F489521

General Info

Members Datasets Scaffolds Average Seq Length
1073 601 883 357

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10007862|JGI25153J46596_100078623
Length 405
Sequence MTQQQXQPVPAXWSPRIAALEPYVPGEQPRIANLVKLNTNENPYPPSPVAVEAIRRAAEDGLERYPDPTSLALREAVARRHGLEPGEVFAGNGSDEVLAHAFFAFFQQAAPLLMPDVSYSFXKVYAQLYGIACEQQPVDEGLGIDIDALAVRARRGCAGIVIANPNAPTGIGLPLSRIEQLLEACPDRVVLVDEAYVDFGGESALPLIRKYPNLLVVQTLSKSRALAGLRVGFACGQAHLIDALVRVKDSFNSYPLDRLASAGAIAALEDEAWFREACGKIVDTREGLTLQLEDLGFEVLPSQTNFVFARHPKRDAAELAASLRERAVLVRHFRQPRIAQYLRISIGTREQCSVLCSGCRTSSTRLHERFPTHAGPGLRSARRGLRRLLGGREHPARKPAGLACP

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
11 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
12 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
13 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
14 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
15 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
16 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
17 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
18 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
19 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
20 2516143018 Ensifer sp. BR816 Isolate Nodule
21 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
22 2519103095 Burkholderia sp. KJ006 Isolate Nodule
23 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
24 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
25 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
26 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
27 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
28 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
29 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
30 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
31 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
32 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
33 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
34 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
35 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
36 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
37 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
38 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
39 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
40 2643221658 Variovorax sp. Root411 Isolate Unclassified
41 2643221672 Variovorax sp. Root434 Isolate Unclassified
42 2643221683 Variovorax sp. Root473 Isolate Unclassified
43 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
44 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
45 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
46 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
47 2738541277 Variovorax sp. GV051 Isolate Unclassified
48 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
49 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
50 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
51 2738541307 Variovorax sp. GV008 Isolate Unclassified
52 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
53 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
54 2738543019 Variovorax sp. GV040 Isolate Unclassified
55 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
56 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
57 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
58 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
59 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
60 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
61 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
62 2791355261 Rhizobium sp. J15 Isolate Nodule
63 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
64 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
65 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
66 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
67 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
68 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
69 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
70 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
71 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
72 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
73 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
74 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
75 2818991446 Variovorax sp. 1180 Isolate Unclassified
76 2818991452 Burkholderia cepacia 561 Isolate Unclassified
77 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
78 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
79 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
80 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
81 2842677519 Variovorax sp. R-72495 Isolate Unclassified
82 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
83 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
84 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
85 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
86 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
87 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
88 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
89 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
90 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
91 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
92 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
93 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
94 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
95 2885198086 Variovorax sp. 679 Isolate Unclassified
96 2885211737 Variovorax sp. 553 Isolate Unclassified
97 2885266251 Ralstonia sp. SET104 Isolate Nodule
98 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
99 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
100 2899924645 Variovorax sp. 369 Isolate Unclassified
101 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
102 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
103 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
104 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
105 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
106 2904456579 Variovorax sp. 2002 Isolate Unclassified
107 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
108 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
109 2904564687 Burkholderia sp. 571 Isolate Unclassified
110 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
111 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
112 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
113 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
114 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
115 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
116 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
117 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
118 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
119 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
120 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
121 2928037797 Variovorax sp. 1126 Isolate Unclassified
122 2928044640 Variovorax sp. 1128 Isolate Unclassified
123 2928051484 Variovorax sp. 1133 Isolate Unclassified
124 2928058823 Ralstonia sp. 1138 Isolate Unclassified
125 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
126 2928070936 Variovorax gossypii 1167 Isolate Unclassified
127 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
128 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
129 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
130 2928163908 Burkholderia sp. 567 Isolate Unclassified
131 2928170801 Burkholderia sp. 572 Isolate Unclassified
132 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
133 2928536128 Burkholderia sola 565 Isolate Unclassified
134 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
135 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
136 2929520902 Variovorax beijingensis 502 Isolate Unclassified
137 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
138 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
139 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
140 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
141 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
142 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
143 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
144 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
145 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
146 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere
147 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
148 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
149 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
150 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
151 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
152 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
153 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
154 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
155 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
156 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
157 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
158 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
159 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
160 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
161 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
162 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
163 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
164 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
165 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
166 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
167 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
168 2996887358 Rhizobium sp. R711 Isolate Nodule
169 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
170 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
171 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
172 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
173 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
174 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
175 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
176 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
177 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
178 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
179 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
180 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
181 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
182 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
183 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
184 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
185 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
186 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
187 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
188 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
189 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
190 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
191 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
192 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
193 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
194 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
195 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
196 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
197 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
198 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
199 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
200 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
201 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
202 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
203 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
204 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
205 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
206 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
207 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
208 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
209 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
210 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
211 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
212 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
213 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
214 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
215 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
216 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
217 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
218 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
219 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
220 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
221 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
222 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
223 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
224 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
225 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
226 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
227 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
228 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
229 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
230 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
231 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
232 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
233 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
234 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
235 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
236 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
237 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
238 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
239 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
240 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
241 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
242 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
243 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
244 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
245 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
246 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
247 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
248 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
249 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
250 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
251 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
252 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
253 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
254 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
255 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
256 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
257 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
258 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
259 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
260 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
261 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
262 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
263 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
264 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
265 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
266 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
267 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
268 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
269 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
270 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
271 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
272 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
273 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
274 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
275 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
276 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
277 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
278 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
279 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
280 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
281 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
282 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
283 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
284 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
285 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
286 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
287 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
288 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
290 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
291 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
292 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
294 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
299 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
301 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
302 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
303 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
306 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
307 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
308 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
309 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
311 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
312 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
313 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
315 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
316 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
317 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
318 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
319 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
320 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
321 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
354 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
355 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
357 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
360 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
361 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
362 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
363 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
364 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
365 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
366 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
367 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
368 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
369 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
370 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
371 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
372 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
373 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
374 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
375 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
376 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
377 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
378 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
379 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
380 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
381 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
382 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
383 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
384 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
385 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
386 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
387 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
388 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
389 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
390 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
391 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
392 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
393 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
394 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
395 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
396 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
397 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
398 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
399 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
400 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
401 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
402 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
403 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
404 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
405 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
406 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
407 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
408 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
409 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
410 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
411 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
412 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
413 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
414 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
415 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
416 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
417 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
418 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
419 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
420 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
421 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
422 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
423 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
424 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
425 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
426 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
427 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
428 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
429 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
430 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
431 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
432 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
433 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
434 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
435 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
436 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
437 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
438 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
439 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
440 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
441 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
442 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
443 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
444 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
445 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
446 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
447 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
448 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
449 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
450 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
451 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
452 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
453 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
454 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
455 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
456 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
457 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
458 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
459 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
460 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
461 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
462 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
463 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
464 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
465 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
466 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
467 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
468 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
469 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
470 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
471 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
472 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
473 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
474 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
475 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
476 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
477 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
478 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
479 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
480 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
481 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
482 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
483 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
484 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
485 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
486 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
487 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
488 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
489 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
490 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
491 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
492 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
493 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
494 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
495 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
496 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
497 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
498 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
499 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
500 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
501 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
502 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
503 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
504 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
505 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
506 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
507 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
508 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
509 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
510 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
511 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
512 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
513 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
514 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
515 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
516 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
517 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
518 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
519 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
520 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
521 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
522 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
523 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
524 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
525 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
526 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
527 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
528 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
529 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
530 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
531 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
532 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
533 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
534 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
535 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
536 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
537 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
538 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
539 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
540 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
541 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
542 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
543 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
544 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
545 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
546 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
547 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
548 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
549 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
550 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
551 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
552 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
553 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
554 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
555 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
556 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
557 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
558 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
559 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
560 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
561 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
562 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
563 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
564 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
565 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
566 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
567 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
568 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
569 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
570 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
571 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
572 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
573 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
574 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
575 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
576 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
577 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
578 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
579 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
580 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
581 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
582 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
583 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
584 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
585 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
586 8005258706 Rhizobium sp. R693 Isolate Nodule
587 8005321885 Rhizobium sp. R72 Isolate Nodule
588 8005395548 Rhizobium sp. R339 Isolate Nodule
589 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
590 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
591 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
592 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
593 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
594 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
595 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
596 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
597 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
598 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
599 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
600 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
601 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.92
Metatranscriptomes 0.37
Isolates 17.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.14
Nodule 7.46
Rhizoplane 4.29
Rhizosphere 47.72
Stem 0
Stem Tuber 0
Unclassified 16.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000425 3300001915 Bacteria 12794
2 JGI24740J21852_10000751 3300001979 Bacteria 14171
3 JGI24740J21852_10005161 3300001979 Bacteria 5539
4 JGI24739J22299_10011760 3300001989 Bacteria 3225
5 JGI24739J22299_10028380 3300001989 Bacteria 1952
6 JGI24737J22298_10012649 3300001990 Bacteria 2750
7 JGI24735J21928_10002083 3300002067 Bacteria 7050
8 JGI24735J21928_10004669 3300002067 Bacteria 4581
9 JGI24738J21930_10004344 3300002075 Bacteria 3487
10 JGI25156J39149_1005241 3300002705 Bacteria 3789
11 JGI25156J39149_1010286 3300002705 Bacteria 2209
12 JGI25156J39149_1011537 3300002705 Bacteria 1992
13 JGI25154J39366_1001351 3300002738 Bacteria 8979
14 JGI25164J39214_1005585 3300002772 Bacteria 1359
15 JGI25152J39213_1001553 3300002773 Bacteria 9747
16 JGI25152J39213_1002376 3300002773 Bacteria 7218
17 JGI25150J39212_1000788 3300002774 Bacteria 10837
18 JGI25159J45721_1002843 3300002987 Bacteria 6352
19 JGI25159J45721_1006736 3300002987 Bacteria 3387
20 JGI25151J46595_10000884 3300003187 Bacteria 23605
21 JGI25151J46595_10002939 3300003187 Bacteria 9747
22 JGI25151J46595_10003673 3300003187 Bacteria 8355
23 JGI25151J46595_10007055 3300003187 Bacteria 5549
24 JGI25406J46586_10061535 3300003203 Bacteria 1210
25 JGI25165J46597_1001028 3300003214 Bacteria 18325
26 JGI25153J46596_10002888 3300003215 Bacteria 9747
27 JGI25153J46596_10007862 3300003215 Bacteria 5176
28 rootH1_10057596 3300003316 Bacteria 5157
29 rootL2_10029885 3300003322 Bacteria 2744
30 rootH1_10100094 3300003323 Bacteria 1552
31 JGI25160J50197_1003945 3300003354 Bacteria 6484
32 JGI25160J50197_1007108 3300003354 Bacteria 4419
33 JGI25161J50226_1002473 3300003374 Bacteria 4709
34 JGI25161J50226_1005654 3300003374 Bacteria 2383
35 Ga0006562J51391_1010605 3300003578 Bacteria 6236
36 Ga0006562J51391_1010608 3300003578 Bacteria 5010
37 Ga0055539_1000194 3300003752 Bacteria 50008
38 Ga0055533_1000812 3300003756 Bacteria 9659
39 Ga0055533_1001762 3300003756 Bacteria 5492
40 Ga0055532_1000139 3300003758 Bacteria 71879
41 Ga0055532_1001309 3300003758 Bacteria 7215
42 Ga0055532_1002498 3300003758 Bacteria 3767
43 Ga0055532_1003446 3300003758 Bacteria 2709
44 Ga0055525_1000655 3300003759 Bacteria 13452
45 Ga0055527_1000020 3300003760 Bacteria 231441
46 Ga0055527_1000931 3300003760 Bacteria 7221
47 Ga0055527_1000933 3300003760 Bacteria 7215
48 Ga0055527_1002173 3300003760 Bacteria 3472
49 Ga0055535_1000023 3300003761 Bacteria 231441
50 Ga0055535_1000161 3300003761 Bacteria 71879
51 Ga0055535_1000478 3300003761 Bacteria 36378
52 Ga0055535_1002245 3300003761 Bacteria 7221
53 Ga0055535_1002247 3300003761 Bacteria 7215
54 Ga0055542_1000009 3300003762 Bacteria 416550
55 Ga0055542_1000035 3300003762 Bacteria 231441
56 Ga0055542_1000456 3300003762 Bacteria 38610
57 Ga0055542_1001487 3300003762 Bacteria 11476
58 Ga0055542_1002581 3300003762 Bacteria 5748
59 Ga0055529_1000039 3300003763 Bacteria 231439
60 Ga0055529_1000292 3300003763 Bacteria 58403
61 Ga0055529_1001054 3300003763 Bacteria 12793
62 Ga0055526_1006305 3300003771 Bacteria 6484
63 Ga0055526_1006314 3300003771 Bacteria 6472
64 Ga0055526_1008749 3300003771 Bacteria 4991
65 Ga0055537_1000011 3300003773 Bacteria 137556
66 Ga0055537_1001963 3300003773 Bacteria 7348
67 Ga0055537_1002323 3300003773 Bacteria 6484
68 Ga0055524_1004426 3300003775 Bacteria 6484
69 Ga0055524_1004441 3300003775 Bacteria 6471
70 Ga0055536_1003875 3300003781 Bacteria 7862
71 Ga0055536_1003959 3300003781 Bacteria 7763
72 Ga0055536_1004506 3300003781 Bacteria 7093
73 Ga0055534_1000020 3300003784 Bacteria 137562
74 Ga0055534_1002413 3300003784 Bacteria 6484
75 Ga0055534_1002666 3300003784 Bacteria 6037
76 Ga0055528_1001737 3300003790 Bacteria 12598
77 Ga0055528_1003874 3300003790 Bacteria 7359
78 Ga0055528_1004741 3300003790 Bacteria 6484
79 Ga0055528_1023844 3300003790 Bacteria 1852
80 Ga0055530_10003619 3300003791 Bacteria 8673
81 Ga0055530_10003648 3300003791 Bacteria 8627
82 Ga0055540_1001080 3300003792 Bacteria 17306
83 Ga0055540_1001207 3300003792 Bacteria 15899
84 Ga0055540_1002737 3300003792 Bacteria 9063
85 Ga0055540_1002879 3300003792 Bacteria 8732
86 Ga0055540_1006070 3300003792 Bacteria 4885
87 Ga0055531_10003096 3300003794 Bacteria 10746
88 Ga0055531_10004364 3300003794 Bacteria 8648
89 Ga0055531_10004868 3300003794 Bacteria 8000
90 Ga0058692_1002184 3300003856 Bacteria 6680
91 Ga0055543_1001375 3300004625 Bacteria 9785
92 Ga0055543_1002066 3300004625 Bacteria 7015
93 Ga0065165_1000115 3300005262 Bacteria 135145
94 Ga0065165_1003947 3300005262 Bacteria 9753
95 Ga0065165_1004737 3300005262 Bacteria 8161
96 Ga0065714_10107559 3300005288 Bacteria 1529
97 Ga0070658_10086931 3300005327 Bacteria 2572
98 Ga0070670_100000669 3300005331 Bacteria 26588
99 Ga0070666_10008389 3300005335 Bacteria 6415
100 Ga0070660_100001282 3300005339 Bacteria 17122
101 Ga0070661_100000302 3300005344 Bacteria 39886
102 Ga0070668_100151610 3300005347 Bacteria 1875
103 Ga0070669_100043922 3300005353 Bacteria 3256
104 Ga0070671_100113123 3300005355 Bacteria 2281
105 Ga0070659_100000200 3300005366 Bacteria 46333
106 Ga0070659_100000941 3300005366 Bacteria 21399
107 Ga0070667_100027191 3300005367 Bacteria 4760
108 Ga0070667_100045075 3300005367 Bacteria 3707
109 Ga0070713_100016947 3300005436 Bacteria 5493
110 Ga0070711_100151172 3300005439 Bacteria 1751
111 Ga0070708_100106012 3300005445 Bacteria 2580
112 Ga0070663_100000026 3300005455 Bacteria 101463
113 Ga0070663_100000078 3300005455 Bacteria 42943
114 Ga0070663_100009378 3300005455 Bacteria 6058
115 Ga0070663_100048038 3300005455 Bacteria 3025
116 Ga0070678_100015546 3300005456 Bacteria 4841
117 Ga0070662_100011515 3300005457 Bacteria 5836
118 Ga0070662_100030840 3300005457 Bacteria 3756
119 Ga0070698_100035496 3300005471 Bacteria 5156
120 Ga0070679_100209868 3300005530 Bacteria 1911
121 Ga0070684_100384438 3300005535 Bacteria 1293
122 Ga0070697_100071783 3300005536 Bacteria 2840
123 Ga0068853_100074198 3300005539 Bacteria 2968
124 Ga0068853_100315180 3300005539 Bacteria 1449
125 Ga0068853_100343612 3300005539 Bacteria 1387
126 Ga0070665_100003526 3300005548 Bacteria 16631
127 Ga0070665_100006778 3300005548 Bacteria 11645
128 Ga0070665_100105931 3300005548 Bacteria 2814
129 Ga0070665_100220295 3300005548 Bacteria 1898
130 Ga0068855_100135458 3300005563 Bacteria 2810
131 Ga0068855_100217863 3300005563 Bacteria 2142
132 Ga0070664_100000014 3300005564 Bacteria 130113
133 Ga0070664_100007993 3300005564 Bacteria 8544
134 Ga0068857_100077900 3300005577 Bacteria 2958
135 Ga0068854_100000029 3300005578 Bacteria 112855
136 Ga0068856_100000457 3300005614 Bacteria 45000
137 Ga0068852_100013365 3300005616 Bacteria 6284
138 Ga0068851_10013539 3300005834 Bacteria 3859
139 Ga0068862_100040567 3300005844 Bacteria 3957
140 Ga0081455_10022800 3300005937 Bacteria 5841
141 Ga0081539_10003020 3300005985 Bacteria 21846
142 Ga0081539_10020200 3300005985 Bacteria 4516
143 Ga0070717_10023902 3300006028 Bacteria 4848
144 Ga0075365_10060890 3300006038 Bacteria 2519
145 Ga0075365_10097546 3300006038 Bacteria 2010
146 Ga0075365_10154544 3300006038 Bacteria 1597
147 Ga0075365_10175587 3300006038 Bacteria 1496
148 Ga0075363_100017266 3300006048 Bacteria 3576
149 Ga0075363_100059682 3300006048 Bacteria 2052
150 Ga0075364_10030434 3300006051 Bacteria 3464
151 Ga0075364_10030568 3300006051 Bacteria 3457
152 Ga0075364_10128099 3300006051 Bacteria 1703
153 Ga0070716_100064837 3300006173 Bacteria 2125
154 Ga0070712_100016331 3300006175 Bacteria 4795
155 Ga0075362_10015578 3300006177 Bacteria 3095
156 Ga0075362_10015889 3300006177 Bacteria 3070
157 Ga0075362_10025016 3300006177 Bacteria 2537
158 Ga0075362_10036266 3300006177 Bacteria 2156
159 Ga0075362_10049816 3300006177 Bacteria 1872
160 Ga0075362_10087083 3300006177 Bacteria 1446
161 Ga0075367_10011178 3300006178 Bacteria 4738
162 Ga0075367_10019937 3300006178 Bacteria 3727
163 Ga0075367_10020654 3300006178 Bacteria 3671
164 Ga0075367_10024967 3300006178 Bacteria 3375
165 Ga0075369_10010816 3300006186 Bacteria 3575
166 Ga0075366_10048273 3300006195 Bacteria 2524
167 Ga0075370_10009544 3300006353 Bacteria 5043
168 Ga0075370_10022959 3300006353 Bacteria 3432
169 Ga0075370_10026421 3300006353 Bacteria 3216
170 Ga0075370_10062784 3300006353 Bacteria 2117
171 Ga0075370_10090883 3300006353 Bacteria 1761
172 Ga0075370_10131389 3300006353 Bacteria 1461
173 Ga0075370_10176461 3300006353 Bacteria 1257
174 Ga0075434_100279857 3300006871 Bacteria 1688
175 Ga0079104_1000140 3300006946 Bacteria 102147
176 Ga0079104_1001126 3300006946 Bacteria 19544
177 Ga0079104_1002959 3300006946 Bacteria 8374
178 Ga0079104_1004846 3300006946 Bacteria 5580
179 Ga0099826_10000432 3300006948 Bacteria 19961
180 Ga0099794_10040762 3300007265 Bacteria 2209
181 Ga0099795_10013570 3300007788 Bacteria 2503
182 Ga0105244_10006094 3300009036 Bacteria 7880
183 Ga0105250_10001544 3300009092 Bacteria 12364
184 Ga0105240_10018564 3300009093 Bacteria 9335
185 Ga0105240_10109589 3300009093 Bacteria 3343
186 Ga0105240_10112192 3300009093 Bacteria 3296
187 Ga0105240_10149489 3300009093 Bacteria 2784
188 Ga0111539_10162461 3300009094 Bacteria 2612
189 Ga0105243_10006370 3300009148 Bacteria 9119
190 Ga0105243_10009580 3300009148 Bacteria 7376
191 Ga0105248_10077470 3300009177 Bacteria 3737
192 Ga0105237_10092301 3300009545 Bacteria 3017
193 Ga0105238_10011579 3300009551 Bacteria 8887
194 Ga0105238_10042907 3300009551 Bacteria 4578
195 Ga0105238_10055999 3300009551 Bacteria 3956
196 Ga0105238_10076857 3300009551 Bacteria 3331
197 Ga0123341_1048699 3300009765 Bacteria 2461
198 Ga0123342_1015404 3300009766 Bacteria 6963
199 Ga0099796_10032543 3300010159 Bacteria 1709
200 Ga0105239_10032227 3300010375 Bacteria 5760
201 Ga0105239_10162445 3300010375 Bacteria 2496
202 Ga0105246_10182550 3300011119 Bacteria 1617
203 Ga0157373_10005551 3300013100 Bacteria 9455
204 Ga0157373_10025247 3300013100 Bacteria 4300
205 Ga0157373_10031284 3300013100 Bacteria 3831
206 Ga0157371_10000118 3300013102 Bacteria 120790
207 Ga0157371_10017689 3300013102 Bacteria 5289
208 Ga0157370_10000038 3300013104 Bacteria 135182
209 Ga0157370_10004758 3300013104 Bacteria 15452
210 Ga0157370_10037545 3300013104 Bacteria 4696
211 Ga0157370_10241613 3300013104 Bacteria 1671
212 Ga0157369_10001430 3300013105 Bacteria 29294
213 Ga0157369_10006743 3300013105 Bacteria 13250
214 Ga0157369_10146242 3300013105 Bacteria 2499
215 Ga0157374_10013236 3300013296 Bacteria 7197
216 Ga0163162_10010537 3300013306 Bacteria 8991
217 Ga0157372_10000095 3300013307 Bacteria 91464
218 Ga0157372_10042418 3300013307 Bacteria 5033
219 Ga0182008_10003374 3300014497 Bacteria 9685
220 Ga0182008_10004329 3300014497 Bacteria 8308
221 Ga0182008_10101483 3300014497 Bacteria 1423
222 Ga0182008_10113995 3300014497 Bacteria 1340
223 Ga0182006_1002614 3300015261 Bacteria 9732
224 Ga0182006_1003165 3300015261 Bacteria 8601
225 Ga0182006_1042830 3300015261 Bacteria 1772
226 Ga0182006_1076556 3300015261 Bacteria 1229
227 Ga0182007_10000298 3300015262 Bacteria 32177
228 Ga0182007_10004526 3300015262 Bacteria 6285
229 Ga0182007_10008801 3300015262 Bacteria 4118
230 Ga0182005_1001414 3300015265 Bacteria 9715
231 Ga0183362_10001 3300015683 Bacteria 2046624
232 Ga0183361_10001 3300016635 Bacteria 908583
233 Ga0163161_10000042 3300017792 Bacteria 135368
234 Ga0163161_10023957 3300017792 Bacteria 4308
235 Ga0163161_10125023 3300017792 Bacteria 1935
236 Ga0206351_10147340 3300020077 Bacteria 8940
237 Ga0154015_1274796 3300020610 Bacteria 5283
238 Ga0213876_10107972 3300021384 Bacteria 1477
239 Ga0213875_10002062 3300021388 Bacteria 12328
240 Ga0209436_104561 3300025208 Bacteria 3402
241 Ga0209784_100006 3300025224 Bacteria 930704
242 Ga0209784_100108 3300025224 Bacteria 94409
243 Ga0209784_101294 3300025224 Bacteria 3602
244 Ga0209784_102779 3300025224 Bacteria 1657
245 Ga0209566_100002 3300025225 Bacteria 2614868
246 Ga0209566_100164 3300025225 Bacteria 73577
247 Ga0209566_100626 3300025225 Bacteria 21772
248 Ga0209566_101652 3300025225 Bacteria 5713
249 Ga0209674_100017 3300025226 Bacteria 689087
250 Ga0209674_100097 3300025226 Bacteria 167285
251 Ga0209674_100168 3300025226 Bacteria 84107
252 Ga0209674_100287 3300025226 Bacteria 36895
253 Ga0209674_107283 3300025226 Bacteria 1411
254 Ga0209672_100001 3300025228 Bacteria 2828210
255 Ga0209672_100046 3300025228 Bacteria 264244
256 Ga0209672_100088 3300025228 Bacteria 121401
257 Ga0209672_100252 3300025228 Bacteria 39846
258 Ga0209147_100001 3300025229 Bacteria 2384371
259 Ga0209147_100018 3300025229 Bacteria 515719
260 Ga0209147_100043 3300025229 Bacteria 300460
261 Ga0209147_100130 3300025229 Bacteria 121401
262 Ga0209147_100214 3300025229 Bacteria 60481
263 Ga0209147_100373 3300025229 Bacteria 31414
264 Ga0209563_100136 3300025230 Bacteria 88047
265 Ga0209563_102466 3300025230 Bacteria 4176
266 Ga0209563_108718 3300025230 Bacteria 1581
267 Ga0207427_100478 3300025231 Bacteria 21607
268 Ga0209258_100001 3300025242 Bacteria 2384269
269 Ga0209258_100009 3300025242 Bacteria 996276
270 Ga0209258_100023 3300025242 Bacteria 547286
271 Ga0209258_100028 3300025242 Bacteria 515719
272 Ga0209258_100204 3300025242 Bacteria 121401
273 Ga0207425_1000590 3300025245 Bacteria 21180
274 Ga0209646_1000153 3300025246 Bacteria 96707
275 Ga0209026_1009768 3300025250 Bacteria 1852
276 Ga0209677_100007 3300025253 Bacteria 1021332
277 Ga0209148_1000003 3300025254 Bacteria 2384288
278 Ga0209148_1000007 3300025254 Bacteria 1592273
279 Ga0209148_1000029 3300025254 Bacteria 579199
280 Ga0209148_1000286 3300025254 Bacteria 75823
281 Ga0209148_1001373 3300025254 Bacteria 12675
282 Ga0209148_1002571 3300025254 Bacteria 6018
283 Ga0209759_1000037 3300025256 Bacteria 259200
284 Ga0209759_1000175 3300025256 Bacteria 106788
285 Ga0209759_1000649 3300025256 Bacteria 32356
286 Ga0209759_1003128 3300025256 Bacteria 6767
287 Ga0209759_1010536 3300025256 Bacteria 2704
288 Ga0209759_1014653 3300025256 Bacteria 2061
289 Ga0209129_1000013 3300025258 Bacteria 524874
290 Ga0209129_1002294 3300025258 Bacteria 9523
291 Ga0209233_1000123 3300025261 Bacteria 228400
292 Ga0209565_1000058 3300025263 Bacteria 194126
293 Ga0209565_1000197 3300025263 Bacteria 71850
294 Ga0209565_1001200 3300025263 Bacteria 12345
295 Ga0209455_1000001 3300025272 Bacteria 2384278
296 Ga0209455_1000064 3300025272 Bacteria 332404
297 Ga0209455_1000107 3300025272 Bacteria 195136
298 Ga0209455_1001161 3300025272 Bacteria 12675
299 Ga0209673_1000053 3300025273 Bacteria 279449
300 Ga0209673_1000084 3300025273 Bacteria 215878
301 Ga0209673_1000245 3300025273 Bacteria 103315
302 Ga0209673_1000535 3300025273 Bacteria 62272
303 Ga0209673_1005009 3300025273 Bacteria 6847
304 Ga0209130_1000163 3300025284 Bacteria 98074
305 Ga0209130_1001358 3300025284 Bacteria 16510
306 Ga0209130_1015337 3300025284 Bacteria 1892
307 Ga0209675_1000010 3300025291 Bacteria 541927
308 Ga0209675_1000440 3300025291 Bacteria 32862
309 Ga0209675_1000612 3300025291 Bacteria 25599
310 Ga0209676_1000108 3300025292 Bacteria 221168
311 Ga0209676_1000653 3300025292 Bacteria 49661
312 Ga0209676_1001003 3300025292 Bacteria 33089
313 Ga0209676_1003446 3300025292 Bacteria 9729
314 Ga0209676_1017349 3300025292 Bacteria 2553
315 Ga0209025_1000103 3300025294 Bacteria 228054
316 Ga0209025_1000129 3300025294 Bacteria 198847
317 Ga0209025_1000169 3300025294 Bacteria 161428
318 Ga0209025_1012899 3300025294 Bacteria 5310
319 Ga0209025_1040447 3300025294 Bacteria 2016
320 Ga0209564_1000171 3300025295 Bacteria 155716
321 Ga0209564_1000517 3300025295 Bacteria 63233
322 Ga0209564_1002711 3300025295 Bacteria 13373
323 Ga0209564_1007255 3300025295 Bacteria 5759
324 Ga0209758_1000067 3300025297 Bacteria 288575
325 Ga0209758_1007228 3300025297 Bacteria 7642
326 Ga0209758_1023553 3300025297 Bacteria 2780
327 Ga0209050_1000002 3300025298 Bacteria 1792849
328 Ga0209050_1001558 3300025298 Bacteria 23912
329 Ga0209050_1005256 3300025298 Bacteria 8248
330 Ga0209050_1020251 3300025298 Bacteria 2483
331 Ga0209256_1000077 3300025299 Bacteria 230410
332 Ga0209256_1000121 3300025299 Bacteria 167299
333 Ga0207426_1000007 3300025302 Bacteria 971011
334 Ga0207426_1000101 3300025302 Bacteria 262096
335 Ga0207426_1000129 3300025302 Bacteria 210930
336 Ga0207426_1003361 3300025302 Bacteria 8780
337 Ga0209051_1000002 3300025303 Bacteria 1631846
338 Ga0209051_1000145 3300025303 Bacteria 134807
339 Ga0209051_1000289 3300025303 Bacteria 80415
340 Ga0209051_1000501 3300025303 Bacteria 49660
341 Ga0209051_1029941 3300025303 Bacteria 2122
342 Ga0209257_1000002 3300025304 Bacteria 1767052
343 Ga0209257_1001684 3300025304 Bacteria 24845
344 Ga0209257_1004495 3300025304 Bacteria 10749
345 Ga0209257_1009417 3300025304 Bacteria 5239
346 Ga0207655_1001616 3300025728 Bacteria 20066
347 Ga0207713_1032044 3300025735 Bacteria 2314
348 Ga0207647_10001999 3300025904 Bacteria 15600
349 Ga0207647_10007729 3300025904 Bacteria 7740
350 Ga0207647_10011776 3300025904 Bacteria 6117
351 Ga0207695_10002200 3300025913 Bacteria 29366
352 Ga0207695_10005494 3300025913 Bacteria 16777
353 Ga0207695_10100894 3300025913 Bacteria 2881
354 Ga0207671_10008949 3300025914 Bacteria 8425
355 Ga0207671_10037971 3300025914 Bacteria 3570
356 Ga0207671_10054753 3300025914 Bacteria 2955
357 Ga0207693_10012674 3300025915 Bacteria 6809
358 Ga0207657_10000022 3300025919 Bacteria 154101
359 Ga0207649_10000357 3300025920 Bacteria 34223
360 Ga0207652_10132158 3300025921 Bacteria 2227
361 Ga0207681_10008967 3300025923 Bacteria 6109
362 Ga0207694_10000464 3300025924 Bacteria 37340
363 Ga0207694_10027435 3300025924 Bacteria 4337
364 Ga0207694_10042412 3300025924 Bacteria 3509
365 Ga0207694_10071388 3300025924 Bacteria 2713
366 Ga0207650_10001098 3300025925 Bacteria 19961
367 Ga0207664_10112515 3300025929 Bacteria 2266
368 Ga0207664_10223124 3300025929 Bacteria 1635
369 Ga0207644_10087491 3300025931 Bacteria 2316
370 Ga0207690_10000010 3300025932 Bacteria 330298
371 Ga0207690_10000489 3300025932 Bacteria 25578
372 Ga0207706_10002534 3300025933 Bacteria 17812
373 Ga0207706_10061895 3300025933 Bacteria 3296
374 Ga0207709_10001981 3300025935 Bacteria 13355
375 Ga0207709_10025763 3300025935 Bacteria 3370
376 Ga0207665_10061378 3300025939 Bacteria 2548
377 Ga0207691_10259750 3300025940 Bacteria 1497
378 Ga0207689_10065912 3300025942 Bacteria 2978
379 Ga0207679_10000173 3300025945 Bacteria 53176
380 Ga0207679_10069199 3300025945 Bacteria 2655
381 Ga0207667_10018019 3300025949 Bacteria 7930
382 Ga0207667_10048092 3300025949 Bacteria 4512
383 Ga0207668_10085588 3300025972 Bacteria 2301
384 Ga0207640_10000029 3300025981 Bacteria 130583
385 Ga0207658_10029361 3300025986 Bacteria 3883
386 Ga0207658_10063020 3300025986 Bacteria 2777
387 Ga0207639_10022793 3300026041 Bacteria 4514
388 Ga0207639_10331710 3300026041 Bacteria 1354
389 Ga0207678_10000031 3300026067 Bacteria 112136
390 Ga0207678_10000226 3300026067 Bacteria 50299
391 Ga0207678_10014828 3300026067 Bacteria 6857
392 Ga0207678_10290472 3300026067 Bacteria 1404
393 Ga0207702_10000083 3300026078 Bacteria 106990
394 Ga0207702_10252398 3300026078 Bacteria 1657
395 Ga0207674_10340135 3300026116 Bacteria 1451
396 Ga0207683_10006046 3300026121 Bacteria 10363
397 Ga0207683_10041512 3300026121 Bacteria 4017
398 Ga0207683_10163052 3300026121 Bacteria 2016
399 Ga0207698_10008894 3300026142 Bacteria 6367
400 Ga0209281_1000052 3300027111 Bacteria 314741
401 Ga0209281_1001255 3300027111 Bacteria 16525
402 Ga0209281_1003546 3300027111 Bacteria 5094
403 Ga0209371_1000160 3300027312 Bacteria 103642
404 Ga0209371_1011906 3300027312 Bacteria 2552
405 Ga0209179_1023355 3300027512 Bacteria 1220
406 Ga0209282_1001250 3300027666 Bacteria 13759
407 Ga0268266_10002159 3300028379 Bacteria 21578
408 Ga0268266_10013538 3300028379 Bacteria 7024
409 Ga0268265_10019940 3300028380 Bacteria 4671
410 Ga0265323_10015761 3300028653 Bacteria 2967
411 Ga0307515_10000529 3300028794 Bacteria 90388
412 Ga0307515_10040192 3300028794 Bacteria 7404
413 Ga0265338_10000118 3300028800 Bacteria 146710
414 Ga0268256_1000132 3300030500 Bacteria 103642
415 Ga0268256_1012964 3300030500 Bacteria 2552
416 Ga0314311_1017616 3300030733 Bacteria 7952
417 Ga0316182_1269150 3300030745 Bacteria 2786
418 Ga0265340_10003072 3300031247 Bacteria 9476
419 Ga0265327_10001599 3300031251 Bacteria 27544
420 Ga0265327_10023492 3300031251 Bacteria 3650
421 Ga0265327_10051754 3300031251 Bacteria 2142
422 Ga0265316_10024710 3300031344 Bacteria 5026
423 Ga0265316_10059660 3300031344 Bacteria 2966
424 Ga0307513_10050100 3300031456 Bacteria 4518
425 Ga0307408_100030230 3300031548 Bacteria 3760
426 Ga0307408_100031034 3300031548 Bacteria 3716
427 Ga0307408_100128015 3300031548 Bacteria 1977
428 Ga0307408_100143702 3300031548 Bacteria 1875
429 Ga0307408_100145243 3300031548 Bacteria 1866
430 Ga0307408_100220111 3300031548 Bacteria 1548
431 Ga0307408_100299328 3300031548 Bacteria 1347
432 Ga0265314_10000328 3300031711 Bacteria 66888
433 Ga0265314_10003011 3300031711 Bacteria 16665
434 Ga0265314_10063854 3300031711 Bacteria 2496
435 Ga0265342_10026622 3300031712 Bacteria 3621
436 Ga0307405_10022168 3300031731 Bacteria 3586
437 Ga0307405_10022824 3300031731 Bacteria 3545
438 Ga0307405_10097243 3300031731 Bacteria 1965
439 Ga0307405_10220463 3300031731 Bacteria 1391
440 Ga0307406_10004992 3300031901 Bacteria 7228
441 Ga0307412_10000014 3300031911 Bacteria 353795
442 Ga0307412_10186405 3300031911 Bacteria 1565
443 Ga0307416_100007344 3300032002 Bacteria 6999
444 Ga0307411_10053284 3300032005 Bacteria 2649
445 Ga0307411_10233796 3300032005 Bacteria 1434
446 Ga0373953_0004150 3300035117 Bacteria 4595
447 Ga0373953_0004357 3300035117 Bacteria 4507
448 Ga0373954_0030096 3300035118 Bacteria 2502
449 Ga0373956_0037667 3300035119 Bacteria 2138
450 Ga0373956_0047205 3300035119 Bacteria 1926
451 Ga0373957_0060811 3300035120 Bacteria 1463
452 Ga0373943_0076250 3300035170 Bacteria 1710
453 Ga0373955_0041418 3300035172 Bacteria 2469
454 Ga0373955_0042271 3300035172 Bacteria 2446
455 Ga0373924_0005333 3300035410 Bacteria 4545
456 Ga0373933_0011765 3300035724 Bacteria 4832
457 Ga0373933_0075313 3300035724 Bacteria 2060
458 Ga0373947_0081929 3300035725 Bacteria 1999
459 Ga0373937_0005500 3300036401 Bacteria 10856
460 Ga0373937_0058800 3300036401 Bacteria 3531
461 Ga0373925_0005856 3300037068 Bacteria 9115
462 Ga0373925_0033942 3300037068 Bacteria 3760
463 Ga0395899_0058474 3300037312 Bacteria 2843
464 Ga0395900_0014802 3300037418 Bacteria 7949
465 Ga0395905_0000014 3300037471 Bacteria 394209
466 Ga0436364_1018828 3300037853 Bacteria 24754
467 Ga0395901_0090978 3300038443 Bacteria 3194
468 Ga0400484_09450 3300038725 Bacteria 51957
469 Ga0400490_16569 3300038726 Bacteria 23325
470 Ga0400490_34331 3300038726 Bacteria 51219
471 Ga0400488_00855 3300038741 Bacteria 2085
472 Ga0400488_31230 3300038741 Bacteria 9436
473 Ga0400488_46229 3300038741 Bacteria 8025
474 Ga0400488_57661 3300038741 Bacteria 2202
475 Ga0400483_022484 3300039062 Bacteria 6616
476 Ga0400483_110940 3300039062 Bacteria 25482
477 Ga0400483_124837 3300039062 Bacteria 2038
478 Ga0400483_139881 3300039062 Bacteria 3557
479 Ga0400483_162033 3300039062 Bacteria 3222
480 Ga0400483_178214 3300039062 Bacteria 5664
481 Ga0400489_82739 3300039093 Bacteria 12458
482 Ga0400487_00755 3300039110 Bacteria 32177
483 Ga0400487_17506 3300039110 Bacteria 28809
484 Ga0400487_20039 3300039110 Bacteria 2534
485 Ga0436365_1223717 3300039437 Bacteria 3382
486 Ga0436365_1537138 3300039437 Bacteria 1645
487 Ga0436360_0029592 3300039438 Bacteria 1761
488 Ga0439436_0000214 3300041404 Bacteria 13875
489 Ga0439439_0012974 3300041406 Unclassified 2017
490 Ga0439461_0003905 3300041410 Bacteria 2471
491 Ga0439466_0001691 3300041411 Bacteria 8611
492 Ga0439466_0035238 3300041411 Bacteria 1693
493 Ga0439465_0000284 3300041413 Bacteria 14247
494 Ga0439465_0006085 3300041413 Bacteria 3836
495 Ga0439465_0059064 3300041413 Bacteria 1268
496 Ga0439465_0068097 3300041413 Bacteria 1189
497 Ga0451853_0648112 3300041512 Bacteria 1618
498 Ga0439431_0001002 3300041997 Bacteria 6130
499 Ga0439433_0000507 3300041999 Bacteria 7285
500 Ga0439445_0001387 3300042004 Bacteria 5255
501 Ga0439432_000159 3300042006 Bacteria 23165
502 Ga0439432_004404 3300042006 Bacteria 5145
503 Ga0439449_0000249 3300042007 Bacteria 19258
504 Ga0439449_0000826 3300042007 Bacteria 11992
505 Ga0439449_0002714 3300042007 Bacteria 6891
506 Ga0439449_0045678 3300042007 Bacteria 1623
507 Ga0439452_000942 3300042010 Bacteria 13057
508 Ga0439457_004362 3300042014 Bacteria 3695
509 Ga0439462_0004652 3300042015 Bacteria 3357
510 Ga0450920_006450 3300042122 Bacteria 2111
511 Ga0450898_013372 3300042134 Bacteria 1367
512 Ga0450906_002514 3300042145 Bacteria 4004
513 Ga0450906_011779 3300042145 Bacteria 1630
514 Ga0439446_0001321 3300042156 Bacteria 5580
515 Ga0439446_0005757 3300042156 Bacteria 3202
516 Ga0450908_003602 3300042184 Bacteria 3015
517 Ga0439434_0000603 3300042435 Bacteria 10334
518 Ga0439434_0001166 3300042435 Bacteria 7603
519 Ga0439464_0009131 3300042439 Bacteria 2606
520 Ga0451577_0000603 3300042876 Bacteria 57862
521 Ga0466986_0139040 3300044650 Bacteria 1648
522 Ga0466969_0000396 3300044656 Bacteria 23866
523 Ga0466972_0000283 3300044658 Bacteria 31634
524 Ga0466965_0000909 3300044683 Bacteria 11333
525 Ga0466966_0029968 3300044684 Bacteria 3537
526 Ga0466966_0030704 3300044684 Bacteria 3486
527 Ga0466966_0060052 3300044684 Bacteria 2400
528 Ga0466963_0000828 3300044694 Bacteria 15502
529 Ga0453684_0000014 3300044712 Bacteria 993311
530 Ga0453684_0139413 3300044712 Bacteria 2899
531 Ga0453684_0139836 3300044712 Bacteria 2893
532 Ga0466968_0078121 3300044735 Bacteria 1450
533 Ga0466970_0009250 3300044765 Bacteria 4973
534 Ga0466970_0126792 3300044765 Bacteria 1400
535 Ga0466957_0023839 3300044842 Bacteria 3619
536 Ga0466957_0272471 3300044842 Bacteria 1130
537 Ga0466959_0025316 3300045049 Bacteria 4397
538 Ga0466959_0089716 3300045049 Bacteria 2208
539 Ga0451576_0079011 3300045051 Bacteria 3423
540 Ga0466958_0008883 3300045836 Bacteria 5581
541 Ga0466958_0152971 3300045836 Bacteria 1456
542 Ga0466967_0556383 3300045976 Bacteria 1129
543 Ga0495592_0071206 3300046454 Bacteria 2531
544 Ga0495603_0020534 3300046455 Bacteria 4002
545 Ga0495603_0024278 3300046455 Bacteria 3666
546 Ga0495590_0014815 3300046457 Bacteria 2842
547 Ga0495591_000791 3300046458 Bacteria 22446
548 Ga0495591_005442 3300046458 Bacteria 5902
549 Ga0495629_0001348 3300046459 Bacteria 19354
550 Ga0495629_0003125 3300046459 Bacteria 12552
551 Ga0495629_0003148 3300046459 Bacteria 12497
552 Ga0495629_0030457 3300046459 Bacteria 3825
553 Ga0495629_0139094 3300046459 Bacteria 1690
554 Ga0495629_0210125 3300046459 Bacteria 1344
555 Ga0495638_0012178 3300046460 Bacteria 5905
556 Ga0495638_0019593 3300046460 Bacteria 4475
557 Ga0495651_0004507 3300046462 Bacteria 10661
558 Ga0495653_0000246 3300046463 Bacteria 43409
559 Ga0495653_0015589 3300046463 Bacteria 6195
560 Ga0495653_0035979 3300046463 Bacteria 3903
561 Ga0495653_0053734 3300046463 Bacteria 3080
562 Ga0495653_0104709 3300046463 Bacteria 2044
563 Ga0495653_0120593 3300046463 Bacteria 1870
564 Ga0495653_0171111 3300046463 Bacteria 1499
565 Ga0495650_0002161 3300046471 Bacteria 16666
566 Ga0495580_0000803 3300046472 Bacteria 27143
567 Ga0495580_0004970 3300046472 Bacteria 11109
568 Ga0495580_0009006 3300046472 Bacteria 7880
569 Ga0495580_0011237 3300046472 Bacteria 6927
570 Ga0495580_0015300 3300046472 Bacteria 5791
571 Ga0495580_0024823 3300046472 Bacteria 4383
572 Ga0495580_0310599 3300046472 Bacteria 1072
573 Ga0495582_0007322 3300046473 Bacteria 6115
574 Ga0495582_0022001 3300046473 Bacteria 3488
575 Ga0495582_0022261 3300046473 Bacteria 3468
576 Ga0495582_0038275 3300046473 Bacteria 2639
577 Ga0495582_0042356 3300046473 Bacteria 2508
578 Ga0495605_0001100 3300046474 Bacteria 17990
579 Ga0495605_0002292 3300046474 Bacteria 11951
580 Ga0495605_0014364 3300046474 Bacteria 4340
581 Ga0495639_0018773 3300046475 Bacteria 3012
582 Ga0495639_0114697 3300046475 Bacteria 1281
583 Ga0495662_0134887 3300046476 Bacteria 1214
584 Ga0495664_0044411 3300046477 Bacteria 2633
585 Ga0495585_0159962 3300046492 Bacteria 1169
586 Ga0495596_0021579 3300046500 Bacteria 2627
587 Ga0495596_0081098 3300046500 Bacteria 1259
588 Ga0495583_0005045 3300046506 Bacteria 9123
589 Ga0495606_0011868 3300046507 Bacteria 7050
590 Ga0495606_0079499 3300046507 Bacteria 2042
591 Ga0495608_0005355 3300046511 Bacteria 9169
592 Ga0495608_0028877 3300046511 Bacteria 3768
593 Ga0495608_0059327 3300046511 Bacteria 2521
594 Ga0495616_0021156 3300046513 Bacteria 3527
595 Ga0495616_0067269 3300046513 Bacteria 1742
596 Ga0495618_0012608 3300046514 Bacteria 5135
597 Ga0495620_0010367 3300046515 Bacteria 4918
598 Ga0495620_0043324 3300046515 Bacteria 1961
599 Ga0495628_0017869 3300046516 Bacteria 5885
600 Ga0495628_0038150 3300046516 Bacteria 3847
601 Ga0495628_0066197 3300046516 Bacteria 2824
602 Ga0495628_0178502 3300046516 Bacteria 1607
603 Ga0495628_0369500 3300046516 Bacteria 1052
604 Ga0495630_0035456 3300046517 Bacteria 3728
605 Ga0495630_0186845 3300046517 Bacteria 1581
606 Ga0495631_0000088 3300046518 Bacteria 59630
607 Ga0495631_0070125 3300046518 Bacteria 1515
608 Ga0495637_0010963 3300046520 Bacteria 4368
609 Ga0495644_0080580 3300046523 Bacteria 1227
610 Ga0495648_0045645 3300046524 Bacteria 2723
611 Ga0495666_0003678 3300046526 Bacteria 7750
612 Ga0495666_0004075 3300046526 Bacteria 7383
613 Ga0495642_0024251 3300046528 Bacteria 2399
614 Ga0495642_0047233 3300046528 Bacteria 1762
615 Ga0495652_0016973 3300046529 Bacteria 6504
616 Ga0495654_0039123 3300046530 Bacteria 2368
617 Ga0495654_0048304 3300046530 Bacteria 2089
618 Ga0495665_0016826 3300046531 Bacteria 3936
619 Ga0495665_0019441 3300046531 Bacteria 3653
620 Ga0495665_0024966 3300046531 Bacteria 3211
621 Ga0495640_0173024 3300046533 Bacteria 1379
622 Ga0495586_0051489 3300046535 Bacteria 2229
623 Ga0495586_0063427 3300046535 Bacteria 2013
624 Ga0495587_0007211 3300046536 Bacteria 7213
625 Ga0495587_0013176 3300046536 Bacteria 5199
626 Ga0495587_0151257 3300046536 Bacteria 1323
627 Ga0495609_0073592 3300046538 Bacteria 1499
628 Ga0495645_0002307 3300046543 Bacteria 12965
629 Ga0495645_0005748 3300046543 Bacteria 8549
630 Ga0495645_0007946 3300046543 Bacteria 7383
631 Ga0495622_0014881 3300046557 Bacteria 3617
632 Ga0495622_0016630 3300046557 Bacteria 3426
633 Ga0495667_0020652 3300046559 Bacteria 4443
634 Ga0495667_0037230 3300046559 Bacteria 3243
635 Ga0495656_0000106 3300046615 Bacteria 34172
636 Ga0495668_0030852 3300046616 Bacteria 3023
637 Ga0495634_0005877 3300046642 Bacteria 9377
638 Ga0495625_0002306 3300046660 Bacteria 20876
639 Ga0495635_0004906 3300046663 Bacteria 9303
640 Ga0495635_0018065 3300046663 Bacteria 4925
641 Ga0495635_0034172 3300046663 Bacteria 3527
642 Ga0495661_0008466 3300046665 Bacteria 7111
643 Ga0495661_0033257 3300046665 Bacteria 3253
644 Ga0495599_0022737 3300046678 Bacteria 3915
645 Ga0495623_0026574 3300046679 Bacteria 3725
646 Ga0495623_0065070 3300046679 Bacteria 2280
647 Ga0495623_0079138 3300046679 Bacteria 2037
648 Ga0495646_0000411 3300046680 Bacteria 22588
649 Ga0495646_0004942 3300046680 Bacteria 8419
650 Ga0495646_0039957 3300046680 Bacteria 2891
651 Ga0495646_0055178 3300046680 Bacteria 2387
652 Ga0495658_0015701 3300046683 Bacteria 3888
653 Ga0495669_0015128 3300046684 Bacteria 3301
654 Ga0495624_0000480 3300046690 Bacteria 31197
655 Ga0495624_0004188 3300046690 Bacteria 10600
656 Ga0495624_0009643 3300046690 Bacteria 6683
657 Ga0495624_0011954 3300046690 Bacteria 5950
658 Ga0495670_0051119 3300046691 Bacteria 2068
659 Ga0495671_0003011 3300046692 Bacteria 10477
660 Ga0495649_0007008 3300046694 Bacteria 6949
661 Ga0495649_0010030 3300046694 Bacteria 5600
662 Ga0495649_0035698 3300046694 Bacteria 2734
663 Ga0495589_0003243 3300046794 Bacteria 8868
664 Ga0495589_0032012 3300046794 Bacteria 2645
665 Ga0495600_0003049 3300046809 Bacteria 9781
666 Ga0495600_0032604 3300046809 Bacteria 3381
667 Ga0495581_0002005 3300047315 Bacteria 11435
668 Ga0495581_0008129 3300047315 Bacteria 6076
669 Ga0495581_0129863 3300047315 Bacteria 1468
670 Ga0495604_0016589 3300047317 Bacteria 5888
671 Ga0495674_0000742 3300047319 Bacteria 30834
672 Ga0495674_0002606 3300047319 Bacteria 17571
673 Ga0495674_0014804 3300047319 Bacteria 7297
674 Ga0495674_0067056 3300047319 Bacteria 3110
675 Ga0495674_0083907 3300047319 Bacteria 2730
676 Ga0495674_0170952 3300047319 Bacteria 1813
677 Ga0495672_0008928 3300047320 Bacteria 7320
678 Ga0495672_0010580 3300047320 Bacteria 6560
679 Ga0495676_0002416 3300047321 Bacteria 16576
680 Ga0495676_0057095 3300047321 Bacteria 3082
681 Ga0495676_0170406 3300047321 Bacteria 1532
682 Ga0495680_0099750 3300047322 Bacteria 2164
683 Ga0495680_0197403 3300047322 Bacteria 1445
684 Ga0495683_0022524 3300047323 Bacteria 3239
685 Ga0495683_0029606 3300047323 Bacteria 2797
686 Ga0495683_0035829 3300047323 Bacteria 2521
687 Ga0495683_0071732 3300047323 Bacteria 1699
688 Ga0495683_0093889 3300047323 Bacteria 1450
689 Ga0495683_0118316 3300047323 Bacteria 1259
690 Ga0495687_000011 3300047443 Bacteria 397225
691 Ga0495687_007490 3300047443 Bacteria 6421
692 Ga0495687_014212 3300047443 Bacteria 4111
693 Ga0495687_034430 3300047443 Bacteria 2289
694 Ga0495687_065445 3300047443 Bacteria 1480
695 Ga0495675_0004456 3300047444 Bacteria 8476
696 Ga0495675_0018617 3300047444 Bacteria 4408
697 Ga0495675_0027541 3300047444 Bacteria 3621
698 Ga0495679_000007 3300047446 Bacteria 401482
699 Ga0495679_003927 3300047446 Bacteria 7018
700 Ga0495679_015953 3300047446 Bacteria 2729
701 Ga0495681_0039614 3300047470 Bacteria 2299
702 Ga0495684_0072738 3300047471 Bacteria 2612
703 Ga0495684_0170311 3300047471 Bacteria 1620
704 Ga0495593_0002695 3300047673 Bacteria 10691
705 Ga0495593_0088373 3300047673 Bacteria 1597
706 Ga0495602_0002908 3300048088 Bacteria 17557
707 Ga0495602_0017500 3300048088 Bacteria 7182
708 Ga0495602_0037077 3300048088 Bacteria 4529
709 Ga0495614_0002367 3300048089 Bacteria 8391
710 Ga0495614_0003643 3300048089 Bacteria 6905
711 Ga0495615_0003835 3300048090 Bacteria 2558
712 Ga0495626_0014225 3300048091 Bacteria 4110
713 Ga0496100_0005600 3300048903 Bacteria 6782
714 Ga0496101_0004212 3300048904 Bacteria 9010
715 Ga0496101_0021403 3300048904 Bacteria 4443
716 Ga0496101_0021960 3300048904 Bacteria 4387
717 Ga0496101_0036958 3300048904 Bacteria 3461
718 Ga0496101_0045923 3300048904 Bacteria 3130
719 Ga0496101_0143184 3300048904 Bacteria 1824
720 Ga0496102_0001577 3300048905 Bacteria 20115
721 Ga0496102_0006078 3300048905 Bacteria 10295
722 Ga0496102_0065372 3300048905 Bacteria 3333
723 Ga0496103_0002910 3300048906 Bacteria 10613
724 Ga0496103_0004929 3300048906 Bacteria 8059
725 Ga0496103_0007751 3300048906 Bacteria 6384
726 Ga0496103_0039606 3300048906 Bacteria 2896
727 Ga0496104_0004204 3300048907 Bacteria 12501
728 Ga0496104_0145845 3300048907 Bacteria 2273
729 Ga0496104_0201255 3300048907 Bacteria 1903
730 Ga0496105_0008880 3300048908 Bacteria 7830
731 Ga0496105_0266932 3300048908 Bacteria 1383
732 Ga0496106_0000071 3300048909 Bacteria 82296
733 Ga0496106_0077599 3300048909 Bacteria 2547
734 Ga0496106_0127565 3300048909 Bacteria 1993
735 Ga0496107_0010829 3300048910 Bacteria 6346
736 Ga0496107_0106974 3300048910 Bacteria 2055
737 Ga0496108_0184134 3300048911 Bacteria 1809
738 Ga0496108_0190931 3300048911 Bacteria 1775
739 Ga0496110_0010435 3300048913 Bacteria 7554
740 Ga0496110_0072668 3300048913 Bacteria 3052
741 Ga0496110_0154486 3300048913 Bacteria 2079
742 Ga0496112_0004021 3300048915 Bacteria 12332
743 Ga0496113_0006084 3300048916 Bacteria 7608
744 Ga0496113_0013566 3300048916 Bacteria 5527
745 Ga0496114_0001303 3300048917 Bacteria 18882
746 Ga0496114_0067663 3300048917 Bacteria 2997
747 Ga0496115_0032759 3300048918 Bacteria 4101
748 Ga0496115_0053230 3300048918 Bacteria 3248
749 Ga0496115_0301616 3300048918 Bacteria 1313
750 Ga0496116_0008846 3300048919 Bacteria 8668
751 Ga0496116_0022830 3300048919 Bacteria 4675
752 Ga0496116_0059199 3300048919 Bacteria 2493
753 Ga0496117_0000107 3300048920 Bacteria 187748
754 Ga0496117_0003482 3300048920 Bacteria 18253
755 Ga0496117_0026157 3300048920 Bacteria 4571
756 Ga0496117_0026468 3300048920 Bacteria 4538
757 Ga0496117_0027713 3300048920 Bacteria 4405
758 Ga0496117_0035628 3300048920 Bacteria 3733
759 Ga0496117_0057695 3300048920 Bacteria 2694
760 Ga0496117_0072319 3300048920 Bacteria 2306
761 Ga0496117_0108380 3300048920 Bacteria 1737
762 Ga0496118_0006466 3300048921 Bacteria 12870
763 Ga0496118_0010536 3300048921 Bacteria 9143
764 Ga0496118_0014797 3300048921 Bacteria 7277
765 Ga0496118_0022677 3300048921 Bacteria 5478
766 Ga0496118_0033767 3300048921 Bacteria 4189
767 Ga0496118_0040781 3300048921 Bacteria 3686
768 Ga0496118_0081645 3300048921 Bacteria 2269
769 Ga0496118_0100468 3300048921 Bacteria 1956
770 Ga0496118_0108541 3300048921 Bacteria 1850
771 Ga0496118_0152133 3300048921 Bacteria 1446
772 Ga0496119_0010556 3300048922 Bacteria 7753
773 Ga0496119_0099729 3300048922 Bacteria 1633
774 Ga0496120_0060972 3300048923 Bacteria 2108
775 Ga0496121_0000034 3300048924 Bacteria 377095
776 Ga0496121_0000333 3300048924 Bacteria 98583
777 Ga0496121_0013697 3300048924 Bacteria 8694
778 Ga0496121_0017772 3300048924 Bacteria 7230
779 Ga0496121_0034806 3300048924 Bacteria 4526
780 Ga0496121_0036959 3300048924 Bacteria 4344
781 Ga0496121_0046408 3300048924 Bacteria 3719
782 Ga0496121_0183582 3300048924 Bacteria 1507
783 Ga0496122_0000380 3300048925 Bacteria 95108
784 Ga0496122_0017964 3300048925 Bacteria 6563
785 Ga0496122_0051500 3300048925 Bacteria 3127
786 Ga0496122_0099514 3300048925 Bacteria 1949
787 Ga0496123_0000246 3300048926 Bacteria 109397
788 Ga0496123_0028605 3300048926 Bacteria 4121
789 Ga0496123_0031839 3300048926 Bacteria 3829
790 Ga0496123_0056193 3300048926 Bacteria 2575
791 Ga0496123_0071305 3300048926 Bacteria 2168
792 Ga0496123_0135258 3300048926 Bacteria 1357
793 Ga0496124_0000155 3300048927 Bacteria 138529
794 Ga0496124_0017307 3300048927 Bacteria 6796
795 Ga0496124_0051294 3300048927 Bacteria 3511
796 Ga0496124_0106863 3300048927 Bacteria 2259
797 Ga0496124_0160866 3300048927 Bacteria 1750
798 Ga0496124_0199369 3300048927 Bacteria 1523
799 Ga0496124_0228134 3300048927 Bacteria 1394
800 Ga0496125_0000030 3300048928 Bacteria 375023
801 Ga0496125_0020368 3300048928 Bacteria 6223
802 Ga0496125_0031820 3300048928 Bacteria 4694
803 Ga0496125_0047496 3300048928 Bacteria 3589
804 Ga0496125_0052026 3300048928 Bacteria 3371
805 Ga0496125_0111216 3300048928 Bacteria 1983
806 Ga0496126_0000043 3300048929 Bacteria 337789
807 Ga0496126_0001409 3300048929 Bacteria 38034
808 Ga0496126_0002413 3300048929 Bacteria 25289
809 Ga0496126_0007047 3300048929 Bacteria 12397
810 Ga0496126_0076463 3300048929 Bacteria 2970
811 Ga0496126_0129945 3300048929 Bacteria 2177
812 Ga0496126_0163780 3300048929 Bacteria 1899
813 Ga0496126_0173501 3300048929 Bacteria 1835
814 Ga0496126_0234104 3300048929 Bacteria 1537
815 Ga0501074_0262192 3300049590 Bacteria 1228
816 Ga0501209_020084 3300049656 Bacteria 1569
817 Ga0501225_0003628 3300049705 Bacteria 4652
818 Ga0501262_000201 3300049759 Bacteria 7408
819 nmdc:mga03683_1856_c1 3300050489 Bacteria 4690
820 nmdc:mga03683_27346_c1 3300050489 Bacteria 2258
821 nmdc:mga03683_4927_c1 3300050489 Bacteria 4465
822 nmdc:mga03683_55483_c1 3300050489 Bacteria 1664
823 nmdc:mga03n38_10262_c1 3300050490 Bacteria 3438
824 nmdc:mga03n38_202031_c1 3300050490 Bacteria 1029
825 nmdc:mga00v17_187096_c1 3300050491 Bacteria 1337
826 nmdc:mga00v17_76481_c1 3300050491 Bacteria 2083
827 nmdc:mga0yw44_18159_c1 3300050492 Bacteria 3846
828 nmdc:mga0yw44_223850_c1 3300050492 Bacteria 1248
829 nmdc:mga0yw44_78814_c1 3300050492 Bacteria 2060
830 nmdc:mga0k408_62591_c1 3300050493 Bacteria 2164
831 nmdc:mga0k408_9616_c1 3300050493 Bacteria 2777
832 nmdc:mga06z11_34701_c1 3300050494 Bacteria 2478
833 nmdc:mga06z11_52571_c1 3300050494 Bacteria 2091
834 nmdc:mga07m45_115948_c1 3300050496 Bacteria 1545
835 nmdc:mga07m45_20590_c1 3300050496 Bacteria 3584
836 nmdc:mga07m45_2448_c1 3300050496 Bacteria 8718
837 nmdc:mga07m45_2509_c1 3300050496 Bacteria 8610
838 nmdc:mga07m45_50341_c1 3300050496 Bacteria 2347
839 nmdc:mga07m45_59362_c1 3300050496 Bacteria 2164
840 nmdc:mga07m45_6535_c1 3300050496 Bacteria 5900
841 nmdc:mga0n895_357783_c1 3300050512 Bacteria 1478
842 nmdc:mga0sz30_7377_c1 3300050516 Bacteria 4120
843 Ga0495601_0005423 3300053077 Bacteria 7427
844 Ga0495601_0133808 3300053077 Bacteria 1615
845 Ga0495612_0004695 3300053078 Bacteria 5660
846 Ga0500610_0004716 3300053079 Bacteria 5467
847 Ga0500610_0005350 3300053079 Bacteria 5249
848 Ga0495595_0028917 3300053084 Bacteria 2477
849 Ga0495595_0138945 3300053084 Bacteria 1191
850 Ga0495619_0109369 3300053085 Bacteria 1887
851 Ga0500643_004359 3300053087 Bacteria 6434
852 Ga0500651_0000056 3300053093 Bacteria 72712
853 Ga0500566_0008497 3300053094 Bacteria 6070
854 Ga0500562_002390 3300053108 Bacteria 4713
855 Ga0500562_011496 3300053108 Bacteria 2247
856 Ga0500569_018397 3300053109 Bacteria 1804
857 Ga0500571_001458 3300053110 Bacteria 11090
858 Ga0500593_001228 3300053117 Bacteria 9285
859 Ga0500595_020867 3300053119 Bacteria 2349
860 Ga0500597_014366 3300053120 Bacteria 2968
861 Ga0500607_001013 3300053121 Bacteria 26660
862 Ga0500607_014149 3300053121 Bacteria 4635
863 Ga0500607_042862 3300053121 Bacteria 2442
864 Ga0500608_001525 3300053122 Bacteria 8288
865 Ga0500608_056056 3300053122 Bacteria 1889
866 Ga0500618_000086 3300053125 Bacteria 75318
867 Ga0500618_002945 3300053125 Bacteria 6089
868 Ga0500626_002765 3300053128 Bacteria 6188
869 Ga0500655_000715 3300053133 Bacteria 6561
870 Ga0500658_0001313 3300053134 Bacteria 10057
871 Ga0500658_0002526 3300053134 Bacteria 7087
872 Ga0500559_0004634 3300053136 Bacteria 6487
873 Ga0500559_0011811 3300053136 Bacteria 3723
874 Ga0500561_0067750 3300053137 Bacteria 1014
875 Ga0500564_013461 3300053138 Bacteria 3662
876 Ga0500568_0006465 3300053139 Bacteria 5878
877 Ga0500573_0017931 3300053140 Bacteria 4033
878 Ga0500627_0000404 3300053158 Bacteria 11611
879 Ga0500638_001459 3300053162 Bacteria 7449
880 Ga0500636_0000050 3300053177 Bacteria 56422
881 Ga0500637_0009892 3300053178 Bacteria 4878
882 Ga0500625_050306 3300053729 Bacteria 1927
883 Ga0466962_0000412 3300061719 Bacteria 18479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049590 Ga0501074_0262192 Ga0501074_0262192_33_893 285
2 3300025940 Ga0207691_10259750 Ga0207691_102597501 306
3 3300039438 Ga0436360_0029592 Ga0436360_0029592_794_1720 307
4 3300050490 nmdc:mga03n38_202031_c1 nmdc:mga03n38_202031_c1_39_992 308
5 3300046516 Ga0495628_0369500 Ga0495628_0369500_86_1039 311
6 3300053108 Ga0500562_002390 Ga0500562_002390_23_961 311
7 3300053137 Ga0500561_0067750 Ga0500561_0067750_57_995 312
8 3300005985 Ga0081539_10020200 Ga0081539_100202005 325
9 iso_pu_bacteria 2582581867 2585404620 326
10 iso_pu_bacteria 2923556063 2923562278 326
11 3300048922 Ga0496119_0099729 Ga0496119_0099729_22_1080 327
12 3300026121 Ga0207683_10163052 Ga0207683_101630522 328
13 3300009765 Ga0123341_1048699 Ga0123341_10486993 330
14 3300009766 Ga0123342_1015404 Ga0123342_10154042 330
15 3300006946 Ga0079104_1001126 Ga0079104_100112615 331
16 3300009094 Ga0111539_10162461 Ga0111539_101624613 331
17 3300027111 Ga0209281_1003546 Ga0209281_10035462 331
18 3300048928 Ga0496125_0111216 Ga0496125_0111216_498_1535 336
19 3300044712 Ga0453684_0139836 Ga0453684_0139836_1837_2880 337
20 3300047322 Ga0495680_0197403 Ga0495680_0197403_397_1413 337
21 3300006038 Ga0075365_10060890 Ga0075365_100608903 338
22 3300047323 Ga0495683_0022524 Ga0495683_0022524_1017_2078 338
23 3300006353 Ga0075370_10176461 Ga0075370_101764611 339
24 3300006175 Ga0070712_100016331 Ga0070712_1000163314 340
25 3300006871 Ga0075434_100279857 Ga0075434_1002798572 340
26 3300025915 Ga0207693_10012674 Ga0207693_100126744 340
27 3300025939 Ga0207665_10061378 Ga0207665_100613782 340
28 3300046472 Ga0495580_0310599 Ga0495580_0310599_20_1054 340
29 3300046473 Ga0495582_0038275 Ga0495582_0038275_1419_2453 340
30 3300046516 Ga0495628_0066197 Ga0495628_0066197_718_1752 340
31 3300046526 Ga0495666_0003678 Ga0495666_0003678_6694_7728 340
32 3300046529 Ga0495652_0016973 Ga0495652_0016973_23_1057 340
33 3300046535 Ga0495586_0063427 Ga0495586_0063427_91_1125 340
34 3300046557 Ga0495622_0016630 Ga0495622_0016630_2346_3380 340
35 3300046665 Ga0495661_0008466 Ga0495661_0008466_314_1348 340
36 3300046680 Ga0495646_0004942 Ga0495646_0004942_619_1653 340
37 3300047321 Ga0495676_0170406 Ga0495676_0170406_21_1055 340
38 3300048924 Ga0496121_0013697 Ga0496121_0013697_234_1268 340
39 3300050512 nmdc:mga0n895_357783_c1 nmdc:mga0n895_357783_c1_113_1177 340
40 iso_pu_bacteria 2852673933 2852676130 340
41 3300048924 Ga0496121_0000333 Ga0496121_0000333_83860_84939 342
42 3300048929 Ga0496126_0002413 Ga0496126_0002413_15364_16443 342
43 iso_pu_bacteria 2551306092 2551734997 343
44 3300025924 Ga0207694_10000464 Ga0207694_1000046427 344
45 3300039062 Ga0400483_139881 Ga0400483_139881_797_1831 344
46 iso_pu_bacteria 2904690495 2904698313 344
47 iso_pu_bacteria 2904434214 2904436852 345
48 iso_pu_bacteria 2939615513 2939617023 345
49 iso_pu_bacteria 2908756301 2908762914 346
50 iso_pu_bacteria 2935926038 2935932674 346
51 iso_pu_bacteria 2935934488 2935941242 346
52 iso_pu_bacteria 2935942939 2935949344 346
53 iso_pu_bacteria 2935951376 2935958039 346
54 iso_pu_bacteria 2935967501 2935974319 346
55 iso_pu_bacteria 8005658619 8005658988 346
56 iso_pu_bacteria 8019687851 8019693547 346
57 3300031344 Ga0265316_10059660 Ga0265316_100596602 347
58 iso_pu_bacteria 2512875026 2512973527 347
59 iso_pu_bacteria 2513237089 2513601954 347
60 iso_pu_bacteria 2513237156 2513983409 347
61 iso_pu_bacteria 2513237159 2513998350 347
62 iso_pu_bacteria 2513237160 2514003446 347
63 iso_pu_bacteria 2516143018 2516205591 347
64 iso_pu_bacteria 2517487022 2517571469 347
65 iso_pu_bacteria 2690316117 2692319906 347
66 iso_pu_bacteria 2751185821 2753458544 347
67 iso_pu_bacteria 2791355091 2792621867 347
68 iso_pu_bacteria 2791355092 2792628875 347
69 iso_pu_bacteria 2791355094 2792639935 347
70 iso_pu_bacteria 2802428858 2802717163 347
71 iso_pu_bacteria 2802428859 2802724848 347
72 iso_pu_bacteria 2802428860 2802729599 347
73 iso_pu_bacteria 2802428861 2802736945 347
74 iso_pu_bacteria 2802428862 2802743350 347
75 iso_pu_bacteria 2802428863 2802749524 347
76 iso_pu_bacteria 2842521101 2842524623 347
77 iso_pu_bacteria 2847417321 2847420871 347
78 iso_pu_bacteria 2848992105 2848995700 347
79 iso_pu_bacteria 2855872281 2855878235 347
80 iso_pu_bacteria 2915980308 2915982374 347
81 iso_pu_bacteria 2916061851 2916064960 347
82 iso_pu_bacteria 2921250672 2921252884 347
83 iso_pu_bacteria 2937029754 2937031805 347
84 iso_pu_bacteria 2937036028 2937036263 347
85 iso_pu_bacteria 2937078374 2937082100 347
86 iso_pu_bacteria 2937084907 2937088216 347
87 iso_pu_bacteria 2957375807 2957381774 347
88 iso_pu_bacteria 2957437181 2957441590 347
89 iso_pu_bacteria 2960591022 2960595963 347
90 iso_pu_bacteria 2960631154 2960633759 347
91 iso_pu_bacteria 2960680706 2960682395 347
92 iso_pu_bacteria 2960693952 2960698178 347
93 iso_pu_bacteria 2967686174 2967690194 347
94 iso_pu_bacteria 2967728569 2967730878 347
95 iso_pu_bacteria 2970026789 2970028758 347
96 iso_pu_bacteria 2970122695 2970124585 347
97 iso_pu_bacteria 2970143518 2970143548 347
98 iso_pu_bacteria 2977530762 2977535029 347
99 iso_pu_bacteria 2977544691 2977550573 347
100 iso_pu_bacteria 643692032 643827462 347
101 iso_pu_bacteria 8003999396 8004003134 347
102 iso_pu_bacteria 2513237088 2513598419 348
103 iso_pu_bacteria 2791355261 2793327365 348
104 iso_pu_bacteria 2821443989 2821444833 348
105 iso_pu_bacteria 2844533157 2844535754 348
106 iso_pu_bacteria 2852387548 2852388807 348
107 iso_pu_bacteria 2857576091 2857579097 348
108 iso_pu_bacteria 2898329390 2898331252 348
109 iso_pu_bacteria 2904113452 2904117759 348
110 iso_pu_bacteria 2928510474 2928513400 348
111 iso_pu_bacteria 2929138655 2929141923 348
112 iso_pu_bacteria 8005258706 8005264857 348
113 iso_pu_bacteria 8005395548 8005400729 348
114 3300006038 Ga0075365_10154544 Ga0075365_101545442 349
115 3300006177 Ga0075362_10025016 Ga0075362_100250162 349
116 3300006195 Ga0075366_10048273 Ga0075366_100482732 349
117 3300006353 Ga0075370_10062784 Ga0075370_100627842 349
118 3300031711 Ga0265314_10003011 Ga0265314_1000301113 349
119 3300035170 Ga0373943_0076250 Ga0373943_0076250_295_1362 349
120 3300035725 Ga0373947_0081929 Ga0373947_0081929_753_1820 349
121 3300037068 Ga0373925_0005856 Ga0373925_0005856_257_1324 349
122 3300048920 Ga0496117_0000107 Ga0496117_0000107_153338_154420 349
123 3300048929 Ga0496126_0163780 Ga0496126_0163780_154_1233 349
124 3300050493 nmdc:mga0k408_9616_c1 nmdc:mga0k408_9616_c1_559_1641 349
125 3300050496 nmdc:mga07m45_59362_c1 nmdc:mga07m45_59362_c1_717_1799 349
126 3300005288 Ga0065714_10107559 Ga0065714_101075591 350
127 3300005353 Ga0070669_100043922 Ga0070669_1000439222 350
128 3300005367 Ga0070667_100045075 Ga0070667_1000450752 350
129 3300005539 Ga0068853_100315180 Ga0068853_1003151801 350
130 3300005563 Ga0068855_100135458 Ga0068855_1001354582 350
131 3300009545 Ga0105237_10092301 Ga0105237_100923012 350
132 3300009551 Ga0105238_10042907 Ga0105238_100429073 350
133 3300010375 Ga0105239_10032227 Ga0105239_100322274 350
134 3300015261 Ga0182006_1076556 Ga0182006_10765561 350
135 3300015262 Ga0182007_10004526 Ga0182007_100045264 350
136 3300015683 Ga0183362_10001 Ga0183362_10001152 350
137 3300017792 Ga0163161_10125023 Ga0163161_101250232 350
138 3300021384 Ga0213876_10107972 Ga0213876_101079721 350
139 3300025914 Ga0207671_10054753 Ga0207671_100547531 350
140 3300025923 Ga0207681_10008967 Ga0207681_100089673 350
141 3300025924 Ga0207694_10027435 Ga0207694_100274353 350
142 3300025929 Ga0207664_10223124 Ga0207664_102231242 350
143 3300025949 Ga0207667_10048092 Ga0207667_100480922 350
144 3300025986 Ga0207658_10063020 Ga0207658_100630202 350
145 3300026041 Ga0207639_10331710 Ga0207639_103317101 350
146 3300028794 Ga0307515_10000529 Ga0307515_1000052955 350
147 3300031251 Ga0265327_10001599 Ga0265327_100015999 350
148 3300031251 Ga0265327_10023492 Ga0265327_100234922 350
149 3300031711 Ga0265314_10000328 Ga0265314_1000032853 350
150 3300031711 Ga0265314_10063854 Ga0265314_100638542 350
151 3300039437 Ga0436365_1537138 Ga0436365_1537138_245_1297 350
152 3300041404 Ga0439436_0000214 Ga0439436_0000214_10300_11379 350
153 3300041410 Ga0439461_0003905 Ga0439461_0003905_1288_2367 350
154 3300041411 Ga0439466_0001691 Ga0439466_0001691_3121_4200 350
155 3300041411 Ga0439466_0035238 Ga0439466_0035238_483_1559 350
156 3300041413 Ga0439465_0000284 Ga0439465_0000284_2704_3783 350
157 3300041413 Ga0439465_0006085 Ga0439465_0006085_591_1667 350
158 3300041997 Ga0439431_0001002 Ga0439431_0001002_2855_3934 350
159 3300041999 Ga0439433_0000507 Ga0439433_0000507_3854_4933 350
160 3300042004 Ga0439445_0001387 Ga0439445_0001387_371_1450 350
161 3300042006 Ga0439432_000159 Ga0439432_000159_19506_20585 350
162 3300042006 Ga0439432_004404 Ga0439432_004404_553_1635 350
163 3300042007 Ga0439449_0000249 Ga0439449_0000249_12872_13954 350
164 3300042007 Ga0439449_0002714 Ga0439449_0002714_3094_4173 350
165 3300042010 Ga0439452_000942 Ga0439452_000942_6357_7436 350
166 3300042014 Ga0439457_004362 Ga0439457_004362_2385_3467 350
167 3300042015 Ga0439462_0004652 Ga0439462_0004652_273_1352 350
168 3300042122 Ga0450920_006450 Ga0450920_006450_570_1646 350
169 3300042145 Ga0450906_002514 Ga0450906_002514_514_1590 350
170 3300042156 Ga0439446_0001321 Ga0439446_0001321_2329_3408 350
171 3300042184 Ga0450908_003602 Ga0450908_003602_394_1470 350
172 3300042435 Ga0439434_0000603 Ga0439434_0000603_3940_5019 350
173 3300042435 Ga0439434_0001166 Ga0439434_0001166_3098_4174 350
174 3300044842 Ga0466957_0272471 Ga0466957_0272471_59_1111 350
175 3300045836 Ga0466958_0152971 Ga0466958_0152971_385_1437 350
176 3300046475 Ga0495639_0018773 Ga0495639_0018773_1459_2541 350
177 3300046513 Ga0495616_0021156 Ga0495616_0021156_309_1388 350
178 3300046530 Ga0495654_0048304 Ga0495654_0048304_146_1225 350
179 3300046616 Ga0495668_0030852 Ga0495668_0030852_1300_2379 350
180 3300046683 Ga0495658_0015701 Ga0495658_0015701_2219_3298 350
181 3300047321 Ga0495676_0002416 Ga0495676_0002416_13330_14409 350
182 3300048089 Ga0495614_0002367 Ga0495614_0002367_5421_6500 350
183 3300048903 Ga0496100_0005600 Ga0496100_0005600_1900_2982 350
184 3300048904 Ga0496101_0004212 Ga0496101_0004212_5386_6468 350
185 3300048904 Ga0496101_0143184 Ga0496101_0143184_692_1777 350
186 3300048905 Ga0496102_0006078 Ga0496102_0006078_9128_10210 350
187 3300048906 Ga0496103_0007751 Ga0496103_0007751_406_1488 350
188 3300048907 Ga0496104_0004204 Ga0496104_0004204_656_1738 350
189 3300048908 Ga0496105_0008880 Ga0496105_0008880_5471_6553 350
190 3300048910 Ga0496107_0106974 Ga0496107_0106974_528_1610 350
191 3300048911 Ga0496108_0190931 Ga0496108_0190931_419_1501 350
192 3300048913 Ga0496110_0072668 Ga0496110_0072668_1013_2095 350
193 3300048925 Ga0496122_0000380 Ga0496122_0000380_67127_68206 350
194 3300048926 Ga0496123_0000246 Ga0496123_0000246_11767_12846 350
195 3300048927 Ga0496124_0017307 Ga0496124_0017307_4762_5841 350
196 3300050489 nmdc:mga03683_4927_c1 nmdc:mga03683_4927_c1_1969_3048 350
197 3300050496 nmdc:mga07m45_6535_c1 nmdc:mga07m45_6535_c1_4688_5767 350
198 3300053093 Ga0500651_0000056 Ga0500651_0000056_22710_23789 350
199 3300053094 Ga0500566_0008497 Ga0500566_0008497_1937_3016 350
200 3300053109 Ga0500569_018397 Ga0500569_018397_11_1090 350
201 3300053110 Ga0500571_001458 Ga0500571_001458_3654_4733 350
202 3300053122 Ga0500608_056056 Ga0500608_056056_165_1244 350
203 3300053125 Ga0500618_002945 Ga0500618_002945_3597_4673 350
204 3300053134 Ga0500658_0001313 Ga0500658_0001313_5182_6261 350
205 3300053134 Ga0500658_0002526 Ga0500658_0002526_5740_6819 350
206 3300053136 Ga0500559_0004634 Ga0500559_0004634_3105_4193 350
207 3300053138 Ga0500564_013461 Ga0500564_013461_1520_2599 350
208 3300053139 Ga0500568_0006465 Ga0500568_0006465_2656_3735 350
209 3300053140 Ga0500573_0017931 Ga0500573_0017931_873_1961 350
210 iso_pu_bacteria 2513020051 2513228222 350
211 iso_pu_bacteria 2599185214 2599626919 350
212 iso_pu_bacteria 2599185226 2599676165 350
213 iso_pu_bacteria 2599185227 2599684477 350
214 iso_pu_bacteria 2599185229 2599696470 350
215 iso_pu_bacteria 2643221628 2644160526 350
216 iso_pu_bacteria 2643221658 2644324651 350
217 iso_pu_bacteria 2643221672 2644396515 350
218 iso_pu_bacteria 2643221683 2644464444 350
219 iso_pu_bacteria 2738541277 2738718985 350
220 iso_pu_bacteria 2738541307 2738880002 350
221 iso_pu_bacteria 2738543019 2739281747 350
222 iso_pu_bacteria 2818991446 2819599462 350
223 iso_pu_bacteria 2831265667 2831271267 350
224 iso_pu_bacteria 2838054893 2838055854 350
225 iso_pu_bacteria 2842677519 2842681979 350
226 iso_pu_bacteria 2885192300 2885197967 350
227 iso_pu_bacteria 2885198086 2885200596 350
228 iso_pu_bacteria 2885211737 2885214621 350
229 iso_pu_bacteria 2899924645 2899925797 350
230 iso_pu_bacteria 2904449895 2904450439 350
231 iso_pu_bacteria 2904456579 2904456738 350
232 iso_pu_bacteria 2904541872 2904544400 350
233 iso_pu_bacteria 2919462493 2919463032 350
234 iso_pu_bacteria 2928037797 2928041815 350
235 iso_pu_bacteria 2928044640 2928049379 350
236 iso_pu_bacteria 2928051484 2928051946 350
237 iso_pu_bacteria 2928064002 2928065362 350
238 iso_pu_bacteria 2928070936 2928076538 350
239 iso_pu_bacteria 2928084124 2928089353 350
240 iso_pu_bacteria 2928115317 2928115577 350
241 iso_pu_bacteria 2929160207 2929162029 350
242 iso_pu_bacteria 2929520902 2929521152 350
243 iso_pu_bacteria 2945909444 2945913564 350
244 iso_pu_bacteria 2945945610 2945949165 350
245 iso_pu_bacteria 2945972063 2945973219 350
246 iso_pu_bacteria 2945984333 2945991041 350
247 iso_pu_bacteria 2954767861 2954768533 350
248 3300003187 JGI25151J46595_10000884 JGI25151J46595_100008847 351
249 3300003323 rootH1_10100094 rootH1_101000941 351
250 3300003578 Ga0006562J51391_1010605 Ga0006562J51391_10106059 351
251 3300003578 Ga0006562J51391_1010608 Ga0006562J51391_10106082 351
252 3300003773 Ga0055537_1000011 Ga0055537_1000011129 351
253 3300003781 Ga0055536_1003875 Ga0055536_10038756 351
254 3300003784 Ga0055534_1000020 Ga0055534_10000207 351
255 3300003790 Ga0055528_1001737 Ga0055528_10017377 351
256 3300003791 Ga0055530_10003648 Ga0055530_100036484 351
257 3300003792 Ga0055540_1002879 Ga0055540_10028795 351
258 3300003792 Ga0055540_1006070 Ga0055540_10060702 351
259 3300003794 Ga0055531_10003096 Ga0055531_100030968 351
260 3300005457 Ga0070662_100030840 Ga0070662_1000308402 351
261 3300005548 Ga0070665_100105931 Ga0070665_1001059312 351
262 3300005564 Ga0070664_100007993 Ga0070664_1000079939 351
263 3300005844 Ga0068862_100040567 Ga0068862_1000405675 351
264 3300006038 Ga0075365_10097546 Ga0075365_100975462 351
265 3300006048 Ga0075363_100017266 Ga0075363_1000172663 351
266 3300006051 Ga0075364_10030434 Ga0075364_100304341 351
267 3300006177 Ga0075362_10015578 Ga0075362_100155784 351
268 3300006177 Ga0075362_10036266 Ga0075362_100362662 351
269 3300006177 Ga0075362_10049816 Ga0075362_100498162 351
270 3300006177 Ga0075362_10087083 Ga0075362_100870832 351
271 3300006178 Ga0075367_10024967 Ga0075367_100249672 351
272 3300006353 Ga0075370_10009544 Ga0075370_100095443 351
273 3300006353 Ga0075370_10022959 Ga0075370_100229592 351
274 3300006946 Ga0079104_1002959 Ga0079104_10029595 351
275 3300006948 Ga0099826_10000432 Ga0099826_1000043212 351
276 3300009036 Ga0105244_10006094 Ga0105244_100060944 351
277 3300009148 Ga0105243_10006370 Ga0105243_100063707 351
278 3300009551 Ga0105238_10055999 Ga0105238_100559992 351
279 3300010375 Ga0105239_10162445 Ga0105239_101624452 351
280 3300011119 Ga0105246_10182550 Ga0105246_101825502 351
281 3300013100 Ga0157373_10025247 Ga0157373_100252474 351
282 3300013100 Ga0157373_10031284 Ga0157373_100312843 351
283 3300013104 Ga0157370_10004758 Ga0157370_1000475812 351
284 3300013105 Ga0157369_10006743 Ga0157369_1000674312 351
285 3300014497 Ga0182008_10003374 Ga0182008_100033744 351
286 3300014497 Ga0182008_10004329 Ga0182008_100043297 351
287 3300015261 Ga0182006_1003165 Ga0182006_10031657 351
288 3300015262 Ga0182007_10000298 Ga0182007_1000029814 351
289 3300017792 Ga0163161_10000042 Ga0163161_100000424 351
290 3300017792 Ga0163161_10023957 Ga0163161_100239574 351
291 3300021388 Ga0213875_10002062 Ga0213875_100020629 351
292 3300025258 Ga0209129_1002294 Ga0209129_10022947 351
293 3300025263 Ga0209565_1000058 Ga0209565_100005845 351
294 3300025273 Ga0209673_1000053 Ga0209673_1000053121 351
295 3300025273 Ga0209673_1005009 Ga0209673_10050096 351
296 3300025291 Ga0209675_1000010 Ga0209675_1000010402 351
297 3300025292 Ga0209676_1001003 Ga0209676_100100328 351
298 3300025292 Ga0209676_1017349 Ga0209676_10173492 351
299 3300025294 Ga0209025_1000129 Ga0209025_1000129149 351
300 3300025294 Ga0209025_1040447 Ga0209025_10404472 351
301 3300025298 Ga0209050_1001558 Ga0209050_10015584 351
302 3300025298 Ga0209050_1005256 Ga0209050_10052562 351
303 3300025303 Ga0209051_1000145 Ga0209051_100014515 351
304 3300025303 Ga0209051_1000289 Ga0209051_100028914 351
305 3300025304 Ga0209257_1001684 Ga0209257_100168416 351
306 3300025728 Ga0207655_1001616 Ga0207655_10016165 351
307 3300025914 Ga0207671_10037971 Ga0207671_100379714 351
308 3300025933 Ga0207706_10061895 Ga0207706_100618952 351
309 3300025935 Ga0207709_10025763 Ga0207709_100257632 351
310 3300025942 Ga0207689_10065912 Ga0207689_100659123 351
311 3300025945 Ga0207679_10069199 Ga0207679_100691994 351
312 3300027666 Ga0209282_1001250 Ga0209282_10012502 351
313 3300028380 Ga0268265_10019940 Ga0268265_100199403 351
314 3300030733 Ga0314311_1017616 Ga0314311_10176167 351
315 3300030745 Ga0316182_1269150 Ga0316182_12691502 351
316 3300031247 Ga0265340_10003072 Ga0265340_100030723 351
317 3300031456 Ga0307513_10050100 Ga0307513_100501002 351
318 3300031548 Ga0307408_100030230 Ga0307408_1000302304 351
319 3300031548 Ga0307408_100031034 Ga0307408_1000310343 351
320 3300031548 Ga0307408_100128015 Ga0307408_1001280152 351
321 3300031548 Ga0307408_100143702 Ga0307408_1001437022 351
322 3300031548 Ga0307408_100145243 Ga0307408_1001452432 351
323 3300031548 Ga0307408_100220111 Ga0307408_1002201111 351
324 3300031712 Ga0265342_10026622 Ga0265342_100266222 351
325 3300031731 Ga0307405_10022168 Ga0307405_100221684 351
326 3300031731 Ga0307405_10097243 Ga0307405_100972432 351
327 3300031731 Ga0307405_10220463 Ga0307405_102204632 351
328 3300031901 Ga0307406_10004992 Ga0307406_100049924 351
329 3300031911 Ga0307412_10186405 Ga0307412_101864051 351
330 3300032002 Ga0307416_100007344 Ga0307416_1000073446 351
331 3300032005 Ga0307411_10053284 Ga0307411_100532843 351
332 3300032005 Ga0307411_10233796 Ga0307411_102337962 351
333 3300037853 Ga0436364_1018828 Ga0436364_1018828_7586_8641 351
334 3300038725 Ga0400484_09450 Ga0400484_09450_23043_24098 351
335 3300038726 Ga0400490_34331 Ga0400490_34331_37618_38673 351
336 3300038741 Ga0400488_00855 Ga0400488_00855_576_1631 351
337 3300038741 Ga0400488_31230 Ga0400488_31230_8366_9421 351
338 3300038741 Ga0400488_46229 Ga0400488_46229_4144_5199 351
339 3300038741 Ga0400488_57661 Ga0400488_57661_861_1916 351
340 3300039062 Ga0400483_022484 Ga0400483_022484_2503_3558 351
341 3300039062 Ga0400483_124837 Ga0400483_124837_846_1901 351
342 3300039062 Ga0400483_162033 Ga0400483_162033_920_1975 351
343 3300039062 Ga0400483_178214 Ga0400483_178214_181_1236 351
344 3300039093 Ga0400489_82739 Ga0400489_82739_4964_6019 351
345 3300039110 Ga0400487_00755 Ga0400487_00755_302_1357 351
346 3300039110 Ga0400487_17506 Ga0400487_17506_24019_25074 351
347 3300041413 Ga0439465_0068097 Ga0439465_0068097_17_1072 351
348 3300042134 Ga0450898_013372 Ga0450898_013372_74_1129 351
349 3300042145 Ga0450906_011779 Ga0450906_011779_293_1348 351
350 3300042156 Ga0439446_0005757 Ga0439446_0005757_994_2082 351
351 3300046518 Ga0495631_0000088 Ga0495631_0000088_12553_13644 351
352 3300046520 Ga0495637_0010963 Ga0495637_0010963_1935_3026 351
353 3300046538 Ga0495609_0073592 Ga0495609_0073592_173_1264 351
354 3300046557 Ga0495622_0014881 Ga0495622_0014881_432_1523 351
355 3300046660 Ga0495625_0002306 Ga0495625_0002306_15760_16848 351
356 3300046692 Ga0495671_0003011 Ga0495671_0003011_3887_4978 351
357 3300048904 Ga0496101_0021960 Ga0496101_0021960_2072_3163 351
358 3300048919 Ga0496116_0059199 Ga0496116_0059199_1386_2474 351
359 3300048920 Ga0496117_0072319 Ga0496117_0072319_508_1596 351
360 3300048921 Ga0496118_0033767 Ga0496118_0033767_2966_4057 351
361 3300048921 Ga0496118_0081645 Ga0496118_0081645_917_2005 351
362 3300048922 Ga0496119_0010556 Ga0496119_0010556_773_1828 351
363 3300048924 Ga0496121_0036959 Ga0496121_0036959_2774_3865 351
364 3300048924 Ga0496121_0046408 Ga0496121_0046408_1758_2846 351
365 3300048925 Ga0496122_0017964 Ga0496122_0017964_762_1820 351
366 3300048926 Ga0496123_0028605 Ga0496123_0028605_1146_2273 351
367 3300048926 Ga0496123_0031839 Ga0496123_0031839_1686_2774 351
368 3300048926 Ga0496123_0056193 Ga0496123_0056193_771_1862 351
369 3300048927 Ga0496124_0051294 Ga0496124_0051294_579_1673 351
370 3300048928 Ga0496125_0047496 Ga0496125_0047496_16_1107 351
371 3300048929 Ga0496126_0129945 Ga0496126_0129945_627_1718 351
372 3300049705 Ga0501225_0003628 Ga0501225_0003628_1365_2453 351
373 3300049759 Ga0501262_000201 Ga0501262_000201_2127_3215 351
374 3300050489 nmdc:mga03683_27346_c1 nmdc:mga03683_27346_c1_1007_2095 351
375 3300050490 nmdc:mga03n38_10262_c1 nmdc:mga03n38_10262_c1_303_1391 351
376 3300050491 nmdc:mga00v17_76481_c1 nmdc:mga00v17_76481_c1_99_1187 351
377 3300050492 nmdc:mga0yw44_78814_c1 nmdc:mga0yw44_78814_c1_629_1717 351
378 3300050496 nmdc:mga07m45_2448_c1 nmdc:mga07m45_2448_c1_5492_6583 351
379 3300050496 nmdc:mga07m45_2509_c1 nmdc:mga07m45_2509_c1_5510_6601 351
380 3300053079 Ga0500610_0004716 Ga0500610_0004716_3353_4444 351
381 3300053079 Ga0500610_0005350 Ga0500610_0005350_3135_4226 351
382 3300053087 Ga0500643_004359 Ga0500643_004359_2160_3251 351
383 3300053108 Ga0500562_011496 Ga0500562_011496_903_1994 351
384 3300053117 Ga0500593_001228 Ga0500593_001228_2826_3917 351
385 3300053120 Ga0500597_014366 Ga0500597_014366_211_1302 351
386 3300053121 Ga0500607_001013 Ga0500607_001013_14245_15336 351
387 3300053121 Ga0500607_042862 Ga0500607_042862_767_1858 351
388 3300053122 Ga0500608_001525 Ga0500608_001525_2610_3692 351
389 3300053128 Ga0500626_002765 Ga0500626_002765_2071_3162 351
390 3300053133 Ga0500655_000715 Ga0500655_000715_1223_2314 351
391 3300053136 Ga0500559_0011811 Ga0500559_0011811_2020_3111 351
392 3300053158 Ga0500627_0000404 Ga0500627_0000404_6666_7757 351
393 3300053162 Ga0500638_001459 Ga0500638_001459_4430_5521 351
394 iso_pu_bacteria 2501025501 2501070811 351
395 iso_pu_bacteria 2501025502 2501080335 351
396 iso_pu_bacteria 2501025504 2501413644 351
397 iso_pu_bacteria 2508501125 2509129122 351
398 iso_pu_bacteria 2510065045 2510253201 351
399 iso_pu_bacteria 2510917013 2511089689 351
400 iso_pu_bacteria 2510917014 2511095086 351
401 iso_pu_bacteria 2510917015 2511104745 351
402 iso_pu_bacteria 2512047030 2512347373 351
403 iso_pu_bacteria 2513237151 2513959204 351
404 iso_pu_bacteria 2515154122 2515685297 351
405 iso_pu_bacteria 2515154189 2516016800 351
406 iso_pu_bacteria 2519103095 2519459847 351
407 iso_pu_bacteria 2526164713 2527078834 351
408 iso_pu_bacteria 2526164713 2527080327 351
409 iso_pu_bacteria 2562617112 2563060016 351
410 iso_pu_bacteria 2582581311 2585290649 351
411 iso_pu_bacteria 2596583598 2597032057 351
412 iso_pu_bacteria 2599185178 2599448353 351
413 iso_pu_bacteria 2599185239 2599740244 351
414 iso_pu_bacteria 2599185240 2599744080 351
415 iso_pu_bacteria 2599185355 2600210815 351
416 iso_pu_bacteria 2600255067 2600810332 351
417 iso_pu_bacteria 2675903129 2676743569 351
418 iso_pu_bacteria 2711768613 2713479266 351
419 iso_pu_bacteria 2718217991 2719638990 351
420 iso_pu_bacteria 2738541296 2738823787 351
421 iso_pu_bacteria 2738541298 2738836178 351
422 iso_pu_bacteria 2738541306 2738877708 351
423 iso_pu_bacteria 2738543002 2739189414 351
424 iso_pu_bacteria 2738543008 2739224301 351
425 iso_pu_bacteria 2791355137 2792834675 351
426 iso_pu_bacteria 2808606384 2808968311 351
427 iso_pu_bacteria 2808606390 2809003142 351
428 iso_pu_bacteria 2808606391 2809010419 351
429 iso_pu_bacteria 2816332253 2817262131 351
430 iso_pu_bacteria 2816332256 2817279832 351
431 iso_pu_bacteria 2816332286 2817455562 351
432 iso_pu_bacteria 2818991452 2819633708 351
433 iso_pu_bacteria 2856287931 2856293268 351
434 iso_pu_bacteria 2857357740 2857366613 351
435 iso_pu_bacteria 2863421361 2863427308 351
436 iso_pu_bacteria 2870068957 2870070109 351
437 iso_pu_bacteria 2883087390 2883094550 351
438 iso_pu_bacteria 2885266251 2885269308 351
439 iso_pu_bacteria 2885270888 2885276737 351
440 iso_pu_bacteria 2900577576 2900578747 351
441 iso_pu_bacteria 2902682994 2902689117 351
442 iso_pu_bacteria 2904483920 2904488536 351
443 iso_pu_bacteria 2904564687 2904567665 351
444 iso_pu_bacteria 2904571731 2904574933 351
445 iso_pu_bacteria 2904615490 2904620390 351
446 iso_pu_bacteria 2919527303 2919532148 351
447 iso_pu_bacteria 2921643360 2921644157 351
448 iso_pu_bacteria 2928058823 2928060416 351
449 iso_pu_bacteria 2928157003 2928162064 351
450 iso_pu_bacteria 2928163908 2928169294 351
451 iso_pu_bacteria 2928170801 2928175466 351
452 iso_pu_bacteria 2928536128 2928538976 351
453 iso_pu_bacteria 2945934425 2945935225 351
454 iso_pu_bacteria 2981990288 2981992790 351
455 iso_pu_bacteria 2990703756 2990704181 351
456 iso_pu_bacteria 641736151 642422337 351
457 iso_pu_bacteria 641736154 642418040 351
458 iso_pu_bacteria 642555113 642620146 351
459 iso_pu_bacteria 8018845410 8018846253 351
460 iso_pu_bacteria 8020807995 8020814262 351
461 iso_pu_bacteria 8020938398 8020940022 351
462 iso_pu_bacteria 8020945358 8020950348 351
463 iso_pu_bacteria 8020953355 8020954695 351
464 iso_pu_bacteria 8021120328 8021125565 351
465 iso_pu_bacteria 8039098773 8039104479 351
466 iso_pu_bacteria 8040167225 8040172117 351
467 iso_pu_bacteria 8040173305 8040173974 351
468 iso_pu_bacteria 8055266321 8055268173 351
469 iso_pu_bacteria 8055301274 8055304075 351
470 3300001989 JGI24739J22299_10011760 JGI24739J22299_100117603 352
471 3300002773 JGI25152J39213_1001553 JGI25152J39213_10015537 352
472 3300002773 JGI25152J39213_1002376 JGI25152J39213_10023767 352
473 3300002774 JGI25150J39212_1000788 JGI25150J39212_10007887 352
474 3300002987 JGI25159J45721_1002843 JGI25159J45721_10028433 352
475 3300002987 JGI25159J45721_1006736 JGI25159J45721_10067362 352
476 3300003187 JGI25151J46595_10002939 JGI25151J46595_100029397 352
477 3300003187 JGI25151J46595_10003673 JGI25151J46595_100036736 352
478 3300003187 JGI25151J46595_10007055 JGI25151J46595_100070554 352
479 3300003203 JGI25406J46586_10061535 JGI25406J46586_100615351 352
480 3300003215 JGI25153J46596_10002888 JGI25153J46596_100028887 352
481 3300003215 JGI25153J46596_10007862 JGI25153J46596_100078623 352
482 3300003316 rootH1_10057596 rootH1_100575966 352
483 3300003354 JGI25160J50197_1003945 JGI25160J50197_10039453 352
484 3300003354 JGI25160J50197_1007108 JGI25160J50197_10071083 352
485 3300003374 JGI25161J50226_1002473 JGI25161J50226_10024733 352
486 3300003374 JGI25161J50226_1005654 JGI25161J50226_10056542 352
487 3300003761 Ga0055535_1000478 Ga0055535_10004785 352
488 3300003762 Ga0055542_1000009 Ga0055542_100000954 352
489 3300003771 Ga0055526_1006305 Ga0055526_10063053 352
490 3300003771 Ga0055526_1006314 Ga0055526_10063143 352
491 3300003771 Ga0055526_1008749 Ga0055526_10087495 352
492 3300003773 Ga0055537_1001963 Ga0055537_10019633 352
493 3300003773 Ga0055537_1002323 Ga0055537_10023233 352
494 3300003775 Ga0055524_1004426 Ga0055524_10044263 352
495 3300003775 Ga0055524_1004441 Ga0055524_10044413 352
496 3300003781 Ga0055536_1003959 Ga0055536_10039596 352
497 3300003781 Ga0055536_1004506 Ga0055536_10045064 352
498 3300003784 Ga0055534_1002413 Ga0055534_10024133 352
499 3300003784 Ga0055534_1002666 Ga0055534_10026666 352
500 3300003790 Ga0055528_1003874 Ga0055528_10038743 352
501 3300003790 Ga0055528_1004741 Ga0055528_10047413 352
502 3300003791 Ga0055530_10003619 Ga0055530_100036197 352
503 3300003792 Ga0055540_1001080 Ga0055540_100108011 352
504 3300003792 Ga0055540_1001207 Ga0055540_10012074 352
505 3300003792 Ga0055540_1002737 Ga0055540_10027375 352
506 3300003794 Ga0055531_10004364 Ga0055531_100043644 352
507 3300003794 Ga0055531_10004868 Ga0055531_100048684 352
508 3300004625 Ga0055543_1001375 Ga0055543_10013757 352
509 3300004625 Ga0055543_1002066 Ga0055543_10020665 352
510 3300005262 Ga0065165_1003947 Ga0065165_10039477 352
511 3300005262 Ga0065165_1004737 Ga0065165_10047375 352
512 3300005331 Ga0070670_100000669 Ga0070670_1000006693 352
513 3300005355 Ga0070671_100113123 Ga0070671_1001131232 352
514 3300005436 Ga0070713_100016947 Ga0070713_1000169473 352
515 3300005439 Ga0070711_100151172 Ga0070711_1001511721 352
516 3300005445 Ga0070708_100106012 Ga0070708_1001060121 352
517 3300005457 Ga0070662_100011515 Ga0070662_1000115152 352
518 3300005471 Ga0070698_100035496 Ga0070698_1000354963 352
519 3300005530 Ga0070679_100209868 Ga0070679_1002098683 352
520 3300005536 Ga0070697_100071783 Ga0070697_1000717834 352
521 3300005539 Ga0068853_100074198 Ga0068853_1000741982 352
522 3300005548 Ga0070665_100003526 Ga0070665_1000035269 352
523 3300005548 Ga0070665_100006778 Ga0070665_10000677810 352
524 3300005834 Ga0068851_10013539 Ga0068851_100135392 352
525 3300005937 Ga0081455_10022800 Ga0081455_100228004 352
526 3300005985 Ga0081539_10003020 Ga0081539_100030205 352
527 3300006028 Ga0070717_10023902 Ga0070717_100239025 352
528 3300006038 Ga0075365_10175587 Ga0075365_101755872 352
529 3300006048 Ga0075363_100059682 Ga0075363_1000596822 352
530 3300006051 Ga0075364_10030568 Ga0075364_100305683 352
531 3300006051 Ga0075364_10128099 Ga0075364_101280992 352
532 3300006173 Ga0070716_100064837 Ga0070716_1000648372 352
533 3300006177 Ga0075362_10015889 Ga0075362_100158892 352
534 3300006178 Ga0075367_10011178 Ga0075367_100111787 352
535 3300006178 Ga0075367_10019937 Ga0075367_100199372 352
536 3300006178 Ga0075367_10020654 Ga0075367_100206542 352
537 3300006186 Ga0075369_10010816 Ga0075369_100108162 352
538 3300006353 Ga0075370_10026421 Ga0075370_100264213 352
539 3300006353 Ga0075370_10090883 Ga0075370_100908832 352
540 3300006353 Ga0075370_10131389 Ga0075370_101313891 352
541 3300006946 Ga0079104_1000140 Ga0079104_100014075 352
542 3300006946 Ga0079104_1004846 Ga0079104_10048461 352
543 3300007265 Ga0099794_10040762 Ga0099794_100407622 352
544 3300007788 Ga0099795_10013570 Ga0099795_100135702 352
545 3300009093 Ga0105240_10149489 Ga0105240_101494894 352
546 3300009148 Ga0105243_10009580 Ga0105243_100095806 352
547 3300010159 Ga0099796_10032543 Ga0099796_100325431 352
548 3300013102 Ga0157371_10017689 Ga0157371_100176895 352
549 3300013104 Ga0157370_10037545 Ga0157370_100375453 352
550 3300013307 Ga0157372_10042418 Ga0157372_100424183 352
551 3300025208 Ga0209436_104561 Ga0209436_1045612 352
552 3300025229 Ga0209147_100373 Ga0209147_10037324 352
553 3300025242 Ga0209258_100009 Ga0209258_100009595 352
554 3300025245 Ga0207425_1000590 Ga0207425_100059015 352
555 3300025254 Ga0209148_1000007 Ga0209148_1000007595 352
556 3300025258 Ga0209129_1000013 Ga0209129_100001369 352
557 3300025263 Ga0209565_1000197 Ga0209565_100019715 352
558 3300025263 Ga0209565_1001200 Ga0209565_10012006 352
559 3300025273 Ga0209673_1000245 Ga0209673_100024528 352
560 3300025273 Ga0209673_1000535 Ga0209673_100053527 352
561 3300025284 Ga0209130_1000163 Ga0209130_100016337 352
562 3300025284 Ga0209130_1001358 Ga0209130_100135817 352
563 3300025291 Ga0209675_1000440 Ga0209675_10004408 352
564 3300025291 Ga0209675_1000612 Ga0209675_100061211 352
565 3300025292 Ga0209676_1000108 Ga0209676_1000108119 352
566 3300025292 Ga0209676_1000653 Ga0209676_10006534 352
567 3300025292 Ga0209676_1003446 Ga0209676_10034467 352
568 3300025294 Ga0209025_1000103 Ga0209025_1000103164 352
569 3300025294 Ga0209025_1000169 Ga0209025_100016927 352
570 3300025294 Ga0209025_1012899 Ga0209025_10128996 352
571 3300025295 Ga0209564_1000171 Ga0209564_100017127 352
572 3300025295 Ga0209564_1000517 Ga0209564_100051745 352
573 3300025297 Ga0209758_1000067 Ga0209758_1000067186 352
574 3300025297 Ga0209758_1007228 Ga0209758_10072287 352
575 3300025297 Ga0209758_1023553 Ga0209758_10235531 352
576 3300025298 Ga0209050_1000002 Ga0209050_1000002377 352
577 3300025298 Ga0209050_1020251 Ga0209050_10202512 352
578 3300025299 Ga0209256_1000077 Ga0209256_1000077187 352
579 3300025299 Ga0209256_1000121 Ga0209256_100012127 352
580 3300025302 Ga0207426_1000101 Ga0207426_100010169 352
581 3300025302 Ga0207426_1000129 Ga0207426_100012971 352
582 3300025303 Ga0209051_1000002 Ga0209051_1000002145 352
583 3300025303 Ga0209051_1000501 Ga0209051_10005014 352
584 3300025303 Ga0209051_1029941 Ga0209051_10299412 352
585 3300025304 Ga0209257_1000002 Ga0209257_1000002286 352
586 3300025304 Ga0209257_1004495 Ga0209257_10044957 352
587 3300025304 Ga0209257_1009417 Ga0209257_10094173 352
588 3300025921 Ga0207652_10132158 Ga0207652_101321582 352
589 3300025925 Ga0207650_10001098 Ga0207650_100010983 352
590 3300025929 Ga0207664_10112515 Ga0207664_101125152 352
591 3300025931 Ga0207644_10087491 Ga0207644_100874912 352
592 3300025933 Ga0207706_10002534 Ga0207706_100025346 352
593 3300025935 Ga0207709_10001981 Ga0207709_1000198113 352
594 3300026041 Ga0207639_10022793 Ga0207639_100227935 352
595 3300026078 Ga0207702_10252398 Ga0207702_102523982 352
596 3300026116 Ga0207674_10340135 Ga0207674_103401352 352
597 3300026121 Ga0207683_10006046 Ga0207683_100060467 352
598 3300027111 Ga0209281_1000052 Ga0209281_1000052126 352
599 3300027111 Ga0209281_1001255 Ga0209281_10012557 352
600 3300027512 Ga0209179_1023355 Ga0209179_10233551 352
601 3300028379 Ga0268266_10002159 Ga0268266_1000215911 352
602 3300028379 Ga0268266_10013538 Ga0268266_100135384 352
603 3300028794 Ga0307515_10040192 Ga0307515_100401926 352
604 3300031251 Ga0265327_10051754 Ga0265327_100517543 352
605 3300031548 Ga0307408_100299328 Ga0307408_1002993281 352
606 3300031731 Ga0307405_10022824 Ga0307405_100228242 352
607 3300035117 Ga0373953_0004150 Ga0373953_0004150_133_1212 352
608 3300035117 Ga0373953_0004357 Ga0373953_0004357_302_1369 352
609 3300035118 Ga0373954_0030096 Ga0373954_0030096_1010_2074 352
610 3300035119 Ga0373956_0037667 Ga0373956_0037667_346_1410 352
611 3300035119 Ga0373956_0047205 Ga0373956_0047205_787_1851 352
612 3300035120 Ga0373957_0060811 Ga0373957_0060811_310_1374 352
613 3300035172 Ga0373955_0041418 Ga0373955_0041418_599_1678 352
614 3300035172 Ga0373955_0042271 Ga0373955_0042271_767_1831 352
615 3300035410 Ga0373924_0005333 Ga0373924_0005333_2144_3208 352
616 3300035724 Ga0373933_0011765 Ga0373933_0011765_1541_2605 352
617 3300035724 Ga0373933_0075313 Ga0373933_0075313_455_1519 352
618 3300036401 Ga0373937_0005500 Ga0373937_0005500_1484_2548 352
619 3300036401 Ga0373937_0058800 Ga0373937_0058800_1806_2870 352
620 3300037068 Ga0373925_0033942 Ga0373925_0033942_2525_3589 352
621 3300037312 Ga0395899_0058474 Ga0395899_0058474_1591_2655 352
622 3300038443 Ga0395901_0090978 Ga0395901_0090978_190_1254 352
623 3300038726 Ga0400490_16569 Ga0400490_16569_17196_18266 352
624 3300039062 Ga0400483_110940 Ga0400483_110940_16672_17736 352
625 3300039110 Ga0400487_20039 Ga0400487_20039_754_1938 352
626 3300041406 Ga0439439_0012974 Ga0439439_0012974_747_1808 352
627 3300041413 Ga0439465_0059064 Ga0439465_0059064_93_1154 352
628 3300042007 Ga0439449_0000826 Ga0439449_0000826_10824_11885 352
629 3300042007 Ga0439449_0045678 Ga0439449_0045678_95_1156 352
630 3300042439 Ga0439464_0009131 Ga0439464_0009131_1362_2429 352
631 3300042876 Ga0451577_0000603 Ga0451577_0000603_1835_2899 352
632 3300044658 Ga0466972_0000283 Ga0466972_0000283_18269_19351 352
633 3300044684 Ga0466966_0030704 Ga0466966_0030704_2248_3312 352
634 3300044712 Ga0453684_0000014 Ga0453684_0000014_751821_752885 352
635 3300044712 Ga0453684_0139413 Ga0453684_0139413_621_1682 352
636 3300045049 Ga0466959_0025316 Ga0466959_0025316_1973_3037 352
637 3300045051 Ga0451576_0079011 Ga0451576_0079011_1317_2381 352
638 3300045976 Ga0466967_0556383 Ga0466967_0556383_14_1078 352
639 3300046454 Ga0495592_0071206 Ga0495592_0071206_303_1382 352
640 3300046463 Ga0495653_0015589 Ga0495653_0015589_261_1325 352
641 3300046477 Ga0495664_0044411 Ga0495664_0044411_1275_2354 352
642 3300046511 Ga0495608_0005355 Ga0495608_0005355_2000_3079 352
643 3300046511 Ga0495608_0059327 Ga0495608_0059327_1368_2432 352
644 3300046515 Ga0495620_0043324 Ga0495620_0043324_355_1416 352
645 3300046516 Ga0495628_0038150 Ga0495628_0038150_1813_2892 352
646 3300046533 Ga0495640_0173024 Ga0495640_0173024_187_1251 352
647 3300046536 Ga0495587_0007211 Ga0495587_0007211_2489_3568 352
648 3300046536 Ga0495587_0151257 Ga0495587_0151257_172_1248 352
649 3300046543 Ga0495645_0005748 Ga0495645_0005748_4542_5621 352
650 3300046559 Ga0495667_0020652 Ga0495667_0020652_116_1195 352
651 3300046559 Ga0495667_0037230 Ga0495667_0037230_887_1951 352
652 3300046615 Ga0495656_0000106 Ga0495656_0000106_29845_30954 352
653 3300046663 Ga0495635_0018065 Ga0495635_0018065_3833_4912 352
654 3300046679 Ga0495623_0079138 Ga0495623_0079138_13_1092 352
655 3300047319 Ga0495674_0014804 Ga0495674_0014804_551_1630 352
656 3300047320 Ga0495672_0010580 Ga0495672_0010580_2310_3371 352
657 3300047443 Ga0495687_065445 Ga0495687_065445_158_1240 352
658 3300047444 Ga0495675_0004456 Ga0495675_0004456_4770_5849 352
659 3300047446 Ga0495679_003927 Ga0495679_003927_5892_6953 352
660 3300047471 Ga0495684_0170311 Ga0495684_0170311_293_1372 352
661 3300048088 Ga0495602_0002908 Ga0495602_0002908_16461_17540 352
662 3300048090 Ga0495615_0003835 Ga0495615_0003835_558_1667 352
663 3300048917 Ga0496114_0067663 Ga0496114_0067663_1610_2719 352
664 3300048919 Ga0496116_0022830 Ga0496116_0022830_3018_4082 352
665 3300048921 Ga0496118_0006466 Ga0496118_0006466_10539_11639 352
666 3300048924 Ga0496121_0000034 Ga0496121_0000034_147561_148625 352
667 3300048926 Ga0496123_0135258 Ga0496123_0135258_107_1171 352
668 3300048927 Ga0496124_0000155 Ga0496124_0000155_29637_30707 352
669 3300048927 Ga0496124_0199369 Ga0496124_0199369_243_1307 352
670 3300048927 Ga0496124_0228134 Ga0496124_0228134_217_1281 352
671 3300048928 Ga0496125_0000030 Ga0496125_0000030_225876_226940 352
672 3300048928 Ga0496125_0020368 Ga0496125_0020368_4077_5177 352
673 3300048929 Ga0496126_0000043 Ga0496126_0000043_203952_205010 352
674 3300048929 Ga0496126_0076463 Ga0496126_0076463_1253_2311 352
675 3300048929 Ga0496126_0173501 Ga0496126_0173501_343_1407 352
676 3300048929 Ga0496126_0234104 Ga0496126_0234104_343_1407 352
677 3300049656 Ga0501209_020084 Ga0501209_020084_136_1197 352
678 3300050489 nmdc:mga03683_1856_c1 nmdc:mga03683_1856_c1_2700_3833 352
679 3300050489 nmdc:mga03683_55483_c1 nmdc:mga03683_55483_c1_135_1226 352
680 3300050491 nmdc:mga00v17_187096_c1 nmdc:mga00v17_187096_c1_156_1220 352
681 3300050492 nmdc:mga0yw44_18159_c1 nmdc:mga0yw44_18159_c1_2763_3824 352
682 3300050492 nmdc:mga0yw44_223850_c1 nmdc:mga0yw44_223850_c1_25_1092 352
683 3300050493 nmdc:mga0k408_62591_c1 nmdc:mga0k408_62591_c1_169_1236 352
684 3300050494 nmdc:mga06z11_34701_c1 nmdc:mga06z11_34701_c1_1088_2155 352
685 3300050494 nmdc:mga06z11_52571_c1 nmdc:mga06z11_52571_c1_572_1705 352
686 3300050496 nmdc:mga07m45_115948_c1 nmdc:mga07m45_115948_c1_256_1347 352
687 3300050496 nmdc:mga07m45_20590_c1 nmdc:mga07m45_20590_c1_1163_2254 352
688 3300050496 nmdc:mga07m45_50341_c1 nmdc:mga07m45_50341_c1_1064_2167 352
689 3300050516 nmdc:mga0sz30_7377_c1 nmdc:mga0sz30_7377_c1_855_1988 352
690 3300053077 Ga0495601_0005423 Ga0495601_0005423_172_1251 352
691 3300053077 Ga0495601_0133808 Ga0495601_0133808_458_1522 352
692 3300053078 Ga0495612_0004695 Ga0495612_0004695_54_1133 352
693 3300053084 Ga0495595_0028917 Ga0495595_0028917_1165_2229 352
694 3300053084 Ga0495595_0138945 Ga0495595_0138945_66_1130 352
695 3300053085 Ga0495619_0109369 Ga0495619_0109369_603_1667 352
696 3300053119 Ga0500595_020867 Ga0500595_020867_1278_2339 352
697 3300053121 Ga0500607_014149 Ga0500607_014149_1784_2842 352
698 3300053125 Ga0500618_000086 Ga0500618_000086_3356_4417 352
699 3300053177 Ga0500636_0000050 Ga0500636_0000050_55325_56383 352
700 3300053178 Ga0500637_0009892 Ga0500637_0009892_2977_4035 352
701 3300053729 Ga0500625_050306 Ga0500625_050306_729_1787 352
702 iso_pu_bacteria 2996887358 2996892516 352
703 iso_pu_bacteria 8005321885 8005327043 352
704 3300046463 Ga0495653_0000246 Ga0495653_0000246_28211_29305 353
705 3300046472 Ga0495580_0000803 Ga0495580_0000803_9701_10795 353
706 3300046473 Ga0495582_0007322 Ga0495582_0007322_58_1152 353
707 3300046516 Ga0495628_0017869 Ga0495628_0017869_4077_5171 353
708 3300046680 Ga0495646_0000411 Ga0495646_0000411_18013_19107 353
709 3300046690 Ga0495624_0000480 Ga0495624_0000480_15978_17072 353
710 3300047319 Ga0495674_0000742 Ga0495674_0000742_15615_16709 353
711 3300047673 Ga0495593_0002695 Ga0495593_0002695_4590_5684 353
712 iso_pu_bacteria 2551306352 2552745781 353
713 3300041512 Ga0451853_0648112 Ga0451853_0648112_25_1131 354
714 3300044656 Ga0466969_0000396 Ga0466969_0000396_21306_22373 354
715 3300044683 Ga0466965_0000909 Ga0466965_0000909_7562_8629 354
716 3300044684 Ga0466966_0029968 Ga0466966_0029968_802_1869 354
717 3300044694 Ga0466963_0000828 Ga0466963_0000828_666_1733 354
718 3300044735 Ga0466968_0078121 Ga0466968_0078121_282_1349 354
719 3300044765 Ga0466970_0009250 Ga0466970_0009250_1697_2764 354
720 3300044842 Ga0466957_0023839 Ga0466957_0023839_1657_2724 354
721 3300045836 Ga0466958_0008883 Ga0466958_0008883_985_2052 354
722 3300061719 Ga0466962_0000412 Ga0466962_0000412_10689_11756 354
723 3300001915 JGI24741J21665_1000425 JGI24741J21665_10004257 355
724 3300001979 JGI24740J21852_10000751 JGI24740J21852_100007515 355
725 3300001979 JGI24740J21852_10005161 JGI24740J21852_100051615 355
726 3300001989 JGI24739J22299_10028380 JGI24739J22299_100283803 355
727 3300001990 JGI24737J22298_10012649 JGI24737J22298_100126494 355
728 3300002067 JGI24735J21928_10002083 JGI24735J21928_100020838 355
729 3300002067 JGI24735J21928_10004669 JGI24735J21928_100046692 355
730 3300002075 JGI24738J21930_10004344 JGI24738J21930_100043443 355
731 3300002705 JGI25156J39149_1005241 JGI25156J39149_10052412 355
732 3300002705 JGI25156J39149_1010286 JGI25156J39149_10102862 355
733 3300002705 JGI25156J39149_1011537 JGI25156J39149_10115372 355
734 3300002738 JGI25154J39366_1001351 JGI25154J39366_10013514 355
735 3300002772 JGI25164J39214_1005585 JGI25164J39214_10055851 355
736 3300003214 JGI25165J46597_1001028 JGI25165J46597_100102813 355
737 3300003322 rootL2_10029885 rootL2_100298854 355
738 3300003752 Ga0055539_1000194 Ga0055539_10001945 355
739 3300003756 Ga0055533_1000812 Ga0055533_10008123 355
740 3300003756 Ga0055533_1001762 Ga0055533_10017624 355
741 3300003758 Ga0055532_1000139 Ga0055532_100013937 355
742 3300003758 Ga0055532_1001309 Ga0055532_10013097 355
743 3300003758 Ga0055532_1002498 Ga0055532_10024984 355
744 3300003758 Ga0055532_1003446 Ga0055532_10034462 355
745 3300003759 Ga0055525_1000655 Ga0055525_100065515 355
746 3300003760 Ga0055527_1000020 Ga0055527_100002060 355
747 3300003760 Ga0055527_1000931 Ga0055527_10009313 355
748 3300003760 Ga0055527_1000933 Ga0055527_10009337 355
749 3300003760 Ga0055527_1002173 Ga0055527_10021734 355
750 3300003761 Ga0055535_1000023 Ga0055535_1000023158 355
751 3300003761 Ga0055535_1000161 Ga0055535_100016137 355
752 3300003761 Ga0055535_1002245 Ga0055535_10022457 355
753 3300003761 Ga0055535_1002247 Ga0055535_10022477 355
754 3300003762 Ga0055542_1000035 Ga0055542_100003560 355
755 3300003762 Ga0055542_1000456 Ga0055542_100045624 355
756 3300003762 Ga0055542_1001487 Ga0055542_100148711 355
757 3300003762 Ga0055542_1002581 Ga0055542_10025816 355
758 3300003763 Ga0055529_1000039 Ga0055529_1000039158 355
759 3300003763 Ga0055529_1000292 Ga0055529_100029237 355
760 3300003763 Ga0055529_1001054 Ga0055529_100105413 355
761 3300003790 Ga0055528_1023844 Ga0055528_10238442 355
762 3300003856 Ga0058692_1002184 Ga0058692_10021844 355
763 3300005262 Ga0065165_1000115 Ga0065165_100011557 355
764 3300005327 Ga0070658_10086931 Ga0070658_100869313 355
765 3300005335 Ga0070666_10008389 Ga0070666_100083895 355
766 3300005339 Ga0070660_100001282 Ga0070660_10000128210 355
767 3300005344 Ga0070661_100000302 Ga0070661_10000030238 355
768 3300005347 Ga0070668_100151610 Ga0070668_1001516102 355
769 3300005366 Ga0070659_100000200 Ga0070659_10000020010 355
770 3300005366 Ga0070659_100000941 Ga0070659_10000094110 355
771 3300005367 Ga0070667_100027191 Ga0070667_1000271913 355
772 3300005455 Ga0070663_100000026 Ga0070663_10000002638 355
773 3300005455 Ga0070663_100000078 Ga0070663_10000007829 355
774 3300005455 Ga0070663_100009378 Ga0070663_1000093785 355
775 3300005455 Ga0070663_100048038 Ga0070663_1000480383 355
776 3300005456 Ga0070678_100015546 Ga0070678_1000155466 355
777 3300005535 Ga0070684_100384438 Ga0070684_1003844381 355
778 3300005539 Ga0068853_100343612 Ga0068853_1003436122 355
779 3300005548 Ga0070665_100220295 Ga0070665_1002202952 355
780 3300005563 Ga0068855_100217863 Ga0068855_1002178632 355
781 3300005564 Ga0070664_100000014 Ga0070664_10000001439 355
782 3300005577 Ga0068857_100077900 Ga0068857_1000779005 355
783 3300005578 Ga0068854_100000029 Ga0068854_10000002985 355
784 3300005614 Ga0068856_100000457 Ga0068856_1000004576 355
785 3300005616 Ga0068852_100013365 Ga0068852_1000133655 355
786 3300009092 Ga0105250_10001544 Ga0105250_1000154410 355
787 3300009093 Ga0105240_10018564 Ga0105240_100185643 355
788 3300009093 Ga0105240_10109589 Ga0105240_101095892 355
789 3300009093 Ga0105240_10112192 Ga0105240_101121924 355
790 3300009177 Ga0105248_10077470 Ga0105248_100774704 355
791 3300009551 Ga0105238_10011579 Ga0105238_100115796 355
792 3300009551 Ga0105238_10076857 Ga0105238_100768572 355
793 3300013100 Ga0157373_10005551 Ga0157373_100055518 355
794 3300013102 Ga0157371_10000118 Ga0157371_1000011884 355
795 3300013104 Ga0157370_10000038 Ga0157370_1000003896 355
796 3300013104 Ga0157370_10241613 Ga0157370_102416132 355
797 3300013105 Ga0157369_10001430 Ga0157369_100014309 355
798 3300013105 Ga0157369_10146242 Ga0157369_101462422 355
799 3300013296 Ga0157374_10013236 Ga0157374_100132366 355
800 3300013306 Ga0163162_10010537 Ga0163162_100105378 355
801 3300013307 Ga0157372_10000095 Ga0157372_1000009515 355
802 3300014497 Ga0182008_10101483 Ga0182008_101014832 355
803 3300014497 Ga0182008_10113995 Ga0182008_101139951 355
804 3300015261 Ga0182006_1002614 Ga0182006_10026146 355
805 3300015261 Ga0182006_1042830 Ga0182006_10428302 355
806 3300015262 Ga0182007_10008801 Ga0182007_100088015 355
807 3300015265 Ga0182005_1001414 Ga0182005_10014142 355
808 3300016635 Ga0183361_10001 Ga0183361_10001212 355
809 3300020077 Ga0206351_10147340 Ga0206351_101473406 355
810 3300020610 Ga0154015_1274796 Ga0154015_12747963 355
811 3300025224 Ga0209784_100006 Ga0209784_10000658 355
812 3300025224 Ga0209784_100108 Ga0209784_10010867 355
813 3300025224 Ga0209784_101294 Ga0209784_1012944 355
814 3300025224 Ga0209784_102779 Ga0209784_1027792 355
815 3300025225 Ga0209566_100002 Ga0209566_10000258 355
816 3300025225 Ga0209566_100164 Ga0209566_10016434 355
817 3300025225 Ga0209566_100626 Ga0209566_10062624 355
818 3300025225 Ga0209566_101652 Ga0209566_1016526 355
819 3300025226 Ga0209674_100017 Ga0209674_1000173 355
820 3300025226 Ga0209674_100097 Ga0209674_10009758 355
821 3300025226 Ga0209674_100168 Ga0209674_10016824 355
822 3300025226 Ga0209674_100287 Ga0209674_1002873 355
823 3300025226 Ga0209674_107283 Ga0209674_1072831 355
824 3300025228 Ga0209672_100001 Ga0209672_1000011941 355
825 3300025228 Ga0209672_100046 Ga0209672_10004680 355
826 3300025228 Ga0209672_100088 Ga0209672_10008883 355
827 3300025228 Ga0209672_100252 Ga0209672_10025213 355
828 3300025229 Ga0209147_100001 Ga0209147_1000011941 355
829 3300025229 Ga0209147_100018 Ga0209147_100018436 355
830 3300025229 Ga0209147_100043 Ga0209147_100043183 355
831 3300025229 Ga0209147_100130 Ga0209147_10013083 355
832 3300025229 Ga0209147_100214 Ga0209147_10021434 355
833 3300025230 Ga0209563_100136 Ga0209563_10013626 355
834 3300025230 Ga0209563_102466 Ga0209563_1024665 355
835 3300025230 Ga0209563_108718 Ga0209563_1087181 355
836 3300025231 Ga0207427_100478 Ga0207427_10047823 355
837 3300025242 Ga0209258_100001 Ga0209258_1000011941 355
838 3300025242 Ga0209258_100023 Ga0209258_100023383 355
839 3300025242 Ga0209258_100028 Ga0209258_100028436 355
840 3300025242 Ga0209258_100204 Ga0209258_10020483 355
841 3300025246 Ga0209646_1000153 Ga0209646_100015395 355
842 3300025250 Ga0209026_1009768 Ga0209026_10097681 355
843 3300025253 Ga0209677_100007 Ga0209677_10000758 355
844 3300025254 Ga0209148_1000003 Ga0209148_10000031941 355
845 3300025254 Ga0209148_1000029 Ga0209148_1000029449 355
846 3300025254 Ga0209148_1000286 Ga0209148_100028656 355
847 3300025254 Ga0209148_1001373 Ga0209148_10013733 355
848 3300025254 Ga0209148_1002571 Ga0209148_10025716 355
849 3300025256 Ga0209759_1000037 Ga0209759_1000037238 355
850 3300025256 Ga0209759_1000175 Ga0209759_100017515 355
851 3300025256 Ga0209759_1000649 Ga0209759_100064931 355
852 3300025256 Ga0209759_1003128 Ga0209759_10031285 355
853 3300025256 Ga0209759_1010536 Ga0209759_10105362 355
854 3300025256 Ga0209759_1014653 Ga0209759_10146532 355
855 3300025261 Ga0209233_1000123 Ga0209233_1000123150 355
856 3300025272 Ga0209455_1000001 Ga0209455_10000011941 355
857 3300025272 Ga0209455_1000064 Ga0209455_1000064178 355
858 3300025272 Ga0209455_1000107 Ga0209455_1000107136 355
859 3300025272 Ga0209455_1001161 Ga0209455_100116113 355
860 3300025273 Ga0209673_1000084 Ga0209673_1000084169 355
861 3300025284 Ga0209130_1015337 Ga0209130_10153372 355
862 3300025295 Ga0209564_1002711 Ga0209564_10027117 355
863 3300025295 Ga0209564_1007255 Ga0209564_10072557 355
864 3300025302 Ga0207426_1000007 Ga0207426_1000007271 355
865 3300025302 Ga0207426_1003361 Ga0207426_10033616 355
866 3300025735 Ga0207713_1032044 Ga0207713_10320441 355
867 3300025904 Ga0207647_10001999 Ga0207647_1000199914 355
868 3300025904 Ga0207647_10007729 Ga0207647_100077298 355
869 3300025904 Ga0207647_10011776 Ga0207647_100117763 355
870 3300025913 Ga0207695_10002200 Ga0207695_100022004 355
871 3300025913 Ga0207695_10005494 Ga0207695_1000549414 355
872 3300025913 Ga0207695_10100894 Ga0207695_101008942 355
873 3300025914 Ga0207671_10008949 Ga0207671_100089491 355
874 3300025919 Ga0207657_10000022 Ga0207657_1000002210 355
875 3300025920 Ga0207649_10000357 Ga0207649_1000035719 355
876 3300025924 Ga0207694_10042412 Ga0207694_100424123 355
877 3300025924 Ga0207694_10071388 Ga0207694_100713883 355
878 3300025932 Ga0207690_10000010 Ga0207690_10000010301 355
879 3300025932 Ga0207690_10000489 Ga0207690_100004892 355
880 3300025945 Ga0207679_10000173 Ga0207679_1000017314 355
881 3300025949 Ga0207667_10018019 Ga0207667_100180199 355
882 3300025972 Ga0207668_10085588 Ga0207668_100855882 355
883 3300025981 Ga0207640_10000029 Ga0207640_10000029100 355
884 3300025986 Ga0207658_10029361 Ga0207658_100293614 355
885 3300026067 Ga0207678_10000031 Ga0207678_1000003177 355
886 3300026067 Ga0207678_10000226 Ga0207678_1000022634 355
887 3300026067 Ga0207678_10014828 Ga0207678_100148284 355
888 3300026067 Ga0207678_10290472 Ga0207678_102904722 355
889 3300026078 Ga0207702_10000083 Ga0207702_1000008392 355
890 3300026121 Ga0207683_10041512 Ga0207683_100415123 355
891 3300026142 Ga0207698_10008894 Ga0207698_100088942 355
892 3300027312 Ga0209371_1000160 Ga0209371_100016069 355
893 3300027312 Ga0209371_1011906 Ga0209371_10119062 355
894 3300028653 Ga0265323_10015761 Ga0265323_100157614 355
895 3300028800 Ga0265338_10000118 Ga0265338_1000011856 355
896 3300030500 Ga0268256_1000132 Ga0268256_100013235 355
897 3300030500 Ga0268256_1012964 Ga0268256_10129643 355
898 3300031344 Ga0265316_10024710 Ga0265316_100247105 355
899 3300031911 Ga0307412_10000014 Ga0307412_10000014143 355
900 3300037418 Ga0395900_0014802 Ga0395900_0014802_6469_7536 355
901 3300037471 Ga0395905_0000014 Ga0395905_0000014_190573_191652 355
902 3300039437 Ga0436365_1223717 Ga0436365_1223717_2100_3167 355
903 3300044650 Ga0466986_0139040 Ga0466986_0139040_293_1360 355
904 3300044684 Ga0466966_0060052 Ga0466966_0060052_642_1709 355
905 3300044765 Ga0466970_0126792 Ga0466970_0126792_315_1382 355
906 3300045049 Ga0466959_0089716 Ga0466959_0089716_517_1584 355
907 3300046455 Ga0495603_0020534 Ga0495603_0020534_2662_3732 355
908 3300046455 Ga0495603_0024278 Ga0495603_0024278_1862_2941 355
909 3300046457 Ga0495590_0014815 Ga0495590_0014815_1398_2477 355
910 3300046458 Ga0495591_000791 Ga0495591_000791_16550_17629 355
911 3300046458 Ga0495591_005442 Ga0495591_005442_618_1688 355
912 3300046459 Ga0495629_0001348 Ga0495629_0001348_7202_8272 355
913 3300046459 Ga0495629_0003125 Ga0495629_0003125_2571_3650 355
914 3300046459 Ga0495629_0003148 Ga0495629_0003148_10080_11159 355
915 3300046459 Ga0495629_0030457 Ga0495629_0030457_1519_2598 355
916 3300046459 Ga0495629_0139094 Ga0495629_0139094_119_1198 355
917 3300046459 Ga0495629_0210125 Ga0495629_0210125_212_1294 355
918 3300046460 Ga0495638_0012178 Ga0495638_0012178_2922_4004 355
919 3300046460 Ga0495638_0019593 Ga0495638_0019593_91_1170 355
920 3300046462 Ga0495651_0004507 Ga0495651_0004507_1534_2613 355
921 3300046463 Ga0495653_0035979 Ga0495653_0035979_1386_2465 355
922 3300046463 Ga0495653_0053734 Ga0495653_0053734_1670_2749 355
923 3300046463 Ga0495653_0104709 Ga0495653_0104709_627_1706 355
924 3300046463 Ga0495653_0120593 Ga0495653_0120593_320_1414 355
925 3300046463 Ga0495653_0171111 Ga0495653_0171111_125_1204 355
926 3300046471 Ga0495650_0002161 Ga0495650_0002161_14553_15623 355
927 3300046472 Ga0495580_0004970 Ga0495580_0004970_8994_10073 355
928 3300046472 Ga0495580_0009006 Ga0495580_0009006_6312_7382 355
929 3300046472 Ga0495580_0011237 Ga0495580_0011237_1619_2698 355
930 3300046472 Ga0495580_0015300 Ga0495580_0015300_1079_2158 355
931 3300046472 Ga0495580_0024823 Ga0495580_0024823_2229_3308 355
932 3300046473 Ga0495582_0022001 Ga0495582_0022001_972_2051 355
933 3300046473 Ga0495582_0022261 Ga0495582_0022261_2336_3406 355
934 3300046473 Ga0495582_0042356 Ga0495582_0042356_1361_2440 355
935 3300046474 Ga0495605_0001100 Ga0495605_0001100_4100_5179 355
936 3300046474 Ga0495605_0002292 Ga0495605_0002292_10063_11145 355
937 3300046474 Ga0495605_0014364 Ga0495605_0014364_597_1676 355
938 3300046475 Ga0495639_0114697 Ga0495639_0114697_153_1223 355
939 3300046476 Ga0495662_0134887 Ga0495662_0134887_93_1172 355
940 3300046492 Ga0495585_0159962 Ga0495585_0159962_28_1110 355
941 3300046500 Ga0495596_0021579 Ga0495596_0021579_1386_2465 355
942 3300046500 Ga0495596_0081098 Ga0495596_0081098_123_1193 355
943 3300046506 Ga0495583_0005045 Ga0495583_0005045_6441_7520 355
944 3300046507 Ga0495606_0011868 Ga0495606_0011868_4976_6055 355
945 3300046507 Ga0495606_0079499 Ga0495606_0079499_706_1785 355
946 3300046511 Ga0495608_0028877 Ga0495608_0028877_2282_3361 355
947 3300046513 Ga0495616_0067269 Ga0495616_0067269_158_1237 355
948 3300046514 Ga0495618_0012608 Ga0495618_0012608_1438_2517 355
949 3300046515 Ga0495620_0010367 Ga0495620_0010367_596_1675 355
950 3300046516 Ga0495628_0178502 Ga0495628_0178502_38_1132 355
951 3300046517 Ga0495630_0035456 Ga0495630_0035456_2601_3671 355
952 3300046517 Ga0495630_0186845 Ga0495630_0186845_19_1098 355
953 3300046518 Ga0495631_0070125 Ga0495631_0070125_244_1326 355
954 3300046523 Ga0495644_0080580 Ga0495644_0080580_78_1160 355
955 3300046524 Ga0495648_0045645 Ga0495648_0045645_1074_2153 355
956 3300046526 Ga0495666_0004075 Ga0495666_0004075_5868_6947 355
957 3300046528 Ga0495642_0024251 Ga0495642_0024251_338_1420 355
958 3300046528 Ga0495642_0047233 Ga0495642_0047233_673_1743 355
959 3300046530 Ga0495654_0039123 Ga0495654_0039123_1055_2125 355
960 3300046531 Ga0495665_0016826 Ga0495665_0016826_875_1954 355
961 3300046531 Ga0495665_0019441 Ga0495665_0019441_542_1621 355
962 3300046531 Ga0495665_0024966 Ga0495665_0024966_1942_3021 355
963 3300046535 Ga0495586_0051489 Ga0495586_0051489_511_1581 355
964 3300046536 Ga0495587_0013176 Ga0495587_0013176_3971_5050 355
965 3300046543 Ga0495645_0002307 Ga0495645_0002307_9407_10477 355
966 3300046543 Ga0495645_0007946 Ga0495645_0007946_3461_4540 355
967 3300046642 Ga0495634_0005877 Ga0495634_0005877_8119_9198 355
968 3300046663 Ga0495635_0004906 Ga0495635_0004906_2662_3741 355
969 3300046663 Ga0495635_0034172 Ga0495635_0034172_55_1134 355
970 3300046665 Ga0495661_0033257 Ga0495661_0033257_1504_2583 355
971 3300046678 Ga0495599_0022737 Ga0495599_0022737_67_1161 355
972 3300046679 Ga0495623_0026574 Ga0495623_0026574_1027_2106 355
973 3300046679 Ga0495623_0065070 Ga0495623_0065070_221_1300 355
974 3300046680 Ga0495646_0039957 Ga0495646_0039957_132_1202 355
975 3300046680 Ga0495646_0055178 Ga0495646_0055178_414_1493 355
976 3300046684 Ga0495669_0015128 Ga0495669_0015128_1922_3004 355
977 3300046690 Ga0495624_0004188 Ga0495624_0004188_9102_10196 355
978 3300046690 Ga0495624_0009643 Ga0495624_0009643_2589_3668 355
979 3300046690 Ga0495624_0011954 Ga0495624_0011954_3794_4873 355
980 3300046691 Ga0495670_0051119 Ga0495670_0051119_144_1226 355
981 3300046694 Ga0495649_0007008 Ga0495649_0007008_4279_5358 355
982 3300046694 Ga0495649_0010030 Ga0495649_0010030_2586_3668 355
983 3300046694 Ga0495649_0035698 Ga0495649_0035698_822_1892 355
984 3300046794 Ga0495589_0003243 Ga0495589_0003243_2685_3767 355
985 3300046794 Ga0495589_0032012 Ga0495589_0032012_1376_2455 355
986 3300046809 Ga0495600_0003049 Ga0495600_0003049_214_1293 355
987 3300046809 Ga0495600_0032604 Ga0495600_0032604_1404_2474 355
988 3300047315 Ga0495581_0002005 Ga0495581_0002005_1432_2511 355
989 3300047315 Ga0495581_0008129 Ga0495581_0008129_2613_3683 355
990 3300047315 Ga0495581_0129863 Ga0495581_0129863_66_1145 355
991 3300047317 Ga0495604_0016589 Ga0495604_0016589_1471_2550 355
992 3300047319 Ga0495674_0002606 Ga0495674_0002606_7328_8407 355
993 3300047319 Ga0495674_0067056 Ga0495674_0067056_1048_2127 355
994 3300047319 Ga0495674_0083907 Ga0495674_0083907_1079_2158 355
995 3300047319 Ga0495674_0170952 Ga0495674_0170952_441_1520 355
996 3300047320 Ga0495672_0008928 Ga0495672_0008928_491_1570 355
997 3300047321 Ga0495676_0057095 Ga0495676_0057095_937_2016 355
998 3300047322 Ga0495680_0099750 Ga0495680_0099750_433_1512 355
999 3300047323 Ga0495683_0029606 Ga0495683_0029606_1488_2567 355
1000 3300047323 Ga0495683_0035829 Ga0495683_0035829_776_1855 355
1001 3300047323 Ga0495683_0071732 Ga0495683_0071732_73_1152 355
1002 3300047323 Ga0495683_0093889 Ga0495683_0093889_65_1135 355
1003 3300047323 Ga0495683_0118316 Ga0495683_0118316_115_1194 355
1004 3300047443 Ga0495687_000011 Ga0495687_000011_126424_127494 355
1005 3300047443 Ga0495687_007490 Ga0495687_007490_2654_3721 355
1006 3300047443 Ga0495687_014212 Ga0495687_014212_260_1339 355
1007 3300047443 Ga0495687_034430 Ga0495687_034430_939_2018 355
1008 3300047444 Ga0495675_0018617 Ga0495675_0018617_284_1363 355
1009 3300047444 Ga0495675_0027541 Ga0495675_0027541_2425_3504 355
1010 3300047446 Ga0495679_000007 Ga0495679_000007_133098_134177 355
1011 3300047446 Ga0495679_015953 Ga0495679_015953_191_1270 355
1012 3300047470 Ga0495681_0039614 Ga0495681_0039614_153_1223 355
1013 3300047471 Ga0495684_0072738 Ga0495684_0072738_488_1582 355
1014 3300047673 Ga0495593_0088373 Ga0495593_0088373_28_1098 355
1015 3300048088 Ga0495602_0017500 Ga0495602_0017500_78_1157 355
1016 3300048088 Ga0495602_0037077 Ga0495602_0037077_3137_4231 355
1017 3300048089 Ga0495614_0003643 Ga0495614_0003643_1395_2474 355
1018 3300048091 Ga0495626_0014225 Ga0495626_0014225_2858_3937 355
1019 3300048904 Ga0496101_0021403 Ga0496101_0021403_2157_3236 355
1020 3300048904 Ga0496101_0036958 Ga0496101_0036958_2102_3181 355
1021 3300048904 Ga0496101_0045923 Ga0496101_0045923_1181_2260 355
1022 3300048905 Ga0496102_0001577 Ga0496102_0001577_18641_19720 355
1023 3300048905 Ga0496102_0065372 Ga0496102_0065372_651_1730 355
1024 3300048906 Ga0496103_0002910 Ga0496103_0002910_247_1326 355
1025 3300048906 Ga0496103_0004929 Ga0496103_0004929_3794_4873 355
1026 3300048906 Ga0496103_0039606 Ga0496103_0039606_833_1912 355
1027 3300048907 Ga0496104_0145845 Ga0496104_0145845_826_1905 355
1028 3300048907 Ga0496104_0201255 Ga0496104_0201255_124_1194 355
1029 3300048908 Ga0496105_0266932 Ga0496105_0266932_258_1337 355
1030 3300048909 Ga0496106_0000071 Ga0496106_0000071_48828_49907 355
1031 3300048909 Ga0496106_0077599 Ga0496106_0077599_946_2025 355
1032 3300048909 Ga0496106_0127565 Ga0496106_0127565_142_1221 355
1033 3300048910 Ga0496107_0010829 Ga0496107_0010829_658_1737 355
1034 3300048911 Ga0496108_0184134 Ga0496108_0184134_203_1282 355
1035 3300048913 Ga0496110_0010435 Ga0496110_0010435_2808_3887 355
1036 3300048913 Ga0496110_0154486 Ga0496110_0154486_953_2023 355
1037 3300048915 Ga0496112_0004021 Ga0496112_0004021_365_1444 355
1038 3300048916 Ga0496113_0006084 Ga0496113_0006084_1014_2093 355
1039 3300048916 Ga0496113_0013566 Ga0496113_0013566_4323_5402 355
1040 3300048917 Ga0496114_0001303 Ga0496114_0001303_6745_7815 355
1041 3300048918 Ga0496115_0032759 Ga0496115_0032759_629_1699 355
1042 3300048918 Ga0496115_0053230 Ga0496115_0053230_110_1189 355
1043 3300048918 Ga0496115_0301616 Ga0496115_0301616_62_1141 355
1044 3300048919 Ga0496116_0008846 Ga0496116_0008846_3255_4334 355
1045 3300048920 Ga0496117_0003482 Ga0496117_0003482_1798_2877 355
1046 3300048920 Ga0496117_0026157 Ga0496117_0026157_1020_2099 355
1047 3300048920 Ga0496117_0026468 Ga0496117_0026468_1632_2711 355
1048 3300048920 Ga0496117_0027713 Ga0496117_0027713_205_1284 355
1049 3300048920 Ga0496117_0035628 Ga0496117_0035628_2514_3593 355
1050 3300048920 Ga0496117_0057695 Ga0496117_0057695_1042_2121 355
1051 3300048920 Ga0496117_0108380 Ga0496117_0108380_229_1296 355
1052 3300048921 Ga0496118_0010536 Ga0496118_0010536_1030_2109 355
1053 3300048921 Ga0496118_0014797 Ga0496118_0014797_4145_5224 355
1054 3300048921 Ga0496118_0022677 Ga0496118_0022677_2761_3840 355
1055 3300048921 Ga0496118_0040781 Ga0496118_0040781_916_1995 355
1056 3300048921 Ga0496118_0100468 Ga0496118_0100468_155_1234 355
1057 3300048921 Ga0496118_0108541 Ga0496118_0108541_417_1508 355
1058 3300048921 Ga0496118_0152133 Ga0496118_0152133_190_1269 355
1059 3300048923 Ga0496120_0060972 Ga0496120_0060972_691_1770 355
1060 3300048924 Ga0496121_0017772 Ga0496121_0017772_2774_3853 355
1061 3300048924 Ga0496121_0034806 Ga0496121_0034806_850_1929 355
1062 3300048924 Ga0496121_0183582 Ga0496121_0183582_274_1365 355
1063 3300048925 Ga0496122_0051500 Ga0496122_0051500_1088_2167 355
1064 3300048925 Ga0496122_0099514 Ga0496122_0099514_709_1788 355
1065 3300048926 Ga0496123_0071305 Ga0496123_0071305_553_1632 355
1066 3300048927 Ga0496124_0106863 Ga0496124_0106863_984_2063 355
1067 3300048927 Ga0496124_0160866 Ga0496124_0160866_29_1108 355
1068 3300048928 Ga0496125_0031820 Ga0496125_0031820_611_1828 355
1069 3300048928 Ga0496125_0052026 Ga0496125_0052026_1753_2832 355
1070 3300048929 Ga0496126_0001409 Ga0496126_0001409_7064_8143 355
1071 3300048929 Ga0496126_0007047 Ga0496126_0007047_2244_3323 355
1072 iso_pu_bacteria 2744054900 2746086348 355
1073 iso_pu_bacteria 2744054901 2746093348 355

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

32

358

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hdo-assembly1.cif.gz_B crystal structure of a histidinol-phosphate aminotransferase from geobacter metallireducens 0.9504 5 353
3hdo-assembly1.cif.gz_B crystal structure of a histidinol-phosphate aminotransferase from geobacter metallireducens 0.9398 5 353
1uu1-assembly1.cif.gz_A complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) 0.9051 11 352
1lc7-assembly1.cif.gz_A crystal structure of l-threonine-o-3-phosphate decarboxylase from s. enterica complexed with a substrate 0.9013 26 355
3ftb-assembly2.cif.gz_D the crystal structure of the histidinol-phosphate aminotransferase from clostridium acetobutylicum 0.9008 28 354
ID Description Score Start End Superfamily
3hdoB01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9689 261 353 3.90.1150.10
af_I1MNX6_339_418_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9464 272 347 3.90.1150.10
3hdoB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9351 38 261 3.40.640.10
3hdoB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.931 38 261 3.40.640.10
3cq4B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9217 260 353 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A3D4R1I4-F1-model_v4 Histidinol-phosphate transaminase (EC 2.6.1.9) 0.9921 284 354 GO:0004400
GO:0009058
GO:0030170
AF-A0A3B9PL55-F1-model_v4 Histidinol-phosphate transaminase 0.9879 71 354 GO:0008483
GO:0009058
GO:0030170
AF-Q89GX0-F1-model_v4 Histidinol-phosphate aminotransferase 1 (EC 2.6.1.9) (Imidazole acetol-phosphate transaminase 1) 0.9869 1 353 GO:0000105
GO:0004400
GO:0030170
AF-T0XZR1-F1-model_v4 Aminotransferase class I/classII large domain-containing protein 0.9833 261 354 GO:0008483
GO:0009058
GO:0016020
GO:0030170
AF-A0A382YUB4-F1-model_v4 Aminotransferase class I/classII large domain-containing protein 0.9829 260 354 GO:0008483
GO:0008652
GO:0030170

Feature Viewer

pLDDT pTM Quality
94.47 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map