032 | Ga0105239_101310322 | 295 |
| 418 | 3300013102 | Ga0157371_10015904 | Ga0157371_100159044 | 295 |
| 419 | 3300013104 | Ga0157370_10108237 | Ga0157370_101082372 | 295 |
| 420 | 3300013104 | Ga0157370_10124721 | Ga0157370_101247214 | 295 |
| 421 | 3300013104 | Ga0157370_10180609 | Ga0157370_101806092 | 295 |
| 422 | 3300013105 | Ga0157369_10009007 | Ga0157369_100090073 | 295 |
| 423 | 3300013105 | Ga0157369_10009927 | Ga0157369_1000992710 | 295 |
| 424 | 3300013105 | Ga0157369_10218728 | Ga0157369_102187281 | 295 |
| 425 | 3300013105 | Ga0157369_10343522 | Ga0157369_103435222 | 295 |
| 426 | 3300013296 | Ga0157374_10041978 | Ga0157374_100419782 | 295 |
| 427 | 3300013306 | Ga0163162_10149747 | Ga0163162_101497472 | 295 |
| 428 | 3300013307 | Ga0157372_10079888 | Ga0157372_100798885 | 295 |
| 429 | 3300013307 | Ga0157372_10310985 | Ga0157372_103109851 | 295 |
| 430 | 3300013307 | Ga0157372_10363327 | Ga0157372_103633272 | 295 |
| 431 | 3300013307 | Ga0157372_10418999 | Ga0157372_104189991 | 295 |
| 432 | 3300013307 | Ga0157372_10453038 | Ga0157372_104530382 | 295 |
| 433 | 3300013308 | Ga0157375_10133986 | Ga0157375_101339863 | 295 |
| 434 | 3300013308 | Ga0157375_10212208 | Ga0157375_102122082 | 295 |
| 435 | 3300014325 | Ga0163163_10081730 | Ga0163163_100817302 | 295 |
| 436 | 3300014325 | Ga0163163_10230508 | Ga0163163_102305081 | 295 |
| 437 | 3300014745 | Ga0157377_10091376 | Ga0157377_100913761 | 295 |
| 438 | 3300014969 | Ga0157376_10110571 | Ga0157376_101105712 | 295 |
| 439 | 3300014969 | Ga0157376_10311911 | Ga0157376_103119112 | 295 |
| 440 | 3300021320 | Ga0214544_1000011 | Ga0214544_100001164 | 295 |
| 441 | 3300021321 | Ga0214542_1000009 | Ga0214542_1000009178 | 295 |
| 442 | 3300021324 | Ga0214545_1000007 | Ga0214545_100000764 | 295 |
| 443 | 3300021327 | Ga0214543_1000020 | Ga0214543_1000020178 | 295 |
| 444 | 3300021361 | Ga0213872_10019823 | Ga0213872_100198231 | 295 |
| 445 | 3300021377 | Ga0213874_10013163 | Ga0213874_100131633 | 295 |
| 446 | 3300021384 | Ga0213876_10001735 | Ga0213876_100017351 | 295 |
| 447 | 3300024227 | Ga0228598_1032947 | Ga0228598_10329471 | 295 |
| 448 | 3300025295 | Ga0209564_1008389 | Ga0209564_10083892 | 295 |
| 449 | 3300025297 | Ga0209758_1000106 | Ga0209758_1000106120 | 295 |
| 450 | 3300025297 | Ga0209758_1001683 | Ga0209758_100168316 | 295 |
| 451 | 3300025297 | Ga0209758_1002332 | Ga0209758_100233210 | 295 |
| 452 | 3300025297 | Ga0209758_1006430 | Ga0209758_10064304 | 295 |
| 453 | 3300025298 | Ga0209050_1022586 | Ga0209050_10225862 | 295 |
| 454 | 3300025302 | Ga0207426_1003263 | Ga0207426_10032637 | 295 |
| 455 | 3300025304 | Ga0209257_1001741 | Ga0209257_100174111 | 295 |
| 456 | 3300025898 | Ga0207692_10005117 | Ga0207692_100051173 | 295 |
| 457 | 3300025898 | Ga0207692_10008782 | Ga0207692_100087823 | 295 |
| 458 | 3300025898 | Ga0207692_10063539 | Ga0207692_100635391 | 295 |
| 459 | 3300025900 | Ga0207710_10072188 | Ga0207710_100721881 | 295 |
| 460 | 3300025900 | Ga0207710_10126377 | Ga0207710_101263772 | 295 |
| 461 | 3300025903 | Ga0207680_10164264 | Ga0207680_101642641 | 295 |
| 462 | 3300025905 | Ga0207685_10003939 | Ga0207685_100039391 | 295 |
| 463 | 3300025905 | Ga0207685_10015299 | Ga0207685_100152993 | 295 |
| 464 | 3300025906 | Ga0207699_10000740 | Ga0207699_1000074010 | 295 |
| 465 | 3300025906 | Ga0207699_10006844 | Ga0207699_100068445 | 295 |
| 466 | 3300025906 | Ga0207699_10055566 | Ga0207699_100555663 | 295 |
| 467 | 3300025909 | Ga0207705_10038645 | Ga0207705_100386452 | 295 |
| 468 | 3300025910 | Ga0207684_10262085 | Ga0207684_102620851 | 295 |
| 469 | 3300025911 | Ga0207654_10184902 | Ga0207654_101849021 | 295 |
| 470 | 3300025912 | Ga0207707_10000541 | Ga0207707_1000054123 | 295 |
| 471 | 3300025912 | Ga0207707_10000582 | Ga0207707_1000058228 | 295 |
| 472 | 3300025912 | Ga0207707_10064900 | Ga0207707_100649003 | 295 |
| 473 | 3300025913 | Ga0207695_10000478 | Ga0207695_1000047852 | 295 |
| 474 | 3300025913 | Ga0207695_10018101 | Ga0207695_100181015 | 295 |
| 475 | 3300025913 | Ga0207695_10031949 | Ga0207695_100319496 | 295 |
| 476 | 3300025914 | Ga0207671_10003084 | Ga0207671_1000308411 | 295 |
| 477 | 3300025914 | Ga0207671_10030076 | Ga0207671_100300761 | 295 |
| 478 | 3300025914 | Ga0207671_10044416 | Ga0207671_100444163 | 295 |
| 479 | 3300025914 | Ga0207671_10156052 | Ga0207671_101560522 | 295 |
| 480 | 3300025914 | Ga0207671_10162138 | Ga0207671_101621381 | 295 |
| 481 | 3300025914 | Ga0207671_10183495 | Ga0207671_101834952 | 295 |
| 482 | 3300025915 | Ga0207693_10005512 | Ga0207693_1000551211 | 295 |
| 483 | 3300025915 | Ga0207693_10008208 | Ga0207693_100082083 | 295 |
| 484 | 3300025915 | Ga0207693_10014476 | Ga0207693_100144765 | 295 |
| 485 | 3300025915 | Ga0207693_10090801 | Ga0207693_100908013 | 295 |
| 486 | 3300025915 | Ga0207693_10288729 | Ga0207693_102887291 | 295 |
| 487 | 3300025916 | Ga0207663_10000425 | Ga0207663_1000042515 | 295 |
| 488 | 3300025916 | Ga0207663_10057794 | Ga0207663_100577943 | 295 |
| 489 | 3300025916 | Ga0207663_10072056 | Ga0207663_100720563 | 295 |
| 490 | 3300025916 | Ga0207663_10110833 | Ga0207663_101108331 | 295 |
| 491 | 3300025916 | Ga0207663_10138454 | Ga0207663_101384541 | 295 |
| 492 | 3300025917 | Ga0207660_10022911 | Ga0207660_100229114 | 295 |
| 493 | 3300025917 | Ga0207660_10074692 | Ga0207660_100746924 | 295 |
| 494 | 3300025919 | Ga0207657_10002950 | Ga0207657_1000295010 | 295 |
| 495 | 3300025919 | Ga0207657_10136726 | Ga0207657_101367262 | 295 |
| 496 | 3300025920 | Ga0207649_10123275 | Ga0207649_101232752 | 295 |
| 497 | 3300025921 | Ga0207652_10004959 | Ga0207652_100049592 | 295 |
| 498 | 3300025921 | Ga0207652_10005910 | Ga0207652_100059109 | 295 |
| 499 | 3300025921 | Ga0207652_10138958 | Ga0207652_101389583 | 295 |
| 500 | 3300025923 | Ga0207681_10136395 | Ga0207681_101363952 | 295 |
| 501 | 3300025923 | Ga0207681_10277034 | Ga0207681_102770342 | 295 |
| 502 | 3300025924 | Ga0207694_10015749 | Ga0207694_100157495 | 295 |
| 503 | 3300025924 | Ga0207694_10159501 | Ga0207694_101595012 | 295 |
| 504 | 3300025927 | Ga0207687_10320813 | Ga0207687_103208131 | 295 |
| 505 | 3300025928 | Ga0207700_10004824 | Ga0207700_100048241 | 295 |
| 506 | 3300025928 | Ga0207700_10107598 | Ga0207700_101075982 | 295 |
| 507 | 3300025928 | Ga0207700_10308074 | Ga0207700_103080742 | 295 |
| 508 | 3300025929 | Ga0207664_10150991 | Ga0207664_101509913 | 295 |
| 509 | 3300025929 | Ga0207664_10293691 | Ga0207664_102936911 | 295 |
| 510 | 3300025931 | Ga0207644_10160881 | Ga0207644_101608811 | 295 |
| 511 | 3300025931 | Ga0207644_10200252 | Ga0207644_102002522 | 295 |
| 512 | 3300025932 | Ga0207690_10112687 | Ga0207690_101126871 | 295 |
| 513 | 3300025932 | Ga0207690_10151692 | Ga0207690_101516921 | 295 |
| 514 | 3300025937 | Ga0207669_10014908 | Ga0207669_100149083 | 295 |
| 515 | 3300025938 | Ga0207704_10009478 | Ga0207704_100094784 | 295 |
| 516 | 3300025939 | Ga0207665_10003367 | Ga0207665_1000336711 | 295 |
| 517 | 3300025939 | Ga0207665_10003573 | Ga0207665_100035733 | 295 |
| 518 | 3300025940 | Ga0207691_10412079 | Ga0207691_104120791 | 295 |
| 519 | 3300025941 | Ga0207711_10293994 | Ga0207711_102939942 | 295 |
| 520 | 3300025942 | Ga0207689_10155732 | Ga0207689_101557321 | 295 |
| 521 | 3300025942 | Ga0207689_10174428 | Ga0207689_101744282 | 295 |
| 522 | 3300025942 | Ga0207689_10343299 | Ga0207689_103432992 | 295 |
| 523 | 3300025944 | Ga0207661_10000109 | Ga0207661_1000010921 | 295 |
| 524 | 3300025944 | Ga0207661_10081608 | Ga0207661_100816084 | 295 |
| 525 | 3300025949 | Ga0207667_10083996 | Ga0207667_100839961 | 295 |
| 526 | 3300025949 | Ga0207667_10123692 | Ga0207667_101236922 | 295 |
| 527 | 3300025949 | Ga0207667_10125735 | Ga0207667_101257352 | 295 |
| 528 | 3300025949 | Ga0207667_10215053 | Ga0207667_102150532 | 295 |
| 529 | 3300025949 | Ga0207667_10432994 | Ga0207667_104329942 | 295 |
| 530 | 3300025949 | Ga0207667_10481998 | Ga0207667_104819981 | 295 |
| 531 | 3300025972 | Ga0207668_10015127 | Ga0207668_100151271 | 295 |
| 532 | 3300025972 | Ga0207668_10405550 | Ga0207668_104055501 | 295 |
| 533 | 3300026023 | Ga0207677_10067744 | Ga0207677_100677442 | 295 |
| 534 | 3300026023 | Ga0207677_10080223 | Ga0207677_100802231 | 295 |
| 535 | 3300026035 | Ga0207703_10104833 | Ga0207703_101048331 | 295 |
| 536 | 3300026035 | Ga0207703_10253798 | Ga0207703_102537981 | 295 |
| 537 | 3300026035 | Ga0207703_10425232 | Ga0207703_104252321 | 295 |
| 538 | 3300026035 | Ga0207703_10471963 | Ga0207703_104719631 | 295 |
| 539 | 3300026041 | Ga0207639_10007486 | Ga0207639_100074867 | 295 |
| 540 | 3300026041 | Ga0207639_10223000 | Ga0207639_102230002 | 295 |
| 541 | 3300026041 | Ga0207639_10260091 | Ga0207639_102600911 | 295 |
| 542 | 3300026067 | Ga0207678_10046082 | Ga0207678_100460822 | 295 |
| 543 | 3300026067 | Ga0207678_10148445 | Ga0207678_101484453 | 295 |
| 544 | 3300026067 | Ga0207678_10195442 | Ga0207678_101954421 | 295 |
| 545 | 3300026075 | Ga0207708_10106601 | Ga0207708_101066013 | 295 |
| 546 | 3300026078 | Ga0207702_10000014 | Ga0207702_10000014223 | 295 |
| 547 | 3300026078 | Ga0207702_10254153 | Ga0207702_102541532 | 295 |
| 548 | 3300026078 | Ga0207702_10681322 | Ga0207702_106813221 | 295 |
| 549 | 3300026089 | Ga0207648_10106662 | Ga0207648_101066623 | 295 |
| 550 | 3300026095 | Ga0207676_10059522 | Ga0207676_100595222 | 295 |
| 551 | 3300026095 | Ga0207676_10284789 | Ga0207676_102847892 | 295 |
| 552 | 3300026116 | Ga0207674_10057148 | Ga0207674_100571483 | 295 |
| 553 | 3300026116 | Ga0207674_10065509 | Ga0207674_100655092 | 295 |
| 554 | 3300026116 | Ga0207674_10108590 | Ga0207674_101085901 | 295 |
| 555 | 3300026121 | Ga0207683_10117668 | Ga0207683_101176682 | 295 |
| 556 | 3300026121 | Ga0207683_10220341 | Ga0207683_102203412 | 295 |
| 557 | 3300026142 | Ga0207698_10063823 | Ga0207698_100638233 | 295 |
| 558 | 3300026142 | Ga0207698_10159850 | Ga0207698_101598501 | 295 |
| 559 | 3300027296 | Ga0209389_1000016 | Ga0209389_100001684 | 295 |
| 560 | 3300027296 | Ga0209389_1000027 | Ga0209389_100002760 | 295 |
| 561 | 3300027357 | Ga0209589_1000005 | Ga0209589_1000005342 | 295 |
| 562 | 3300027357 | Ga0209589_1000031 | Ga0209589_100003172 | 295 |
| 563 | 3300027361 | Ga0209489_100005 | Ga0209489_100005342 | 295 |
| 564 | 3300027361 | Ga0209489_100057 | Ga0209489_10005775 | 295 |
| 565 | 3300027361 | Ga0209489_100063 | Ga0209489_10006342 | 295 |
| 566 | 3300027363 | Ga0209700_100006 | Ga0209700_100006342 | 295 |
| 567 | 3300027363 | Ga0209700_100012 | Ga0209700_10001285 | 295 |
| 568 | 3300027671 | Ga0209588_1004211 | Ga0209588_10042112 | 295 |
| 569 | 3300028379 | Ga0268266_10001346 | Ga0268266_100013466 | 295 |
| 570 | 3300028379 | Ga0268266_10068805 | Ga0268266_100688051 | 295 |
| 571 | 3300028379 | Ga0268266_10199533 | Ga0268266_101995332 | 295 |
| 572 | 3300028379 | Ga0268266_10548464 | Ga0268266_105484641 | 295 |
| 573 | 3300028380 | Ga0268265_10034105 | Ga0268265_100341052 | 295 |
| 574 | 3300028380 | Ga0268265_10199546 | Ga0268265_101995462 | 295 |
| 575 | 3300028381 | Ga0268264_10000042 | Ga0268264_1000004277 | 295 |
| 576 | 3300028381 | Ga0268264_10135286 | Ga0268264_101352861 | 295 |
| 577 | 3300028381 | Ga0268264_10198150 | Ga0268264_101981503 | 295 |
| 578 | 3300028786 | Ga0307517_10000176 | Ga0307517_1000017632 | 295 |
| 579 | 3300028794 | Ga0307515_10317759 | Ga0307515_103177591 | 295 |
| 580 | 3300030521 | Ga0307511_10050299 | Ga0307511_100502991 | 295 |
| 581 | 3300031238 | Ga0265332_10016978 | Ga0265332_100169784 | 295 |
| 582 | 3300031249 | Ga0265339_10000383 | Ga0265339_100003839 | 295 |
| 583 | 3300031344 | Ga0265316_10103031 | Ga0265316_101030312 | 295 |
| 584 | 3300031507 | Ga0307509_10025042 | Ga0307509_100250427 | 295 |
| 585 | 3300031507 | Ga0307509_10251156 | Ga0307509_102511562 | 295 |
| 586 | 3300031507 | Ga0307509_10333330 | Ga0307509_103333301 | 295 |
| 587 | 3300031616 | Ga0307508_10000029 | Ga0307508_10000029119 | 295 |
| 588 | 3300031616 | Ga0307508_10024413 | Ga0307508_100244137 | 295 |
| 589 | 3300031711 | Ga0265314_10010200 | Ga0265314_100102003 | 295 |
| 590 | 3300031711 | Ga0265314_10229713 | Ga0265314_102297131 | 295 |
| 591 | 3300031712 | Ga0265342_10055988 | Ga0265342_100559883 | 295 |
| 592 | 3300031730 | Ga0307516_10088341 | Ga0307516_100883414 | 295 |
| 593 | 3300031730 | Ga0307516_10161240 | Ga0307516_101612401 | 295 |
| 594 | 3300031911 | Ga0307412_10204058 | Ga0307412_102040582 | 295 |
| 595 | 3300031995 | Ga0307409_100317876 | Ga0307409_1003178762 | 295 |
| 596 | 3300032004 | Ga0307414_10178805 | Ga0307414_101788052 | 295 |
| 597 | 3300032126 | Ga0307415_100123019 | Ga0307415_1001230192 | 295 |
| 598 | 3300033179 | Ga0307507_10021924 | Ga0307507_100219242 | 295 |
| 599 | 3300033180 | Ga0307510_10024826 | Ga0307510_100248266 | 295 |
| 600 | 3300033180 | Ga0307510_10026321 | Ga0307510_100263217 | 295 |
| 601 | 3300033180 | Ga0307510_10138078 | Ga0307510_101380782 | 295 |
| 602 | 3300033442 | Ga0315911_1000005 | Ga0315911_1000005306 | 295 |
| 603 | 3300035083 | Ga0373926_0060001 | Ga0373926_0060001_299_1186 | 295 |
| 604 | 3300035086 | Ga0373934_0018347 | Ga0373934_0018347_1267_2154 | 295 |
| 605 | 3300035086 | Ga0373934_0056364 | Ga0373934_0056364_479_1366 | 295 |
| 606 | 3300035111 | Ga0373923_0010360 | Ga0373923_0010360_866_1753 | 295 |
| 607 | 3300035111 | Ga0373923_0070889 | Ga0373923_0070889_209_1096 | 295 |
| 608 | 3300035112 | Ga0373932_0076262 | Ga0373932_0076262_136_1023 | 295 |
| 609 | 3300035113 | Ga0373936_0006737 | Ga0373936_0006737_1906_2793 | 295 |
| 610 | 3300035113 | Ga0373936_0085224 | Ga0373936_0085224_402_1289 | 295 |
| 611 | 3300035113 | Ga0373936_0114482 | Ga0373936_0114482_48_935 | 295 |
| 612 | 3300035116 | Ga0373945_0016664 | Ga0373945_0016664_963_1850 | 295 |
| 613 | 3300035117 | Ga0373953_0009510 | Ga0373953_0009510_609_1496 | 295 |
| 614 | 3300035118 | Ga0373954_0002278 | Ga0373954_0002278_441_1328 | 295 |
| 615 | 3300035118 | Ga0373954_0009920 | Ga0373954_0009920_1356_2411 | 295 |
| 616 | 3300035119 | Ga0373956_0004148 | Ga0373956_0004148_4091_4978 | 295 |
| 617 | 3300035119 | Ga0373956_0019733 | Ga0373956_0019733_568_1623 | 295 |
| 618 | 3300035120 | Ga0373957_0001409 | Ga0373957_0001409_294_1181 | 295 |
| 619 | 3300035120 | Ga0373957_0034103 | Ga0373957_0034103_910_1797 | 295 |
| 620 | 3300035170 | Ga0373943_0060746 | Ga0373943_0060746_158_1045 | 295 |
| 621 | 3300035171 | Ga0373946_0006137 | Ga0373946_0006137_2610_3497 | 295 |
| 622 | 3300035171 | Ga0373946_0045097 | Ga0373946_0045097_28_915 | 295 |
| 623 | 3300035171 | Ga0373946_0155733 | Ga0373946_0155733_99_1028 | 295 |
| 624 | 3300035172 | Ga0373955_0000395 | Ga0373955_0000395_4556_5443 | 295 |
| 625 | 3300035172 | Ga0373955_0042757 | Ga0373955_0042757_193_1248 | 295 |
| 626 | 3300035410 | Ga0373924_0008165 | Ga0373924_0008165_833_1720 | 295 |
| 627 | 3300035410 | Ga0373924_0055653 | Ga0373924_0055653_265_1320 | 295 |
| 628 | 3300035410 | Ga0373924_0071304 | Ga0373924_0071304_93_980 | 295 |
| 629 | 3300035691 | Ga0373931_0001048 | Ga0373931_0001048_2089_2976 | 295 |
| 630 | 3300035691 | Ga0373931_0030584 | Ga0373931_0030584_411_1340 | 295 |
| 631 | 3300035691 | Ga0373931_0179784 | Ga0373931_0179784_332_1219 | 295 |
| 632 | 3300035692 | Ga0373935_0004219 | Ga0373935_0004219_1043_1930 | 295 |
| 633 | 3300035695 | Ga0373927_0002702 | Ga0373927_0002702_862_1749 | 295 |
| 634 | 3300035695 | Ga0373927_0004563 | Ga0373927_0004563_6617_7504 | 295 |
| 635 | 3300035695 | Ga0373927_0023782 | Ga0373927_0023782_2903_3805 | 295 |
| 636 | 3300035695 | Ga0373927_0084381 | Ga0373927_0084381_1058_1945 | 295 |
| 637 | 3300035695 | Ga0373927_0143006 | Ga0373927_0143006_202_1089 | 295 |
| 638 | 3300035724 | Ga0373933_0003364 | Ga0373933_0003364_6220_7107 | 295 |
| 639 | 3300035724 | Ga0373933_0007313 | Ga0373933_0007313_1050_2105 | 295 |
| 640 | 3300035724 | Ga0373933_0091286 | Ga0373933_0091286_793_1680 | 295 |
| 641 | 3300035725 | Ga0373947_0007364 | Ga0373947_0007364_3742_4629 | 295 |
| 642 | 3300035725 | Ga0373947_0027701 | Ga0373947_0027701_1482_2369 | 295 |
| 643 | 3300035725 | Ga0373947_0065680 | Ga0373947_0065680_779_1666 | 295 |
| 644 | 3300036401 | Ga0373937_0011914 | Ga0373937_0011914_313_1200 | 295 |
| 645 | 3300036401 | Ga0373937_0049502 | Ga0373937_0049502_450_1337 | 295 |
| 646 | 3300037068 | Ga0373925_0007592 | Ga0373925_0007592_4647_5534 | 295 |
| 647 | 3300037068 | Ga0373925_0018541 | Ga0373925_0018541_4108_4995 | 295 |
| 648 | 3300037068 | Ga0373925_0034208 | Ga0373925_0034208_2632_3534 | 295 |
| 649 | 3300037068 | Ga0373925_0049760 | Ga0373925_0049760_1541_2428 | 295 |
| 650 | 3300037068 | Ga0373925_0092541 | Ga0373925_0092541_1195_2082 | 295 |
| 651 | 3300037068 | Ga0373925_0104706 | Ga0373925_0104706_1252_2139 | 295 |
| 652 | 3300037418 | Ga0395900_0007140 | Ga0395900_0007140_1845_2735 | 295 |
| 653 | 3300037418 | Ga0395900_0044885 | Ga0395900_0044885_2885_3772 | 295 |
| 654 | 3300037418 | Ga0395900_0105951 | Ga0395900_0105951_1315_2202 | 295 |
| 655 | 3300037466 | Ga0395898_0067033 | Ga0395898_0067033_560_1447 | 295 |
| 656 | 3300037466 | Ga0395898_0138367 | Ga0395898_0138367_694_1584 | 295 |
| 657 | 3300037471 | Ga0395905_0028290 | Ga0395905_0028290_3200_4090 | 295 |
| 658 | 3300037471 | Ga0395905_0246935 | Ga0395905_0246935_204_1094 | 295 |
| 659 | 3300037471 | Ga0395905_0547190 | Ga0395905_0547190_135_1025 | 295 |
| 660 | 3300037853 | Ga0436364_0776445 | Ga0436364_0776445_872_1837 | 295 |
| 661 | 3300038443 | Ga0395901_0129075 | Ga0395901_0129075_207_1094 | 295 |
| 662 | 3300039437 | Ga0436365_1364744 | Ga0436365_1364744_533_1420 | 295 |
| 663 | 3300039437 | Ga0436365_1778823 | Ga0436365_1778823_708_1595 | 295 |
| 664 | 3300039438 | Ga0436360_0202944 | Ga0436360_0202944_112_999 | 295 |
| 665 | 3300039447 | Ga0436361_0764338 | Ga0436361_0764338_473_1360 | 295 |
| 666 | 3300039447 | Ga0436361_1007400 | Ga0436361_1007400_1193_2080 | 295 |
| 667 | 3300039450 | Ga0436363_0187212 | Ga0436363_0187212_1500_2450 | 295 |
| 668 | 3300039450 | Ga0436363_1164297 | Ga0436363_1164297_2362_3285 | 295 |
| 669 | 3300039450 | Ga0436363_1664076 | Ga0436363_1664076_35_922 | 295 |
| 670 | 3300041496 | Ga0451839_1296627 | Ga0451839_1296627_83_970 | 295 |
| 671 | 3300041505 | Ga0451849_1550937 | Ga0451849_1550937_152_1042 | 295 |
| 672 | 3300044656 | Ga0466969_0038171 | Ga0466969_0038171_340_1230 | 295 |
| 673 | 3300044658 | Ga0466972_0000177 | Ga0466972_0000177_32528_33418 | 295 |
| 674 | 3300044658 | Ga0466972_0005224 | Ga0466972_0005224_4415_5305 | 295 |
| 675 | 3300044683 | Ga0466965_0032138 | Ga0466965_0032138_885_1775 | 295 |
| 676 | 3300044683 | Ga0466965_0199123 | Ga0466965_0199123_93_980 | 295 |
| 677 | 3300044684 | Ga0466966_0000474 | Ga0466966_0000474_9334_10224 | 295 |
| 678 | 3300044693 | Ga0466961_0000023 | Ga0466961_0000023_74809_75699 | 295 |
| 679 | 3300044693 | Ga0466961_0115673 | Ga0466961_0115673_767_1654 | 295 |
| 680 | 3300044735 | Ga0466968_0006075 | Ga0466968_0006075_2709_3599 | 295 |
| 681 | 3300044735 | Ga0466968_0041477 | Ga0466968_0041477_727_1614 | 295 |
| 682 | 3300044842 | Ga0466957_0312438 | Ga0466957_0312438_79_966 | 295 |
| 683 | 3300045049 | Ga0466959_0000726 | Ga0466959_0000726_8312_9202 | 295 |
| 684 | 3300045976 | Ga0466967_0189767 | Ga0466967_0189767_244_1131 | 295 |
| 685 | 3300045976 | Ga0466967_0628871 | Ga0466967_0628871_155_1042 | 295 |
| 686 | 3300046454 | Ga0495592_0020908 | Ga0495592_0020908_3931_4818 | 295 |
| 687 | 3300046454 | Ga0495592_0021820 | Ga0495592_0021820_437_1324 | 295 |
| 688 | 3300046454 | Ga0495592_0084009 | Ga0495592_0084009_1044_2099 | 295 |
| 689 | 3300046454 | Ga0495592_0301622 | Ga0495592_0301622_50_937 | 295 |
| 690 | 3300046455 | Ga0495603_0001935 | Ga0495603_0001935_2890_3777 | 295 |
| 691 | 3300046455 | Ga0495603_0006284 | Ga0495603_0006284_5669_6556 | 295 |
| 692 | 3300046455 | Ga0495603_0020664 | Ga0495603_0020664_1122_2009 | 295 |
| 693 | 3300046455 | Ga0495603_0049526 | Ga0495603_0049526_856_1743 | 295 |
| 694 | 3300046455 | Ga0495603_0062862 | Ga0495603_0062862_1196_2083 | 295 |
| 695 | 3300046455 | Ga0495603_0118366 | Ga0495603_0118366_561_1448 | 295 |
| 696 | 3300046455 | Ga0495603_0224158 | Ga0495603_0224158_180_1067 | 295 |
| 697 | 3300046459 | Ga0495629_0000416 | Ga0495629_0000416_32823_33710 | 295 |
| 698 | 3300046459 | Ga0495629_0000655 | Ga0495629_0000655_19595_20482 | 295 |
| 699 | 3300046461 | Ga0495641_0002593 | Ga0495641_0002593_12393_13280 | 295 |
| 700 | 3300046461 | Ga0495641_0101626 | Ga0495641_0101626_45_935 | 295 |
| 701 | 3300046462 | Ga0495651_0010752 | Ga0495651_0010752_5416_6306 | 295 |
| 702 | 3300046462 | Ga0495651_0144620 | Ga0495651_0144620_92_979 | 295 |
| 703 | 3300046463 | Ga0495653_0004854 | Ga0495653_0004854_6638_7525 | 295 |
| 704 | 3300046471 | Ga0495650_0025806 | Ga0495650_0025806_1816_2706 | 295 |
| 705 | 3300046472 | Ga0495580_0055436 | Ga0495580_0055436_847_1734 | 295 |
| 706 | 3300046473 | Ga0495582_0032876 | Ga0495582_0032876_933_1820 | 295 |
| 707 | 3300046475 | Ga0495639_0001046 | Ga0495639_0001046_10012_10899 | 295 |
| 708 | 3300046475 | Ga0495639_0084132 | Ga0495639_0084132_159_1046 | 295 |
| 709 | 3300046475 | Ga0495639_0129966 | Ga0495639_0129966_236_1123 | 295 |
| 710 | 3300046476 | Ga0495662_0003282 | Ga0495662_0003282_1017_1904 | 295 |
| 711 | 3300046477 | Ga0495664_0114940 | Ga0495664_0114940_575_1462 | 295 |
| 712 | 3300046492 | Ga0495585_0113023 | Ga0495585_0113023_109_996 | 295 |
| 713 | 3300046492 | Ga0495585_0147552 | Ga0495585_0147552_10_897 | 295 |
| 714 | 3300046499 | Ga0495594_0051840 | Ga0495594_0051840_236_1123 | 295 |
| 715 | 3300046507 | Ga0495606_0066283 | Ga0495606_0066283_762_1652 | 295 |
| 716 | 3300046511 | Ga0495608_0107848 | Ga0495608_0107848_25_1080 | 295 |
| 717 | 3300046514 | Ga0495618_0110921 | Ga0495618_0110921_638_1693 | 295 |
| 718 | 3300046515 | Ga0495620_0117244 | Ga0495620_0117244_43_930 | 295 |
| 719 | 3300046516 | Ga0495628_0011825 | Ga0495628_0011825_934_1824 | 295 |
| 720 | 3300046516 | Ga0495628_0030845 | Ga0495628_0030845_2490_3377 | 295 |
| 721 | 3300046516 | Ga0495628_0117808 | Ga0495628_0117808_347_1402 | 295 |
| 722 | 3300046516 | Ga0495628_0136125 | Ga0495628_0136125_313_1200 | 295 |
| 723 | 3300046517 | Ga0495630_0009444 | Ga0495630_0009444_1043_1930 | 295 |
| 724 | 3300046522 | Ga0495643_0014428 | Ga0495643_0014428_2366_3256 | 295 |
| 725 | 3300046524 | Ga0495648_0000640 | Ga0495648_0000640_3771_4658 | 295 |
| 726 | 3300046526 | Ga0495666_0016886 | Ga0495666_0016886_934_1821 | 295 |
| 727 | 3300046526 | Ga0495666_0030220 | Ga0495666_0030220_1388_2275 | 295 |
| 728 | 3300046528 | Ga0495642_0121770 | Ga0495642_0121770_19_906 | 295 |
| 729 | 3300046529 | Ga0495652_0026522 | Ga0495652_0026522_3745_4635 | 295 |
| 730 | 3300046529 | Ga0495652_0082257 | Ga0495652_0082257_527_1582 | 295 |
| 731 | 3300046531 | Ga0495665_0003441 | Ga0495665_0003441_6740_7627 | 295 |
| 732 | 3300046531 | Ga0495665_0056047 | Ga0495665_0056047_1168_2055 | 295 |
| 733 | 3300046533 | Ga0495640_0045167 | Ga0495640_0045167_850_1737 | 295 |
| 734 | 3300046533 | Ga0495640_0045731 | Ga0495640_0045731_55_996 | 295 |
| 735 | 3300046533 | Ga0495640_0073507 | Ga0495640_0073507_527_1414 | 295 |
| 736 | 3300046533 | Ga0495640_0085105 | Ga0495640_0085105_964_1851 | 295 |
| 737 | 3300046535 | Ga0495586_0085300 | Ga0495586_0085300_121_1176 | 295 |
| 738 | 3300046536 | Ga0495587_0007940 | Ga0495587_0007940_4522_5577 | 295 |
| 739 | 3300046536 | Ga0495587_0016331 | Ga0495587_0016331_313_1200 | 295 |
| 740 | 3300046537 | Ga0495598_0010333 | Ga0495598_0010333_145_1032 | 295 |
| 741 | 3300046537 | Ga0495598_0023933 | Ga0495598_0023933_69_956 | 295 |
| 742 | 3300046539 | Ga0495621_0078806 | Ga0495621_0078806_191_1078 | 295 |
| 743 | 3300046543 | Ga0495645_0002973 | Ga0495645_0002973_10082_10969 | 295 |
| 744 | 3300046543 | Ga0495645_0133459 | Ga0495645_0133459_776_1663 | 295 |
| 745 | 3300046557 | Ga0495622_0023686 | Ga0495622_0023686_983_1870 | 295 |
| 746 | 3300046557 | Ga0495622_0026482 | Ga0495622_0026482_307_1209 | 295 |
| 747 | 3300046557 | Ga0495622_0088749 | Ga0495622_0088749_326_1213 | 295 |
| 748 | 3300046559 | Ga0495667_0032457 | Ga0495667_0032457_511_1566 | 295 |
| 749 | 3300046559 | Ga0495667_0036654 | Ga0495667_0036654_441_1328 | 295 |
| 750 | 3300046559 | Ga0495667_0044661 | Ga0495667_0044661_1121_2008 | 295 |
| 751 | 3300046559 | Ga0495667_0060623 | Ga0495667_0060623_102_992 | 295 |
| 752 | 3300046615 | Ga0495656_0118066 | Ga0495656_0118066_148_1035 | 295 |
| 753 | 3300046616 | Ga0495668_0073358 | Ga0495668_0073358_267_1154 | 295 |
| 754 | 3300046616 | Ga0495668_0191459 | Ga0495668_0191459_198_1085 | 295 |
| 755 | 3300046642 | Ga0495634_0000602 | Ga0495634_0000602_1143_2030 | 295 |
| 756 | 3300046642 | Ga0495634_0074164 | Ga0495634_0074164_266_1321 | 295 |
| 757 | 3300046642 | Ga0495634_0159003 | Ga0495634_0159003_430_1317 | 295 |
| 758 | 3300046642 | Ga0495634_0223408 | Ga0495634_0223408_73_960 | 295 |
| 759 | 3300046663 | Ga0495635_0000380 | Ga0495635_0000380_3507_4394 | 295 |
| 760 | 3300046663 | Ga0495635_0012975 | Ga0495635_0012975_3934_4821 | 295 |
| 761 | 3300046663 | Ga0495635_0042493 | Ga0495635_0042493_740_1681 | 295 |
| 762 | 3300046663 | Ga0495635_0243080 | Ga0495635_0243080_16_903 | 295 |
| 763 | 3300046664 | Ga0495659_0030136 | Ga0495659_0030136_69_956 | 295 |
| 764 | 3300046674 | Ga0495588_0003413 | Ga0495588_0003413_1071_1958 | 295 |
| 765 | 3300046675 | Ga0495657_0005248 | Ga0495657_0005248_4570_5457 | 295 |
| 766 | 3300046675 | Ga0495657_0019627 | Ga0495657_0019627_1693_2634 | 295 |
| 767 | 3300046675 | Ga0495657_0050390 | Ga0495657_0050390_1045_2100 | 295 |
| 768 | 3300046678 | Ga0495599_0004515 | Ga0495599_0004515_222_1112 | 295 |
| 769 | 3300046678 | Ga0495599_0025467 | Ga0495599_0025467_883_1770 | 295 |
| 770 | 3300046678 | Ga0495599_0026173 | Ga0495599_0026173_666_1721 | 295 |
| 771 | 3300046678 | Ga0495599_0079124 | Ga0495599_0079124_828_1715 | 295 |
| 772 | 3300046679 | Ga0495623_0002235 | Ga0495623_0002235_5980_6870 | 295 |
| 773 | 3300046679 | Ga0495623_0015456 | Ga0495623_0015456_1944_2831 | 295 |
| 774 | 3300046680 | Ga0495646_0046242 | Ga0495646_0046242_1301_2188 | 295 |
| 775 | 3300046680 | Ga0495646_0048567 | Ga0495646_0048567_1304_2359 | 295 |
| 776 | 3300046680 | Ga0495646_0070850 | Ga0495646_0070850_819_1709 | 295 |
| 777 | 3300046680 | Ga0495646_0131009 | Ga0495646_0131009_99_1040 | 295 |
| 778 | 3300046681 | Ga0495647_0021626 | Ga0495647_0021626_876_1763 | 295 |
| 779 | 3300046681 | Ga0495647_0030022 | Ga0495647_0030022_901_1788 | 295 |
| 780 | 3300046683 | Ga0495658_0005105 | Ga0495658_0005105_4339_5226 | 295 |
| 781 | 3300046683 | Ga0495658_0053507 | Ga0495658_0053507_1052_1939 | 295 |
| 782 | 3300046684 | Ga0495669_0076437 | Ga0495669_0076437_53_940 | 295 |
| 783 | 3300046689 | Ga0495613_0032956 | Ga0495613_0032956_2111_2998 | 295 |
| 784 | 3300046689 | Ga0495613_0057599 | Ga0495613_0057599_1035_1922 | 295 |
| 785 | 3300046690 | Ga0495624_0003072 | Ga0495624_0003072_9753_10640 | 295 |
| 786 | 3300046794 | Ga0495589_0157788 | Ga0495589_0157788_28_915 | 295 |
| 787 | 3300046809 | Ga0495600_0029981 | Ga0495600_0029981_2072_2959 | 295 |
| 788 | 3300046809 | Ga0495600_0035125 | Ga0495600_0035125_1047_1934 | 295 |
| 789 | 3300046809 | Ga0495600_0114920 | Ga0495600_0114920_722_1663 | 295 |
| 790 | 3300047315 | Ga0495581_0020748 | Ga0495581_0020748_998_1885 | 295 |
| 791 | 3300047315 | Ga0495581_0036506 | Ga0495581_0036506_963_1850 | 295 |
| 792 | 3300047315 | Ga0495581_0097104 | Ga0495581_0097104_669_1556 | 295 |
| 793 | 3300047315 | Ga0495581_0198853 | Ga0495581_0198853_112_999 | 295 |
| 794 | 3300047317 | Ga0495604_0007336 | Ga0495604_0007336_1294_2184 | 295 |
| 795 | 3300047317 | Ga0495604_0008886 | Ga0495604_0008886_3507_4394 | 295 |
| 796 | 3300047317 | Ga0495604_0054854 | Ga0495604_0054854_1286_2227 | 295 |
| 797 | 3300047317 | Ga0495604_0127221 | Ga0495604_0127221_111_1166 | 295 |
| 798 | 3300047319 | Ga0495674_0008020 | Ga0495674_0008020_1417_2304 | 295 |
| 799 | 3300047319 | Ga0495674_0022101 | Ga0495674_0022101_4096_4983 | 295 |
| 800 | 3300047319 | Ga0495674_0066148 | Ga0495674_0066148_982_1869 | 295 |
| 801 | 3300047319 | Ga0495674_0160752 | Ga0495674_0160752_40_1095 | 295 |
| 802 | 3300047319 | Ga0495674_0305009 | Ga0495674_0305009_314_1252 | 295 |
| 803 | 3300047321 | Ga0495676_0069277 | Ga0495676_0069277_368_1255 | 295 |
| 804 | 3300047321 | Ga0495676_0122028 | Ga0495676_0122028_742_1629 | 295 |
| 805 | 3300047321 | Ga0495676_0123320 | Ga0495676_0123320_54_941 | 295 |
| 806 | 3300047322 | Ga0495680_0002016 | Ga0495680_0002016_8728_9618 | 295 |
| 807 | 3300047322 | Ga0495680_0025159 | Ga0495680_0025159_313_1200 | 295 |
| 808 | 3300047322 | Ga0495680_0085244 | Ga0495680_0085244_1278_2165 | 295 |
| 809 | 3300047322 | Ga0495680_0261857 | Ga0495680_0261857_254_1141 | 295 |
| 810 | 3300047444 | Ga0495675_0001856 | Ga0495675_0001856_209_1099 | 295 |
| 811 | 3300047444 | Ga0495675_0127716 | Ga0495675_0127716_200_1255 | 295 |
| 812 | 3300047446 | Ga0495679_059730 | Ga0495679_059730_28_915 | 295 |
| 813 | 3300047470 | Ga0495681_0121593 | Ga0495681_0121593_194_1081 | 295 |
| 814 | 3300047471 | Ga0495684_0000294 | Ga0495684_0000294_19554_20441 | 295 |
| 815 | 3300047471 | Ga0495684_0096973 | Ga0495684_0096973_112_999 | 295 |
| 816 | 3300047471 | Ga0495684_0138880 | Ga0495684_0138880_63_1118 | 295 |
| 817 | 3300047673 | Ga0495593_0000022 | Ga0495593_0000022_895_1782 | 295 |
| 818 | 3300047673 | Ga0495593_0000744 | Ga0495593_0000744_6602_7489 | 295 |
| 819 | 3300048088 | Ga0495602_0062578 | Ga0495602_0062578_624_1514 | 295 |
| 820 | 3300048088 | Ga0495602_0155583 | Ga0495602_0155583_559_1614 | 295 |
| 821 | 3300048903 | Ga0496100_0027259 | Ga0496100_0027259_714_1601 | 295 |
| 822 | 3300048904 | Ga0496101_0063193 | Ga0496101_0063193_1595_2482 | 295 |
| 823 | 3300048904 | Ga0496101_0088147 | Ga0496101_0088147_581_1471 | 295 |
| 824 | 3300048904 | Ga0496101_0116245 | Ga0496101_0116245_162_1049 | 295 |
| 825 | 3300048905 | Ga0496102_0014293 | Ga0496102_0014293_2386_3273 | 295 |
| 826 | 3300048905 | Ga0496102_0059266 | Ga0496102_0059266_517_1407 | 295 |
| 827 | 3300048905 | Ga0496102_0076480 | Ga0496102_0076480_2065_2982 | 295 |
| 828 | 3300048905 | Ga0496102_0334862 | Ga0496102_0334862_383_1270 | 295 |
| 829 | 3300048906 | Ga0496103_0101444 | Ga0496103_0101444_239_1126 | 295 |
| 830 | 3300048907 | Ga0496104_0002005 | Ga0496104_0002005_1673_2614 | 295 |
| 831 | 3300048907 | Ga0496104_0023320 | Ga0496104_0023320_899_1786 | 295 |
| 832 | 3300048907 | Ga0496104_0033610 | Ga0496104_0033610_18_905 | 295 |
| 833 | 3300048907 | Ga0496104_0235301 | Ga0496104_0235301_609_1499 | 295 |
| 834 | 3300048908 | Ga0496105_0009772 | Ga0496105_0009772_336_1223 | 295 |
| 835 | 3300048908 | Ga0496105_0011036 | Ga0496105_0011036_4838_5725 | 295 |
| 836 | 3300048908 | Ga0496105_0012416 | Ga0496105_0012416_3685_4626 | 295 |
| 837 | 3300048908 | Ga0496105_0391803 | Ga0496105_0391803_153_1040 | 295 |
| 838 | 3300048909 | Ga0496106_0001262 | Ga0496106_0001262_15784_16686 | 295 |
| 839 | 3300048909 | Ga0496106_0003691 | Ga0496106_0003691_1545_2618 | 295 |
| 840 | 3300048909 | Ga0496106_0014884 | Ga0496106_0014884_3900_4787 | 295 |
| 841 | 3300048909 | Ga0496106_0137472 | Ga0496106_0137472_569_1456 | 295 |
| 842 | 3300048909 | Ga0496106_0139912 | Ga0496106_0139912_706_1593 | 295 |
| 843 | 3300048909 | Ga0496106_0489794 | Ga0496106_0489794_71_958 | 295 |
| 844 | 3300048910 | Ga0496107_0021225 | Ga0496107_0021225_2870_3757 | 295 |
| 845 | 3300048911 | Ga0496108_0084458 | Ga0496108_0084458_1166_2056 | 295 |
| 846 | 3300048911 | Ga0496108_0141737 | Ga0496108_0141737_639_1529 | 295 |
| 847 | 3300048911 | Ga0496108_0155553 | Ga0496108_0155553_120_1007 | 295 |
| 848 | 3300048911 | Ga0496108_0199656 | Ga0496108_0199656_168_1055 | 295 |
| 849 | 3300048911 | Ga0496108_0247223 | Ga0496108_0247223_181_1068 | 295 |
| 850 | 3300048912 | Ga0496109_0000910 | Ga0496109_0000910_1947_3020 | 295 |
| 851 | 3300048912 | Ga0496109_0117615 | Ga0496109_0117615_1243_2130 | 295 |
| 852 | 3300048912 | Ga0496109_0142527 | Ga0496109_0142527_586_1476 | 295 |
| 853 | 3300048912 | Ga0496109_0147156 | Ga0496109_0147156_242_1129 | 295 |
| 854 | 3300048912 | Ga0496109_0155298 | Ga0496109_0155298_149_1036 | 295 |
| 855 | 3300048912 | Ga0496109_0166533 | Ga0496109_0166533_401_1288 | 295 |
| 856 | 3300048912 | Ga0496109_0168061 | Ga0496109_0168061_951_1838 | 295 |
| 857 | 3300048912 | Ga0496109_0293113 | Ga0496109_0293113_239_1126 | 295 |
| 858 | 3300048913 | Ga0496110_0101486 | Ga0496110_0101486_36_923 | 295 |
| 859 | 3300048913 | Ga0496110_0105664 | Ga0496110_0105664_856_1746 | 295 |
| 860 | 3300048913 | Ga0496110_0118704 | Ga0496110_0118704_1290_2177 | 295 |
| 861 | 3300048913 | Ga0496110_0206343 | Ga0496110_0206343_514_1401 | 295 |
| 862 | 3300048914 | Ga0496111_0034388 | Ga0496111_0034388_27_914 | 295 |
| 863 | 3300048914 | Ga0496111_0116502 | Ga0496111_0116502_1038_1925 | 295 |
| 864 | 3300048914 | Ga0496111_0259119 | Ga0496111_0259119_365_1255 | 295 |
| 865 | 3300048914 | Ga0496111_0452236 | Ga0496111_0452236_44_931 | 295 |
| 866 | 3300048915 | Ga0496112_0000022 | Ga0496112_0000022_37574_38461 | 295 |
| 867 | 3300048915 | Ga0496112_0023710 | Ga0496112_0023710_2101_2988 | 295 |
| 868 | 3300048915 | Ga0496112_0034500 | Ga0496112_0034500_855_1928 | 295 |
| 869 | 3300048915 | Ga0496112_0043988 | Ga0496112_0043988_91_978 | 295 |
| 870 | 3300048915 | Ga0496112_0118773 | Ga0496112_0118773_1613_2503 | 295 |
| 871 | 3300048915 | Ga0496112_0170514 | Ga0496112_0170514_646_1533 | 295 |
| 872 | 3300048915 | Ga0496112_0261545 | Ga0496112_0261545_464_1375 | 295 |
| 873 | 3300048915 | Ga0496112_0266577 | Ga0496112_0266577_46_933 | 295 |
| 874 | 3300048915 | Ga0496112_0402327 | Ga0496112_0402327_279_1166 | 295 |
| 875 | 3300048915 | Ga0496112_0539679 | Ga0496112_0539679_101_988 | 295 |
| 876 | 3300048916 | Ga0496113_0009540 | Ga0496113_0009540_5405_6292 | 295 |
| 877 | 3300048916 | Ga0496113_0072238 | Ga0496113_0072238_1017_1904 | 295 |
| 878 | 3300048916 | Ga0496113_0108196 | Ga0496113_0108196_1252_2142 | 295 |
| 879 | 3300048916 | Ga0496113_0129870 | Ga0496113_0129870_647_1720 | 295 |
| 880 | 3300048917 | Ga0496114_0009367 | Ga0496114_0009367_490_1377 | 295 |
| 881 | 3300048917 | Ga0496114_0245788 | Ga0496114_0245788_222_1154 | 295 |
| 882 | 3300048918 | Ga0496115_0032437 | Ga0496115_0032437_1661_2551 | 295 |
| 883 | 3300048918 | Ga0496115_0033888 | Ga0496115_0033888_1695_2582 | 295 |
| 884 | 3300048918 | Ga0496115_0081033 | Ga0496115_0081033_1497_2384 | 295 |
| 885 | 3300048918 | Ga0496115_0189664 | Ga0496115_0189664_563_1504 | 295 |
| 886 | 3300048918 | Ga0496115_0238742 | Ga0496115_0238742_18_905 | 295 |
| 887 | 3300048918 | Ga0496115_0422078 | Ga0496115_0422078_166_1053 | 295 |
| 888 | 3300048919 | Ga0496116_0077687 | Ga0496116_0077687_983_1873 | 295 |
| 889 | 3300048920 | Ga0496117_0043940 | Ga0496117_0043940_1561_2448 | 295 |
| 890 | 3300048920 | Ga0496117_0088506 | Ga0496117_0088506_218_1108 | 295 |
| 891 | 3300048921 | Ga0496118_0083539 | Ga0496118_0083539_1318_2205 | 295 |
| 892 | 3300048922 | Ga0496119_0068858 | Ga0496119_0068858_267_1154 | 295 |
| 893 | 3300048922 | Ga0496119_0123246 | Ga0496119_0123246_279_1166 | 295 |
| 894 | 3300048922 | Ga0496119_0127019 | Ga0496119_0127019_308_1198 | 295 |
| 895 | 3300048923 | Ga0496120_0022888 | Ga0496120_0022888_1308_2249 | 295 |
| 896 | 3300048924 | Ga0496121_0000254 | Ga0496121_0000254_71339_72226 | 295 |
| 897 | 3300048924 | Ga0496121_0002114 | Ga0496121_0002114_27908_28810 | 295 |
| 898 | 3300048924 | Ga0496121_0011243 | Ga0496121_0011243_143_1030 | 295 |
| 899 | 3300048924 | Ga0496121_0012395 | Ga0496121_0012395_2887_3774 | 295 |
| 900 | 3300048924 | Ga0496121_0055262 | Ga0496121_0055262_1495_2385 | 295 |
| 901 | 3300048924 | Ga0496121_0090630 | Ga0496121_0090630_1311_2198 | 295 |
| 902 | 3300048924 | Ga0496121_0128284 | Ga0496121_0128284_862_1749 | 295 |
| 903 | 3300048924 | Ga0496121_0222224 | Ga0496121_0222224_163_1050 | 295 |
| 904 | 3300048927 | Ga0496124_0001351 | Ga0496124_0001351_6962_7864 | 295 |
| 905 | 3300048928 | Ga0496125_0065882 | Ga0496125_0065882_523_1425 | 295 |
| 906 | 3300048928 | Ga0496125_0099784 | Ga0496125_0099784_112_999 | 295 |
| 907 | 3300048929 | Ga0496126_0007801 | Ga0496126_0007801_7583_8470 | 295 |
| 908 | 3300048929 | Ga0496126_0012548 | Ga0496126_0012548_1146_2033 | 295 |
| 909 | 3300048929 | Ga0496126_0022598 | Ga0496126_0022598_1280_2182 | 295 |
| 910 | 3300048929 | Ga0496126_0024830 | Ga0496126_0024830_57_944 | 295 |
| 911 | 3300048929 | Ga0496126_0026051 | Ga0496126_0026051_632_1534 | 295 |
| 912 | 3300048929 | Ga0496126_0049875 | Ga0496126_0049875_975_1916 | 295 |
| 913 | 3300048929 | Ga0496126_0155068 | Ga0496126_0155068_863_1750 | 295 |
| 914 | 3300048929 | Ga0496126_0222802 | Ga0496126_0222802_424_1311 | 295 |
| 915 | 3300048929 | Ga0496126_0368862 | Ga0496126_0368862_33_920 | 295 |
| 916 | 3300049568 | Ga0501031_0001005 | Ga0501031_0001005_6508_7395 | 295 |
| 917 | 3300049569 | Ga0501032_0000161 | Ga0501032_0000161_19435_20322 | 295 |
| 918 | 3300049569 | Ga0501032_0053496 | Ga0501032_0053496_695_1582 | 295 |
| 919 | 3300049570 | Ga0501033_0000111 | Ga0501033_0000111_73076_73963 | 295 |
| 920 | 3300049571 | Ga0501034_0000072 | Ga0501034_0000072_115755_116642 | 295 |
| 921 | 3300049571 | Ga0501034_0071554 | Ga0501034_0071554_37_924 | 295 |
| 922 | 3300049571 | Ga0501034_0144499 | Ga0501034_0144499_1258_2145 | 295 |
| 923 | 3300049571 | Ga0501034_0260391 | Ga0501034_0260391_709_1596 | 295 |
| 924 | 3300049572 | Ga0501036_0011119 | Ga0501036_0011119_2560_3447 | 295 |
| 925 | 3300049572 | Ga0501036_0053940 | Ga0501036_0053940_2205_3092 | 295 |
| 926 | 3300049572 | Ga0501036_0073036 | Ga0501036_0073036_1457_2434 | 295 |
| 927 | 3300049572 | Ga0501036_0446357 | Ga0501036_0446357_28_915 | 295 |
| 928 | 3300049573 | Ga0501037_0000030 | Ga0501037_0000030_121238_122125 | 295 |
| 929 | 3300049573 | Ga0501037_0062319 | Ga0501037_0062319_695_1582 | 295 |
| 930 | 3300049573 | Ga0501037_0126387 | Ga0501037_0126387_70_1047 | 295 |
| 931 | 3300049574 | Ga0501038_0000060 | Ga0501038_0000060_22554_23441 | 295 |
| 932 | 3300049574 | Ga0501038_0003347 | Ga0501038_0003347_39_926 | 295 |
| 933 | 3300049574 | Ga0501038_0019562 | Ga0501038_0019562_4469_5356 | 295 |
| 934 | 3300049574 | Ga0501038_0203591 | Ga0501038_0203591_430_1317 | 295 |
| 935 | 3300049575 | Ga0501039_0003983 | Ga0501039_0003983_284_1171 | 295 |
| 936 | 3300049575 | Ga0501039_0155791 | Ga0501039_0155791_447_1334 | 295 |
| 937 | 3300049576 | Ga0501040_0118117 | Ga0501040_0118117_714_1601 | 295 |
| 938 | 3300049578 | Ga0501042_0112143 | Ga0501042_0112143_355_1242 | 295 |
| 939 | 3300049579 | Ga0501043_0000357 | Ga0501043_0000357_36372_37259 | 295 |
| 940 | 3300049580 | Ga0501046_0002205 | Ga0501046_0002205_7204_8091 | 295 |
| 941 | 3300049581 | Ga0501047_0000140 | Ga0501047_0000140_4726_5613 | 295 |
| 942 | 3300049581 | Ga0501047_0026961 | Ga0501047_0026961_3230_4117 | 295 |
| 943 | 3300049581 | Ga0501047_0068547 | Ga0501047_0068547_2083_2970 | 295 |
| 944 | 3300049581 | Ga0501047_0241726 | Ga0501047_0241726_699_1586 | 295 |
| 945 | 3300049581 | Ga0501047_0338958 | Ga0501047_0338958_146_1036 | 295 |
| 946 | 3300049582 | Ga0501048_0000812 | Ga0501048_0000812_20133_21020 | 295 |
| 947 | 3300049582 | Ga0501048_0144939 | Ga0501048_0144939_145_1125 | 295 |
| 948 | 3300049583 | Ga0501067_0000697 | Ga0501067_0000697_5220_6107 | 295 |
| 949 | 3300049583 | Ga0501067_0002459 | Ga0501067_0002459_8144_9031 | 295 |
| 950 | 3300049583 | Ga0501067_0067838 | Ga0501067_0067838_368_1255 | 295 |
| 951 | 3300049584 | Ga0501068_0015057 | Ga0501068_0015057_3365_4252 | 295 |
| 952 | 3300049585 | Ga0501069_0062846 | Ga0501069_0062846_994_1881 | 295 |
| 953 | 3300049585 | Ga0501069_0066501 | Ga0501069_0066501_966_1853 | 295 |
| 954 | 3300049586 | Ga0501070_0000602 | Ga0501070_0000602_17686_18573 | 295 |
| 955 | 3300049586 | Ga0501070_0010155 | Ga0501070_0010155_4478_5365 | 295 |
| 956 | 3300049586 | Ga0501070_0058337 | Ga0501070_0058337_2136_3023 | 295 |
| 957 | 3300049586 | Ga0501070_0138152 | Ga0501070_0138152_187_1077 | 295 |
| 958 | 3300049586 | Ga0501070_0180023 | Ga0501070_0180023_286_1173 | 295 |
| 959 | 3300049588 | Ga0501072_0084380 | Ga0501072_0084380_915_1802 | 295 |
| 960 | 3300049588 | Ga0501072_0401974 | Ga0501072_0401974_177_1064 | 295 |
| 961 | 3300049589 | Ga0501073_0000009 | Ga0501073_0000009_131580_132467 | 295 |
| 962 | 3300049589 | Ga0501073_0009578 | Ga0501073_0009578_1849_2736 | 295 |
| 963 | 3300049589 | Ga0501073_0035565 | Ga0501073_0035565_1516_2403 | 295 |
| 964 | 3300049590 | Ga0501074_0000137 | Ga0501074_0000137_32184_33071 | 295 |
| 965 | 3300049593 | Ga0501077_0095551 | Ga0501077_0095551_410_1297 | 295 |
| 966 | 3300049741 | Ga0501079_0017212 | Ga0501079_0017212_252_1139 | 295 |
| 967 | 3300049742 | Ga0501080_0000088 | Ga0501080_0000088_53415_54302 | 295 |
| 968 | 3300049742 | Ga0501080_0037211 | Ga0501080_0037211_1063_1950 | 295 |
| 969 | 3300049744 | Ga0501083_0013621 | Ga0501083_0013621_4552_5439 | 295 |
| 970 | 3300049744 | Ga0501083_0050365 | Ga0501083_0050365_781_1668 | 295 |
| 971 | 3300049822 | Ga0501035_0057070 | Ga0501035_0057070_2560_3447 | 295 |
| 972 | 3300049822 | Ga0501035_0116770 | Ga0501035_0116770_798_1685 | 295 |
| 973 | 3300049822 | Ga0501035_0204141 | Ga0501035_0204141_636_1523 | 295 |
| 974 | 3300049822 | Ga0501035_0242617 | Ga0501035_0242617_302_1189 | 295 |
| 975 | 3300049822 | Ga0501035_0302376 | Ga0501035_0302376_447_1334 | 295 |
| 976 | 3300049823 | Ga0501044_0002346 | Ga0501044_0002346_8577_9464 | 295 |
| 977 | 3300049823 | Ga0501044_0013964 | Ga0501044_0013964_7530_8417 | 295 |
| 978 | 3300049823 | Ga0501044_0022171 | Ga0501044_0022171_2148_3035 | 295 |
| 979 | 3300049824 | Ga0501045_0024317 | Ga0501045_0024317_2321_3208 | 295 |
| 980 | 3300050489 | nmdc:mga03683_51497_c1 | nmdc:mga03683_51497_c1_678_1565 | 295 |
| 981 | 3300050490 | nmdc:mga03n38_4303_c1 | nmdc:mga03n38_4303_c1_1537_2424 | 295 |
| 982 | 3300050491 | nmdc:mga00v17_32663_c1 | nmdc:mga00v17_32663_c1_752_1642 | 295 |
| 983 | 3300050492 | nmdc:mga0yw44_13579_c1 | nmdc:mga0yw44_13579_c1_632_1519 | 295 |
| 984 | 3300050492 | nmdc:mga0yw44_194539_c1 | nmdc:mga0yw44_194539_c1_282_1169 | 295 |
| 985 | 3300050492 | nmdc:mga0yw44_78840_c1 | nmdc:mga0yw44_78840_c1_289_1230 | 295 |
| 986 | 3300050492 | nmdc:mga0yw44_8656_c1 | nmdc:mga0yw44_8656_c1_3692_4579 | 295 |
| 987 | 3300050492 | nmdc:mga0yw44_93034_c1 | nmdc:mga0yw44_93034_c1_383_1273 | 295 |
| 988 | 3300050493 | nmdc:mga0k408_6488_c1 | nmdc:mga0k408_6488_c1_1208_2095 | 295 |
| 989 | 3300050494 | nmdc:mga06z11_182462_c1 | nmdc:mga06z11_182462_c1_274_1161 | 295 |
| 990 | 3300050494 | nmdc:mga06z11_21687_c1 | nmdc:mga06z11_21687_c1_1515_2402 | 295 |
| 991 | 3300050494 | nmdc:mga06z11_47781_c1 | nmdc:mga06z11_47781_c1_1149_2036 | 295 |
| 992 | 3300050494 | nmdc:mga06z11_7412_c1 | nmdc:mga06z11_7412_c1_242_1129 | 295 |
| 993 | 3300050495 | nmdc:mga04h51_43933_c1 | nmdc:mga04h51_43933_c1_172_1113 | 295 |
| 994 | 3300050496 | nmdc:mga07m45_19689_c1 | nmdc:mga07m45_19689_c1_189_1079 | 295 |
| 995 | 3300050496 | nmdc:mga07m45_25952_c1 | nmdc:mga07m45_25952_c1_206_1093 | 295 |
| 996 | 3300050507 | nmdc:mga05p37_338976_c1 | nmdc:mga05p37_338976_c1_533_1420 | 295 |
| 997 | 3300050512 | nmdc:mga0n895_2476_c1 | nmdc:mga0n895_2476_c1_7044_7931 | 295 |
| 998 | 3300050512 | nmdc:mga0n895_47793_c1 | nmdc:mga0n895_47793_c1_2190_3077 | 295 |
| 999 | 3300050512 | nmdc:mga0n895_95111_c1 | nmdc:mga0n895_95111_c1_1115_2002 | 295 |
| 1000 | 3300050512 | nmdc:mga0n895_95260_c1 | nmdc:mga0n895_95260_c1_247_1134 | 295 |
| 1001 | 3300050513 | nmdc:mga0rr50_82341_c1 | nmdc:mga0rr50_82341_c1_734_1621 | 295 |
| 1002 | 3300050516 | nmdc:mga0sz30_59207_c1 | nmdc:mga0sz30_59207_c1_277_1167 | 295 |
| 1003 | 3300053077 | Ga0495601_0047714 | Ga0495601_0047714_865_1755 | 295 |
| 1004 | 3300053077 | Ga0495601_0159031 | Ga0495601_0159031_365_1252 | 295 |
| 1005 | 3300053078 | Ga0495612_0045607 | Ga0495612_0045607_785_1672 | 295 |
| 1006 | 3300053084 | Ga0495595_0021212 | Ga0495595_0021212_659_1714 | 295 |
| 1007 | 3300053084 | Ga0495595_0032285 | Ga0495595_0032285_194_1084 | 295 |
| 1008 | 3300053085 | Ga0495619_0003855 | Ga0495619_0003855_4556_5443 | 295 |
| 1009 | 3300053085 | Ga0495619_0112518 | Ga0495619_0112518_16_957 | 295 |
| 1010 | 3300053086 | Ga0500578_0186649 | Ga0500578_0186649_220_1110 | 295 |
| 1011 | 3300053093 | Ga0500651_0018002 | Ga0500651_0018002_118_1005 | 295 |
| 1012 | 3300053093 | Ga0500651_0023015 | Ga0500651_0023015_148_1035 | 295 |
| 1013 | 3300053094 | Ga0500566_0007702 | Ga0500566_0007702_5033_5920 | 295 |
| 1014 | 3300053094 | Ga0500566_0033416 | Ga0500566_0033416_1325_2215 | 295 |
| 1015 | 3300053094 | Ga0500566_0043140 | Ga0500566_0043140_98_1000 | 295 |
| 1016 | 3300053094 | Ga0500566_0134479 | Ga0500566_0134479_275_1162 | 295 |
| 1017 | 3300053095 | Ga0500640_002809 | Ga0500640_002809_3616_4503 | 295 |
| 1018 | 3300053105 | Ga0500557_000057 | Ga0500557_000057_38266_39156 | 295 |
| 1019 | 3300053105 | Ga0500557_090483 | Ga0500557_090483_107_997 | 295 |
| 1020 | 3300053109 | Ga0500569_059070 | Ga0500569_059070_273_1160 | 295 |
| 1021 | 3300053111 | Ga0500572_001892 | Ga0500572_001892_3140_4027 | 295 |
| 1022 | 3300053119 | Ga0500595_004172 | Ga0500595_004172_5107_5994 | 295 |
| 1023 | 3300053119 | Ga0500595_009841 | Ga0500595_009841_2589_3476 | 295 |
| 1024 | 3300053119 | Ga0500595_022825 | Ga0500595_022825_302_1204 | 295 |
| 1025 | 3300053121 | Ga0500607_073306 | Ga0500607_073306_482_1372 | 295 |
| 1026 | 3300053122 | Ga0500608_068887 | Ga0500608_068887_640_1530 | 295 |
| 1027 | 3300053130 | Ga0500642_0000263 | Ga0500642_0000263_18289_19179 | 295 |
| 1028 | 3300053136 | Ga0500559_0049727 | Ga0500559_0049727_306_1208 | 295 |
| 1029 | 3300053136 | Ga0500559_0051797 | Ga0500559_0051797_720_1607 | 295 |
| 1030 | 3300053136 | Ga0500559_0055710 | Ga0500559_0055710_620_1507 | 295 |
| 1031 | 3300053139 | Ga0500568_0037793 | Ga0500568_0037793_420_1310 | 295 |
| 1032 | 3300053140 | Ga0500573_0045454 | Ga0500573_0045454_1216_2118 | 295 |
| 1033 | 3300053142 | Ga0500577_0000035 | Ga0500577_0000035_13117_14004 | 295 |
| 1034 | 3300053150 | Ga0500603_000335 | Ga0500603_000335_8088_8975 | 295 |
| 1035 | 3300053150 | Ga0500603_000740 | Ga0500603_000740_6514_7401 | 295 |
| 1036 | 3300053150 | Ga0500603_035785 | Ga0500603_035785_161_1063 | 295 |
| 1037 | 3300053155 | Ga0500620_005833 | Ga0500620_005833_1032_1922 | 295 |
| 1038 | 3300053159 | Ga0500630_016635 | Ga0500630_016635_284_1171 | 295 |
| 1039 | 3300053162 | Ga0500638_062254 | Ga0500638_062254_85_987 | 295 |
| 1040 | 3300053163 | Ga0500639_001074 | Ga0500639_001074_238_1125 | 295 |
| 1041 | 3300053177 | Ga0500636_0001378 | Ga0500636_0001378_7278_8168 | 295 |
| 1042 | 3300053177 | Ga0500636_0017028 | Ga0500636_0017028_2278_3165 | 295 |
| 1043 | 3300053177 | Ga0500636_0148333 | Ga0500636_0148333_118_1020 | 295 |
| 1044 | 3300053725 | Ga0500576_113008 | Ga0500576_113008_59_946 | 295 |
| 1045 | 3300053728 | Ga0500657_084075 | Ga0500657_084075_406_1308 | 295 |
| 1046 | 3300053730 | Ga0500645_065959 | Ga0500645_065959_46_987 | 295 |
| 1047 | 3300053735 | Ga0500596_001060 | Ga0500596_001060_3276_4163 | 295 |
| 1048 | 3300053735 | Ga0500596_004321 | Ga0500596_004321_256_1158 | 295 |
| 1049 | 3300053737 | Ga0500601_001101 | Ga0500601_001101_2052_2942 | 295 |
| 1050 | 3300054114 | Ga0501084_0005438 | Ga0501084_0005438_4944_5831 | 295 |
| 1051 | 3300054114 | Ga0501084_0036315 | Ga0501084_0036315_2978_3865 | 295 |
| 1052 | 3300060353 | Ga0501082_0018483 | Ga0501082_0018483_714_1601 | 295 |
| 1053 | 3300060353 | Ga0501082_0025748 | Ga0501082_0025748_1414_2301 | 295 |
| 1054 | iso_pu_bacteria | 2507262055 | 2507504320 | 295 |
| 1055 | iso_pu_bacteria | 2513237096 | 2513655421 | 295 |
| 1056 | iso_pu_bacteria | 2513237137 | 2513860015 | 295 |
| 1057 | iso_pu_bacteria | 2513237145 | 2513916501 | 295 |
| 1058 | iso_pu_bacteria | 2517572143 | 2517889908 | 295 |
| 1059 | iso_pu_bacteria | 2524023228 | 2524532903 | 295 |
| 1060 | iso_pu_bacteria | 2617270741 | 2617374679 | 295 |
| 1061 | iso_pu_bacteria | 2667528175 | 2671121068 | 295 |
| 1062 | iso_pu_bacteria | 2791355197 | 2793068143 | 295 |
| 1063 | iso_pu_bacteria | 2791355199 | 2793078539 | 295 |
| 1064 | iso_pu_bacteria | 2935630451 | 2935633100 | 295 |
| 1065 | iso_pu_bacteria | 2941507105 | 2941509598 | 295 |
| 1066 | iso_pu_bacteria | 2941515067 | 2941517427 | 295 |
| 1067 | iso_pu_bacteria | 2941523033 | 2941526620 | 295 |
| 1068 | iso_pu_bacteria | 3005474847 | 3005476126 | 295 |
| 1069 | iso_pu_bacteria | 3005483717 | 3005486013 | 295 |
| 1070 | iso_pu_bacteria | 3005710791 | 3005717414 | 295 |
| 1071 | iso_pu_bacteria | 8006933436 | 8006937439 | 295 |
| 1072 | iso_pu_bacteria | 8006973647 | 8006977468 | 295 |
| 1073 | iso_pu_bacteria | 8016583857 | 8016587716 | 295 |
| 1074 | iso_pu_bacteria | 8019555841 | 8019561185 | 295 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2q7s-assembly1.cif.gz_A | crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution | 0.8329 | 9 | 280 |
| 2q7s-assembly1.cif.gz_A | crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution | 0.8127 | 9 | 280 |
| 2q7s-assembly2.cif.gz_B | crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution | 0.8109 | 9 | 280 |
| 2q7s-assembly2.cif.gz_B | crystal structure of n-formylglutamate amidohydrolase (yp_297560.1) from ralstonia eutropha jmp134 at 2.00 a resolution | 0.7864 | 9 | 280 |
| 2odf-assembly3.cif.gz_C | the crystal structure of gene product atu2144 from agrobacterium tumefaciens | 0.7553 | 9 | 281 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2q7sA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases | 0.8192 | 9 | 280 | 3.40.630.40 |
| 2q7sA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases | 0.799 | 9 | 280 | 3.40.630.40 |
| af_Q21515_35_411_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7219 | 144 | 174 | 3.40.50.1820 |
| 2odfB01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases | 0.7206 | 12 | 282 | 3.40.630.40 |
| 2odfB01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases | 0.7155 | 12 | 282 | 3.40.630.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A327VBP4-F1-model_v4 | N-formylglutamate amidohydrolase | 0.8897 | 125 | 278 |
GO:0016787
|
| AF-A0A382QXK2-F1-model_v4 | N-formylglutamate amidohydrolase | 0.8855 | 152 | 283 |
|
| AF-A0A7K3FDL9-F1-model_v4 | deleted | 0.8851 | 135 | 254 |
|
| AF-A0A2G1YZ59-F1-model_v4 | N-formylglutamate amidohydrolase | 0.8753 | 155 | 282 |
GO:0016787
|
| AF-A0A2G1YT19-F1-model_v4 | deleted | 0.8745 | 130 | 281 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar