F489496

General Info

Members Datasets Scaffolds Average Seq Length
1071 507 979 265

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_52090_c1|nmdc:mga00v17_52090_c1_1379_2320
Length 313
Sequence MRFGCRASPIRSASSPTPHAERHIGARLAGAERLQSLASEENVMTLPSLFLSHGAPTLPLTDTPARTFLTQLGGKLPRPKAVLVVSAHWETTKPTVSAVNWNETIHDFRGFPRALYDLRYPAPGSPQVAARLAETLRASGFDCDIDRRRGLDHGAWVPLLLTYPQADIPVLQLSVQPHLGPEHHLRIGRALAPLREEGVLIVGSGSFTHDLSEFRGQELDAPSPDWVNDFADWMDEALAKNQIKELLNYRHAAPFAVKNHPTEEHLLPLYVALGAAGDRPHAERLHASSTYSILRMDVYAFRNASDAVVKSAA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
11 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
12 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
13 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
14 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
15 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
16 2519103095 Burkholderia sp. KJ006 Isolate Nodule
17 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
18 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
19 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
20 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
21 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
22 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
23 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
24 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
25 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
26 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
27 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
28 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
29 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
30 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
31 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
32 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
33 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
34 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
35 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
36 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
37 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
38 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
39 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
40 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
41 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
42 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
43 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
44 2818991450 Burkholderia sp. 604 Isolate Unclassified
45 2818991452 Burkholderia cepacia 561 Isolate Unclassified
46 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
47 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
48 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
49 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
50 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
51 2849560528 Caulobacter zeae 410 Isolate Unclassified
52 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
53 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
54 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
55 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
56 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
57 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
58 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
59 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
60 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
61 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
62 2904564687 Burkholderia sp. 571 Isolate Unclassified
63 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
64 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
65 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
66 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
67 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
68 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
69 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
70 2928163908 Burkholderia sp. 567 Isolate Unclassified
71 2928170801 Burkholderia sp. 572 Isolate Unclassified
72 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
73 2928536128 Burkholderia sola 565 Isolate Unclassified
74 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
75 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
76 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
77 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
78 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
79 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
80 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
81 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
82 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
83 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
84 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
85 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
86 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
87 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
88 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
89 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
90 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
91 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
92 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
93 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
94 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
95 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
96 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
97 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
98 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
99 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
100 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
101 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
102 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
103 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
104 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
105 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
106 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
107 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
108 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
109 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
110 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
111 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
112 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
113 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
114 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
115 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
116 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
117 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
118 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
119 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
120 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
121 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
122 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
123 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
124 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
125 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
126 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
127 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
128 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
129 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
130 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
131 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
132 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
133 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
134 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
135 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
136 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
137 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
138 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
139 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
140 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
141 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
142 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
143 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
144 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
145 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
146 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
147 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
148 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
149 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
150 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
151 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
152 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
153 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
154 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
155 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
156 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
157 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
158 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
162 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
166 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
167 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
168 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
169 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
170 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
171 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
172 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
173 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
175 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
177 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
178 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
179 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
180 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
188 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
189 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
194 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
243 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
244 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
245 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
246 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
247 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
248 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
249 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
250 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
251 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
252 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
253 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
254 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
255 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
256 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
257 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
258 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
259 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
260 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
261 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
262 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
263 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
264 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
265 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
266 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
267 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
268 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
269 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
270 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
272 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
273 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
274 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
275 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
276 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
277 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
278 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
279 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
280 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
281 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
282 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
283 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
285 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
286 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
287 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
288 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
289 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
290 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
291 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
292 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
293 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
294 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
295 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
296 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
297 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
298 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
299 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
300 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
301 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
302 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
303 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
304 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
305 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
306 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
307 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
308 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
309 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
310 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
311 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
312 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
313 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
314 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
315 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
316 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
317 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
318 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
319 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
320 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
321 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
322 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
323 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
324 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
325 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
326 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
327 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
328 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
329 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
330 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
331 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
332 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
333 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
334 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
335 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
336 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
337 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
338 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
339 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
340 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
341 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
342 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
343 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
344 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
345 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
346 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
347 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
348 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
349 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
350 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
351 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
352 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
353 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
354 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
355 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
356 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
357 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
358 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
359 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
360 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
361 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
362 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
363 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
364 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
365 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
366 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
367 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
368 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
369 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
370 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
371 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
372 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
373 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
374 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
375 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
376 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
377 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
378 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
379 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
380 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
381 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
382 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
383 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
384 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
385 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
386 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
387 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
388 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
389 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
390 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
391 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
392 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
393 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
394 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
395 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
396 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
397 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
398 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
399 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
400 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
401 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
402 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
403 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
404 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
405 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
406 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
407 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
408 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
409 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
410 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
411 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
412 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
413 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
414 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
415 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
416 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
417 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
418 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
419 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
420 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
421 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
422 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
429 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
430 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
431 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
432 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
433 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
434 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
435 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
436 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
437 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
438 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
439 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
440 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
441 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
442 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
443 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
444 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
445 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
446 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
447 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
448 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
449 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
450 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
451 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
452 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
453 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
454 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
455 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
456 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
457 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
458 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
459 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
460 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
461 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
462 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
463 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
464 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
465 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
466 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
467 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
468 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
469 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
470 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
471 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
472 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
473 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
474 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
475 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
476 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
477 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
478 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
479 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
480 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
481 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
482 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
483 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
484 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
485 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
486 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
487 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
488 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
489 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
490 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
491 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
492 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
493 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
494 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
495 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
496 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
497 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
498 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
499 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
500 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
501 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
502 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
503 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
504 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
505 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
506 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
507 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.85
Metatranscriptomes 0.56
Isolates 8.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.1
Nodule 1.77
Rhizoplane 3.83
Rhizosphere 70.21
Stem 0
Stem Tuber 0
Unclassified 10.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10029710 3300001989 Bacteria 1898
2 JGI24739J22299_10038296 3300001989 Bacteria 1612
3 JGI24737J22298_10012651 3300001990 Bacteria 2750
4 JGI24735J21928_10006038 3300002067 Bacteria 4001
5 JGI24735J21928_10006346 3300002067 Bacteria 3901
6 JGI24735J21928_10101600 3300002067 Bacteria 826
7 JGI24751J29686_10003654 3300002459 Bacteria 3099
8 JGI25156J39149_1005451 3300002705 Bacteria 3664
9 rootH2_10253312 3300003320 Bacteria 1708
10 rootH2_10255524 3300003320 Bacteria 1374
11 rootL2_10337834 3300003322 Bacteria 1544
12 rootH1_10176638 3300003323 Bacteria 2499
13 Ga0055539_1002880 3300003752 Bacteria 2512
14 Ga0055533_1002644 3300003756 Bacteria 3980
15 Ga0055532_1000718 3300003758 Bacteria 12309
16 Ga0055532_1004042 3300003758 Bacteria 2323
17 Ga0055532_1004063 3300003758 Bacteria 2314
18 Ga0055527_1003540 3300003760 Bacteria 2293
19 Ga0055527_1003554 3300003760 Bacteria 2283
20 Ga0055535_1006604 3300003761 Bacteria 2323
21 Ga0055535_1006637 3300003761 Bacteria 2314
22 Ga0055542_1004393 3300003762 Bacteria 3445
23 Ga0055542_1006925 3300003762 Bacteria 2362
24 Ga0055529_1003991 3300003763 Bacteria 2314
25 Ga0055529_1003997 3300003763 Bacteria 2313
26 Ga0055528_1001636 3300003790 Bacteria 13188
27 Ga0058692_1004095 3300003856 Bacteria 4376
28 Ga0065165_1000648 3300005262 Bacteria 50260
29 Ga0070670_100019902 3300005331 Bacteria 5762
30 Ga0070670_100305927 3300005331 Bacteria 1391
31 Ga0070670_100558992 3300005331 Bacteria 1021
32 Ga0070666_10001588 3300005335 Bacteria 13814
33 Ga0070680_100112515 3300005336 Bacteria 2267
34 Ga0070660_100000204 3300005339 Bacteria 39747
35 Ga0070660_100001152 3300005339 Bacteria 17832
36 Ga0070661_100087551 3300005344 Bacteria 2304
37 Ga0070669_100000004 3300005353 Bacteria 314707
38 Ga0070675_100118645 3300005354 Bacteria 2246
39 Ga0070671_100000004 3300005355 Bacteria 262155
40 Ga0070659_100000156 3300005366 Bacteria 52480
41 Ga0070667_100027200 3300005367 Bacteria 4759
42 Ga0070709_10094073 3300005434 Bacteria 1982
43 Ga0070714_100002166 3300005435 Bacteria 14431
44 Ga0070714_100015389 3300005435 Bacteria 6156
45 Ga0070714_100267561 3300005435 Bacteria 1584
46 Ga0070713_100060518 3300005436 Bacteria 3166
47 Ga0070711_100140983 3300005439 Bacteria 1807
48 Ga0070711_100273159 3300005439 Bacteria 1334
49 Ga0070663_100007485 3300005455 Bacteria 6648
50 Ga0070663_100011786 3300005455 Bacteria 5504
51 Ga0070678_100072220 3300005456 Unclassified 2586
52 Ga0070678_100461535 3300005456 Bacteria 1114
53 Ga0070681_10027823 3300005458 Bacteria 5685
54 Ga0070681_10062338 3300005458 Bacteria 3702
55 Ga0070681_10121087 3300005458 Bacteria 2552
56 Ga0070681_10122299 3300005458 Bacteria 2536
57 Ga0070681_10440419 3300005458 Bacteria 1215
58 Ga0068867_100108471 3300005459 Bacteria 2129
59 Ga0070685_10002911 3300005466 Bacteria 8749
60 Ga0070706_100553234 3300005467 Bacteria 1070
61 Ga0070679_100063148 3300005530 Bacteria 3692
62 Ga0070679_100078433 3300005530 Bacteria 3292
63 Ga0070679_100162930 3300005530 Bacteria 2204
64 Ga0070679_100792895 3300005530 Bacteria 890
65 Ga0070684_100022062 3300005535 Bacteria 5306
66 Ga0070686_100094455 3300005544 Bacteria 2007
67 Ga0070695_100017779 3300005545 Bacteria 4314
68 Ga0070665_100023540 3300005548 Bacteria 6201
69 Ga0068855_100004044 3300005563 Bacteria 17897
70 Ga0068855_100074923 3300005563 Bacteria 3930
71 Ga0068855_100216159 3300005563 Bacteria 2152
72 Ga0068855_100338109 3300005563 Bacteria 1661
73 Ga0070664_100221985 3300005564 Bacteria 1691
74 Ga0068857_100529192 3300005577 Bacteria 1109
75 Ga0068854_100132023 3300005578 Bacteria 1908
76 Ga0068856_100133357 3300005614 Bacteria 2489
77 Ga0068852_100025272 3300005616 Bacteria 4810
78 Ga0068859_100003632 3300005617 Bacteria 15731
79 Ga0068859_100468779 3300005617 Bacteria 1355
80 Ga0068864_100004715 3300005618 Bacteria 11175
81 Ga0068861_100025417 3300005719 Bacteria 4295
82 Ga0068863_100037037 3300005841 Bacteria 4645
83 Ga0068858_100002081 3300005842 Bacteria 20346
84 Ga0068860_100001690 3300005843 Bacteria 23583
85 Ga0068860_100080142 3300005843 Bacteria 3105
86 Ga0068862_100002536 3300005844 Bacteria 16157
87 Ga0068862_100506019 3300005844 Bacteria 1147
88 Ga0075365_10102819 3300006038 Bacteria 1958
89 Ga0075363_100000129 3300006048 Bacteria 18151
90 Ga0075363_100015629 3300006048 Bacteria 3734
91 Ga0075363_100097600 3300006048 Bacteria 1624
92 Ga0075364_10004589 3300006051 Bacteria 7956
93 Ga0075364_10071428 3300006051 Bacteria 2286
94 Ga0075364_10083829 3300006051 Bacteria 2110
95 Ga0070712_100173343 3300006175 Bacteria 1675
96 Ga0075362_10000024 3300006177 Bacteria 59846
97 Ga0075362_10020589 3300006177 Bacteria 2758
98 Ga0075362_10027731 3300006177 Bacteria 2426
99 Ga0075367_10000197 3300006178 Bacteria 19933
100 Ga0075367_10070406 3300006178 Bacteria 2102
101 Ga0075369_10000380 3300006186 Bacteria 13318
102 Ga0075369_10010043 3300006186 Bacteria 3697
103 Ga0075369_10042650 3300006186 Bacteria 1945
104 Ga0075369_10054877 3300006186 Bacteria 1730
105 Ga0075366_10000115 3300006195 Bacteria 33019
106 Ga0075366_10004537 3300006195 Bacteria 7456
107 Ga0075366_10014611 3300006195 Bacteria 4486
108 Ga0075366_10091455 3300006195 Bacteria 1823
109 Ga0075366_10269720 3300006195 Bacteria 1039
110 Ga0075370_10000001 3300006353 Bacteria 239876
111 Ga0075370_10036581 3300006353 Bacteria 2758
112 Ga0075370_10111603 3300006353 Bacteria 1588
113 Ga0075370_10228638 3300006353 Bacteria 1100
114 Ga0075430_100121858 3300006846 Bacteria 2174
115 Ga0075429_100001195 3300006880 Bacteria 21009
116 Ga0097620_100003632 3300006931 Bacteria 15731
117 Ga0097620_100468845 3300006931 Bacteria 1355
118 Ga0105251_10000758 3300009011 Bacteria 29449
119 Ga0105251_10001262 3300009011 Bacteria 21860
120 Ga0105251_10081877 3300009011 Bacteria 1491
121 Ga0105244_10178424 3300009036 Bacteria 1008
122 Ga0105250_10026968 3300009092 Bacteria 2315
123 Ga0105250_10096753 3300009092 Bacteria 1204
124 Ga0105240_10001922 3300009093 Bacteria 34528
125 Ga0105240_10029364 3300009093 Bacteria 7165
126 Ga0105240_10031832 3300009093 Bacteria 6834
127 Ga0105240_10106844 3300009093 Bacteria 3394
128 Ga0105240_10315871 3300009093 Bacteria 1782
129 Ga0105247_10006203 3300009101 Bacteria 7415
130 Ga0105247_10008016 3300009101 Bacteria 6455
131 Ga0105243_10182488 3300009148 Bacteria 1826
132 Ga0105241_10030298 3300009174 Bacteria 4042
133 Ga0105241_10458896 3300009174 Bacteria 1128
134 Ga0105242_10483129 3300009176 Bacteria 1174
135 Ga0105248_10020642 3300009177 Bacteria 7300
136 Ga0105248_10070883 3300009177 Bacteria 3914
137 Ga0105248_10077726 3300009177 Bacteria 3731
138 Ga0105237_10021860 3300009545 Bacteria 6571
139 Ga0105237_10097080 3300009545 Bacteria 2937
140 Ga0105238_10013695 3300009551 Bacteria 8191
141 Ga0105238_10045913 3300009551 Bacteria 4412
142 Ga0105238_10184432 3300009551 Bacteria 2063
143 Ga0105238_10195917 3300009551 Bacteria 1996
144 Ga0105238_10244838 3300009551 Bacteria 1771
145 Ga0105239_10003468 3300010375 Bacteria 19297
146 Ga0105239_10021398 3300010375 Bacteria 7131
147 Ga0105239_10119618 3300010375 Bacteria 2924
148 Ga0105239_10547472 3300010375 Bacteria 1318
149 Ga0157322_1002390 3300012490 Bacteria 1052
150 Ga0157373_10008296 3300013100 Bacteria 7717
151 Ga0157373_10014587 3300013100 Bacteria 5760
152 Ga0157370_10000439 3300013104 Bacteria 51955
153 Ga0157370_10002253 3300013104 Bacteria 23432
154 Ga0157370_10118451 3300013104 Bacteria 2473
155 Ga0157370_10244972 3300013104 Bacteria 1658
156 Ga0157370_10600392 3300013104 Bacteria 1008
157 Ga0157369_10000410 3300013105 Bacteria 56813
158 Ga0157369_10001007 3300013105 Bacteria 35470
159 Ga0157369_10001022 3300013105 Bacteria 35263
160 Ga0157369_10060127 3300013105 Bacteria 4098
161 Ga0157369_10120622 3300013105 Bacteria 2783
162 Ga0157369_10256173 3300013105 Bacteria 1826
163 Ga0157374_10000146 3300013296 Bacteria 64549
164 Ga0157374_10192269 3300013296 Unclassified 1996
165 Ga0157378_10887720 3300013297 Bacteria 922
166 Ga0163162_10000877 3300013306 Bacteria 28017
167 Ga0163162_10325829 3300013306 Bacteria 1669
168 Ga0157372_10000323 3300013307 Bacteria 52602
169 Ga0157372_10066434 3300013307 Bacteria 4052
170 Ga0157372_10067793 3300013307 Bacteria 4011
171 Ga0157380_10723724 3300014326 Bacteria 1003
172 Ga0182008_10068800 3300014497 Bacteria 1742
173 Ga0182008_10117141 3300014497 Bacteria 1322
174 Ga0157379_10007612 3300014968 Bacteria 9378
175 Ga0157379_10152384 3300014968 Bacteria 2085
176 Ga0157376_10230952 3300014969 Bacteria 1718
177 Ga0182006_1078219 3300015261 Bacteria 1212
178 Ga0182007_10003995 3300015262 Bacteria 6804
179 Ga0182005_1015290 3300015265 Bacteria 2142
180 Ga0183361_10015 3300016635 Bacteria 166772
181 Ga0206350_11077195 3300020080 Bacteria 2097
182 Ga0206354_10237220 3300020081 Bacteria 1482
183 Ga0206354_10883746 3300020081 Bacteria 3058
184 Ga0206353_10068211 3300020082 Bacteria 1585
185 Ga0206353_10562420 3300020082 Bacteria 5535
186 Ga0213876_10131643 3300021384 Bacteria 1329
187 Ga0213871_10015669 3300021441 Bacteria 1815
188 Ga0224712_10000055 3300022467 Bacteria 17216
189 Ga0209435_102614 3300025206 Bacteria 2094
190 Ga0209566_101192 3300025225 Bacteria 9260
191 Ga0209674_100260 3300025226 Bacteria 42764
192 Ga0209674_104036 3300025226 Bacteria 2493
193 Ga0209672_100054 3300025228 Bacteria 222217
194 Ga0209672_100072 3300025228 Bacteria 167942
195 Ga0209672_100185 3300025228 Bacteria 50385
196 Ga0209147_100085 3300025229 Bacteria 185813
197 Ga0209147_100100 3300025229 Bacteria 162747
198 Ga0209147_100278 3300025229 Bacteria 44611
199 Ga0209258_100168 3300025242 Bacteria 145329
200 Ga0209258_100331 3300025242 Bacteria 71624
201 Ga0209677_100644 3300025253 Bacteria 18509
202 Ga0209148_1001174 3300025254 Bacteria 15107
203 Ga0209148_1001511 3300025254 Bacteria 11507
204 Ga0209759_1000351 3300025256 Bacteria 59891
205 Ga0209759_1000502 3300025256 Bacteria 42732
206 Ga0209759_1021861 3300025256 Bacteria 1444
207 Ga0209233_1000791 3300025261 Bacteria 14218
208 Ga0209565_1018615 3300025263 Bacteria 1499
209 Ga0209455_1000279 3300025272 Bacteria 55567
210 Ga0209455_1000760 3300025272 Bacteria 18220
211 Ga0209455_1003360 3300025272 Bacteria 5715
212 Ga0209455_1005077 3300025272 Bacteria 4156
213 Ga0209673_1000098 3300025273 Bacteria 193352
214 Ga0209564_1007078 3300025295 Bacteria 5872
215 Ga0207426_1000199 3300025302 Bacteria 145826
216 Ga0207697_10002018 3300025315 Bacteria 10745
217 Ga0207696_1019421 3300025711 Bacteria 2214
218 Ga0207713_1000186 3300025735 Bacteria 87336
219 Ga0207713_1023306 3300025735 Bacteria 2916
220 Ga0207692_10137091 3300025898 Bacteria 1388
221 Ga0207710_10012334 3300025900 Bacteria 3596
222 Ga0207710_10022648 3300025900 Bacteria 2697
223 Ga0207680_10001639 3300025903 Bacteria 10588
224 Ga0207680_10016281 3300025903 Bacteria 3900
225 Ga0207647_10000126 3300025904 Bacteria 59628
226 Ga0207647_10005134 3300025904 Bacteria 9640
227 Ga0207647_10007932 3300025904 Bacteria 7634
228 Ga0207647_10046048 3300025904 Bacteria 2718
229 Ga0207705_10058067 3300025909 Bacteria 2791
230 Ga0207654_10278119 3300025911 Bacteria 1131
231 Ga0207707_10042279 3300025912 Bacteria 3978
232 Ga0207707_10061038 3300025912 Bacteria 3280
233 Ga0207707_10433340 3300025912 Bacteria 1126
234 Ga0207695_10000971 3300025913 Bacteria 51107
235 Ga0207695_10004600 3300025913 Bacteria 18738
236 Ga0207695_10005877 3300025913 Bacteria 16101
237 Ga0207695_10177134 3300025913 Bacteria 2054
238 Ga0207695_10332538 3300025913 Bacteria 1408
239 Ga0207695_10383498 3300025913 Bacteria 1291
240 Ga0207671_10067446 3300025914 Bacteria 2664
241 Ga0207671_10108323 3300025914 Bacteria 2111
242 Ga0207671_10256833 3300025914 Bacteria 1375
243 Ga0207693_10021011 3300025915 Bacteria 5190
244 Ga0207663_10109936 3300025916 Bacteria 1869
245 Ga0207663_10265978 3300025916 Bacteria 1268
246 Ga0207657_10000096 3300025919 Bacteria 85043
247 Ga0207657_10006312 3300025919 Bacteria 12317
248 Ga0207657_10058090 3300025919 Bacteria 3331
249 Ga0207652_10034939 3300025921 Bacteria 4240
250 Ga0207681_10000010 3300025923 Bacteria 403379
251 Ga0207694_10077803 3300025924 Bacteria 2600
252 Ga0207694_10194661 3300025924 Bacteria 1648
253 Ga0207694_10342557 3300025924 Bacteria 1236
254 Ga0207650_10009672 3300025925 Bacteria 6591
255 Ga0207659_10230218 3300025926 Bacteria 1494
256 Ga0207700_10481503 3300025928 Bacteria 1097
257 Ga0207700_10692257 3300025928 Bacteria 910
258 Ga0207664_10006538 3300025929 Bacteria 8025
259 Ga0207664_10074075 3300025929 Bacteria 2750
260 Ga0207664_10316985 3300025929 Bacteria 1375
261 Ga0207644_10000007 3300025931 Bacteria 381778
262 Ga0207644_10148919 3300025931 Bacteria 1810
263 Ga0207690_10000074 3300025932 Bacteria 87516
264 Ga0207690_10060622 3300025932 Bacteria 2569
265 Ga0207709_10067808 3300025935 Bacteria 2253
266 Ga0207669_10121095 3300025937 Bacteria 1776
267 Ga0207711_10014166 3300025941 Bacteria 6624
268 Ga0207711_10157661 3300025941 Bacteria 2052
269 Ga0207667_10018190 3300025949 Bacteria 7888
270 Ga0207667_10038744 3300025949 Bacteria 5085
271 Ga0207667_10070621 3300025949 Bacteria 3634
272 Ga0207667_10154251 3300025949 Bacteria 2363
273 Ga0207667_10273513 3300025949 Bacteria 1726
274 Ga0207667_10460213 3300025949 Bacteria 1292
275 Ga0207712_10385909 3300025961 Bacteria 1174
276 Ga0207668_10003062 3300025972 Bacteria 9802
277 Ga0207640_10086724 3300025981 Bacteria 2156
278 Ga0207640_10342737 3300025981 Bacteria 1198
279 Ga0207658_10001394 3300025986 Bacteria 18834
280 Ga0207658_10133928 3300025986 Bacteria 1995
281 Ga0207703_10003496 3300026035 Bacteria 13142
282 Ga0207703_10339664 3300026035 Bacteria 1380
283 Ga0207639_10429963 3300026041 Bacteria 1195
284 Ga0207678_10000061 3300026067 Bacteria 85413
285 Ga0207678_10113488 3300026067 Bacteria 2312
286 Ga0207678_10290489 3300026067 Bacteria 1404
287 Ga0207678_10325757 3300026067 Bacteria 1322
288 Ga0207702_10035282 3300026078 Bacteria 4182
289 Ga0207641_10024523 3300026088 Bacteria 4971
290 Ga0207648_10120659 3300026089 Bacteria 2305
291 Ga0207648_10204744 3300026089 Unclassified 1751
292 Ga0207676_10000953 3300026095 Bacteria 22371
293 Ga0207674_10413453 3300026116 Bacteria 1303
294 Ga0207674_10622728 3300026116 Bacteria 1042
295 Ga0207675_100000329 3300026118 Bacteria 45296
296 Ga0207683_10473685 3300026121 Bacteria 1155
297 Ga0207698_10010491 3300026142 Bacteria 5959
298 Ga0209371_1000141 3300027312 Bacteria 118767
299 Ga0209371_1001782 3300027312 Bacteria 13499
300 Ga0207428_10091617 3300027907 Bacteria 2360
301 Ga0268266_10109492 3300028379 Bacteria 2446
302 Ga0268265_10000058 3300028380 Bacteria 154702
303 Ga0268265_10659145 3300028380 Bacteria 1007
304 Ga0268264_10000048 3300028381 Bacteria 334457
305 Ga0268264_10000106 3300028381 Bacteria 210031
306 Ga0268264_10461769 3300028381 Bacteria 1232
307 Ga0265334_10000033 3300028573 Bacteria 106132
308 Ga0265334_10005691 3300028573 Bacteria 5440
309 Ga0265318_10047837 3300028577 Bacteria 1612
310 Ga0265323_10025771 3300028653 Bacteria 2221
311 Ga0265336_10003085 3300028666 Bacteria 6636
312 Ga0307515_10000103 3300028794 Bacteria 198308
313 Ga0265338_10000328 3300028800 Bacteria 86546
314 Ga0265338_10001296 3300028800 Bacteria 41001
315 Ga0265338_10003732 3300028800 Bacteria 21182
316 Ga0265324_10011635 3300029957 Bacteria 3350
317 Ga0268256_1000418 3300030500 Bacteria 38424
318 Ga0268256_1007322 3300030500 Bacteria 3956
319 Ga0265330_10006525 3300031235 Bacteria 5768
320 Ga0265330_10028702 3300031235 Bacteria 2506
321 Ga0265330_10037338 3300031235 Bacteria 2163
322 Ga0265332_10049842 3300031238 Bacteria 1800
323 Ga0265325_10000290 3300031241 Bacteria 35188
324 Ga0265325_10026252 3300031241 Bacteria 3157
325 Ga0265325_10046724 3300031241 Bacteria 2244
326 Ga0265340_10006819 3300031247 Bacteria 6248
327 Ga0265339_10004298 3300031249 Bacteria 9743
328 Ga0265339_10065229 3300031249 Bacteria 1953
329 Ga0265339_10097479 3300031249 Bacteria 1534
330 Ga0265331_10012529 3300031250 Bacteria 4588
331 Ga0265331_10062262 3300031250 Bacteria 1760
332 Ga0265331_10070234 3300031250 Bacteria 1640
333 Ga0265331_10143931 3300031250 Bacteria 1083
334 Ga0265316_10043368 3300031344 Bacteria 3586
335 Ga0307513_10002845 3300031456 Bacteria 23699
336 Ga0307513_10182885 3300031456 Bacteria 1957
337 Ga0307509_10022838 3300031507 Bacteria 7038
338 Ga0307509_10158527 3300031507 Bacteria 2165
339 Ga0307509_10161044 3300031507 Bacteria 2141
340 Ga0307408_100000422 3300031548 Bacteria 38013
341 Ga0265313_10033376 3300031595 Bacteria 2616
342 Ga0307508_10000249 3300031616 Bacteria 65482
343 Ga0307508_10296125 3300031616 Bacteria 1211
344 Ga0265314_10001283 3300031711 Bacteria 28552
345 Ga0265314_10035129 3300031711 Bacteria 3655
346 Ga0265314_10068772 3300031711 Bacteria 2380
347 Ga0307412_10000056 3300031911 Bacteria 145861
348 Ga0307412_10124282 3300031911 Bacteria 1863
349 Ga0307409_100024795 3300031995 Bacteria 4192
350 Ga0307416_100240652 3300032002 Bacteria 1753
351 Ga0307411_10095442 3300032005 Bacteria 2088
352 Ga0316583_10000941 3300032133 Bacteria 9361
353 Ga0373948_0019631 3300034817 Bacteria 1280
354 Ga0373934_0002476 3300035086 Bacteria 6800
355 Ga0373923_0000171 3300035111 Bacteria 12894
356 Ga0373936_0089331 3300035113 Bacteria 1290
357 Ga0373953_0010573 3300035117 Bacteria 3217
358 Ga0373954_0000518 3300035118 Bacteria 14465
359 Ga0373957_0000722 3300035120 Bacteria 8569
360 Ga0373957_0028764 3300035120 Bacteria 2027
361 Ga0373955_0003463 3300035172 Bacteria 6934
362 Ga0373955_0043872 3300035172 Bacteria 2406
363 Ga0316574_0158678 3300035398 Bacteria 1457
364 Ga0373924_0002025 3300035410 Bacteria 6754
365 Ga0373924_0029313 3300035410 Bacteria 2199
366 Ga0373931_0045141 3300035691 Bacteria 2326
367 Ga0373927_0000002 3300035695 Bacteria 966219
368 Ga0373927_0014461 3300035695 Bacteria 5223
369 Ga0373933_0000274 3300035724 Bacteria 33544
370 Ga0373933_0003540 3300035724 Bacteria 8686
371 Ga0373933_0093813 3300035724 Bacteria 1855
372 Ga0373933_0125499 3300035724 Bacteria 1610
373 Ga0373933_0277349 3300035724 Bacteria 1083
374 Ga0373947_0128176 3300035725 Bacteria 1618
375 Ga0373937_0005546 3300036401 Bacteria 10823
376 Ga0373937_0038202 3300036401 Bacteria 4375
377 Ga0373925_0081160 3300037068 Bacteria 2466
378 Ga0395899_0000080 3300037312 Bacteria 171568
379 Ga0395899_0107386 3300037312 Bacteria 2009
380 Ga0395900_0000058 3300037418 Bacteria 206785
381 Ga0395900_0000087 3300037418 Bacteria 171568
382 Ga0395900_0000411 3300037418 Bacteria 61659
383 Ga0395900_0042730 3300037418 Bacteria 4670
384 Ga0395900_0066243 3300037418 Bacteria 3712
385 Ga0395900_0097596 3300037418 Bacteria 3019
386 Ga0395900_0161091 3300037418 Bacteria 2288
387 Ga0395900_0594919 3300037418 Bacteria 1047
388 Ga0395898_0000283 3300037466 Bacteria 122630
389 Ga0395898_0000559 3300037466 Bacteria 69751
390 Ga0395898_0000679 3300037466 Bacteria 61481
391 Ga0395898_0009374 3300037466 Bacteria 10283
392 Ga0395898_0053488 3300037466 Bacteria 3944
393 Ga0395898_0159522 3300037466 Bacteria 2157
394 Ga0395898_0474067 3300037466 Bacteria 1191
395 Ga0395905_0067442 3300037471 Bacteria 3351
396 Ga0395905_0070884 3300037471 Bacteria 3267
397 Ga0395905_0183778 3300037471 Bacteria 1963
398 Ga0436364_1182640 3300037853 Bacteria 1516
399 Ga0395901_0000328 3300038443 Bacteria 58470
400 Ga0395901_0001663 3300038443 Bacteria 22943
401 Ga0395901_0141800 3300038443 Bacteria 2525
402 Ga0436365_0174471 3300039437 Bacteria 3704
403 Ga0436365_0371724 3300039437 Bacteria 5113
404 Ga0436365_1636570 3300039437 Bacteria 2205
405 Ga0436360_0564642 3300039438 Bacteria 10245
406 Ga0436360_1339610 3300039438 Bacteria 1043
407 Ga0436361_0870638 3300039447 Bacteria 3408
408 Ga0436361_1134714 3300039447 Bacteria 2853
409 Ga0436361_1185506 3300039447 Bacteria 1703
410 Ga0436362_0922352 3300039453 Bacteria 7873
411 Ga0439445_0005202 3300042004 Bacteria 2959
412 Ga0439448_0000429 3300042005 Bacteria 9645
413 Ga0451577_0367131 3300042876 Bacteria 1306
414 Ga0451577_0711638 3300042876 Bacteria 909
415 Ga0466969_0000833 3300044656 Bacteria 16765
416 Ga0466969_0214799 3300044656 Bacteria 875
417 Ga0466973_0070919 3300044659 Bacteria 3102
418 Ga0466966_0000058 3300044684 Bacteria 81196
419 Ga0466966_0003945 3300044684 Bacteria 9801
420 Ga0466966_0031126 3300044684 Bacteria 3461
421 Ga0466966_0194802 3300044684 Bacteria 1227
422 Ga0466961_0000204 3300044693 Bacteria 39748
423 Ga0466961_0000224 3300044693 Bacteria 38254
424 Ga0466961_0132237 3300044693 Bacteria 1563
425 Ga0466961_0177919 3300044693 Bacteria 1321
426 Ga0466963_0003869 3300044694 Bacteria 8642
427 Ga0466963_0036883 3300044694 Bacteria 3190
428 Ga0466964_0204704 3300044706 Bacteria 949
429 Ga0453684_0518630 3300044712 Bacteria 1317
430 Ga0453684_0595088 3300044712 Bacteria 1213
431 Ga0466971_0001186 3300044719 Bacteria 10818
432 Ga0466971_0074685 3300044719 Bacteria 1541
433 Ga0466968_0028681 3300044735 Bacteria 2297
434 Ga0466968_0030208 3300044735 Bacteria 2244
435 Ga0466970_0001740 3300044765 Bacteria 10497
436 Ga0466970_0015169 3300044765 Bacteria 3962
437 Ga0466970_0030302 3300044765 Bacteria 2852
438 Ga0466957_0000621 3300044842 Bacteria 17927
439 Ga0466957_0002537 3300044842 Bacteria 9824
440 Ga0466957_0305047 3300044842 Bacteria 1071
441 Ga0466959_0005343 3300045049 Bacteria 8786
442 Ga0466959_0062688 3300045049 Bacteria 2701
443 Ga0466959_0095700 3300045049 Bacteria 2129
444 Ga0466959_0118491 3300045049 Bacteria 1884
445 Ga0466959_0286590 3300045049 Bacteria 1129
446 Ga0451576_0000246 3300045051 Bacteria 132778
447 Ga0451576_0103717 3300045051 Bacteria 2958
448 Ga0466958_0005251 3300045836 Bacteria 6942
449 Ga0466967_0408380 3300045976 Bacteria 1322
450 Ga0495627_002847 3300046453 Bacteria 7993
451 Ga0495627_071272 3300046453 Bacteria 1015
452 Ga0495592_0006004 3300046454 Bacteria 9028
453 Ga0495592_0150394 3300046454 Bacteria 1610
454 Ga0495603_0037122 3300046455 Bacteria 2923
455 Ga0495603_0061077 3300046455 Bacteria 2226
456 Ga0495603_0063725 3300046455 Bacteria 2174
457 Ga0495603_0076487 3300046455 Bacteria 1964
458 Ga0495590_0001575 3300046457 Bacteria 9773
459 Ga0495590_0003243 3300046457 Bacteria 6651
460 Ga0495590_0009707 3300046457 Bacteria 3648
461 Ga0495629_0000309 3300046459 Bacteria 41866
462 Ga0495629_0000625 3300046459 Bacteria 28762
463 Ga0495629_0001021 3300046459 Bacteria 22468
464 Ga0495629_0002634 3300046459 Bacteria 13750
465 Ga0495629_0003835 3300046459 Bacteria 11343
466 Ga0495629_0081801 3300046459 Bacteria 2254
467 Ga0495638_0000517 3300046460 Bacteria 45154
468 Ga0495638_0000875 3300046460 Bacteria 31213
469 Ga0495638_0001208 3300046460 Bacteria 24646
470 Ga0495638_0014896 3300046460 Bacteria 5238
471 Ga0495638_0026681 3300046460 Bacteria 3743
472 Ga0495641_0053756 3300046461 Bacteria 1831
473 Ga0495641_0111852 3300046461 Bacteria 1218
474 Ga0495651_0002383 3300046462 Bacteria 14520
475 Ga0495651_0010274 3300046462 Bacteria 7189
476 Ga0495651_0043092 3300046462 Bacteria 3502
477 Ga0495651_0087012 3300046462 Bacteria 2350
478 Ga0495651_0102367 3300046462 Bacteria 2130
479 Ga0495651_0327166 3300046462 Bacteria 1020
480 Ga0495653_0003619 3300046463 Bacteria 12470
481 Ga0495653_0003799 3300046463 Bacteria 12219
482 Ga0495653_0047038 3300046463 Bacteria 3338
483 Ga0495653_0072119 3300046463 Bacteria 2579
484 Ga0495653_0155902 3300046463 Bacteria 1590
485 Ga0495653_0183391 3300046463 Bacteria 1434
486 Ga0495650_0000007 3300046471 Bacteria 718072
487 Ga0495650_0001711 3300046471 Bacteria 20137
488 Ga0495650_0010003 3300046471 Bacteria 5337
489 Ga0495650_0038166 3300046471 Bacteria 2083
490 Ga0495650_0039764 3300046471 Bacteria 2026
491 Ga0495650_0072034 3300046471 Bacteria 1353
492 Ga0495580_0000302 3300046472 Bacteria 40112
493 Ga0495580_0001573 3300046472 Bacteria 20072
494 Ga0495580_0009825 3300046472 Bacteria 7503
495 Ga0495580_0014037 3300046472 Bacteria 6092
496 Ga0495580_0016553 3300046472 Bacteria 5531
497 Ga0495580_0027489 3300046472 Bacteria 4139
498 Ga0495580_0112366 3300046472 Bacteria 1892
499 Ga0495582_0005015 3300046473 Bacteria 7419
500 Ga0495582_0065691 3300046473 Bacteria 2004
501 Ga0495605_0002667 3300046474 Bacteria 10920
502 Ga0495605_0009236 3300046474 Bacteria 5540
503 Ga0495605_0010282 3300046474 Bacteria 5240
504 Ga0495605_0028952 3300046474 Bacteria 2855
505 Ga0495639_0134711 3300046475 Bacteria 1184
506 Ga0495662_0004987 3300046476 Bacteria 6649
507 Ga0495662_0022988 3300046476 Bacteria 3010
508 Ga0495662_0061546 3300046476 Bacteria 1814
509 Ga0495662_0064588 3300046476 Bacteria 1769
510 Ga0495664_0001157 3300046477 Bacteria 13713
511 Ga0495664_0012877 3300046477 Bacteria 4739
512 Ga0495585_0046538 3300046492 Bacteria 2419
513 Ga0495594_0027143 3300046499 Bacteria 3084
514 Ga0495596_0001981 3300046500 Bacteria 11294
515 Ga0495596_0051859 3300046500 Bacteria 1606
516 Ga0495596_0177340 3300046500 Bacteria 828
517 Ga0495607_0058749 3300046501 Bacteria 2197
518 Ga0495607_0154216 3300046501 Bacteria 1173
519 Ga0495583_0000209 3300046506 Bacteria 98671
520 Ga0495583_0004759 3300046506 Bacteria 9536
521 Ga0495606_0019943 3300046507 Bacteria 4963
522 Ga0495606_0035281 3300046507 Bacteria 3421
523 Ga0495606_0067238 3300046507 Bacteria 2270
524 Ga0495606_0197918 3300046507 Bacteria 1147
525 Ga0495608_0000721 3300046511 Bacteria 23015
526 Ga0495608_0002463 3300046511 Bacteria 13294
527 Ga0495608_0013647 3300046511 Bacteria 5636
528 Ga0495608_0136355 3300046511 Bacteria 1568
529 Ga0495610_0000127 3300046512 Bacteria 84143
530 Ga0495610_0000195 3300046512 Bacteria 67472
531 Ga0495610_0001399 3300046512 Bacteria 21428
532 Ga0495616_0001431 3300046513 Bacteria 16614
533 Ga0495616_0042489 3300046513 Bacteria 2314
534 Ga0495618_0005667 3300046514 Bacteria 7591
535 Ga0495618_0011010 3300046514 Bacteria 5481
536 Ga0495618_0097707 3300046514 Bacteria 1879
537 Ga0495628_0019540 3300046516 Bacteria 5598
538 Ga0495628_0022733 3300046516 Bacteria 5149
539 Ga0495628_0061401 3300046516 Bacteria 2947
540 Ga0495628_0121769 3300046516 Bacteria 2000
541 Ga0495628_0223216 3300046516 Bacteria 1414
542 Ga0495630_0000005 3300046517 Bacteria 406219
543 Ga0495630_0084812 3300046517 Bacteria 2391
544 Ga0495630_0120180 3300046517 Bacteria 1993
545 Ga0495630_0192089 3300046517 Bacteria 1557
546 Ga0495630_0409124 3300046517 Bacteria 1039
547 Ga0495631_0002603 3300046518 Bacteria 10084
548 Ga0495637_0004227 3300046520 Bacteria 7459
549 Ga0495637_0007583 3300046520 Bacteria 5368
550 Ga0495637_0012422 3300046520 Bacteria 4072
551 Ga0495643_0006927 3300046522 Bacteria 7374
552 Ga0495643_0023390 3300046522 Bacteria 3514
553 Ga0495643_0169892 3300046522 Bacteria 1067
554 Ga0495648_0002225 3300046524 Bacteria 18134
555 Ga0495648_0012803 3300046524 Bacteria 6228
556 Ga0495648_0017826 3300046524 Bacteria 5060
557 Ga0495648_0040724 3300046524 Bacteria 2942
558 Ga0495648_0071733 3300046524 Bacteria 2006
559 Ga0495648_0107219 3300046524 Bacteria 1527
560 Ga0495648_0112160 3300046524 Bacteria 1482
561 Ga0495663_0008082 3300046525 Bacteria 2911
562 Ga0495666_0001199 3300046526 Bacteria 12516
563 Ga0495666_0006920 3300046526 Bacteria 5695
564 Ga0495666_0013815 3300046526 Bacteria 4026
565 Ga0495666_0016418 3300046526 Bacteria 3686
566 Ga0495666_0043695 3300046526 Bacteria 2164
567 Ga0495666_0083087 3300046526 Bacteria 1514
568 Ga0495652_0010784 3300046529 Bacteria 8283
569 Ga0495652_0013894 3300046529 Bacteria 7241
570 Ga0495652_0098010 3300046529 Bacteria 2383
571 Ga0495652_0122887 3300046529 Bacteria 2067
572 Ga0495652_0156120 3300046529 Bacteria 1777
573 Ga0495652_0194512 3300046529 Bacteria 1545
574 Ga0495654_0000262 3300046530 Bacteria 47780
575 Ga0495654_0040990 3300046530 Bacteria 2305
576 Ga0495654_0064725 3300046530 Bacteria 1747
577 Ga0495654_0119728 3300046530 Bacteria 1193
578 Ga0495665_0007143 3300046531 Bacteria 6029
579 Ga0495665_0017791 3300046531 Bacteria 3820
580 Ga0495665_0019537 3300046531 Bacteria 3643
581 Ga0495665_0043147 3300046531 Bacteria 2398
582 Ga0495665_0095573 3300046531 Bacteria 1560
583 Ga0495640_0005747 3300046533 Bacteria 9856
584 Ga0495640_0016145 3300046533 Bacteria 5592
585 Ga0495640_0022717 3300046533 Bacteria 4580
586 Ga0495640_0134679 3300046533 Bacteria 1596
587 Ga0495586_0000830 3300046535 Bacteria 17768
588 Ga0495586_0020449 3300046535 Bacteria 3525
589 Ga0495587_0003407 3300046536 Bacteria 10605
590 Ga0495587_0037840 3300046536 Bacteria 2894
591 Ga0495587_0042110 3300046536 Bacteria 2724
592 Ga0495587_0084174 3300046536 Bacteria 1842
593 Ga0495597_0011826 3300046542 Bacteria 4225
594 Ga0495645_0001202 3300046543 Bacteria 17703
595 Ga0495645_0001234 3300046543 Bacteria 17452
596 Ga0495645_0017810 3300046543 Bacteria 5095
597 Ga0495645_0034844 3300046543 Bacteria 3670
598 Ga0495645_0109585 3300046543 Bacteria 1955
599 Ga0495622_0000416 3300046557 Bacteria 28234
600 Ga0495622_0066630 3300046557 Bacteria 1664
601 Ga0495622_0070803 3300046557 Bacteria 1609
602 Ga0495622_0119980 3300046557 Bacteria 1201
603 Ga0495633_0000486 3300046558 Bacteria 40273
604 Ga0495667_0000319 3300046559 Bacteria 30374
605 Ga0495667_0063791 3300046559 Bacteria 2411
606 Ga0495667_0082886 3300046559 Bacteria 2083
607 Ga0495668_0002183 3300046616 Bacteria 16740
608 Ga0495668_0081593 3300046616 Bacteria 1774
609 Ga0495634_0002073 3300046642 Bacteria 16965
610 Ga0495634_0014012 3300046642 Bacteria 5789
611 Ga0495634_0021151 3300046642 Bacteria 4603
612 Ga0495634_0046559 3300046642 Bacteria 2926
613 Ga0495611_0041064 3300046648 Bacteria 2063
614 Ga0495611_0054433 3300046648 Bacteria 1809
615 Ga0495611_0142766 3300046648 Bacteria 1118
616 Ga0495625_0041628 3300046660 Bacteria 3342
617 Ga0495625_0068433 3300046660 Bacteria 2496
618 Ga0495635_0000180 3300046663 Bacteria 40008
619 Ga0495635_0000986 3300046663 Bacteria 18758
620 Ga0495635_0004865 3300046663 Bacteria 9346
621 Ga0495635_0045947 3300046663 Bacteria 3012
622 Ga0495661_0001100 3300046665 Bacteria 23680
623 Ga0495661_0009353 3300046665 Bacteria 6727
624 Ga0495661_0027764 3300046665 Bacteria 3630
625 Ga0495588_0028684 3300046674 Bacteria 2788
626 Ga0495657_0006534 3300046675 Bacteria 9117
627 Ga0495657_0052534 3300046675 Bacteria 2731
628 Ga0495657_0228912 3300046675 Bacteria 1125
629 Ga0495599_0000885 3300046678 Bacteria 16722
630 Ga0495599_0009795 3300046678 Bacteria 5865
631 Ga0495599_0017908 3300046678 Bacteria 4411
632 Ga0495599_0123309 3300046678 Bacteria 1611
633 Ga0495623_0002524 3300046679 Bacteria 12120
634 Ga0495623_0007636 3300046679 Bacteria 7025
635 Ga0495623_0023038 3300046679 Bacteria 4020
636 Ga0495623_0054728 3300046679 Bacteria 2517
637 Ga0495623_0057306 3300046679 Bacteria 2451
638 Ga0495623_0140124 3300046679 Bacteria 1440
639 Ga0495646_0002312 3300046680 Bacteria 11665
640 Ga0495646_0003646 3300046680 Bacteria 9606
641 Ga0495646_0005817 3300046680 Bacteria 7820
642 Ga0495646_0012263 3300046680 Bacteria 5450
643 Ga0495646_0026685 3300046680 Bacteria 3626
644 Ga0495646_0187937 3300046680 Bacteria 1130
645 Ga0495647_0024093 3300046681 Unclassified 2213
646 Ga0495647_0051090 3300046681 Bacteria 1606
647 Ga0495658_0287112 3300046683 Bacteria 1039
648 Ga0495669_0029409 3300046684 Bacteria 2409
649 Ga0495669_0062496 3300046684 Bacteria 1687
650 Ga0495613_0000699 3300046689 Bacteria 26439
651 Ga0495613_0001221 3300046689 Bacteria 19632
652 Ga0495613_0026003 3300046689 Bacteria 4361
653 Ga0495613_0412259 3300046689 Bacteria 920
654 Ga0495624_0028174 3300046690 Bacteria 3672
655 Ga0495624_0031854 3300046690 Bacteria 3423
656 Ga0495624_0036841 3300046690 Bacteria 3150
657 Ga0495624_0052917 3300046690 Bacteria 2564
658 Ga0495624_0074205 3300046690 Bacteria 2114
659 Ga0495624_0082759 3300046690 Bacteria 1985
660 Ga0495624_0264272 3300046690 Bacteria 1039
661 Ga0495670_0000160 3300046691 Bacteria 29343
662 Ga0495670_0061459 3300046691 Bacteria 1889
663 Ga0495671_0002938 3300046692 Bacteria 10608
664 Ga0495671_0005670 3300046692 Bacteria 7282
665 Ga0495671_0016873 3300046692 Bacteria 3892
666 Ga0495671_0074841 3300046692 Bacteria 1661
667 Ga0495649_0022385 3300046694 Bacteria 3536
668 Ga0495649_0050840 3300046694 Bacteria 2248
669 Ga0495589_0000838 3300046794 Bacteria 19307
670 Ga0495589_0001288 3300046794 Bacteria 14823
671 Ga0495589_0003149 3300046794 Bacteria 9026
672 Ga0495589_0043248 3300046794 Bacteria 2243
673 Ga0495600_0003931 3300046809 Bacteria 8829
674 Ga0495600_0005333 3300046809 Bacteria 7748
675 Ga0495600_0008525 3300046809 Bacteria 6303
676 Ga0495600_0085655 3300046809 Bacteria 2056
677 Ga0495660_0029848 3300046810 Bacteria 3075
678 Ga0495660_0096562 3300046810 Bacteria 1527
679 Ga0495660_0100688 3300046810 Bacteria 1488
680 Ga0495581_0000663 3300047315 Bacteria 18068
681 Ga0495581_0006131 3300047315 Bacteria 6969
682 Ga0495581_0016518 3300047315 Bacteria 4289
683 Ga0495604_0004307 3300047317 Bacteria 11263
684 Ga0495604_0018287 3300047317 Bacteria 5613
685 Ga0495604_0037638 3300047317 Bacteria 3809
686 Ga0495604_0055582 3300047317 Bacteria 3050
687 Ga0495604_0079211 3300047317 Bacteria 2464
688 Ga0495674_0020526 3300047319 Bacteria 6114
689 Ga0495674_0024016 3300047319 Bacteria 5609
690 Ga0495674_0027200 3300047319 Bacteria 5227
691 Ga0495674_0060517 3300047319 Bacteria 3304
692 Ga0495674_0063290 3300047319 Bacteria 3218
693 Ga0495674_0070202 3300047319 Bacteria 3027
694 Ga0495674_0093373 3300047319 Bacteria 2567
695 Ga0495674_0146060 3300047319 Bacteria 1985
696 Ga0495674_0198659 3300047319 Bacteria 1664
697 Ga0495672_0001435 3300047320 Bacteria 23387
698 Ga0495672_0131500 3300047320 Bacteria 1316
699 Ga0495676_0046877 3300047321 Bacteria 3502
700 Ga0495676_0066032 3300047321 Bacteria 2806
701 Ga0495676_0085241 3300047321 Bacteria 2380
702 Ga0495676_0181988 3300047321 Bacteria 1472
703 Ga0495680_0003458 3300047322 Bacteria 15547
704 Ga0495680_0012704 3300047322 Bacteria 7392
705 Ga0495680_0015798 3300047322 Bacteria 6498
706 Ga0495680_0023379 3300047322 Bacteria 5140
707 Ga0495680_0069916 3300047322 Bacteria 2677
708 Ga0495680_0124547 3300047322 Bacteria 1900
709 Ga0495683_0002777 3300047323 Bacteria 10424
710 Ga0495683_0007542 3300047323 Bacteria 5869
711 Ga0495683_0012486 3300047323 Bacteria 4457
712 Ga0495683_0014509 3300047323 Bacteria 4106
713 Ga0495683_0016995 3300047323 Bacteria 3773
714 Ga0495683_0071782 3300047323 Bacteria 1698
715 Ga0495683_0096904 3300047323 Bacteria 1422
716 Ga0495683_0138861 3300047323 Bacteria 1140
717 Ga0495683_0214739 3300047323 Bacteria 861
718 Ga0495687_000419 3300047443 Bacteria 52487
719 Ga0495687_006987 3300047443 Bacteria 6777
720 Ga0495687_032079 3300047443 Bacteria 2403
721 Ga0495687_059797 3300047443 Bacteria 1574
722 Ga0495687_127075 3300047443 Bacteria 909
723 Ga0495675_0001691 3300047444 Bacteria 13223
724 Ga0495675_0002275 3300047444 Bacteria 11467
725 Ga0495675_0006134 3300047444 Bacteria 7360
726 Ga0495675_0016472 3300047444 Bacteria 4675
727 Ga0495675_0167805 3300047444 Bacteria 1349
728 Ga0495679_000271 3300047446 Bacteria 43383
729 Ga0495679_007135 3300047446 Bacteria 4702
730 Ga0495679_009458 3300047446 Bacteria 3901
731 Ga0495685_061841 3300047447 Bacteria 1261
732 Ga0495673_0000743 3300047469 Bacteria 31064
733 Ga0495673_0001213 3300047469 Bacteria 21466
734 Ga0495673_0001789 3300047469 Bacteria 16305
735 Ga0495673_0015862 3300047469 Bacteria 3868
736 Ga0495673_0056281 3300047469 Bacteria 1702
737 Ga0495681_0000155 3300047470 Bacteria 57469
738 Ga0495684_0000023 3300047471 Bacteria 133626
739 Ga0495684_0031282 3300047471 Bacteria 4086
740 Ga0495684_0139743 3300047471 Bacteria 1816
741 Ga0495686_0000233 3300047472 Bacteria 101644
742 Ga0495686_0000518 3300047472 Bacteria 55768
743 Ga0495686_0000540 3300047472 Bacteria 54110
744 Ga0495686_0006648 3300047472 Bacteria 8809
745 Ga0495686_0030290 3300047472 Bacteria 3515
746 Ga0495593_0000221 3300047673 Bacteria 30321
747 Ga0495593_0009056 3300047673 Bacteria 5775
748 Ga0495593_0010249 3300047673 Bacteria 5419
749 Ga0495593_0015012 3300047673 Bacteria 4398
750 Ga0495593_0057770 3300047673 Bacteria 2036
751 Ga0495593_0077371 3300047673 Bacteria 1723
752 Ga0495602_0005453 3300048088 Bacteria 13340
753 Ga0495602_0013760 3300048088 Bacteria 8250
754 Ga0495602_0036088 3300048088 Bacteria 4604
755 Ga0495602_0067720 3300048088 Bacteria 3069
756 Ga0495602_0096917 3300048088 Bacteria 2431
757 Ga0495602_0107756 3300048088 Bacteria 2270
758 Ga0495602_0135232 3300048088 Bacteria 1959
759 Ga0495602_0233404 3300048088 Bacteria 1380
760 Ga0495602_0493724 3300048088 Bacteria 857
761 Ga0495614_0000451 3300048089 Bacteria 16848
762 Ga0495614_0019573 3300048089 Bacteria 2929
763 Ga0495626_0017385 3300048091 Bacteria 3632
764 Ga0495626_0060458 3300048091 Bacteria 1726
765 Ga0496100_0016120 3300048903 Bacteria 4380
766 Ga0496100_0024752 3300048903 Bacteria 3665
767 Ga0496100_0111857 3300048903 Bacteria 1898
768 Ga0496101_0012888 3300048904 Bacteria 5592
769 Ga0496101_0056916 3300048904 Bacteria 2826
770 Ga0496101_0107050 3300048904 Bacteria 2100
771 Ga0496101_0186228 3300048904 Bacteria 1600
772 Ga0496101_0359572 3300048904 Bacteria 1144
773 Ga0496102_0008993 3300048905 Bacteria 8571
774 Ga0496102_0055366 3300048905 Bacteria 3617
775 Ga0496102_0793079 3300048905 Bacteria 870
776 Ga0496103_0002058 3300048906 Bacteria 12871
777 Ga0496103_0004787 3300048906 Bacteria 8181
778 Ga0496103_0134127 3300048906 Bacteria 1582
779 Ga0496104_0000055 3300048907 Bacteria 124267
780 Ga0496104_0090976 3300048907 Bacteria 2916
781 Ga0496104_0124176 3300048907 Bacteria 2478
782 Ga0496104_0216510 3300048907 Bacteria 1827
783 Ga0496104_0543270 3300048907 Bacteria 1073
784 Ga0496105_0062824 3300048908 Bacteria 3064
785 Ga0496105_0123359 3300048908 Bacteria 2135
786 Ga0496105_0130301 3300048908 Bacteria 2074
787 Ga0496105_0150056 3300048908 Bacteria 1916
788 Ga0496105_0334484 3300048908 Bacteria 1212
789 Ga0496106_0002838 3300048909 Bacteria 12857
790 Ga0496106_0004759 3300048909 Bacteria 10033
791 Ga0496107_0027843 3300048910 Bacteria 4015
792 Ga0496107_0339683 3300048910 Bacteria 1117
793 Ga0496109_0141124 3300048912 Bacteria 2252
794 Ga0496109_0393014 3300048912 Bacteria 1310
795 Ga0496111_0008723 3300048914 Bacteria 6728
796 Ga0496113_0023434 3300048916 Bacteria 4377
797 Ga0496114_0026363 3300048917 Bacteria 4757
798 Ga0496114_0237392 3300048917 Bacteria 1602
799 Ga0496115_0033943 3300048918 Bacteria 4032
800 Ga0496115_0200891 3300048918 Bacteria 1647
801 Ga0496116_0070588 3300048919 Bacteria 2216
802 Ga0496116_0087016 3300048919 Bacteria 1914
803 Ga0496116_0098192 3300048919 Bacteria 1758
804 Ga0496116_0133908 3300048919 Bacteria 1407
805 Ga0496116_0143858 3300048919 Bacteria 1336
806 Ga0496117_0005798 3300048920 Bacteria 12808
807 Ga0496117_0011530 3300048920 Bacteria 7910
808 Ga0496117_0019287 3300048920 Bacteria 5609
809 Ga0496117_0022924 3300048920 Bacteria 4996
810 Ga0496117_0061518 3300048920 Bacteria 2580
811 Ga0496117_0085023 3300048920 Bacteria 2061
812 Ga0496118_0002114 3300048921 Bacteria 27831
813 Ga0496118_0002552 3300048921 Bacteria 24370
814 Ga0496118_0012795 3300048921 Bacteria 8008
815 Ga0496118_0022621 3300048921 Bacteria 5487
816 Ga0496118_0098992 3300048921 Bacteria 1978
817 Ga0496118_0104571 3300048921 Bacteria 1900
818 Ga0496118_0107393 3300048921 Bacteria 1864
819 Ga0496118_0122723 3300048921 Bacteria 1689
820 Ga0496118_0139404 3300048921 Bacteria 1541
821 Ga0496118_0159568 3300048921 Bacteria 1397
822 Ga0496119_0086537 3300048922 Bacteria 1791
823 Ga0496119_0193487 3300048922 Bacteria 1058
824 Ga0496121_0000757 3300048924 Bacteria 59348
825 Ga0496121_0002288 3300048924 Bacteria 29774
826 Ga0496121_0006568 3300048924 Bacteria 14361
827 Ga0496121_0011728 3300048924 Bacteria 9671
828 Ga0496121_0037278 3300048924 Bacteria 4321
829 Ga0496121_0049486 3300048924 Bacteria 3563
830 Ga0496121_0049639 3300048924 Bacteria 3555
831 Ga0496121_0059437 3300048924 Bacteria 3152
832 Ga0496121_0130767 3300048924 Bacteria 1879
833 Ga0496122_0065255 3300048925 Bacteria 2641
834 Ga0496122_0108735 3300048925 Bacteria 1828
835 Ga0496124_0003589 3300048927 Bacteria 18856
836 Ga0496124_0099710 3300048927 Bacteria 2355
837 Ga0496124_0136301 3300048927 Bacteria 1943
838 Ga0496124_0373346 3300048927 Bacteria 1000
839 Ga0496125_0095734 3300048928 Bacteria 2207
840 Ga0496125_0146896 3300048928 Bacteria 1628
841 Ga0496126_0000538 3300048929 Bacteria 73271
842 Ga0496126_0002311 3300048929 Bacteria 26148
843 Ga0496126_0008981 3300048929 Bacteria 10696
844 Ga0496126_0020776 3300048929 Bacteria 6427
845 Ga0496126_0064964 3300048929 Bacteria 3267
846 Ga0496126_0084304 3300048929 Bacteria 2803
847 Ga0495678_000801 3300049459 Bacteria 28160
848 Ga0495678_054660 3300049459 Bacteria 1528
849 Ga0495678_059696 3300049459 Bacteria 1437
850 Ga0495682_0051384 3300049460 Bacteria 1499
851 Ga0495682_0100826 3300049460 Bacteria 1035
852 Ga0501032_0001988 3300049569 Bacteria 16106
853 Ga0501034_0077093 3300049571 Bacteria 3339
854 Ga0501034_0435982 3300049571 Bacteria 1229
855 Ga0501036_0040681 3300049572 Bacteria 3932
856 Ga0501036_0282131 3300049572 Bacteria 1390
857 Ga0501038_0011461 3300049574 Bacteria 8088
858 Ga0501043_0001461 3300049579 Bacteria 20653
859 Ga0501043_0044039 3300049579 Bacteria 3508
860 Ga0501047_0045113 3300049581 Bacteria 4261
861 Ga0501067_0000017 3300049583 Bacteria 102087
862 Ga0501073_0000021 3300049589 Bacteria 135534
863 Ga0501073_0007819 3300049589 Bacteria 7938
864 Ga0501077_0002351 3300049593 Bacteria 11397
865 Ga0501249_000121 3300049679 Bacteria 23955
866 Ga0501080_0004783 3300049742 Bacteria 12074
867 Ga0501080_0012022 3300049742 Bacteria 7928
868 Ga0501083_0064868 3300049744 Bacteria 2433
869 Ga0501044_0024149 3300049823 Bacteria 6458
870 Ga0501044_0037129 3300049823 Bacteria 5093
871 nmdc:mga03683_16824_c1 3300050489 Bacteria 2756
872 nmdc:mga03683_2_c1 3300050489 Bacteria 289140
873 nmdc:mga03n38_388_c1 3300050490 Bacteria 10864
874 nmdc:mga03n38_40367_c1 3300050490 Bacteria 2028
875 nmdc:mga00v17_168803_c1 3300050491 Bacteria 1410
876 nmdc:mga00v17_52090_c1 3300050491 Bacteria 2490
877 nmdc:mga00v17_72568_c1 3300050491 Bacteria 2136
878 nmdc:mga0yw44_47820_c1 3300050492 Bacteria 2577
879 nmdc:mga0k408_25420_c1 3300050493 Bacteria 3354
880 nmdc:mga0k408_256998_c1 3300050493 Bacteria 1043
881 nmdc:mga0k408_2699_c1 3300050493 Bacteria 9415
882 nmdc:mga0k408_64881_c1 3300050493 Bacteria 2125
883 nmdc:mga0k408_71796_c1 3300050493 Bacteria 2021
884 nmdc:mga06z11_50299_c1 3300050494 Bacteria 2130
885 nmdc:mga06z11_6779_c1 3300050494 Bacteria 4680
886 nmdc:mga07m45_178570_c1 3300050496 Bacteria 1235
887 nmdc:mga07m45_208857_c1 3300050496 Bacteria 1136
888 nmdc:mga07m45_2_c1 3300050496 Bacteria 451154
889 nmdc:mga07m45_35130_c1 3300050496 Bacteria 2788
890 nmdc:mga07m45_37057_c1 3300050496 Bacteria 2720
891 nmdc:mga07m45_52383_c1 3300050496 Bacteria 2304
892 nmdc:mga09592_1643_c1 3300050508 Bacteria 18008
893 nmdc:mga0qj67_27966_c1 3300050509 Bacteria 4374
894 nmdc:mga08y16_36637_c1 3300050511 Bacteria 5151
895 nmdc:mga08x19_44375_c1 3300050514 Bacteria 2838
896 nmdc:mga0sz30_28568_c1 3300050516 Bacteria 2296
897 nmdc:mga0sz30_43518_c1 3300050516 Bacteria 1565
898 Ga0495601_0000087 3300053077 Bacteria 49790
899 Ga0495601_0037088 3300053077 Bacteria 3047
900 Ga0495601_0083025 3300053077 Bacteria 2057
901 Ga0495601_0160555 3300053077 Bacteria 1469
902 Ga0495612_0001669 3300053078 Bacteria 9134
903 Ga0495612_0040056 3300053078 Bacteria 1908
904 Ga0500635_0000511 3300053080 Bacteria 10708
905 Ga0495595_0000218 3300053084 Bacteria 23092
906 Ga0495595_0000375 3300053084 Bacteria 16884
907 Ga0495619_0000111 3300053085 Bacteria 61304
908 Ga0495619_0000951 3300053085 Bacteria 18980
909 Ga0495619_0056365 3300053085 Bacteria 2605
910 Ga0495619_0063582 3300053085 Bacteria 2458
911 Ga0495619_0421866 3300053085 Bacteria 920
912 Ga0500643_000211 3300053087 Bacteria 54924
913 Ga0500643_001276 3300053087 Bacteria 14875
914 Ga0500643_022003 3300053087 Bacteria 2060
915 Ga0500644_0000524 3300053088 Bacteria 16194
916 Ga0500644_0000551 3300053088 Bacteria 15106
917 Ga0500644_0001360 3300053088 Bacteria 6535
918 Ga0500581_041001 3300053089 Bacteria 2371
919 Ga0500647_0014896 3300053091 Bacteria 3545
920 Ga0500566_0002826 3300053094 Bacteria 10332
921 Ga0500641_0008524 3300053096 Bacteria 3663
922 Ga0500641_0037746 3300053096 Bacteria 1938
923 Ga0500648_081059 3300053097 Bacteria 1826
924 Ga0500555_012652 3300053103 Bacteria 2430
925 Ga0500556_0000005 3300053104 Bacteria 581135
926 Ga0500562_000144 3300053108 Bacteria 20946
927 Ga0500562_005970 3300053108 Bacteria 3067
928 Ga0500572_000899 3300053111 Bacteria 9215
929 Ga0500594_0000525 3300053118 Bacteria 8309
930 Ga0500595_020332 3300053119 Bacteria 2392
931 Ga0500595_030197 3300053119 Bacteria 1829
932 Ga0500607_000011 3300053121 Bacteria 110773
933 Ga0500608_023846 3300053122 Bacteria 2851
934 Ga0500608_037185 3300053122 Bacteria 2325
935 Ga0500618_000145 3300053125 Bacteria 58724
936 Ga0500618_004368 3300053125 Bacteria 4545
937 Ga0500628_102911 3300053129 Bacteria 758
938 Ga0500642_0000006 3300053130 Bacteria 350064
939 Ga0500642_0000621 3300053130 Bacteria 10565
940 Ga0500655_000072 3300053133 Bacteria 27038
941 Ga0500655_005301 3300053133 Bacteria 2329
942 Ga0500658_0001897 3300053134 Bacteria 8203
943 Ga0500559_0000007 3300053136 Bacteria 226236
944 Ga0500559_0000067 3300053136 Bacteria 83330
945 Ga0500559_0000624 3300053136 Bacteria 24044
946 Ga0500559_0000915 3300053136 Bacteria 18771
947 Ga0500559_0002226 3300053136 Bacteria 10252
948 Ga0500559_0002389 3300053136 Bacteria 9751
949 Ga0500559_0007361 3300053136 Bacteria 4881
950 Ga0500559_0103399 3300053136 Bacteria 1314
951 Ga0500559_0173205 3300053136 Bacteria 1015
952 Ga0500559_0198050 3300053136 Bacteria 947
953 Ga0500564_000882 3300053138 Bacteria 9678
954 Ga0500573_0095935 3300053140 Bacteria 1671
955 Ga0500577_0001180 3300053142 Bacteria 6685
956 Ga0500590_000281 3300053148 Bacteria 16107
957 Ga0500604_0005013 3300053151 Unclassified 3505
958 Ga0500616_0053160 3300053153 Bacteria 2126
959 Ga0500622_0000060 3300053156 Bacteria 133737
960 Ga0500622_0000172 3300053156 Bacteria 69427
961 Ga0500624_000027 3300053157 Bacteria 108821
962 Ga0500627_0000127 3300053158 Bacteria 23450
963 Ga0500633_0022831 3300053160 Bacteria 1922
964 Ga0500639_026870 3300053163 Bacteria 3041
965 Ga0500636_0000098 3300053177 Bacteria 44586
966 Ga0500636_0000129 3300053177 Bacteria 39152
967 Ga0500636_0000334 3300053177 Bacteria 26118
968 Ga0500636_0058824 3300053177 Bacteria 2246
969 Ga0500637_0000020 3300053178 Bacteria 63918
970 Ga0500570_000563 3300053724 Bacteria 14733
971 Ga0500645_005267 3300053730 Bacteria 4794
972 Ga0500645_016825 3300053730 Bacteria 2299
973 Ga0500596_000465 3300053735 Bacteria 7540
974 Ga0500661_000478 3300055283 Bacteria 7428
975 Ga0500661_002807 3300055283 Bacteria 3283
976 Ga0501082_0050481 3300060353 Bacteria 3587
977 Ga0501082_0215159 3300060353 Bacteria 1672
978 Ga0466962_0004545 3300061719 Bacteria 6655
979 Ga0466962_0004735 3300061719 Bacteria 6540

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10204744 Ga0207648_102047441 180
2 3300042876 Ga0451577_0711638 Ga0451577_0711638_33_647 199
3 3300053129 Ga0500628_102911 Ga0500628_102911_23_712 211
4 3300053136 Ga0500559_0000915 Ga0500559_0000915_17299_17967 213
5 3300049581 Ga0501047_0045113 Ga0501047_0045113_27_710 215
6 3300044712 Ga0453684_0518630 Ga0453684_0518630_28_696 217
7 3300005435 Ga0070714_100015389 Ga0070714_1000153893 222
8 3300025929 Ga0207664_10006538 Ga0207664_100065383 222
9 3300053122 Ga0500608_037185 Ga0500608_037185_66_767 223
10 3300025937 Ga0207669_10121095 Ga0207669_101210951 230
11 3300006186 Ga0075369_10010043 Ga0075369_100100432 237
12 3300006195 Ga0075366_10014611 Ga0075366_100146114 237
13 3300009176 Ga0105242_10483129 Ga0105242_104831292 237
14 3300014969 Ga0157376_10230952 Ga0157376_102309522 237
15 3300026078 Ga0207702_10035282 Ga0207702_100352822 239
16 3300049571 Ga0501034_0435982 Ga0501034_0435982_460_1212 239
17 3300060353 Ga0501082_0215159 Ga0501082_0215159_15_767 239
18 3300005466 Ga0070685_10002911 Ga0070685_100029117 241
19 3300006880 Ga0075429_100001195 Ga0075429_10000119517 242
20 3300005336 Ga0070680_100112515 Ga0070680_1001125151 243
21 3300005563 Ga0068855_100216159 Ga0068855_1002161592 243
22 3300009093 Ga0105240_10106844 Ga0105240_101068443 243
23 3300013104 Ga0157370_10244972 Ga0157370_102449724 243
24 3300013104 Ga0157370_10600392 Ga0157370_106003921 243
25 3300025913 Ga0207695_10332538 Ga0207695_103325382 243
26 3300031711 Ga0265314_10068772 Ga0265314_100687722 243
27 3300032002 Ga0307416_100240652 Ga0307416_1002406522 243
28 3300044842 Ga0466957_0305047 Ga0466957_0305047_34_789 243
29 3300025898 Ga0207692_10137091 Ga0207692_101370912 244
30 3300053111 Ga0500572_000899 Ga0500572_000899_1854_2657 244
31 3300053136 Ga0500559_0000624 Ga0500559_0000624_12368_13171 245
32 3300003322 rootL2_10337834 rootL2_103378342 246
33 3300028573 Ga0265334_10000033 Ga0265334_1000003396 246
34 3300037466 Ga0395898_0000283 Ga0395898_0000283_54988_55845 246
35 3300046454 Ga0495592_0150394 Ga0495592_0150394_860_1600 246
36 3300048927 Ga0496124_0099710 Ga0496124_0099710_42_782 246
37 3300037418 Ga0395900_0000058 Ga0395900_0000058_106572_107429 247
38 3300045051 Ga0451576_0000246 Ga0451576_0000246_117803_118564 247
39 3300045051 Ga0451576_0103717 Ga0451576_0103717_1228_2010 247
40 3300046476 Ga0495662_0004987 Ga0495662_0004987_1156_1926 247
41 3300046517 Ga0495630_0000005 Ga0495630_0000005_151385_152155 247
42 3300046526 Ga0495666_0013815 Ga0495666_0013815_92_862 247
43 3300046681 Ga0495647_0024093 Ga0495647_0024093_1200_1970 247
44 3300025926 Ga0207659_10230218 Ga0207659_102302181 248
45 iso_pu_bacteria 2846033681 2846036069 248
46 iso_pu_bacteria 2846037992 2846041103 248
47 3300005545 Ga0070695_100017779 Ga0070695_1000177792 249
48 3300037471 Ga0395905_0070884 Ga0395905_0070884_453_1295 249
49 3300037471 Ga0395905_0183778 Ga0395905_0183778_798_1589 249
50 3300044684 Ga0466966_0031126 Ga0466966_0031126_938_1717 249
51 3300045049 Ga0466959_0062688 Ga0466959_0062688_629_1408 249
52 3300046500 Ga0495596_0177340 Ga0495596_0177340_46_795 249
53 3300047472 Ga0495686_0000233 Ga0495686_0000233_69966_70745 249
54 iso_pu_bacteria 2582581280 2585154912 249
55 iso_pu_bacteria 2721755763 2723876544 249
56 iso_pu_bacteria 2849560528 2849563886 249
57 iso_pu_bacteria 2849573788 2849578749 249
58 3300002459 JGI24751J29686_10003654 JGI24751J29686_100036542 250
59 3300005331 Ga0070670_100019902 Ga0070670_1000199023 250
60 3300005335 Ga0070666_10001588 Ga0070666_100015883 250
61 3300005353 Ga0070669_100000004 Ga0070669_100000004266 250
62 3300005355 Ga0070671_100000004 Ga0070671_100000004122 250
63 3300005544 Ga0070686_100094455 Ga0070686_1000944552 250
64 3300005548 Ga0070665_100023540 Ga0070665_10002354010 250
65 3300005617 Ga0068859_100003632 Ga0068859_10000363217 250
66 3300005618 Ga0068864_100004715 Ga0068864_1000047152 250
67 3300005719 Ga0068861_100025417 Ga0068861_1000254172 250
68 3300005841 Ga0068863_100037037 Ga0068863_1000370377 250
69 3300005842 Ga0068858_100002081 Ga0068858_10000208121 250
70 3300005844 Ga0068862_100002536 Ga0068862_1000025362 250
71 3300006048 Ga0075363_100000129 Ga0075363_1000001292 250
72 3300006177 Ga0075362_10000024 Ga0075362_1000002420 250
73 3300006186 Ga0075369_10000380 Ga0075369_1000038012 250
74 3300006195 Ga0075366_10000115 Ga0075366_100001155 250
75 3300006195 Ga0075366_10091455 Ga0075366_100914553 250
76 3300006353 Ga0075370_10000001 Ga0075370_10000001242 250
77 3300006931 Ga0097620_100003632 Ga0097620_10000363217 250
78 3300009101 Ga0105247_10006203 Ga0105247_100062037 250
79 3300009177 Ga0105248_10070883 Ga0105248_100708832 250
80 3300012490 Ga0157322_1002390 Ga0157322_10023902 250
81 3300013306 Ga0163162_10325829 Ga0163162_103258292 250
82 3300014968 Ga0157379_10152384 Ga0157379_101523842 250
83 3300025254 Ga0209148_1001511 Ga0209148_10015115 250
84 3300025272 Ga0209455_1000760 Ga0209455_10007604 250
85 3300025315 Ga0207697_10002018 Ga0207697_1000201810 250
86 3300025900 Ga0207710_10012334 Ga0207710_100123346 250
87 3300025903 Ga0207680_10001639 Ga0207680_100016392 250
88 3300025923 Ga0207681_10000010 Ga0207681_10000010141 250
89 3300025925 Ga0207650_10009672 Ga0207650_100096728 250
90 3300025931 Ga0207644_10000007 Ga0207644_10000007127 250
91 3300025941 Ga0207711_10157661 Ga0207711_101576612 250
92 3300025961 Ga0207712_10385909 Ga0207712_103859092 250
93 3300025972 Ga0207668_10003062 Ga0207668_100030623 250
94 3300025986 Ga0207658_10001394 Ga0207658_100013944 250
95 3300026035 Ga0207703_10003496 Ga0207703_100034969 250
96 3300026088 Ga0207641_10024523 Ga0207641_100245233 250
97 3300026095 Ga0207676_10000953 Ga0207676_100009533 250
98 3300026118 Ga0207675_100000329 Ga0207675_10000032915 250
99 3300028379 Ga0268266_10109492 Ga0268266_101094922 250
100 3300028380 Ga0268265_10000058 Ga0268265_1000005844 250
101 3300028381 Ga0268264_10000106 Ga0268264_10000106164 250
102 3300034817 Ga0373948_0019631 Ga0373948_0019631_359_1135 250
103 3300035691 Ga0373931_0045141 Ga0373931_0045141_1289_2065 250
104 3300037853 Ga0436364_1182640 Ga0436364_1182640_317_1093 250
105 3300048905 Ga0496102_0793079 Ga0496102_0793079_59_841 250
106 3300048909 Ga0496106_0004759 Ga0496106_0004759_8630_9451 250
107 3300048912 Ga0496109_0141124 Ga0496109_0141124_959_1840 250
108 3300048917 Ga0496114_0237392 Ga0496114_0237392_708_1589 250
109 3300050489 nmdc:mga03683_2_c1 nmdc:mga03683_2_c1_47067_47843 250
110 3300050490 nmdc:mga03n38_388_c1 nmdc:mga03n38_388_c1_1554_2330 250
111 3300050493 nmdc:mga0k408_64881_c1 nmdc:mga0k408_64881_c1_1258_2034 250
112 3300050496 nmdc:mga07m45_2_c1 nmdc:mga07m45_2_c1_17519_18295 250
113 3300005354 Ga0070675_100118645 Ga0070675_1001186452 251
114 3300005439 Ga0070711_100273159 Ga0070711_1002731592 251
115 3300005456 Ga0070678_100072220 Ga0070678_1000722204 251
116 3300005458 Ga0070681_10027823 Ga0070681_100278233 251
117 3300005458 Ga0070681_10440419 Ga0070681_104404191 251
118 3300005530 Ga0070679_100063148 Ga0070679_1000631486 251
119 3300005530 Ga0070679_100792895 Ga0070679_1007928951 251
120 3300005563 Ga0068855_100338109 Ga0068855_1003381091 251
121 3300005564 Ga0070664_100221985 Ga0070664_1002219852 251
122 3300009101 Ga0105247_10008016 Ga0105247_100080163 251
123 3300013297 Ga0157378_10887720 Ga0157378_108877201 251
124 3300025900 Ga0207710_10022648 Ga0207710_100226483 251
125 3300025912 Ga0207707_10061038 Ga0207707_100610383 251
126 3300025912 Ga0207707_10433340 Ga0207707_104333401 251
127 3300025915 Ga0207693_10021011 Ga0207693_100210115 251
128 3300025916 Ga0207663_10265978 Ga0207663_102659783 251
129 3300025921 Ga0207652_10034939 Ga0207652_100349395 251
130 3300025949 Ga0207667_10273513 Ga0207667_102735133 251
131 3300028800 Ga0265338_10003732 Ga0265338_100037323 251
132 3300031241 Ga0265325_10000290 Ga0265325_1000029024 251
133 3300031241 Ga0265325_10046724 Ga0265325_100467243 251
134 3300031595 Ga0265313_10033376 Ga0265313_100333762 251
135 3300035113 Ga0373936_0089331 Ga0373936_0089331_216_1010 251
136 3300035172 Ga0373955_0043872 Ga0373955_0043872_304_1113 251
137 3300035410 Ga0373924_0029313 Ga0373924_0029313_227_1036 251
138 3300035724 Ga0373933_0093813 Ga0373933_0093813_42_851 251
139 3300036401 Ga0373937_0038202 Ga0373937_0038202_3140_3949 251
140 3300037466 Ga0395898_0053488 Ga0395898_0053488_1218_2015 251
141 3300039438 Ga0436360_1339610 Ga0436360_1339610_236_1021 251
142 3300039447 Ga0436361_1134714 Ga0436361_1134714_1843_2634 251
143 3300039447 Ga0436361_1185506 Ga0436361_1185506_372_1157 251
144 3300046454 Ga0495592_0006004 Ga0495592_0006004_2389_3198 251
145 3300046459 Ga0495629_0081801 Ga0495629_0081801_304_1089 251
146 3300046462 Ga0495651_0043092 Ga0495651_0043092_1637_2446 251
147 3300046472 Ga0495580_0112366 Ga0495580_0112366_929_1714 251
148 3300046516 Ga0495628_0061401 Ga0495628_0061401_1444_2253 251
149 3300046529 Ga0495652_0122887 Ga0495652_0122887_187_996 251
150 3300046536 Ga0495587_0084174 Ga0495587_0084174_504_1313 251
151 3300046675 Ga0495657_0228912 Ga0495657_0228912_230_1039 251
152 3300046679 Ga0495623_0057306 Ga0495623_0057306_485_1294 251
153 3300046681 Ga0495647_0051090 Ga0495647_0051090_249_1034 251
154 3300046809 Ga0495600_0008525 Ga0495600_0008525_5214_6023 251
155 3300047319 Ga0495674_0024016 Ga0495674_0024016_1561_2346 251
156 3300047322 Ga0495680_0023379 Ga0495680_0023379_4067_4876 251
157 3300048907 Ga0496104_0000055 Ga0496104_0000055_111494_112303 251
158 3300048922 Ga0496119_0193487 Ga0496119_0193487_194_1018 251
159 3300049569 Ga0501032_0001988 Ga0501032_0001988_3520_4308 251
160 3300049571 Ga0501034_0077093 Ga0501034_0077093_439_1221 251
161 3300049572 Ga0501036_0040681 Ga0501036_0040681_2368_3156 251
162 3300049572 Ga0501036_0282131 Ga0501036_0282131_119_907 251
163 3300049574 Ga0501038_0011461 Ga0501038_0011461_3400_4188 251
164 3300049579 Ga0501043_0001461 Ga0501043_0001461_8755_9543 251
165 3300049579 Ga0501043_0044039 Ga0501043_0044039_2706_3494 251
166 3300049583 Ga0501067_0000017 Ga0501067_0000017_69037_69825 251
167 3300049589 Ga0501073_0000021 Ga0501073_0000021_7028_7816 251
168 3300049589 Ga0501073_0007819 Ga0501073_0007819_5976_6764 251
169 3300049593 Ga0501077_0002351 Ga0501077_0002351_3365_4153 251
170 3300049742 Ga0501080_0004783 Ga0501080_0004783_2583_3371 251
171 3300049742 Ga0501080_0012022 Ga0501080_0012022_4332_5120 251
172 3300049744 Ga0501083_0064868 Ga0501083_0064868_1408_2196 251
173 3300049823 Ga0501044_0024149 Ga0501044_0024149_1998_2786 251
174 3300049823 Ga0501044_0037129 Ga0501044_0037129_1338_2126 251
175 3300050493 nmdc:mga0k408_25420_c1 nmdc:mga0k408_25420_c1_348_1163 251
176 3300050516 nmdc:mga0sz30_28568_c1 nmdc:mga0sz30_28568_c1_1404_2219 251
177 3300053077 Ga0495601_0000087 Ga0495601_0000087_11359_12168 251
178 3300053078 Ga0495612_0001669 Ga0495612_0001669_5999_6808 251
179 3300053084 Ga0495595_0000375 Ga0495595_0000375_10066_10875 251
180 3300053085 Ga0495619_0000951 Ga0495619_0000951_13430_14239 251
181 3300053085 Ga0495619_0056365 Ga0495619_0056365_1095_1904 251
182 3300053096 Ga0500641_0008524 Ga0500641_0008524_1798_2610 251
183 3300053119 Ga0500595_030197 Ga0500595_030197_872_1660 251
184 3300053177 Ga0500636_0000334 Ga0500636_0000334_18546_19328 251
185 3300060353 Ga0501082_0050481 Ga0501082_0050481_349_1137 251
186 3300005435 Ga0070714_100002166 Ga0070714_1000021669 252
187 3300005467 Ga0070706_100553234 Ga0070706_1005532342 252
188 3300006051 Ga0075364_10004589 Ga0075364_100045893 252
189 3300006177 Ga0075362_10020589 Ga0075362_100205894 252
190 3300021441 Ga0213871_10015669 Ga0213871_100156692 252
191 3300025929 Ga0207664_10074075 Ga0207664_100740752 252
192 3300031249 Ga0265339_10004298 Ga0265339_100042983 252
193 3300039438 Ga0436360_0564642 Ga0436360_0564642_7104_7910 252
194 3300039453 Ga0436362_0922352 Ga0436362_0922352_100_906 252
195 3300042004 Ga0439445_0005202 Ga0439445_0005202_1754_2560 252
196 3300044712 Ga0453684_0595088 Ga0453684_0595088_155_961 252
197 3300045049 Ga0466959_0118491 Ga0466959_0118491_28_816 252
198 3300046453 Ga0495627_002847 Ga0495627_002847_1614_2405 252
199 3300046453 Ga0495627_071272 Ga0495627_071272_27_818 252
200 3300046501 Ga0495607_0058749 Ga0495607_0058749_330_1121 252
201 3300046512 Ga0495610_0000127 Ga0495610_0000127_4675_5466 252
202 3300046513 Ga0495616_0042489 Ga0495616_0042489_927_1718 252
203 3300046520 Ga0495637_0007583 Ga0495637_0007583_4188_4979 252
204 3300046522 Ga0495643_0169892 Ga0495643_0169892_105_896 252
205 3300046524 Ga0495648_0017826 Ga0495648_0017826_630_1421 252
206 3300046530 Ga0495654_0040990 Ga0495654_0040990_1161_1952 252
207 3300046557 Ga0495622_0070803 Ga0495622_0070803_586_1377 252
208 3300046558 Ga0495633_0000486 Ga0495633_0000486_9950_10741 252
209 3300046648 Ga0495611_0041064 Ga0495611_0041064_129_920 252
210 3300046648 Ga0495611_0142766 Ga0495611_0142766_149_940 252
211 3300046691 Ga0495670_0000160 Ga0495670_0000160_561_1352 252
212 3300046692 Ga0495671_0002938 Ga0495671_0002938_8123_8914 252
213 3300046692 Ga0495671_0005670 Ga0495671_0005670_776_1567 252
214 3300047470 Ga0495681_0000155 Ga0495681_0000155_43929_44720 252
215 3300047472 Ga0495686_0000518 Ga0495686_0000518_27824_28615 252
216 3300049679 Ga0501249_000121 Ga0501249_000121_4258_5049 252
217 3300050489 nmdc:mga03683_16824_c1 nmdc:mga03683_16824_c1_1911_2702 252
218 3300050516 nmdc:mga0sz30_43518_c1 nmdc:mga0sz30_43518_c1_744_1535 252
219 3300053080 Ga0500635_0000511 Ga0500635_0000511_6658_7494 252
220 3300053087 Ga0500643_000211 Ga0500643_000211_8112_8903 252
221 3300053087 Ga0500643_001276 Ga0500643_001276_9238_10029 252
222 3300053087 Ga0500643_022003 Ga0500643_022003_547_1338 252
223 3300053088 Ga0500644_0000524 Ga0500644_0000524_12902_13693 252
224 3300053089 Ga0500581_041001 Ga0500581_041001_1562_2353 252
225 3300053096 Ga0500641_0037746 Ga0500641_0037746_237_1028 252
226 3300053104 Ga0500556_0000005 Ga0500556_0000005_233701_234492 252
227 3300053108 Ga0500562_000144 Ga0500562_000144_16850_17641 252
228 3300053118 Ga0500594_0000525 Ga0500594_0000525_2195_2986 252
229 3300053121 Ga0500607_000011 Ga0500607_000011_11491_12282 252
230 3300053122 Ga0500608_023846 Ga0500608_023846_1791_2630 252
231 3300053130 Ga0500642_0000006 Ga0500642_0000006_160972_161763 252
232 3300053134 Ga0500658_0001897 Ga0500658_0001897_952_1743 252
233 3300053136 Ga0500559_0000067 Ga0500559_0000067_33584_34375 252
234 3300053136 Ga0500559_0002389 Ga0500559_0002389_4152_4943 252
235 3300053136 Ga0500559_0103399 Ga0500559_0103399_117_965 252
236 3300053136 Ga0500559_0173205 Ga0500559_0173205_104_901 252
237 3300053151 Ga0500604_0005013 Ga0500604_0005013_288_1079 252
238 3300053156 Ga0500622_0000060 Ga0500622_0000060_88734_89525 252
239 3300053157 Ga0500624_000027 Ga0500624_000027_57253_58044 252
240 3300053160 Ga0500633_0022831 Ga0500633_0022831_138_929 252
241 3300053177 Ga0500636_0000098 Ga0500636_0000098_9324_10115 252
242 3300053177 Ga0500636_0000129 Ga0500636_0000129_15592_16383 252
243 3300053177 Ga0500636_0058824 Ga0500636_0058824_1421_2215 252
244 3300055283 Ga0500661_002807 Ga0500661_002807_245_1036 252
245 3300005331 Ga0070670_100558992 Ga0070670_1005589922 253
246 3300005434 Ga0070709_10094073 Ga0070709_100940732 253
247 3300005435 Ga0070714_100267561 Ga0070714_1002675613 253
248 3300005439 Ga0070711_100140983 Ga0070711_1001409832 253
249 3300005458 Ga0070681_10062338 Ga0070681_100623384 253
250 3300005458 Ga0070681_10121087 Ga0070681_101210872 253
251 3300005530 Ga0070679_100078433 Ga0070679_1000784332 253
252 3300005530 Ga0070679_100162930 Ga0070679_1001629302 253
253 3300005535 Ga0070684_100022062 Ga0070684_1000220622 253
254 3300005578 Ga0068854_100132023 Ga0068854_1001320232 253
255 3300005614 Ga0068856_100133357 Ga0068856_1001333573 253
256 3300005843 Ga0068860_100001690 Ga0068860_10000169014 253
257 3300006038 Ga0075365_10102819 Ga0075365_101028192 253
258 3300006048 Ga0075363_100015629 Ga0075363_1000156294 253
259 3300006051 Ga0075364_10071428 Ga0075364_100714283 253
260 3300006051 Ga0075364_10083829 Ga0075364_100838293 253
261 3300006175 Ga0070712_100173343 Ga0070712_1001733432 253
262 3300006177 Ga0075362_10027731 Ga0075362_100277312 253
263 3300006178 Ga0075367_10000197 Ga0075367_100001978 253
264 3300006178 Ga0075367_10070406 Ga0075367_100704062 253
265 3300006186 Ga0075369_10042650 Ga0075369_100426503 253
266 3300006186 Ga0075369_10054877 Ga0075369_100548773 253
267 3300006195 Ga0075366_10269720 Ga0075366_102697202 253
268 3300006353 Ga0075370_10036581 Ga0075370_100365813 253
269 3300006353 Ga0075370_10111603 Ga0075370_101116032 253
270 3300006353 Ga0075370_10228638 Ga0075370_102286382 253
271 3300009174 Ga0105241_10030298 Ga0105241_100302983 253
272 3300009551 Ga0105238_10045913 Ga0105238_100459133 253
273 3300013100 Ga0157373_10014587 Ga0157373_100145872 253
274 3300013105 Ga0157369_10256173 Ga0157369_102561732 253
275 3300013307 Ga0157372_10067793 Ga0157372_100677934 253
276 3300025909 Ga0207705_10058067 Ga0207705_100580672 253
277 3300025912 Ga0207707_10042279 Ga0207707_100422793 253
278 3300025913 Ga0207695_10383498 Ga0207695_103834981 253
279 3300025916 Ga0207663_10109936 Ga0207663_101099362 253
280 3300025919 Ga0207657_10058090 Ga0207657_100580903 253
281 3300025929 Ga0207664_10316985 Ga0207664_103169852 253
282 3300025949 Ga0207667_10038744 Ga0207667_100387445 253
283 3300025949 Ga0207667_10154251 Ga0207667_101542512 253
284 3300025981 Ga0207640_10086724 Ga0207640_100867243 253
285 3300026035 Ga0207703_10339664 Ga0207703_103396641 253
286 3300026041 Ga0207639_10429963 Ga0207639_104299632 253
287 3300026116 Ga0207674_10622728 Ga0207674_106227282 253
288 3300027907 Ga0207428_10091617 Ga0207428_100916172 253
289 3300028381 Ga0268264_10000048 Ga0268264_10000048187 253
290 3300028573 Ga0265334_10005691 Ga0265334_100056917 253
291 3300031235 Ga0265330_10006525 Ga0265330_100065256 253
292 3300031235 Ga0265330_10028702 Ga0265330_100287022 253
293 3300031235 Ga0265330_10037338 Ga0265330_100373383 253
294 3300031238 Ga0265332_10049842 Ga0265332_100498422 253
295 3300031241 Ga0265325_10026252 Ga0265325_100262524 253
296 3300031247 Ga0265340_10006819 Ga0265340_100068196 253
297 3300031249 Ga0265339_10065229 Ga0265339_100652292 253
298 3300031249 Ga0265339_10097479 Ga0265339_100974792 253
299 3300031250 Ga0265331_10012529 Ga0265331_100125292 253
300 3300031250 Ga0265331_10062262 Ga0265331_100622622 253
301 3300031250 Ga0265331_10070234 Ga0265331_100702342 253
302 3300031250 Ga0265331_10143931 Ga0265331_101439311 253
303 3300031344 Ga0265316_10043368 Ga0265316_100433682 253
304 3300031507 Ga0307509_10022838 Ga0307509_100228381 253
305 3300031507 Ga0307509_10161044 Ga0307509_101610441 253
306 3300031616 Ga0307508_10000249 Ga0307508_1000024952 253
307 3300031616 Ga0307508_10296125 Ga0307508_102961251 253
308 3300031711 Ga0265314_10001283 Ga0265314_1000128323 253
309 3300031711 Ga0265314_10035129 Ga0265314_100351292 253
310 3300032133 Ga0316583_10000941 Ga0316583_1000094113 253
311 3300035086 Ga0373934_0002476 Ga0373934_0002476_3377_4231 253
312 3300035111 Ga0373923_0000171 Ga0373923_0000171_5176_6030 253
313 3300035117 Ga0373953_0010573 Ga0373953_0010573_635_1489 253
314 3300035118 Ga0373954_0000518 Ga0373954_0000518_3074_3928 253
315 3300035120 Ga0373957_0000722 Ga0373957_0000722_2723_3577 253
316 3300035120 Ga0373957_0028764 Ga0373957_0028764_635_1474 253
317 3300035172 Ga0373955_0003463 Ga0373955_0003463_257_1096 253
318 3300035398 Ga0316574_0158678 Ga0316574_0158678_225_1103 253
319 3300035410 Ga0373924_0002025 Ga0373924_0002025_4850_5704 253
320 3300035695 Ga0373927_0000002 Ga0373927_0000002_618077_618853 253
321 3300035695 Ga0373927_0014461 Ga0373927_0014461_2144_2938 253
322 3300035724 Ga0373933_0000274 Ga0373933_0000274_24557_25411 253
323 3300035724 Ga0373933_0003540 Ga0373933_0003540_6149_6988 253
324 3300035724 Ga0373933_0277349 Ga0373933_0277349_152_1000 253
325 3300035725 Ga0373947_0128176 Ga0373947_0128176_430_1257 253
326 3300036401 Ga0373937_0005546 Ga0373937_0005546_7173_8012 253
327 3300037068 Ga0373925_0081160 Ga0373925_0081160_57_890 253
328 3300039437 Ga0436365_0174471 Ga0436365_0174471_148_954 253
329 3300046457 Ga0495590_0001575 Ga0495590_0001575_1764_2558 253
330 3300046459 Ga0495629_0001021 Ga0495629_0001021_6792_7646 253
331 3300046460 Ga0495638_0000517 Ga0495638_0000517_36398_37192 253
332 3300046460 Ga0495638_0001208 Ga0495638_0001208_22066_22860 253
333 3300046460 Ga0495638_0014896 Ga0495638_0014896_409_1203 253
334 3300046462 Ga0495651_0002383 Ga0495651_0002383_10323_11177 253
335 3300046463 Ga0495653_0003619 Ga0495653_0003619_11203_12057 253
336 3300046471 Ga0495650_0000007 Ga0495650_0000007_671397_672191 253
337 3300046506 Ga0495583_0000209 Ga0495583_0000209_58259_59053 253
338 3300046511 Ga0495608_0000721 Ga0495608_0000721_3074_3928 253
339 3300046511 Ga0495608_0136355 Ga0495608_0136355_369_1208 253
340 3300046512 Ga0495610_0000195 Ga0495610_0000195_19420_20214 253
341 3300046513 Ga0495616_0001431 Ga0495616_0001431_12895_13689 253
342 3300046514 Ga0495618_0097707 Ga0495618_0097707_742_1596 253
343 3300046518 Ga0495631_0002603 Ga0495631_0002603_2125_2919 253
344 3300046520 Ga0495637_0004227 Ga0495637_0004227_642_1436 253
345 3300046520 Ga0495637_0012422 Ga0495637_0012422_523_1317 253
346 3300046522 Ga0495643_0006927 Ga0495643_0006927_1884_2678 253
347 3300046524 Ga0495648_0002225 Ga0495648_0002225_12028_12822 253
348 3300046524 Ga0495648_0012803 Ga0495648_0012803_4118_4912 253
349 3300046525 Ga0495663_0008082 Ga0495663_0008082_1524_2318 253
350 3300046529 Ga0495652_0194512 Ga0495652_0194512_538_1377 253
351 3300046530 Ga0495654_0000262 Ga0495654_0000262_17019_17813 253
352 3300046533 Ga0495640_0005747 Ga0495640_0005747_2521_3375 253
353 3300046536 Ga0495587_0042110 Ga0495587_0042110_561_1400 253
354 3300046542 Ga0495597_0011826 Ga0495597_0011826_955_1749 253
355 3300046543 Ga0495645_0034844 Ga0495645_0034844_2709_3563 253
356 3300046557 Ga0495622_0066630 Ga0495622_0066630_790_1620 253
357 3300046559 Ga0495667_0000319 Ga0495667_0000319_21308_22162 253
358 3300046559 Ga0495667_0063791 Ga0495667_0063791_1008_1847 253
359 3300046616 Ga0495668_0002183 Ga0495668_0002183_12694_13488 253
360 3300046616 Ga0495668_0081593 Ga0495668_0081593_529_1323 253
361 3300046642 Ga0495634_0002073 Ga0495634_0002073_4821_5675 253
362 3300046660 Ga0495625_0041628 Ga0495625_0041628_1783_2577 253
363 3300046660 Ga0495625_0068433 Ga0495625_0068433_1254_2048 253
364 3300046663 Ga0495635_0000180 Ga0495635_0000180_9068_9922 253
365 3300046675 Ga0495657_0006534 Ga0495657_0006534_4854_5708 253
366 3300046675 Ga0495657_0052534 Ga0495657_0052534_1323_2162 253
367 3300046678 Ga0495599_0000885 Ga0495599_0000885_5354_6208 253
368 3300046679 Ga0495623_0054728 Ga0495623_0054728_1187_2026 253
369 3300046680 Ga0495646_0012263 Ga0495646_0012263_3108_3962 253
370 3300046683 Ga0495658_0287112 Ga0495658_0287112_87_917 253
371 3300046689 Ga0495613_0026003 Ga0495613_0026003_508_1362 253
372 3300046692 Ga0495671_0016873 Ga0495671_0016873_1685_2479 253
373 3300046692 Ga0495671_0074841 Ga0495671_0074841_413_1207 253
374 3300046794 Ga0495589_0000838 Ga0495589_0000838_5686_6480 253
375 3300046809 Ga0495600_0085655 Ga0495600_0085655_238_1077 253
376 3300046810 Ga0495660_0100688 Ga0495660_0100688_18_812 253
377 3300047319 Ga0495674_0020526 Ga0495674_0020526_3756_4610 253
378 3300047320 Ga0495672_0001435 Ga0495672_0001435_20778_21572 253
379 3300047322 Ga0495680_0015798 Ga0495680_0015798_2433_3287 253
380 3300047444 Ga0495675_0002275 Ga0495675_0002275_5092_5946 253
381 3300047446 Ga0495679_007135 Ga0495679_007135_2822_3616 253
382 3300047469 Ga0495673_0000743 Ga0495673_0000743_19750_20544 253
383 3300047469 Ga0495673_0001213 Ga0495673_0001213_14435_15229 253
384 3300047469 Ga0495673_0001789 Ga0495673_0001789_3401_4195 253
385 3300047471 Ga0495684_0000023 Ga0495684_0000023_106869_107723 253
386 3300047472 Ga0495686_0006648 Ga0495686_0006648_4025_4819 253
387 3300047673 Ga0495593_0000221 Ga0495593_0000221_10308_11162 253
388 3300048088 Ga0495602_0013760 Ga0495602_0013760_4964_5818 253
389 3300048088 Ga0495602_0107756 Ga0495602_0107756_1270_2109 253
390 3300048919 Ga0496116_0070588 Ga0496116_0070588_142_972 253
391 3300048919 Ga0496116_0087016 Ga0496116_0087016_243_1004 253
392 3300048920 Ga0496117_0011530 Ga0496117_0011530_6486_7316 253
393 3300048921 Ga0496118_0002114 Ga0496118_0002114_20271_21101 253
394 3300048924 Ga0496121_0000757 Ga0496121_0000757_46585_47415 253
395 3300048927 Ga0496124_0003589 Ga0496124_0003589_14893_15723 253
396 3300048929 Ga0496126_0020776 Ga0496126_0020776_4497_5327 253
397 3300049459 Ga0495678_000801 Ga0495678_000801_19904_20698 253
398 3300050490 nmdc:mga03n38_40367_c1 nmdc:mga03n38_40367_c1_22_834 253
399 3300050491 nmdc:mga00v17_168803_c1 nmdc:mga00v17_168803_c1_14_826 253
400 3300050491 nmdc:mga00v17_52090_c1 nmdc:mga00v17_52090_c1_1379_2320 253
401 3300050491 nmdc:mga00v17_72568_c1 nmdc:mga00v17_72568_c1_717_1517 253
402 3300050492 nmdc:mga0yw44_47820_c1 nmdc:mga0yw44_47820_c1_1594_2535 253
403 3300050494 nmdc:mga06z11_50299_c1 nmdc:mga06z11_50299_c1_620_1420 253
404 3300050494 nmdc:mga06z11_6779_c1 nmdc:mga06z11_6779_c1_1361_2173 253
405 3300050496 nmdc:mga07m45_178570_c1 nmdc:mga07m45_178570_c1_153_953 253
406 3300050496 nmdc:mga07m45_208857_c1 nmdc:mga07m45_208857_c1_280_1080 253
407 3300050496 nmdc:mga07m45_37057_c1 nmdc:mga07m45_37057_c1_186_998 253
408 3300050496 nmdc:mga07m45_52383_c1 nmdc:mga07m45_52383_c1_781_1593 253
409 3300050511 nmdc:mga08y16_36637_c1 nmdc:mga08y16_36637_c1_1501_2334 253
410 3300050514 nmdc:mga08x19_44375_c1 nmdc:mga08x19_44375_c1_1309_2139 253
411 3300053077 Ga0495601_0037088 Ga0495601_0037088_1939_2793 253
412 3300053077 Ga0495601_0083025 Ga0495601_0083025_178_1017 253
413 3300053077 Ga0495601_0160555 Ga0495601_0160555_555_1385 253
414 3300053078 Ga0495612_0040056 Ga0495612_0040056_564_1418 253
415 3300053084 Ga0495595_0000218 Ga0495595_0000218_18791_19645 253
416 3300053085 Ga0495619_0000111 Ga0495619_0000111_5064_5918 253
417 3300053085 Ga0495619_0063582 Ga0495619_0063582_682_1521 253
418 3300053085 Ga0495619_0421866 Ga0495619_0421866_59_904 253
419 3300053088 Ga0500644_0000551 Ga0500644_0000551_11568_12362 253
420 3300053088 Ga0500644_0001360 Ga0500644_0001360_4561_5355 253
421 3300053091 Ga0500647_0014896 Ga0500647_0014896_1590_2399 253
422 3300053097 Ga0500648_081059 Ga0500648_081059_803_1633 253
423 3300053103 Ga0500555_012652 Ga0500555_012652_1123_1917 253
424 3300053108 Ga0500562_005970 Ga0500562_005970_123_917 253
425 3300053119 Ga0500595_020332 Ga0500595_020332_31_861 253
426 3300053125 Ga0500618_000145 Ga0500618_000145_56605_57399 253
427 3300053125 Ga0500618_004368 Ga0500618_004368_1315_2124 253
428 3300053130 Ga0500642_0000621 Ga0500642_0000621_4075_4869 253
429 3300053133 Ga0500655_000072 Ga0500655_000072_20582_21376 253
430 3300053133 Ga0500655_005301 Ga0500655_005301_240_1034 253
431 3300053136 Ga0500559_0000007 Ga0500559_0000007_121954_122748 253
432 3300053136 Ga0500559_0002226 Ga0500559_0002226_8339_9133 253
433 3300053136 Ga0500559_0007361 Ga0500559_0007361_3544_4374 253
434 3300053138 Ga0500564_000882 Ga0500564_000882_6835_7629 253
435 3300053140 Ga0500573_0095935 Ga0500573_0095935_130_960 253
436 3300053142 Ga0500577_0001180 Ga0500577_0001180_2926_3720 253
437 3300053148 Ga0500590_000281 Ga0500590_000281_1586_2380 253
438 3300053153 Ga0500616_0053160 Ga0500616_0053160_54_848 253
439 3300053156 Ga0500622_0000172 Ga0500622_0000172_51805_52599 253
440 3300053158 Ga0500627_0000127 Ga0500627_0000127_15592_16386 253
441 3300053163 Ga0500639_026870 Ga0500639_026870_40_843 253
442 3300053724 Ga0500570_000563 Ga0500570_000563_3934_4728 253
443 3300053730 Ga0500645_005267 Ga0500645_005267_895_1689 253
444 3300053730 Ga0500645_016825 Ga0500645_016825_1231_2025 253
445 3300053735 Ga0500596_000465 Ga0500596_000465_6109_6939 253
446 3300003752 Ga0055539_1002880 Ga0055539_10028802 254
447 3300005436 Ga0070713_100060518 Ga0070713_1000605182 254
448 3300005617 Ga0068859_100468779 Ga0068859_1004687792 254
449 3300006931 Ga0097620_100468845 Ga0097620_1004688451 254
450 3300009551 Ga0105238_10184432 Ga0105238_101844322 254
451 3300010375 Ga0105239_10021398 Ga0105239_100213987 254
452 3300014326 Ga0157380_10723724 Ga0157380_107237241 254
453 3300021384 Ga0213876_10131643 Ga0213876_101316431 254
454 3300025253 Ga0209677_100644 Ga0209677_1006445 254
455 3300025261 Ga0209233_1000791 Ga0209233_10007914 254
456 3300025272 Ga0209455_1003360 Ga0209455_10033603 254
457 3300025272 Ga0209455_1005077 Ga0209455_10050772 254
458 3300025924 Ga0207694_10077803 Ga0207694_100778032 254
459 3300025928 Ga0207700_10481503 Ga0207700_104815031 254
460 3300025928 Ga0207700_10692257 Ga0207700_106922571 254
461 3300028577 Ga0265318_10047837 Ga0265318_100478372 254
462 3300028653 Ga0265323_10025771 Ga0265323_100257712 254
463 3300028666 Ga0265336_10003085 Ga0265336_100030852 254
464 3300028794 Ga0307515_10000103 Ga0307515_1000010375 254
465 3300028800 Ga0265338_10000328 Ga0265338_1000032871 254
466 3300029957 Ga0265324_10011635 Ga0265324_100116353 254
467 3300035724 Ga0373933_0125499 Ga0373933_0125499_710_1492 254
468 3300039437 Ga0436365_0371724 Ga0436365_0371724_3003_3812 254
469 3300045976 Ga0466967_0408380 Ga0466967_0408380_497_1306 254
470 3300046517 Ga0495630_0120180 Ga0495630_0120180_71_850 254
471 3300048921 Ga0496118_0104571 Ga0496118_0104571_869_1681 254
472 3300048921 Ga0496118_0159568 Ga0496118_0159568_352_1170 254
473 3300048924 Ga0496121_0049639 Ga0496121_0049639_1997_2809 254
474 3300048924 Ga0496121_0130767 Ga0496121_0130767_30_842 254
475 3300048929 Ga0496126_0064964 Ga0496126_0064964_1578_2396 254
476 3300053094 Ga0500566_0002826 Ga0500566_0002826_4379_5197 254
477 3300053136 Ga0500559_0198050 Ga0500559_0198050_113_931 254
478 3300053178 Ga0500637_0000020 Ga0500637_0000020_32452_33270 254
479 3300055283 Ga0500661_000478 Ga0500661_000478_6089_6907 254
480 3300005459 Ga0068867_100108471 Ga0068867_1001084712 255
481 3300005843 Ga0068860_100080142 Ga0068860_1000801422 255
482 3300006048 Ga0075363_100097600 Ga0075363_1000976002 255
483 3300006195 Ga0075366_10004537 Ga0075366_100045373 255
484 3300006846 Ga0075430_100121858 Ga0075430_1001218582 255
485 3300009148 Ga0105243_10182488 Ga0105243_101824881 255
486 3300013296 Ga0157374_10192269 Ga0157374_101922692 255
487 3300014968 Ga0157379_10007612 Ga0157379_100076127 255
488 3300025935 Ga0207709_10067808 Ga0207709_100678082 255
489 3300026089 Ga0207648_10120659 Ga0207648_101206592 255
490 3300028381 Ga0268264_10461769 Ga0268264_104617692 255
491 3300028800 Ga0265338_10001296 Ga0265338_1000129642 255
492 3300031456 Ga0307513_10002845 Ga0307513_1000284514 255
493 3300031456 Ga0307513_10182885 Ga0307513_101828852 255
494 3300031507 Ga0307509_10158527 Ga0307509_101585272 255
495 3300032005 Ga0307411_10095442 Ga0307411_100954422 255
496 3300037466 Ga0395898_0474067 Ga0395898_0474067_222_1124 255
497 3300037471 Ga0395905_0067442 Ga0395905_0067442_1866_2768 255
498 3300042876 Ga0451577_0367131 Ga0451577_0367131_161_1009 255
499 3300046457 Ga0495590_0009707 Ga0495590_0009707_2656_3510 255
500 3300050493 nmdc:mga0k408_256998_c1 nmdc:mga0k408_256998_c1_124_981 255
501 3300050493 nmdc:mga0k408_2699_c1 nmdc:mga0k408_2699_c1_3828_4703 255
502 3300050493 nmdc:mga0k408_71796_c1 nmdc:mga0k408_71796_c1_537_1391 255
503 3300050496 nmdc:mga07m45_35130_c1 nmdc:mga07m45_35130_c1_1735_2610 255
504 3300050508 nmdc:mga09592_1643_c1 nmdc:mga09592_1643_c1_2143_2985 255
505 3300050509 nmdc:mga0qj67_27966_c1 nmdc:mga0qj67_27966_c1_1042_1884 255
506 3300005458 Ga0070681_10122299 Ga0070681_101222993 256
507 iso_pu_bacteria 2508501125 2509130749 257
508 iso_pu_bacteria 2510065045 2510252489 257
509 iso_pu_bacteria 2512047030 2512348345 257
510 iso_pu_bacteria 2513237151 2513962695 257
511 iso_pu_bacteria 2513237166 2514053188 257
512 iso_pu_bacteria 2515154122 2515684762 257
513 iso_pu_bacteria 2515154123 2515690828 257
514 iso_pu_bacteria 2519103095 2519457649 257
515 iso_pu_bacteria 2526164713 2527079932 257
516 iso_pu_bacteria 2562617112 2563061625 257
517 iso_pu_bacteria 2582581311 2585294032 257
518 iso_pu_bacteria 2599185239 2599741173 257
519 iso_pu_bacteria 2599185240 2599747730 257
520 iso_pu_bacteria 2599185355 2600209735 257
521 iso_pu_bacteria 2675903129 2676745912 257
522 iso_pu_bacteria 2711768613 2713478508 257
523 iso_pu_bacteria 2718217991 2719641587 257
524 iso_pu_bacteria 2738541296 2738824582 257
525 iso_pu_bacteria 2738541298 2738837049 257
526 iso_pu_bacteria 2738541306 2738878579 257
527 iso_pu_bacteria 2738543002 2739190271 257
528 iso_pu_bacteria 2738543008 2739225172 257
529 iso_pu_bacteria 2744054900 2746087322 257
530 iso_pu_bacteria 2744054901 2746093171 257
531 iso_pu_bacteria 2751185846 2753566073 257
532 iso_pu_bacteria 2791355137 2792832836 257
533 iso_pu_bacteria 2808606384 2808972969 257
534 iso_pu_bacteria 2808606390 2809007866 257
535 iso_pu_bacteria 2808606391 2809015494 257
536 iso_pu_bacteria 2816332253 2817259842 257
537 iso_pu_bacteria 2816332256 2817277504 257
538 iso_pu_bacteria 2816332286 2817456637 257
539 iso_pu_bacteria 2818991450 2819624260 257
540 iso_pu_bacteria 2818991452 2819637028 257
541 iso_pu_bacteria 2842324504 2842332088 257
542 iso_pu_bacteria 2842348783 2842356460 257
543 iso_pu_bacteria 2842454564 2842461186 257
544 iso_pu_bacteria 2863421361 2863426370 257
545 iso_pu_bacteria 2870068957 2870069257 257
546 iso_pu_bacteria 2885270888 2885272463 257
547 iso_pu_bacteria 2900634093 2900637169 257
548 iso_pu_bacteria 2902682994 2902686776 257
549 iso_pu_bacteria 2904483920 2904490215 257
550 iso_pu_bacteria 2904564687 2904569515 257
551 iso_pu_bacteria 2904571731 2904576648 257
552 iso_pu_bacteria 2919527303 2919533385 257
553 iso_pu_bacteria 2921643360 2921655467 257
554 iso_pu_bacteria 2928108538 2928114114 257
555 iso_pu_bacteria 2928135762 2928141138 257
556 iso_pu_bacteria 2928157003 2928163179 257
557 iso_pu_bacteria 2928163908 2928170075 257
558 iso_pu_bacteria 2928170801 2928176184 257
559 iso_pu_bacteria 2928503688 2928509109 257
560 iso_pu_bacteria 2928536128 2928542136 257
561 iso_pu_bacteria 2945934425 2945934467 257
562 iso_pu_bacteria 2981990288 2981995970 257
563 iso_pu_bacteria 2990703756 2990704973 257
564 iso_pu_bacteria 641736151 642427079 257
565 iso_pu_bacteria 641736154 642418385 257
566 iso_pu_bacteria 642555112 642594520 257
567 iso_pu_bacteria 642555113 642623105 257
568 iso_pu_bacteria 8018845410 8018848774 257
569 iso_pu_bacteria 8020807995 8020810813 257
570 iso_pu_bacteria 8020938398 8020938910 257
571 iso_pu_bacteria 8020945358 8020950452 257
572 iso_pu_bacteria 8020953355 8020953546 257
573 iso_pu_bacteria 8021120328 8021127929 257
574 iso_pu_bacteria 8039098773 8039102044 257
575 iso_pu_bacteria 8040167225 8040172660 257
576 iso_pu_bacteria 8040173305 8040176382 257
577 iso_pu_bacteria 8055301274 8055307315 257
578 iso_pu_bacteria 2501025501 2501070349 258
579 iso_pu_bacteria 2501025502 2501084028 258
580 iso_pu_bacteria 2501025504 2501412715 258
581 iso_pu_bacteria 2510917013 2511093417 258
582 iso_pu_bacteria 2510917014 2511099867 258
583 iso_pu_bacteria 2510917015 2511102348 258
584 iso_pu_bacteria 2515154189 2516024930 258
585 iso_pu_bacteria 2856287931 2856289317 258
586 iso_pu_bacteria 2857357740 2857362175 258
587 iso_pu_bacteria 2883087390 2883094861 258
588 3300013105 Ga0157369_10000410 Ga0157369_1000041029 259
589 3300020081 Ga0206354_10237220 Ga0206354_102372202 259
590 3300020082 Ga0206353_10068211 Ga0206353_100682112 259
591 3300037312 Ga0395899_0107386 Ga0395899_0107386_657_1436 259
592 3300037418 Ga0395900_0000411 Ga0395900_0000411_58587_59366 259
593 3300037418 Ga0395900_0066243 Ga0395900_0066243_905_1684 259
594 3300037418 Ga0395900_0097596 Ga0395900_0097596_1915_2694 259
595 3300037466 Ga0395898_0000559 Ga0395898_0000559_14388_15167 259
596 3300037466 Ga0395898_0159522 Ga0395898_0159522_483_1262 259
597 3300038443 Ga0395901_0000328 Ga0395901_0000328_55570_56349 259
598 3300038443 Ga0395901_0141800 Ga0395901_0141800_858_1637 259
599 3300044694 Ga0466963_0003869 Ga0466963_0003869_3126_3905 259
600 3300044719 Ga0466971_0001186 Ga0466971_0001186_8033_8812 259
601 3300045836 Ga0466958_0005251 Ga0466958_0005251_3128_3907 259
602 3300046471 Ga0495650_0072034 Ga0495650_0072034_562_1341 259
603 3300061719 Ga0466962_0004735 Ga0466962_0004735_1849_2628 259
604 3300003320 rootH2_10253312 rootH2_102533122 260
605 3300013104 Ga0157370_10000439 Ga0157370_1000043926 260
606 3300013105 Ga0157369_10001022 Ga0157369_1000102212 260
607 3300020080 Ga0206350_11077195 Ga0206350_110771953 260
608 3300020081 Ga0206354_10883746 Ga0206354_108837463 260
609 3300020082 Ga0206353_10562420 Ga0206353_105624206 260
610 3300022467 Ga0224712_10000055 Ga0224712_100000559 260
611 3300025932 Ga0207690_10060622 Ga0207690_100606224 260
612 3300037312 Ga0395899_0000080 Ga0395899_0000080_38691_39473 260
613 3300037418 Ga0395900_0000087 Ga0395900_0000087_132096_132878 260
614 3300037418 Ga0395900_0161091 Ga0395900_0161091_1453_2235 260
615 3300037466 Ga0395898_0000679 Ga0395898_0000679_38691_39473 260
616 3300038443 Ga0395901_0001663 Ga0395901_0001663_18293_19075 260
617 3300044656 Ga0466969_0214799 Ga0466969_0214799_45_827 260
618 3300044684 Ga0466966_0000058 Ga0466966_0000058_40068_40850 260
619 3300044684 Ga0466966_0003945 Ga0466966_0003945_7467_8249 260
620 3300044693 Ga0466961_0000204 Ga0466961_0000204_14704_15486 260
621 3300044694 Ga0466963_0036883 Ga0466963_0036883_2333_3115 260
622 3300044706 Ga0466964_0204704 Ga0466964_0204704_151_933 260
623 3300044719 Ga0466971_0074685 Ga0466971_0074685_686_1468 260
624 3300044735 Ga0466968_0028681 Ga0466968_0028681_1311_2093 260
625 3300044765 Ga0466970_0030302 Ga0466970_0030302_1370_2152 260
626 3300044842 Ga0466957_0002537 Ga0466957_0002537_8177_8959 260
627 3300045049 Ga0466959_0095700 Ga0466959_0095700_691_1473 260
628 3300045049 Ga0466959_0286590 Ga0466959_0286590_129_911 260
629 3300061719 Ga0466962_0004545 Ga0466962_0004545_5771_6553 260
630 iso_pu_bacteria 2600255067 2600813930 260
631 3300001989 JGI24739J22299_10029710 JGI24739J22299_100297102 261
632 3300001989 JGI24739J22299_10038296 JGI24739J22299_100382962 261
633 3300001990 JGI24737J22298_10012651 JGI24737J22298_100126512 261
634 3300002067 JGI24735J21928_10006038 JGI24735J21928_100060383 261
635 3300002067 JGI24735J21928_10006346 JGI24735J21928_100063462 261
636 3300002067 JGI24735J21928_10101600 JGI24735J21928_101016001 261
637 3300002705 JGI25156J39149_1005451 JGI25156J39149_10054512 261
638 3300003320 rootH2_10255524 rootH2_102555242 261
639 3300003323 rootH1_10176638 rootH1_101766384 261
640 3300003756 Ga0055533_1002644 Ga0055533_10026443 261
641 3300003758 Ga0055532_1000718 Ga0055532_100071812 261
642 3300003758 Ga0055532_1004042 Ga0055532_10040423 261
643 3300003758 Ga0055532_1004063 Ga0055532_10040633 261
644 3300003760 Ga0055527_1003540 Ga0055527_10035403 261
645 3300003760 Ga0055527_1003554 Ga0055527_10035542 261
646 3300003761 Ga0055535_1006604 Ga0055535_10066043 261
647 3300003761 Ga0055535_1006637 Ga0055535_10066373 261
648 3300003762 Ga0055542_1004393 Ga0055542_10043935 261
649 3300003762 Ga0055542_1006925 Ga0055542_10069253 261
650 3300003763 Ga0055529_1003991 Ga0055529_10039913 261
651 3300003763 Ga0055529_1003997 Ga0055529_10039973 261
652 3300003790 Ga0055528_1001636 Ga0055528_10016366 261
653 3300003856 Ga0058692_1004095 Ga0058692_10040954 261
654 3300005262 Ga0065165_1000648 Ga0065165_100064844 261
655 3300005331 Ga0070670_100305927 Ga0070670_1003059272 261
656 3300005339 Ga0070660_100000204 Ga0070660_10000020440 261
657 3300005339 Ga0070660_100001152 Ga0070660_1000011528 261
658 3300005344 Ga0070661_100087551 Ga0070661_1000875512 261
659 3300005366 Ga0070659_100000156 Ga0070659_10000015639 261
660 3300005367 Ga0070667_100027200 Ga0070667_1000272006 261
661 3300005455 Ga0070663_100007485 Ga0070663_1000074857 261
662 3300005455 Ga0070663_100011786 Ga0070663_1000117862 261
663 3300005456 Ga0070678_100461535 Ga0070678_1004615352 261
664 3300005563 Ga0068855_100004044 Ga0068855_1000040449 261
665 3300005563 Ga0068855_100074923 Ga0068855_1000749234 261
666 3300005577 Ga0068857_100529192 Ga0068857_1005291921 261
667 3300005616 Ga0068852_100025272 Ga0068852_1000252722 261
668 3300005844 Ga0068862_100506019 Ga0068862_1005060192 261
669 3300009011 Ga0105251_10000758 Ga0105251_1000075820 261
670 3300009011 Ga0105251_10001262 Ga0105251_100012626 261
671 3300009011 Ga0105251_10081877 Ga0105251_100818771 261
672 3300009036 Ga0105244_10178424 Ga0105244_101784242 261
673 3300009092 Ga0105250_10026968 Ga0105250_100269683 261
674 3300009092 Ga0105250_10096753 Ga0105250_100967531 261
675 3300009093 Ga0105240_10001922 Ga0105240_1000192225 261
676 3300009093 Ga0105240_10029364 Ga0105240_100293643 261
677 3300009093 Ga0105240_10031832 Ga0105240_100318323 261
678 3300009093 Ga0105240_10315871 Ga0105240_103158712 261
679 3300009174 Ga0105241_10458896 Ga0105241_104588961 261
680 3300009177 Ga0105248_10020642 Ga0105248_100206422 261
681 3300009177 Ga0105248_10077726 Ga0105248_100777262 261
682 3300009545 Ga0105237_10021860 Ga0105237_100218602 261
683 3300009545 Ga0105237_10097080 Ga0105237_100970804 261
684 3300009551 Ga0105238_10013695 Ga0105238_100136952 261
685 3300009551 Ga0105238_10195917 Ga0105238_101959172 261
686 3300009551 Ga0105238_10244838 Ga0105238_102448382 261
687 3300010375 Ga0105239_10003468 Ga0105239_100034688 261
688 3300010375 Ga0105239_10119618 Ga0105239_101196182 261
689 3300010375 Ga0105239_10547472 Ga0105239_105474722 261
690 3300013100 Ga0157373_10008296 Ga0157373_100082966 261
691 3300013104 Ga0157370_10002253 Ga0157370_1000225314 261
692 3300013104 Ga0157370_10118451 Ga0157370_101184512 261
693 3300013105 Ga0157369_10001007 Ga0157369_1000100721 261
694 3300013105 Ga0157369_10060127 Ga0157369_100601273 261
695 3300013105 Ga0157369_10120622 Ga0157369_101206222 261
696 3300013296 Ga0157374_10000146 Ga0157374_1000014623 261
697 3300013306 Ga0163162_10000877 Ga0163162_100008779 261
698 3300013307 Ga0157372_10000323 Ga0157372_100003232 261
699 3300013307 Ga0157372_10066434 Ga0157372_100664342 261
700 3300014497 Ga0182008_10068800 Ga0182008_100688001 261
701 3300014497 Ga0182008_10117141 Ga0182008_101171411 261
702 3300015261 Ga0182006_1078219 Ga0182006_10782192 261
703 3300015262 Ga0182007_10003995 Ga0182007_100039952 261
704 3300015265 Ga0182005_1015290 Ga0182005_10152902 261
705 3300016635 Ga0183361_10015 Ga0183361_10015141 261
706 3300025206 Ga0209435_102614 Ga0209435_1026142 261
707 3300025225 Ga0209566_101192 Ga0209566_1011923 261
708 3300025226 Ga0209674_100260 Ga0209674_1002602 261
709 3300025226 Ga0209674_104036 Ga0209674_1040362 261
710 3300025228 Ga0209672_100054 Ga0209672_10005440 261
711 3300025228 Ga0209672_100072 Ga0209672_100072127 261
712 3300025228 Ga0209672_100185 Ga0209672_10018528 261
713 3300025229 Ga0209147_100085 Ga0209147_100085150 261
714 3300025229 Ga0209147_100100 Ga0209147_100100119 261
715 3300025229 Ga0209147_100278 Ga0209147_10027825 261
716 3300025242 Ga0209258_100168 Ga0209258_100168149 261
717 3300025242 Ga0209258_100331 Ga0209258_10033128 261
718 3300025254 Ga0209148_1001174 Ga0209148_100117412 261
719 3300025256 Ga0209759_1000351 Ga0209759_100035143 261
720 3300025256 Ga0209759_1000502 Ga0209759_100050239 261
721 3300025256 Ga0209759_1021861 Ga0209759_10218612 261
722 3300025263 Ga0209565_1018615 Ga0209565_10186152 261
723 3300025272 Ga0209455_1000279 Ga0209455_100027937 261
724 3300025273 Ga0209673_1000098 Ga0209673_100009841 261
725 3300025295 Ga0209564_1007078 Ga0209564_10070784 261
726 3300025302 Ga0207426_1000199 Ga0207426_1000199115 261
727 3300025711 Ga0207696_1019421 Ga0207696_10194212 261
728 3300025735 Ga0207713_1000186 Ga0207713_100018655 261
729 3300025735 Ga0207713_1023306 Ga0207713_10233062 261
730 3300025903 Ga0207680_10016281 Ga0207680_100162812 261
731 3300025904 Ga0207647_10000126 Ga0207647_1000012664 261
732 3300025904 Ga0207647_10005134 Ga0207647_100051342 261
733 3300025904 Ga0207647_10007932 Ga0207647_100079322 261
734 3300025904 Ga0207647_10046048 Ga0207647_100460482 261
735 3300025911 Ga0207654_10278119 Ga0207654_102781191 261
736 3300025913 Ga0207695_10000971 Ga0207695_1000097128 261
737 3300025913 Ga0207695_10004600 Ga0207695_100046006 261
738 3300025913 Ga0207695_10005877 Ga0207695_100058779 261
739 3300025913 Ga0207695_10177134 Ga0207695_101771343 261
740 3300025914 Ga0207671_10067446 Ga0207671_100674462 261
741 3300025914 Ga0207671_10108323 Ga0207671_101083232 261
742 3300025914 Ga0207671_10256833 Ga0207671_102568332 261
743 3300025919 Ga0207657_10000096 Ga0207657_1000009639 261
744 3300025919 Ga0207657_10006312 Ga0207657_100063122 261
745 3300025924 Ga0207694_10194661 Ga0207694_101946611 261
746 3300025924 Ga0207694_10342557 Ga0207694_103425572 261
747 3300025931 Ga0207644_10148919 Ga0207644_101489192 261
748 3300025932 Ga0207690_10000074 Ga0207690_1000007440 261
749 3300025941 Ga0207711_10014166 Ga0207711_100141664 261
750 3300025949 Ga0207667_10018190 Ga0207667_100181902 261
751 3300025949 Ga0207667_10070621 Ga0207667_100706212 261
752 3300025949 Ga0207667_10460213 Ga0207667_104602131 261
753 3300025981 Ga0207640_10342737 Ga0207640_103427371 261
754 3300025986 Ga0207658_10133928 Ga0207658_101339283 261
755 3300026067 Ga0207678_10000061 Ga0207678_1000006141 261
756 3300026067 Ga0207678_10113488 Ga0207678_101134882 261
757 3300026067 Ga0207678_10290489 Ga0207678_102904892 261
758 3300026067 Ga0207678_10325757 Ga0207678_103257572 261
759 3300026116 Ga0207674_10413453 Ga0207674_104134531 261
760 3300026121 Ga0207683_10473685 Ga0207683_104736852 261
761 3300026142 Ga0207698_10010491 Ga0207698_100104915 261
762 3300027312 Ga0209371_1000141 Ga0209371_100014186 261
763 3300027312 Ga0209371_1001782 Ga0209371_100178213 261
764 3300028380 Ga0268265_10659145 Ga0268265_106591451 261
765 3300030500 Ga0268256_1000418 Ga0268256_10004186 261
766 3300030500 Ga0268256_1007322 Ga0268256_10073224 261
767 3300031548 Ga0307408_100000422 Ga0307408_10000042231 261
768 3300031911 Ga0307412_10000056 Ga0307412_10000056121 261
769 3300031911 Ga0307412_10124282 Ga0307412_101242822 261
770 3300031995 Ga0307409_100024795 Ga0307409_1000247955 261
771 3300037418 Ga0395900_0042730 Ga0395900_0042730_394_1185 261
772 3300037418 Ga0395900_0594919 Ga0395900_0594919_199_990 261
773 3300037466 Ga0395898_0009374 Ga0395898_0009374_4124_4915 261
774 3300039437 Ga0436365_1636570 Ga0436365_1636570_859_1773 261
775 3300039447 Ga0436361_0870638 Ga0436361_0870638_1744_2544 261
776 3300042005 Ga0439448_0000429 Ga0439448_0000429_2180_2971 261
777 3300044656 Ga0466969_0000833 Ga0466969_0000833_5360_6148 261
778 3300044659 Ga0466973_0070919 Ga0466973_0070919_1552_2340 261
779 3300044684 Ga0466966_0194802 Ga0466966_0194802_193_978 261
780 3300044693 Ga0466961_0000224 Ga0466961_0000224_4340_5128 261
781 3300044693 Ga0466961_0132237 Ga0466961_0132237_411_1268 261
782 3300044693 Ga0466961_0177919 Ga0466961_0177919_204_995 261
783 3300044735 Ga0466968_0030208 Ga0466968_0030208_1112_1900 261
784 3300044765 Ga0466970_0001740 Ga0466970_0001740_8792_9583 261
785 3300044765 Ga0466970_0015169 Ga0466970_0015169_2085_2873 261
786 3300044842 Ga0466957_0000621 Ga0466957_0000621_4467_5255 261
787 3300045049 Ga0466959_0005343 Ga0466959_0005343_3148_3939 261
788 3300046455 Ga0495603_0037122 Ga0495603_0037122_241_1026 261
789 3300046455 Ga0495603_0061077 Ga0495603_0061077_302_1087 261
790 3300046455 Ga0495603_0063725 Ga0495603_0063725_422_1207 261
791 3300046455 Ga0495603_0076487 Ga0495603_0076487_952_1737 261
792 3300046457 Ga0495590_0003243 Ga0495590_0003243_5342_6127 261
793 3300046459 Ga0495629_0000309 Ga0495629_0000309_177_962 261
794 3300046459 Ga0495629_0000625 Ga0495629_0000625_10364_11149 261
795 3300046459 Ga0495629_0002634 Ga0495629_0002634_2073_2858 261
796 3300046459 Ga0495629_0003835 Ga0495629_0003835_8629_9414 261
797 3300046460 Ga0495638_0000875 Ga0495638_0000875_10265_11050 261
798 3300046460 Ga0495638_0026681 Ga0495638_0026681_1065_1850 261
799 3300046461 Ga0495641_0053756 Ga0495641_0053756_695_1480 261
800 3300046461 Ga0495641_0111852 Ga0495641_0111852_194_979 261
801 3300046462 Ga0495651_0010274 Ga0495651_0010274_4259_5044 261
802 3300046462 Ga0495651_0087012 Ga0495651_0087012_1025_1810 261
803 3300046462 Ga0495651_0102367 Ga0495651_0102367_875_1660 261
804 3300046462 Ga0495651_0327166 Ga0495651_0327166_34_819 261
805 3300046463 Ga0495653_0003799 Ga0495653_0003799_2083_2868 261
806 3300046463 Ga0495653_0047038 Ga0495653_0047038_2377_3162 261
807 3300046463 Ga0495653_0072119 Ga0495653_0072119_241_1026 261
808 3300046463 Ga0495653_0155902 Ga0495653_0155902_14_799 261
809 3300046463 Ga0495653_0183391 Ga0495653_0183391_514_1299 261
810 3300046471 Ga0495650_0001711 Ga0495650_0001711_10494_11279 261
811 3300046471 Ga0495650_0010003 Ga0495650_0010003_2602_3387 261
812 3300046471 Ga0495650_0038166 Ga0495650_0038166_1033_1818 261
813 3300046471 Ga0495650_0039764 Ga0495650_0039764_1104_1889 261
814 3300046472 Ga0495580_0000302 Ga0495580_0000302_29313_30098 261
815 3300046472 Ga0495580_0001573 Ga0495580_0001573_14510_15295 261
816 3300046472 Ga0495580_0009825 Ga0495580_0009825_6016_6801 261
817 3300046472 Ga0495580_0014037 Ga0495580_0014037_2128_2913 261
818 3300046472 Ga0495580_0016553 Ga0495580_0016553_3611_4396 261
819 3300046472 Ga0495580_0027489 Ga0495580_0027489_178_963 261
820 3300046473 Ga0495582_0005015 Ga0495582_0005015_4250_5035 261
821 3300046473 Ga0495582_0065691 Ga0495582_0065691_1065_1850 261
822 3300046474 Ga0495605_0002667 Ga0495605_0002667_8186_8971 261
823 3300046474 Ga0495605_0009236 Ga0495605_0009236_239_1024 261
824 3300046474 Ga0495605_0010282 Ga0495605_0010282_610_1395 261
825 3300046474 Ga0495605_0028952 Ga0495605_0028952_346_1131 261
826 3300046475 Ga0495639_0134711 Ga0495639_0134711_38_823 261
827 3300046476 Ga0495662_0022988 Ga0495662_0022988_1366_2151 261
828 3300046476 Ga0495662_0061546 Ga0495662_0061546_363_1148 261
829 3300046476 Ga0495662_0064588 Ga0495662_0064588_464_1249 261
830 3300046477 Ga0495664_0001157 Ga0495664_0001157_10708_11493 261
831 3300046477 Ga0495664_0012877 Ga0495664_0012877_2063_2848 261
832 3300046492 Ga0495585_0046538 Ga0495585_0046538_437_1222 261
833 3300046499 Ga0495594_0027143 Ga0495594_0027143_937_1722 261
834 3300046500 Ga0495596_0001981 Ga0495596_0001981_5134_5919 261
835 3300046500 Ga0495596_0051859 Ga0495596_0051859_710_1495 261
836 3300046501 Ga0495607_0154216 Ga0495607_0154216_53_838 261
837 3300046506 Ga0495583_0004759 Ga0495583_0004759_8303_9088 261
838 3300046507 Ga0495606_0019943 Ga0495606_0019943_2081_2866 261
839 3300046507 Ga0495606_0035281 Ga0495606_0035281_1414_2199 261
840 3300046507 Ga0495606_0067238 Ga0495606_0067238_848_1633 261
841 3300046507 Ga0495606_0197918 Ga0495606_0197918_217_1002 261
842 3300046511 Ga0495608_0002463 Ga0495608_0002463_4278_5063 261
843 3300046511 Ga0495608_0013647 Ga0495608_0013647_599_1384 261
844 3300046512 Ga0495610_0001399 Ga0495610_0001399_775_1560 261
845 3300046514 Ga0495618_0005667 Ga0495618_0005667_3247_4032 261
846 3300046514 Ga0495618_0011010 Ga0495618_0011010_2607_3392 261
847 3300046516 Ga0495628_0019540 Ga0495628_0019540_2732_3517 261
848 3300046516 Ga0495628_0022733 Ga0495628_0022733_589_1374 261
849 3300046516 Ga0495628_0121769 Ga0495628_0121769_147_932 261
850 3300046516 Ga0495628_0223216 Ga0495628_0223216_396_1181 261
851 3300046517 Ga0495630_0084812 Ga0495630_0084812_1146_1931 261
852 3300046517 Ga0495630_0192089 Ga0495630_0192089_687_1472 261
853 3300046517 Ga0495630_0409124 Ga0495630_0409124_191_976 261
854 3300046522 Ga0495643_0023390 Ga0495643_0023390_2088_2873 261
855 3300046524 Ga0495648_0040724 Ga0495648_0040724_799_1584 261
856 3300046524 Ga0495648_0071733 Ga0495648_0071733_436_1221 261
857 3300046524 Ga0495648_0107219 Ga0495648_0107219_705_1490 261
858 3300046524 Ga0495648_0112160 Ga0495648_0112160_584_1369 261
859 3300046526 Ga0495666_0001199 Ga0495666_0001199_7710_8495 261
860 3300046526 Ga0495666_0006920 Ga0495666_0006920_2221_3006 261
861 3300046526 Ga0495666_0016418 Ga0495666_0016418_660_1445 261
862 3300046526 Ga0495666_0043695 Ga0495666_0043695_411_1196 261
863 3300046526 Ga0495666_0083087 Ga0495666_0083087_128_913 261
864 3300046529 Ga0495652_0010784 Ga0495652_0010784_5589_6374 261
865 3300046529 Ga0495652_0013894 Ga0495652_0013894_589_1374 261
866 3300046529 Ga0495652_0098010 Ga0495652_0098010_240_1025 261
867 3300046529 Ga0495652_0156120 Ga0495652_0156120_212_997 261
868 3300046530 Ga0495654_0064725 Ga0495654_0064725_447_1232 261
869 3300046530 Ga0495654_0119728 Ga0495654_0119728_332_1117 261
870 3300046531 Ga0495665_0007143 Ga0495665_0007143_3776_4561 261
871 3300046531 Ga0495665_0017791 Ga0495665_0017791_244_1029 261
872 3300046531 Ga0495665_0019537 Ga0495665_0019537_1492_2277 261
873 3300046531 Ga0495665_0043147 Ga0495665_0043147_1290_2075 261
874 3300046531 Ga0495665_0095573 Ga0495665_0095573_179_964 261
875 3300046533 Ga0495640_0016145 Ga0495640_0016145_2674_3459 261
876 3300046533 Ga0495640_0022717 Ga0495640_0022717_861_1646 261
877 3300046533 Ga0495640_0134679 Ga0495640_0134679_458_1243 261
878 3300046535 Ga0495586_0000830 Ga0495586_0000830_13080_13865 261
879 3300046535 Ga0495586_0020449 Ga0495586_0020449_2702_3487 261
880 3300046536 Ga0495587_0003407 Ga0495587_0003407_6495_7280 261
881 3300046536 Ga0495587_0037840 Ga0495587_0037840_2078_2863 261
882 3300046543 Ga0495645_0001202 Ga0495645_0001202_2835_3620 261
883 3300046543 Ga0495645_0001234 Ga0495645_0001234_6627_7412 261
884 3300046543 Ga0495645_0017810 Ga0495645_0017810_3184_3969 261
885 3300046543 Ga0495645_0109585 Ga0495645_0109585_568_1353 261
886 3300046557 Ga0495622_0000416 Ga0495622_0000416_11249_12034 261
887 3300046557 Ga0495622_0119980 Ga0495622_0119980_93_878 261
888 3300046559 Ga0495667_0082886 Ga0495667_0082886_36_821 261
889 3300046642 Ga0495634_0014012 Ga0495634_0014012_2593_3378 261
890 3300046642 Ga0495634_0021151 Ga0495634_0021151_15_800 261
891 3300046642 Ga0495634_0046559 Ga0495634_0046559_1282_2067 261
892 3300046648 Ga0495611_0054433 Ga0495611_0054433_985_1770 261
893 3300046663 Ga0495635_0000986 Ga0495635_0000986_13953_14738 261
894 3300046663 Ga0495635_0004865 Ga0495635_0004865_5993_6778 261
895 3300046663 Ga0495635_0045947 Ga0495635_0045947_942_1727 261
896 3300046665 Ga0495661_0001100 Ga0495661_0001100_12146_12931 261
897 3300046665 Ga0495661_0009353 Ga0495661_0009353_5410_6195 261
898 3300046665 Ga0495661_0027764 Ga0495661_0027764_421_1206 261
899 3300046674 Ga0495588_0028684 Ga0495588_0028684_1492_2277 261
900 3300046678 Ga0495599_0009795 Ga0495599_0009795_4274_5059 261
901 3300046678 Ga0495599_0017908 Ga0495599_0017908_830_1615 261
902 3300046678 Ga0495599_0123309 Ga0495599_0123309_746_1531 261
903 3300046679 Ga0495623_0002524 Ga0495623_0002524_2395_3180 261
904 3300046679 Ga0495623_0007636 Ga0495623_0007636_5389_6174 261
905 3300046679 Ga0495623_0023038 Ga0495623_0023038_1109_1894 261
906 3300046679 Ga0495623_0140124 Ga0495623_0140124_292_1077 261
907 3300046680 Ga0495646_0002312 Ga0495646_0002312_3008_3793 261
908 3300046680 Ga0495646_0003646 Ga0495646_0003646_661_1446 261
909 3300046680 Ga0495646_0005817 Ga0495646_0005817_4922_5707 261
910 3300046680 Ga0495646_0026685 Ga0495646_0026685_2693_3478 261
911 3300046680 Ga0495646_0187937 Ga0495646_0187937_16_801 261
912 3300046684 Ga0495669_0029409 Ga0495669_0029409_448_1233 261
913 3300046684 Ga0495669_0062496 Ga0495669_0062496_86_871 261
914 3300046689 Ga0495613_0000699 Ga0495613_0000699_14082_14867 261
915 3300046689 Ga0495613_0001221 Ga0495613_0001221_10687_11472 261
916 3300046689 Ga0495613_0412259 Ga0495613_0412259_43_828 261
917 3300046690 Ga0495624_0028174 Ga0495624_0028174_1156_1941 261
918 3300046690 Ga0495624_0031854 Ga0495624_0031854_241_1026 261
919 3300046690 Ga0495624_0036841 Ga0495624_0036841_1337_2122 261
920 3300046690 Ga0495624_0052917 Ga0495624_0052917_1068_1853 261
921 3300046690 Ga0495624_0074205 Ga0495624_0074205_605_1390 261
922 3300046690 Ga0495624_0082759 Ga0495624_0082759_1024_1809 261
923 3300046690 Ga0495624_0264272 Ga0495624_0264272_240_1025 261
924 3300046691 Ga0495670_0061459 Ga0495670_0061459_693_1478 261
925 3300046694 Ga0495649_0022385 Ga0495649_0022385_1205_1990 261
926 3300046694 Ga0495649_0050840 Ga0495649_0050840_911_1696 261
927 3300046794 Ga0495589_0001288 Ga0495589_0001288_11881_12666 261
928 3300046794 Ga0495589_0003149 Ga0495589_0003149_6983_7768 261
929 3300046794 Ga0495589_0043248 Ga0495589_0043248_705_1490 261
930 3300046809 Ga0495600_0003931 Ga0495600_0003931_239_1024 261
931 3300046809 Ga0495600_0005333 Ga0495600_0005333_1278_2063 261
932 3300046810 Ga0495660_0029848 Ga0495660_0029848_1275_2060 261
933 3300046810 Ga0495660_0096562 Ga0495660_0096562_690_1475 261
934 3300047315 Ga0495581_0000663 Ga0495581_0000663_5013_5798 261
935 3300047315 Ga0495581_0006131 Ga0495581_0006131_2289_3074 261
936 3300047315 Ga0495581_0016518 Ga0495581_0016518_1289_2074 261
937 3300047317 Ga0495604_0004307 Ga0495604_0004307_8401_9186 261
938 3300047317 Ga0495604_0018287 Ga0495604_0018287_2603_3388 261
939 3300047317 Ga0495604_0037638 Ga0495604_0037638_2444_3229 261
940 3300047317 Ga0495604_0055582 Ga0495604_0055582_956_1741 261
941 3300047317 Ga0495604_0079211 Ga0495604_0079211_12_797 261
942 3300047319 Ga0495674_0027200 Ga0495674_0027200_3910_4695 261
943 3300047319 Ga0495674_0060517 Ga0495674_0060517_115_900 261
944 3300047319 Ga0495674_0063290 Ga0495674_0063290_2211_2996 261
945 3300047319 Ga0495674_0070202 Ga0495674_0070202_1029_1814 261
946 3300047319 Ga0495674_0093373 Ga0495674_0093373_937_1722 261
947 3300047319 Ga0495674_0146060 Ga0495674_0146060_1024_1809 261
948 3300047319 Ga0495674_0198659 Ga0495674_0198659_806_1591 261
949 3300047320 Ga0495672_0131500 Ga0495672_0131500_384_1169 261
950 3300047321 Ga0495676_0046877 Ga0495676_0046877_2571_3356 261
951 3300047321 Ga0495676_0066032 Ga0495676_0066032_93_878 261
952 3300047321 Ga0495676_0085241 Ga0495676_0085241_1377_2162 261
953 3300047321 Ga0495676_0181988 Ga0495676_0181988_64_849 261
954 3300047322 Ga0495680_0003458 Ga0495680_0003458_4453_5238 261
955 3300047322 Ga0495680_0012704 Ga0495680_0012704_240_1025 261
956 3300047322 Ga0495680_0069916 Ga0495680_0069916_1032_1817 261
957 3300047322 Ga0495680_0124547 Ga0495680_0124547_733_1518 261
958 3300047323 Ga0495683_0002777 Ga0495683_0002777_5720_6505 261
959 3300047323 Ga0495683_0007542 Ga0495683_0007542_2071_2856 261
960 3300047323 Ga0495683_0012486 Ga0495683_0012486_194_979 261
961 3300047323 Ga0495683_0014509 Ga0495683_0014509_89_874 261
962 3300047323 Ga0495683_0016995 Ga0495683_0016995_857_1642 261
963 3300047323 Ga0495683_0071782 Ga0495683_0071782_889_1674 261
964 3300047323 Ga0495683_0096904 Ga0495683_0096904_141_926 261
965 3300047323 Ga0495683_0138861 Ga0495683_0138861_145_930 261
966 3300047323 Ga0495683_0214739 Ga0495683_0214739_24_809 261
967 3300047443 Ga0495687_000419 Ga0495687_000419_17476_18261 261
968 3300047443 Ga0495687_006987 Ga0495687_006987_169_954 261
969 3300047443 Ga0495687_032079 Ga0495687_032079_653_1438 261
970 3300047443 Ga0495687_059797 Ga0495687_059797_233_1018 261
971 3300047443 Ga0495687_127075 Ga0495687_127075_69_854 261
972 3300047444 Ga0495675_0001691 Ga0495675_0001691_11778_12563 261
973 3300047444 Ga0495675_0006134 Ga0495675_0006134_532_1317 261
974 3300047444 Ga0495675_0016472 Ga0495675_0016472_1249_2034 261
975 3300047444 Ga0495675_0167805 Ga0495675_0167805_427_1212 261
976 3300047446 Ga0495679_000271 Ga0495679_000271_2429_3214 261
977 3300047446 Ga0495679_009458 Ga0495679_009458_853_1638 261
978 3300047447 Ga0495685_061841 Ga0495685_061841_250_1035 261
979 3300047469 Ga0495673_0015862 Ga0495673_0015862_2112_2897 261
980 3300047469 Ga0495673_0056281 Ga0495673_0056281_500_1285 261
981 3300047471 Ga0495684_0031282 Ga0495684_0031282_2235_3020 261
982 3300047471 Ga0495684_0139743 Ga0495684_0139743_985_1770 261
983 3300047472 Ga0495686_0000540 Ga0495686_0000540_15403_16188 261
984 3300047472 Ga0495686_0030290 Ga0495686_0030290_1914_2699 261
985 3300047673 Ga0495593_0009056 Ga0495593_0009056_2075_2860 261
986 3300047673 Ga0495593_0010249 Ga0495593_0010249_2540_3325 261
987 3300047673 Ga0495593_0015012 Ga0495593_0015012_3051_3836 261
988 3300047673 Ga0495593_0057770 Ga0495593_0057770_776_1561 261
989 3300047673 Ga0495593_0077371 Ga0495593_0077371_795_1580 261
990 3300048088 Ga0495602_0005453 Ga0495602_0005453_2119_2904 261
991 3300048088 Ga0495602_0036088 Ga0495602_0036088_1395_2180 261
992 3300048088 Ga0495602_0067720 Ga0495602_0067720_1416_2201 261
993 3300048088 Ga0495602_0096917 Ga0495602_0096917_1154_1939 261
994 3300048088 Ga0495602_0135232 Ga0495602_0135232_559_1344 261
995 3300048088 Ga0495602_0233404 Ga0495602_0233404_63_848 261
996 3300048088 Ga0495602_0493724 Ga0495602_0493724_59_844 261
997 3300048089 Ga0495614_0000451 Ga0495614_0000451_10831_11616 261
998 3300048089 Ga0495614_0019573 Ga0495614_0019573_1948_2733 261
999 3300048091 Ga0495626_0017385 Ga0495626_0017385_102_887 261
1000 3300048091 Ga0495626_0060458 Ga0495626_0060458_715_1500 261
1001 3300048903 Ga0496100_0016120 Ga0496100_0016120_1478_2263 261
1002 3300048903 Ga0496100_0024752 Ga0496100_0024752_2552_3337 261
1003 3300048903 Ga0496100_0111857 Ga0496100_0111857_895_1680 261
1004 3300048904 Ga0496101_0012888 Ga0496101_0012888_2703_3488 261
1005 3300048904 Ga0496101_0056916 Ga0496101_0056916_2017_2802 261
1006 3300048904 Ga0496101_0107050 Ga0496101_0107050_224_1009 261
1007 3300048904 Ga0496101_0186228 Ga0496101_0186228_415_1200 261
1008 3300048904 Ga0496101_0359572 Ga0496101_0359572_19_804 261
1009 3300048905 Ga0496102_0008993 Ga0496102_0008993_5415_6200 261
1010 3300048905 Ga0496102_0055366 Ga0496102_0055366_2052_2837 261
1011 3300048906 Ga0496103_0002058 Ga0496103_0002058_7014_7799 261
1012 3300048906 Ga0496103_0004787 Ga0496103_0004787_5471_6256 261
1013 3300048906 Ga0496103_0134127 Ga0496103_0134127_706_1491 261
1014 3300048907 Ga0496104_0090976 Ga0496104_0090976_368_1153 261
1015 3300048907 Ga0496104_0124176 Ga0496104_0124176_895_1680 261
1016 3300048907 Ga0496104_0216510 Ga0496104_0216510_337_1122 261
1017 3300048907 Ga0496104_0543270 Ga0496104_0543270_116_901 261
1018 3300048908 Ga0496105_0062824 Ga0496105_0062824_2241_3026 261
1019 3300048908 Ga0496105_0123359 Ga0496105_0123359_1301_2086 261
1020 3300048908 Ga0496105_0130301 Ga0496105_0130301_1171_1956 261
1021 3300048908 Ga0496105_0150056 Ga0496105_0150056_681_1466 261
1022 3300048908 Ga0496105_0334484 Ga0496105_0334484_129_914 261
1023 3300048909 Ga0496106_0002838 Ga0496106_0002838_10816_11601 261
1024 3300048910 Ga0496107_0027843 Ga0496107_0027843_1411_2196 261
1025 3300048910 Ga0496107_0339683 Ga0496107_0339683_276_1061 261
1026 3300048912 Ga0496109_0393014 Ga0496109_0393014_307_1092 261
1027 3300048914 Ga0496111_0008723 Ga0496111_0008723_1060_1845 261
1028 3300048916 Ga0496113_0023434 Ga0496113_0023434_3086_3871 261
1029 3300048917 Ga0496114_0026363 Ga0496114_0026363_1559_2344 261
1030 3300048918 Ga0496115_0033943 Ga0496115_0033943_2163_2948 261
1031 3300048918 Ga0496115_0200891 Ga0496115_0200891_774_1559 261
1032 3300048919 Ga0496116_0098192 Ga0496116_0098192_621_1406 261
1033 3300048919 Ga0496116_0133908 Ga0496116_0133908_508_1293 261
1034 3300048919 Ga0496116_0143858 Ga0496116_0143858_344_1135 261
1035 3300048920 Ga0496117_0005798 Ga0496117_0005798_6472_7257 261
1036 3300048920 Ga0496117_0019287 Ga0496117_0019287_1651_2436 261
1037 3300048920 Ga0496117_0022924 Ga0496117_0022924_3766_4551 261
1038 3300048920 Ga0496117_0061518 Ga0496117_0061518_331_1116 261
1039 3300048920 Ga0496117_0085023 Ga0496117_0085023_1221_2012 261
1040 3300048921 Ga0496118_0002552 Ga0496118_0002552_16133_16918 261
1041 3300048921 Ga0496118_0012795 Ga0496118_0012795_2438_3223 261
1042 3300048921 Ga0496118_0022621 Ga0496118_0022621_2682_3467 261
1043 3300048921 Ga0496118_0098992 Ga0496118_0098992_650_1435 261
1044 3300048921 Ga0496118_0107393 Ga0496118_0107393_167_952 261
1045 3300048921 Ga0496118_0122723 Ga0496118_0122723_702_1487 261
1046 3300048921 Ga0496118_0139404 Ga0496118_0139404_87_872 261
1047 3300048922 Ga0496119_0086537 Ga0496119_0086537_143_928 261
1048 3300048924 Ga0496121_0002288 Ga0496121_0002288_10993_11778 261
1049 3300048924 Ga0496121_0006568 Ga0496121_0006568_12697_13482 261
1050 3300048924 Ga0496121_0011728 Ga0496121_0011728_2231_3016 261
1051 3300048924 Ga0496121_0037278 Ga0496121_0037278_1116_1901 261
1052 3300048924 Ga0496121_0049486 Ga0496121_0049486_2454_3239 261
1053 3300048924 Ga0496121_0059437 Ga0496121_0059437_286_1071 261
1054 3300048925 Ga0496122_0065255 Ga0496122_0065255_63_848 261
1055 3300048925 Ga0496122_0108735 Ga0496122_0108735_469_1260 261
1056 3300048927 Ga0496124_0136301 Ga0496124_0136301_1115_1900 261
1057 3300048927 Ga0496124_0373346 Ga0496124_0373346_14_799 261
1058 3300048928 Ga0496125_0095734 Ga0496125_0095734_1248_2033 261
1059 3300048928 Ga0496125_0146896 Ga0496125_0146896_779_1564 261
1060 3300048929 Ga0496126_0000538 Ga0496126_0000538_33169_33954 261
1061 3300048929 Ga0496126_0002311 Ga0496126_0002311_9807_10592 261
1062 3300048929 Ga0496126_0008981 Ga0496126_0008981_7295_8080 261
1063 3300048929 Ga0496126_0084304 Ga0496126_0084304_809_1594 261
1064 3300049459 Ga0495678_054660 Ga0495678_054660_155_940 261
1065 3300049459 Ga0495678_059696 Ga0495678_059696_143_928 261
1066 3300049460 Ga0495682_0051384 Ga0495682_0051384_405_1190 261
1067 3300049460 Ga0495682_0100826 Ga0495682_0100826_82_867 261
1068 iso_pu_bacteria 2513237083 2513565591 261
1069 iso_pu_bacteria 2904615490 2904623282 261
1070 iso_pu_bacteria 8003955200 8003961980 261
1071 iso_pu_bacteria 8055266321 8055269523 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

47

301

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pw6-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein jw3007 from escherichia coli k12 0.8606 3 259
2pw6-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein jw3007 from escherichia coli k12 0.8573 3 259
7txy-assembly2.cif.gz_E crystal structure of the 2-aminophenol 1,6-dioxygenase from the aro bacterial microcompartment of micromonospora rosaria 0.7831 2 257
8iq8-assembly1.cif.gz_D crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii 0.7711 1 261
8iq8-assembly1.cif.gz_D crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii 0.7684 1 261
ID Description Score Start End Superfamily
af_I1MQB9_2_262_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9543 5 258 3.40.830.10
af_P24197_1_271_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.943 2 259 3.40.830.10
af_P24197_1_271_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.929 2 259 3.40.830.10
af_Q54W77_1_267_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8834 1 259 3.40.830.10
af_Q54W77_1_267_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8738 1 259 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A158DJN0-F1-model_v4 Extradiol ring-cleavage dioxygenase III subunit B 1.002 42 261 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A7Y9WM76-F1-model_v4 4,5-DOPA dioxygenase extradiol (EC 1.13.11.-) 1.001 4 261 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A158DJN0-F1-model_v4 Extradiol ring-cleavage dioxygenase III subunit B 0.9975 42 261 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A7Y9WM76-F1-model_v4 4,5-DOPA dioxygenase extradiol (EC 1.13.11.-) 0.9974 4 261 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A3G3LPH2-F1-model_v4 stizolobate synthase (EC 1.13.11.29) 0.9858 35 136 GO:0008198
GO:0008270
GO:0050297

Feature Viewer

pLDDT pTM Quality
96.09 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map