F489496
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1071 | 507 | 979 | 265 |
Family's Representative Sequence
| Representative Sequence | 3300050491|nmdc:mga00v17_52090_c1|nmdc:mga00v17_52090_c1_1379_2320 |
| Length | 313 |
| Sequence | MRFGCRASPIRSASSPTPHAERHIGARLAGAERLQSLASEENVMTLPSLFLSHGAPTLPLTDTPARTFLTQLGGKLPRPKAVLVVSAHWETTKPTVSAVNWNETIHDFRGFPRALYDLRYPAPGSPQVAARLAETLRASGFDCDIDRRRGLDHGAWVPLLLTYPQADIPVLQLSVQPHLGPEHHLRIGRALAPLREEGVLIVGSGSFTHDLSEFRGQELDAPSPDWVNDFADWMDEALAKNQIKELLNYRHAAPFAVKNHPTEEHLLPLYVALGAAGDRPHAERLHASSTYSILRMDVYAFRNASDAVVKSAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 5 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 6 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 7 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 8 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 9 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 10 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 11 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 12 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 13 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 14 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 15 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 16 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 17 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 18 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 19 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 20 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 21 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 22 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 23 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 24 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 25 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 26 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 27 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 28 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 29 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 30 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 31 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 32 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 33 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 34 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 35 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 36 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 37 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 38 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 39 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 40 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 41 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 42 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 43 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 44 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 45 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 46 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 47 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 48 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 49 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 50 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 51 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 52 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 53 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 54 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 55 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 56 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 57 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 58 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 59 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 60 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 61 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 62 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 63 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 64 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 65 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 66 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 67 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 68 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 69 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 70 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 71 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 72 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 73 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 74 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 75 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 76 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 77 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 78 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 79 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 80 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 81 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 82 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 83 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 84 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 85 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 86 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 87 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 88 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 89 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 90 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 91 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 92 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 93 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 94 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 95 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 98 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 112 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 113 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 114 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 116 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 117 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 118 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 121 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 123 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 124 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 125 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 126 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 127 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 128 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 129 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 130 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 131 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 132 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 133 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 134 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 135 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 136 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 137 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 138 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 139 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 140 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 141 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 142 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 143 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 144 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 158 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 167 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 170 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 171 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 172 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 173 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 175 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 177 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 178 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 179 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 180 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 188 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 244 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 245 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 246 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 247 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 249 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 250 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 251 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 253 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 254 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 255 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 256 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 257 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 258 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 259 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 260 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 261 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 262 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 263 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 264 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 265 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 266 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 267 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 268 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 269 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 272 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 273 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 274 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 275 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 277 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 278 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 279 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 280 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 281 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 282 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 285 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 286 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 287 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 288 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 289 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 290 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 291 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 292 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 293 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 294 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 295 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 296 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 297 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 298 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 299 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 300 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 301 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 302 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 303 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 304 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 305 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 306 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 307 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 308 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 309 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 310 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 311 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 312 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 401 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 402 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 403 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 404 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 405 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 406 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 408 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 409 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 410 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 411 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 412 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 413 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 414 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 415 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 416 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 417 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 418 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 419 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 420 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 432 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 436 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 437 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 438 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 439 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 440 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 441 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 442 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 447 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 450 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 453 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 454 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 455 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 456 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 457 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 458 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 459 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 460 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 461 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 462 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 463 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 464 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 465 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 466 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 467 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 468 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 469 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 470 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 471 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 472 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 473 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 474 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 475 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 476 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 477 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 478 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 479 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 480 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 481 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 482 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 483 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 484 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 485 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 486 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 487 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 488 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 489 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 490 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 492 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 493 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 494 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 495 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 496 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 497 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 498 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 499 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 500 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 501 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 502 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 503 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 504 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 505 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 506 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 507 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.85 |
| Metatranscriptomes | 0.56 |
| Isolates | 8.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.1 |
| Nodule | 1.77 |
| Rhizoplane | 3.83 |
| Rhizosphere | 70.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10029710 | 3300001989 | Bacteria | 1898 |
| 2 | JGI24739J22299_10038296 | 3300001989 | Bacteria | 1612 |
| 3 | JGI24737J22298_10012651 | 3300001990 | Bacteria | 2750 |
| 4 | JGI24735J21928_10006038 | 3300002067 | Bacteria | 4001 |
| 5 | JGI24735J21928_10006346 | 3300002067 | Bacteria | 3901 |
| 6 | JGI24735J21928_10101600 | 3300002067 | Bacteria | 826 |
| 7 | JGI24751J29686_10003654 | 3300002459 | Bacteria | 3099 |
| 8 | JGI25156J39149_1005451 | 3300002705 | Bacteria | 3664 |
| 9 | rootH2_10253312 | 3300003320 | Bacteria | 1708 |
| 10 | rootH2_10255524 | 3300003320 | Bacteria | 1374 |
| 11 | rootL2_10337834 | 3300003322 | Bacteria | 1544 |
| 12 | rootH1_10176638 | 3300003323 | Bacteria | 2499 |
| 13 | Ga0055539_1002880 | 3300003752 | Bacteria | 2512 |
| 14 | Ga0055533_1002644 | 3300003756 | Bacteria | 3980 |
| 15 | Ga0055532_1000718 | 3300003758 | Bacteria | 12309 |
| 16 | Ga0055532_1004042 | 3300003758 | Bacteria | 2323 |
| 17 | Ga0055532_1004063 | 3300003758 | Bacteria | 2314 |
| 18 | Ga0055527_1003540 | 3300003760 | Bacteria | 2293 |
| 19 | Ga0055527_1003554 | 3300003760 | Bacteria | 2283 |
| 20 | Ga0055535_1006604 | 3300003761 | Bacteria | 2323 |
| 21 | Ga0055535_1006637 | 3300003761 | Bacteria | 2314 |
| 22 | Ga0055542_1004393 | 3300003762 | Bacteria | 3445 |
| 23 | Ga0055542_1006925 | 3300003762 | Bacteria | 2362 |
| 24 | Ga0055529_1003991 | 3300003763 | Bacteria | 2314 |
| 25 | Ga0055529_1003997 | 3300003763 | Bacteria | 2313 |
| 26 | Ga0055528_1001636 | 3300003790 | Bacteria | 13188 |
| 27 | Ga0058692_1004095 | 3300003856 | Bacteria | 4376 |
| 28 | Ga0065165_1000648 | 3300005262 | Bacteria | 50260 |
| 29 | Ga0070670_100019902 | 3300005331 | Bacteria | 5762 |
| 30 | Ga0070670_100305927 | 3300005331 | Bacteria | 1391 |
| 31 | Ga0070670_100558992 | 3300005331 | Bacteria | 1021 |
| 32 | Ga0070666_10001588 | 3300005335 | Bacteria | 13814 |
| 33 | Ga0070680_100112515 | 3300005336 | Bacteria | 2267 |
| 34 | Ga0070660_100000204 | 3300005339 | Bacteria | 39747 |
| 35 | Ga0070660_100001152 | 3300005339 | Bacteria | 17832 |
| 36 | Ga0070661_100087551 | 3300005344 | Bacteria | 2304 |
| 37 | Ga0070669_100000004 | 3300005353 | Bacteria | 314707 |
| 38 | Ga0070675_100118645 | 3300005354 | Bacteria | 2246 |
| 39 | Ga0070671_100000004 | 3300005355 | Bacteria | 262155 |
| 40 | Ga0070659_100000156 | 3300005366 | Bacteria | 52480 |
| 41 | Ga0070667_100027200 | 3300005367 | Bacteria | 4759 |
| 42 | Ga0070709_10094073 | 3300005434 | Bacteria | 1982 |
| 43 | Ga0070714_100002166 | 3300005435 | Bacteria | 14431 |
| 44 | Ga0070714_100015389 | 3300005435 | Bacteria | 6156 |
| 45 | Ga0070714_100267561 | 3300005435 | Bacteria | 1584 |
| 46 | Ga0070713_100060518 | 3300005436 | Bacteria | 3166 |
| 47 | Ga0070711_100140983 | 3300005439 | Bacteria | 1807 |
| 48 | Ga0070711_100273159 | 3300005439 | Bacteria | 1334 |
| 49 | Ga0070663_100007485 | 3300005455 | Bacteria | 6648 |
| 50 | Ga0070663_100011786 | 3300005455 | Bacteria | 5504 |
| 51 | Ga0070678_100072220 | 3300005456 | Unclassified | 2586 |
| 52 | Ga0070678_100461535 | 3300005456 | Bacteria | 1114 |
| 53 | Ga0070681_10027823 | 3300005458 | Bacteria | 5685 |
| 54 | Ga0070681_10062338 | 3300005458 | Bacteria | 3702 |
| 55 | Ga0070681_10121087 | 3300005458 | Bacteria | 2552 |
| 56 | Ga0070681_10122299 | 3300005458 | Bacteria | 2536 |
| 57 | Ga0070681_10440419 | 3300005458 | Bacteria | 1215 |
| 58 | Ga0068867_100108471 | 3300005459 | Bacteria | 2129 |
| 59 | Ga0070685_10002911 | 3300005466 | Bacteria | 8749 |
| 60 | Ga0070706_100553234 | 3300005467 | Bacteria | 1070 |
| 61 | Ga0070679_100063148 | 3300005530 | Bacteria | 3692 |
| 62 | Ga0070679_100078433 | 3300005530 | Bacteria | 3292 |
| 63 | Ga0070679_100162930 | 3300005530 | Bacteria | 2204 |
| 64 | Ga0070679_100792895 | 3300005530 | Bacteria | 890 |
| 65 | Ga0070684_100022062 | 3300005535 | Bacteria | 5306 |
| 66 | Ga0070686_100094455 | 3300005544 | Bacteria | 2007 |
| 67 | Ga0070695_100017779 | 3300005545 | Bacteria | 4314 |
| 68 | Ga0070665_100023540 | 3300005548 | Bacteria | 6201 |
| 69 | Ga0068855_100004044 | 3300005563 | Bacteria | 17897 |
| 70 | Ga0068855_100074923 | 3300005563 | Bacteria | 3930 |
| 71 | Ga0068855_100216159 | 3300005563 | Bacteria | 2152 |
| 72 | Ga0068855_100338109 | 3300005563 | Bacteria | 1661 |
| 73 | Ga0070664_100221985 | 3300005564 | Bacteria | 1691 |
| 74 | Ga0068857_100529192 | 3300005577 | Bacteria | 1109 |
| 75 | Ga0068854_100132023 | 3300005578 | Bacteria | 1908 |
| 76 | Ga0068856_100133357 | 3300005614 | Bacteria | 2489 |
| 77 | Ga0068852_100025272 | 3300005616 | Bacteria | 4810 |
| 78 | Ga0068859_100003632 | 3300005617 | Bacteria | 15731 |
| 79 | Ga0068859_100468779 | 3300005617 | Bacteria | 1355 |
| 80 | Ga0068864_100004715 | 3300005618 | Bacteria | 11175 |
| 81 | Ga0068861_100025417 | 3300005719 | Bacteria | 4295 |
| 82 | Ga0068863_100037037 | 3300005841 | Bacteria | 4645 |
| 83 | Ga0068858_100002081 | 3300005842 | Bacteria | 20346 |
| 84 | Ga0068860_100001690 | 3300005843 | Bacteria | 23583 |
| 85 | Ga0068860_100080142 | 3300005843 | Bacteria | 3105 |
| 86 | Ga0068862_100002536 | 3300005844 | Bacteria | 16157 |
| 87 | Ga0068862_100506019 | 3300005844 | Bacteria | 1147 |
| 88 | Ga0075365_10102819 | 3300006038 | Bacteria | 1958 |
| 89 | Ga0075363_100000129 | 3300006048 | Bacteria | 18151 |
| 90 | Ga0075363_100015629 | 3300006048 | Bacteria | 3734 |
| 91 | Ga0075363_100097600 | 3300006048 | Bacteria | 1624 |
| 92 | Ga0075364_10004589 | 3300006051 | Bacteria | 7956 |
| 93 | Ga0075364_10071428 | 3300006051 | Bacteria | 2286 |
| 94 | Ga0075364_10083829 | 3300006051 | Bacteria | 2110 |
| 95 | Ga0070712_100173343 | 3300006175 | Bacteria | 1675 |
| 96 | Ga0075362_10000024 | 3300006177 | Bacteria | 59846 |
| 97 | Ga0075362_10020589 | 3300006177 | Bacteria | 2758 |
| 98 | Ga0075362_10027731 | 3300006177 | Bacteria | 2426 |
| 99 | Ga0075367_10000197 | 3300006178 | Bacteria | 19933 |
| 100 | Ga0075367_10070406 | 3300006178 | Bacteria | 2102 |
| 101 | Ga0075369_10000380 | 3300006186 | Bacteria | 13318 |
| 102 | Ga0075369_10010043 | 3300006186 | Bacteria | 3697 |
| 103 | Ga0075369_10042650 | 3300006186 | Bacteria | 1945 |
| 104 | Ga0075369_10054877 | 3300006186 | Bacteria | 1730 |
| 105 | Ga0075366_10000115 | 3300006195 | Bacteria | 33019 |
| 106 | Ga0075366_10004537 | 3300006195 | Bacteria | 7456 |
| 107 | Ga0075366_10014611 | 3300006195 | Bacteria | 4486 |
| 108 | Ga0075366_10091455 | 3300006195 | Bacteria | 1823 |
| 109 | Ga0075366_10269720 | 3300006195 | Bacteria | 1039 |
| 110 | Ga0075370_10000001 | 3300006353 | Bacteria | 239876 |
| 111 | Ga0075370_10036581 | 3300006353 | Bacteria | 2758 |
| 112 | Ga0075370_10111603 | 3300006353 | Bacteria | 1588 |
| 113 | Ga0075370_10228638 | 3300006353 | Bacteria | 1100 |
| 114 | Ga0075430_100121858 | 3300006846 | Bacteria | 2174 |
| 115 | Ga0075429_100001195 | 3300006880 | Bacteria | 21009 |
| 116 | Ga0097620_100003632 | 3300006931 | Bacteria | 15731 |
| 117 | Ga0097620_100468845 | 3300006931 | Bacteria | 1355 |
| 118 | Ga0105251_10000758 | 3300009011 | Bacteria | 29449 |
| 119 | Ga0105251_10001262 | 3300009011 | Bacteria | 21860 |
| 120 | Ga0105251_10081877 | 3300009011 | Bacteria | 1491 |
| 121 | Ga0105244_10178424 | 3300009036 | Bacteria | 1008 |
| 122 | Ga0105250_10026968 | 3300009092 | Bacteria | 2315 |
| 123 | Ga0105250_10096753 | 3300009092 | Bacteria | 1204 |
| 124 | Ga0105240_10001922 | 3300009093 | Bacteria | 34528 |
| 125 | Ga0105240_10029364 | 3300009093 | Bacteria | 7165 |
| 126 | Ga0105240_10031832 | 3300009093 | Bacteria | 6834 |
| 127 | Ga0105240_10106844 | 3300009093 | Bacteria | 3394 |
| 128 | Ga0105240_10315871 | 3300009093 | Bacteria | 1782 |
| 129 | Ga0105247_10006203 | 3300009101 | Bacteria | 7415 |
| 130 | Ga0105247_10008016 | 3300009101 | Bacteria | 6455 |
| 131 | Ga0105243_10182488 | 3300009148 | Bacteria | 1826 |
| 132 | Ga0105241_10030298 | 3300009174 | Bacteria | 4042 |
| 133 | Ga0105241_10458896 | 3300009174 | Bacteria | 1128 |
| 134 | Ga0105242_10483129 | 3300009176 | Bacteria | 1174 |
| 135 | Ga0105248_10020642 | 3300009177 | Bacteria | 7300 |
| 136 | Ga0105248_10070883 | 3300009177 | Bacteria | 3914 |
| 137 | Ga0105248_10077726 | 3300009177 | Bacteria | 3731 |
| 138 | Ga0105237_10021860 | 3300009545 | Bacteria | 6571 |
| 139 | Ga0105237_10097080 | 3300009545 | Bacteria | 2937 |
| 140 | Ga0105238_10013695 | 3300009551 | Bacteria | 8191 |
| 141 | Ga0105238_10045913 | 3300009551 | Bacteria | 4412 |
| 142 | Ga0105238_10184432 | 3300009551 | Bacteria | 2063 |
| 143 | Ga0105238_10195917 | 3300009551 | Bacteria | 1996 |
| 144 | Ga0105238_10244838 | 3300009551 | Bacteria | 1771 |
| 145 | Ga0105239_10003468 | 3300010375 | Bacteria | 19297 |
| 146 | Ga0105239_10021398 | 3300010375 | Bacteria | 7131 |
| 147 | Ga0105239_10119618 | 3300010375 | Bacteria | 2924 |
| 148 | Ga0105239_10547472 | 3300010375 | Bacteria | 1318 |
| 149 | Ga0157322_1002390 | 3300012490 | Bacteria | 1052 |
| 150 | Ga0157373_10008296 | 3300013100 | Bacteria | 7717 |
| 151 | Ga0157373_10014587 | 3300013100 | Bacteria | 5760 |
| 152 | Ga0157370_10000439 | 3300013104 | Bacteria | 51955 |
| 153 | Ga0157370_10002253 | 3300013104 | Bacteria | 23432 |
| 154 | Ga0157370_10118451 | 3300013104 | Bacteria | 2473 |
| 155 | Ga0157370_10244972 | 3300013104 | Bacteria | 1658 |
| 156 | Ga0157370_10600392 | 3300013104 | Bacteria | 1008 |
| 157 | Ga0157369_10000410 | 3300013105 | Bacteria | 56813 |
| 158 | Ga0157369_10001007 | 3300013105 | Bacteria | 35470 |
| 159 | Ga0157369_10001022 | 3300013105 | Bacteria | 35263 |
| 160 | Ga0157369_10060127 | 3300013105 | Bacteria | 4098 |
| 161 | Ga0157369_10120622 | 3300013105 | Bacteria | 2783 |
| 162 | Ga0157369_10256173 | 3300013105 | Bacteria | 1826 |
| 163 | Ga0157374_10000146 | 3300013296 | Bacteria | 64549 |
| 164 | Ga0157374_10192269 | 3300013296 | Unclassified | 1996 |
| 165 | Ga0157378_10887720 | 3300013297 | Bacteria | 922 |
| 166 | Ga0163162_10000877 | 3300013306 | Bacteria | 28017 |
| 167 | Ga0163162_10325829 | 3300013306 | Bacteria | 1669 |
| 168 | Ga0157372_10000323 | 3300013307 | Bacteria | 52602 |
| 169 | Ga0157372_10066434 | 3300013307 | Bacteria | 4052 |
| 170 | Ga0157372_10067793 | 3300013307 | Bacteria | 4011 |
| 171 | Ga0157380_10723724 | 3300014326 | Bacteria | 1003 |
| 172 | Ga0182008_10068800 | 3300014497 | Bacteria | 1742 |
| 173 | Ga0182008_10117141 | 3300014497 | Bacteria | 1322 |
| 174 | Ga0157379_10007612 | 3300014968 | Bacteria | 9378 |
| 175 | Ga0157379_10152384 | 3300014968 | Bacteria | 2085 |
| 176 | Ga0157376_10230952 | 3300014969 | Bacteria | 1718 |
| 177 | Ga0182006_1078219 | 3300015261 | Bacteria | 1212 |
| 178 | Ga0182007_10003995 | 3300015262 | Bacteria | 6804 |
| 179 | Ga0182005_1015290 | 3300015265 | Bacteria | 2142 |
| 180 | Ga0183361_10015 | 3300016635 | Bacteria | 166772 |
| 181 | Ga0206350_11077195 | 3300020080 | Bacteria | 2097 |
| 182 | Ga0206354_10237220 | 3300020081 | Bacteria | 1482 |
| 183 | Ga0206354_10883746 | 3300020081 | Bacteria | 3058 |
| 184 | Ga0206353_10068211 | 3300020082 | Bacteria | 1585 |
| 185 | Ga0206353_10562420 | 3300020082 | Bacteria | 5535 |
| 186 | Ga0213876_10131643 | 3300021384 | Bacteria | 1329 |
| 187 | Ga0213871_10015669 | 3300021441 | Bacteria | 1815 |
| 188 | Ga0224712_10000055 | 3300022467 | Bacteria | 17216 |
| 189 | Ga0209435_102614 | 3300025206 | Bacteria | 2094 |
| 190 | Ga0209566_101192 | 3300025225 | Bacteria | 9260 |
| 191 | Ga0209674_100260 | 3300025226 | Bacteria | 42764 |
| 192 | Ga0209674_104036 | 3300025226 | Bacteria | 2493 |
| 193 | Ga0209672_100054 | 3300025228 | Bacteria | 222217 |
| 194 | Ga0209672_100072 | 3300025228 | Bacteria | 167942 |
| 195 | Ga0209672_100185 | 3300025228 | Bacteria | 50385 |
| 196 | Ga0209147_100085 | 3300025229 | Bacteria | 185813 |
| 197 | Ga0209147_100100 | 3300025229 | Bacteria | 162747 |
| 198 | Ga0209147_100278 | 3300025229 | Bacteria | 44611 |
| 199 | Ga0209258_100168 | 3300025242 | Bacteria | 145329 |
| 200 | Ga0209258_100331 | 3300025242 | Bacteria | 71624 |
| 201 | Ga0209677_100644 | 3300025253 | Bacteria | 18509 |
| 202 | Ga0209148_1001174 | 3300025254 | Bacteria | 15107 |
| 203 | Ga0209148_1001511 | 3300025254 | Bacteria | 11507 |
| 204 | Ga0209759_1000351 | 3300025256 | Bacteria | 59891 |
| 205 | Ga0209759_1000502 | 3300025256 | Bacteria | 42732 |
| 206 | Ga0209759_1021861 | 3300025256 | Bacteria | 1444 |
| 207 | Ga0209233_1000791 | 3300025261 | Bacteria | 14218 |
| 208 | Ga0209565_1018615 | 3300025263 | Bacteria | 1499 |
| 209 | Ga0209455_1000279 | 3300025272 | Bacteria | 55567 |
| 210 | Ga0209455_1000760 | 3300025272 | Bacteria | 18220 |
| 211 | Ga0209455_1003360 | 3300025272 | Bacteria | 5715 |
| 212 | Ga0209455_1005077 | 3300025272 | Bacteria | 4156 |
| 213 | Ga0209673_1000098 | 3300025273 | Bacteria | 193352 |
| 214 | Ga0209564_1007078 | 3300025295 | Bacteria | 5872 |
| 215 | Ga0207426_1000199 | 3300025302 | Bacteria | 145826 |
| 216 | Ga0207697_10002018 | 3300025315 | Bacteria | 10745 |
| 217 | Ga0207696_1019421 | 3300025711 | Bacteria | 2214 |
| 218 | Ga0207713_1000186 | 3300025735 | Bacteria | 87336 |
| 219 | Ga0207713_1023306 | 3300025735 | Bacteria | 2916 |
| 220 | Ga0207692_10137091 | 3300025898 | Bacteria | 1388 |
| 221 | Ga0207710_10012334 | 3300025900 | Bacteria | 3596 |
| 222 | Ga0207710_10022648 | 3300025900 | Bacteria | 2697 |
| 223 | Ga0207680_10001639 | 3300025903 | Bacteria | 10588 |
| 224 | Ga0207680_10016281 | 3300025903 | Bacteria | 3900 |
| 225 | Ga0207647_10000126 | 3300025904 | Bacteria | 59628 |
| 226 | Ga0207647_10005134 | 3300025904 | Bacteria | 9640 |
| 227 | Ga0207647_10007932 | 3300025904 | Bacteria | 7634 |
| 228 | Ga0207647_10046048 | 3300025904 | Bacteria | 2718 |
| 229 | Ga0207705_10058067 | 3300025909 | Bacteria | 2791 |
| 230 | Ga0207654_10278119 | 3300025911 | Bacteria | 1131 |
| 231 | Ga0207707_10042279 | 3300025912 | Bacteria | 3978 |
| 232 | Ga0207707_10061038 | 3300025912 | Bacteria | 3280 |
| 233 | Ga0207707_10433340 | 3300025912 | Bacteria | 1126 |
| 234 | Ga0207695_10000971 | 3300025913 | Bacteria | 51107 |
| 235 | Ga0207695_10004600 | 3300025913 | Bacteria | 18738 |
| 236 | Ga0207695_10005877 | 3300025913 | Bacteria | 16101 |
| 237 | Ga0207695_10177134 | 3300025913 | Bacteria | 2054 |
| 238 | Ga0207695_10332538 | 3300025913 | Bacteria | 1408 |
| 239 | Ga0207695_10383498 | 3300025913 | Bacteria | 1291 |
| 240 | Ga0207671_10067446 | 3300025914 | Bacteria | 2664 |
| 241 | Ga0207671_10108323 | 3300025914 | Bacteria | 2111 |
| 242 | Ga0207671_10256833 | 3300025914 | Bacteria | 1375 |
| 243 | Ga0207693_10021011 | 3300025915 | Bacteria | 5190 |
| 244 | Ga0207663_10109936 | 3300025916 | Bacteria | 1869 |
| 245 | Ga0207663_10265978 | 3300025916 | Bacteria | 1268 |
| 246 | Ga0207657_10000096 | 3300025919 | Bacteria | 85043 |
| 247 | Ga0207657_10006312 | 3300025919 | Bacteria | 12317 |
| 248 | Ga0207657_10058090 | 3300025919 | Bacteria | 3331 |
| 249 | Ga0207652_10034939 | 3300025921 | Bacteria | 4240 |
| 250 | Ga0207681_10000010 | 3300025923 | Bacteria | 403379 |
| 251 | Ga0207694_10077803 | 3300025924 | Bacteria | 2600 |
| 252 | Ga0207694_10194661 | 3300025924 | Bacteria | 1648 |
| 253 | Ga0207694_10342557 | 3300025924 | Bacteria | 1236 |
| 254 | Ga0207650_10009672 | 3300025925 | Bacteria | 6591 |
| 255 | Ga0207659_10230218 | 3300025926 | Bacteria | 1494 |
| 256 | Ga0207700_10481503 | 3300025928 | Bacteria | 1097 |
| 257 | Ga0207700_10692257 | 3300025928 | Bacteria | 910 |
| 258 | Ga0207664_10006538 | 3300025929 | Bacteria | 8025 |
| 259 | Ga0207664_10074075 | 3300025929 | Bacteria | 2750 |
| 260 | Ga0207664_10316985 | 3300025929 | Bacteria | 1375 |
| 261 | Ga0207644_10000007 | 3300025931 | Bacteria | 381778 |
| 262 | Ga0207644_10148919 | 3300025931 | Bacteria | 1810 |
| 263 | Ga0207690_10000074 | 3300025932 | Bacteria | 87516 |
| 264 | Ga0207690_10060622 | 3300025932 | Bacteria | 2569 |
| 265 | Ga0207709_10067808 | 3300025935 | Bacteria | 2253 |
| 266 | Ga0207669_10121095 | 3300025937 | Bacteria | 1776 |
| 267 | Ga0207711_10014166 | 3300025941 | Bacteria | 6624 |
| 268 | Ga0207711_10157661 | 3300025941 | Bacteria | 2052 |
| 269 | Ga0207667_10018190 | 3300025949 | Bacteria | 7888 |
| 270 | Ga0207667_10038744 | 3300025949 | Bacteria | 5085 |
| 271 | Ga0207667_10070621 | 3300025949 | Bacteria | 3634 |
| 272 | Ga0207667_10154251 | 3300025949 | Bacteria | 2363 |
| 273 | Ga0207667_10273513 | 3300025949 | Bacteria | 1726 |
| 274 | Ga0207667_10460213 | 3300025949 | Bacteria | 1292 |
| 275 | Ga0207712_10385909 | 3300025961 | Bacteria | 1174 |
| 276 | Ga0207668_10003062 | 3300025972 | Bacteria | 9802 |
| 277 | Ga0207640_10086724 | 3300025981 | Bacteria | 2156 |
| 278 | Ga0207640_10342737 | 3300025981 | Bacteria | 1198 |
| 279 | Ga0207658_10001394 | 3300025986 | Bacteria | 18834 |
| 280 | Ga0207658_10133928 | 3300025986 | Bacteria | 1995 |
| 281 | Ga0207703_10003496 | 3300026035 | Bacteria | 13142 |
| 282 | Ga0207703_10339664 | 3300026035 | Bacteria | 1380 |
| 283 | Ga0207639_10429963 | 3300026041 | Bacteria | 1195 |
| 284 | Ga0207678_10000061 | 3300026067 | Bacteria | 85413 |
| 285 | Ga0207678_10113488 | 3300026067 | Bacteria | 2312 |
| 286 | Ga0207678_10290489 | 3300026067 | Bacteria | 1404 |
| 287 | Ga0207678_10325757 | 3300026067 | Bacteria | 1322 |
| 288 | Ga0207702_10035282 | 3300026078 | Bacteria | 4182 |
| 289 | Ga0207641_10024523 | 3300026088 | Bacteria | 4971 |
| 290 | Ga0207648_10120659 | 3300026089 | Bacteria | 2305 |
| 291 | Ga0207648_10204744 | 3300026089 | Unclassified | 1751 |
| 292 | Ga0207676_10000953 | 3300026095 | Bacteria | 22371 |
| 293 | Ga0207674_10413453 | 3300026116 | Bacteria | 1303 |
| 294 | Ga0207674_10622728 | 3300026116 | Bacteria | 1042 |
| 295 | Ga0207675_100000329 | 3300026118 | Bacteria | 45296 |
| 296 | Ga0207683_10473685 | 3300026121 | Bacteria | 1155 |
| 297 | Ga0207698_10010491 | 3300026142 | Bacteria | 5959 |
| 298 | Ga0209371_1000141 | 3300027312 | Bacteria | 118767 |
| 299 | Ga0209371_1001782 | 3300027312 | Bacteria | 13499 |
| 300 | Ga0207428_10091617 | 3300027907 | Bacteria | 2360 |
| 301 | Ga0268266_10109492 | 3300028379 | Bacteria | 2446 |
| 302 | Ga0268265_10000058 | 3300028380 | Bacteria | 154702 |
| 303 | Ga0268265_10659145 | 3300028380 | Bacteria | 1007 |
| 304 | Ga0268264_10000048 | 3300028381 | Bacteria | 334457 |
| 305 | Ga0268264_10000106 | 3300028381 | Bacteria | 210031 |
| 306 | Ga0268264_10461769 | 3300028381 | Bacteria | 1232 |
| 307 | Ga0265334_10000033 | 3300028573 | Bacteria | 106132 |
| 308 | Ga0265334_10005691 | 3300028573 | Bacteria | 5440 |
| 309 | Ga0265318_10047837 | 3300028577 | Bacteria | 1612 |
| 310 | Ga0265323_10025771 | 3300028653 | Bacteria | 2221 |
| 311 | Ga0265336_10003085 | 3300028666 | Bacteria | 6636 |
| 312 | Ga0307515_10000103 | 3300028794 | Bacteria | 198308 |
| 313 | Ga0265338_10000328 | 3300028800 | Bacteria | 86546 |
| 314 | Ga0265338_10001296 | 3300028800 | Bacteria | 41001 |
| 315 | Ga0265338_10003732 | 3300028800 | Bacteria | 21182 |
| 316 | Ga0265324_10011635 | 3300029957 | Bacteria | 3350 |
| 317 | Ga0268256_1000418 | 3300030500 | Bacteria | 38424 |
| 318 | Ga0268256_1007322 | 3300030500 | Bacteria | 3956 |
| 319 | Ga0265330_10006525 | 3300031235 | Bacteria | 5768 |
| 320 | Ga0265330_10028702 | 3300031235 | Bacteria | 2506 |
| 321 | Ga0265330_10037338 | 3300031235 | Bacteria | 2163 |
| 322 | Ga0265332_10049842 | 3300031238 | Bacteria | 1800 |
| 323 | Ga0265325_10000290 | 3300031241 | Bacteria | 35188 |
| 324 | Ga0265325_10026252 | 3300031241 | Bacteria | 3157 |
| 325 | Ga0265325_10046724 | 3300031241 | Bacteria | 2244 |
| 326 | Ga0265340_10006819 | 3300031247 | Bacteria | 6248 |
| 327 | Ga0265339_10004298 | 3300031249 | Bacteria | 9743 |
| 328 | Ga0265339_10065229 | 3300031249 | Bacteria | 1953 |
| 329 | Ga0265339_10097479 | 3300031249 | Bacteria | 1534 |
| 330 | Ga0265331_10012529 | 3300031250 | Bacteria | 4588 |
| 331 | Ga0265331_10062262 | 3300031250 | Bacteria | 1760 |
| 332 | Ga0265331_10070234 | 3300031250 | Bacteria | 1640 |
| 333 | Ga0265331_10143931 | 3300031250 | Bacteria | 1083 |
| 334 | Ga0265316_10043368 | 3300031344 | Bacteria | 3586 |
| 335 | Ga0307513_10002845 | 3300031456 | Bacteria | 23699 |
| 336 | Ga0307513_10182885 | 3300031456 | Bacteria | 1957 |
| 337 | Ga0307509_10022838 | 3300031507 | Bacteria | 7038 |
| 338 | Ga0307509_10158527 | 3300031507 | Bacteria | 2165 |
| 339 | Ga0307509_10161044 | 3300031507 | Bacteria | 2141 |
| 340 | Ga0307408_100000422 | 3300031548 | Bacteria | 38013 |
| 341 | Ga0265313_10033376 | 3300031595 | Bacteria | 2616 |
| 342 | Ga0307508_10000249 | 3300031616 | Bacteria | 65482 |
| 343 | Ga0307508_10296125 | 3300031616 | Bacteria | 1211 |
| 344 | Ga0265314_10001283 | 3300031711 | Bacteria | 28552 |
| 345 | Ga0265314_10035129 | 3300031711 | Bacteria | 3655 |
| 346 | Ga0265314_10068772 | 3300031711 | Bacteria | 2380 |
| 347 | Ga0307412_10000056 | 3300031911 | Bacteria | 145861 |
| 348 | Ga0307412_10124282 | 3300031911 | Bacteria | 1863 |
| 349 | Ga0307409_100024795 | 3300031995 | Bacteria | 4192 |
| 350 | Ga0307416_100240652 | 3300032002 | Bacteria | 1753 |
| 351 | Ga0307411_10095442 | 3300032005 | Bacteria | 2088 |
| 352 | Ga0316583_10000941 | 3300032133 | Bacteria | 9361 |
| 353 | Ga0373948_0019631 | 3300034817 | Bacteria | 1280 |
| 354 | Ga0373934_0002476 | 3300035086 | Bacteria | 6800 |
| 355 | Ga0373923_0000171 | 3300035111 | Bacteria | 12894 |
| 356 | Ga0373936_0089331 | 3300035113 | Bacteria | 1290 |
| 357 | Ga0373953_0010573 | 3300035117 | Bacteria | 3217 |
| 358 | Ga0373954_0000518 | 3300035118 | Bacteria | 14465 |
| 359 | Ga0373957_0000722 | 3300035120 | Bacteria | 8569 |
| 360 | Ga0373957_0028764 | 3300035120 | Bacteria | 2027 |
| 361 | Ga0373955_0003463 | 3300035172 | Bacteria | 6934 |
| 362 | Ga0373955_0043872 | 3300035172 | Bacteria | 2406 |
| 363 | Ga0316574_0158678 | 3300035398 | Bacteria | 1457 |
| 364 | Ga0373924_0002025 | 3300035410 | Bacteria | 6754 |
| 365 | Ga0373924_0029313 | 3300035410 | Bacteria | 2199 |
| 366 | Ga0373931_0045141 | 3300035691 | Bacteria | 2326 |
| 367 | Ga0373927_0000002 | 3300035695 | Bacteria | 966219 |
| 368 | Ga0373927_0014461 | 3300035695 | Bacteria | 5223 |
| 369 | Ga0373933_0000274 | 3300035724 | Bacteria | 33544 |
| 370 | Ga0373933_0003540 | 3300035724 | Bacteria | 8686 |
| 371 | Ga0373933_0093813 | 3300035724 | Bacteria | 1855 |
| 372 | Ga0373933_0125499 | 3300035724 | Bacteria | 1610 |
| 373 | Ga0373933_0277349 | 3300035724 | Bacteria | 1083 |
| 374 | Ga0373947_0128176 | 3300035725 | Bacteria | 1618 |
| 375 | Ga0373937_0005546 | 3300036401 | Bacteria | 10823 |
| 376 | Ga0373937_0038202 | 3300036401 | Bacteria | 4375 |
| 377 | Ga0373925_0081160 | 3300037068 | Bacteria | 2466 |
| 378 | Ga0395899_0000080 | 3300037312 | Bacteria | 171568 |
| 379 | Ga0395899_0107386 | 3300037312 | Bacteria | 2009 |
| 380 | Ga0395900_0000058 | 3300037418 | Bacteria | 206785 |
| 381 | Ga0395900_0000087 | 3300037418 | Bacteria | 171568 |
| 382 | Ga0395900_0000411 | 3300037418 | Bacteria | 61659 |
| 383 | Ga0395900_0042730 | 3300037418 | Bacteria | 4670 |
| 384 | Ga0395900_0066243 | 3300037418 | Bacteria | 3712 |
| 385 | Ga0395900_0097596 | 3300037418 | Bacteria | 3019 |
| 386 | Ga0395900_0161091 | 3300037418 | Bacteria | 2288 |
| 387 | Ga0395900_0594919 | 3300037418 | Bacteria | 1047 |
| 388 | Ga0395898_0000283 | 3300037466 | Bacteria | 122630 |
| 389 | Ga0395898_0000559 | 3300037466 | Bacteria | 69751 |
| 390 | Ga0395898_0000679 | 3300037466 | Bacteria | 61481 |
| 391 | Ga0395898_0009374 | 3300037466 | Bacteria | 10283 |
| 392 | Ga0395898_0053488 | 3300037466 | Bacteria | 3944 |
| 393 | Ga0395898_0159522 | 3300037466 | Bacteria | 2157 |
| 394 | Ga0395898_0474067 | 3300037466 | Bacteria | 1191 |
| 395 | Ga0395905_0067442 | 3300037471 | Bacteria | 3351 |
| 396 | Ga0395905_0070884 | 3300037471 | Bacteria | 3267 |
| 397 | Ga0395905_0183778 | 3300037471 | Bacteria | 1963 |
| 398 | Ga0436364_1182640 | 3300037853 | Bacteria | 1516 |
| 399 | Ga0395901_0000328 | 3300038443 | Bacteria | 58470 |
| 400 | Ga0395901_0001663 | 3300038443 | Bacteria | 22943 |
| 401 | Ga0395901_0141800 | 3300038443 | Bacteria | 2525 |
| 402 | Ga0436365_0174471 | 3300039437 | Bacteria | 3704 |
| 403 | Ga0436365_0371724 | 3300039437 | Bacteria | 5113 |
| 404 | Ga0436365_1636570 | 3300039437 | Bacteria | 2205 |
| 405 | Ga0436360_0564642 | 3300039438 | Bacteria | 10245 |
| 406 | Ga0436360_1339610 | 3300039438 | Bacteria | 1043 |
| 407 | Ga0436361_0870638 | 3300039447 | Bacteria | 3408 |
| 408 | Ga0436361_1134714 | 3300039447 | Bacteria | 2853 |
| 409 | Ga0436361_1185506 | 3300039447 | Bacteria | 1703 |
| 410 | Ga0436362_0922352 | 3300039453 | Bacteria | 7873 |
| 411 | Ga0439445_0005202 | 3300042004 | Bacteria | 2959 |
| 412 | Ga0439448_0000429 | 3300042005 | Bacteria | 9645 |
| 413 | Ga0451577_0367131 | 3300042876 | Bacteria | 1306 |
| 414 | Ga0451577_0711638 | 3300042876 | Bacteria | 909 |
| 415 | Ga0466969_0000833 | 3300044656 | Bacteria | 16765 |
| 416 | Ga0466969_0214799 | 3300044656 | Bacteria | 875 |
| 417 | Ga0466973_0070919 | 3300044659 | Bacteria | 3102 |
| 418 | Ga0466966_0000058 | 3300044684 | Bacteria | 81196 |
| 419 | Ga0466966_0003945 | 3300044684 | Bacteria | 9801 |
| 420 | Ga0466966_0031126 | 3300044684 | Bacteria | 3461 |
| 421 | Ga0466966_0194802 | 3300044684 | Bacteria | 1227 |
| 422 | Ga0466961_0000204 | 3300044693 | Bacteria | 39748 |
| 423 | Ga0466961_0000224 | 3300044693 | Bacteria | 38254 |
| 424 | Ga0466961_0132237 | 3300044693 | Bacteria | 1563 |
| 425 | Ga0466961_0177919 | 3300044693 | Bacteria | 1321 |
| 426 | Ga0466963_0003869 | 3300044694 | Bacteria | 8642 |
| 427 | Ga0466963_0036883 | 3300044694 | Bacteria | 3190 |
| 428 | Ga0466964_0204704 | 3300044706 | Bacteria | 949 |
| 429 | Ga0453684_0518630 | 3300044712 | Bacteria | 1317 |
| 430 | Ga0453684_0595088 | 3300044712 | Bacteria | 1213 |
| 431 | Ga0466971_0001186 | 3300044719 | Bacteria | 10818 |
| 432 | Ga0466971_0074685 | 3300044719 | Bacteria | 1541 |
| 433 | Ga0466968_0028681 | 3300044735 | Bacteria | 2297 |
| 434 | Ga0466968_0030208 | 3300044735 | Bacteria | 2244 |
| 435 | Ga0466970_0001740 | 3300044765 | Bacteria | 10497 |
| 436 | Ga0466970_0015169 | 3300044765 | Bacteria | 3962 |
| 437 | Ga0466970_0030302 | 3300044765 | Bacteria | 2852 |
| 438 | Ga0466957_0000621 | 3300044842 | Bacteria | 17927 |
| 439 | Ga0466957_0002537 | 3300044842 | Bacteria | 9824 |
| 440 | Ga0466957_0305047 | 3300044842 | Bacteria | 1071 |
| 441 | Ga0466959_0005343 | 3300045049 | Bacteria | 8786 |
| 442 | Ga0466959_0062688 | 3300045049 | Bacteria | 2701 |
| 443 | Ga0466959_0095700 | 3300045049 | Bacteria | 2129 |
| 444 | Ga0466959_0118491 | 3300045049 | Bacteria | 1884 |
| 445 | Ga0466959_0286590 | 3300045049 | Bacteria | 1129 |
| 446 | Ga0451576_0000246 | 3300045051 | Bacteria | 132778 |
| 447 | Ga0451576_0103717 | 3300045051 | Bacteria | 2958 |
| 448 | Ga0466958_0005251 | 3300045836 | Bacteria | 6942 |
| 449 | Ga0466967_0408380 | 3300045976 | Bacteria | 1322 |
| 450 | Ga0495627_002847 | 3300046453 | Bacteria | 7993 |
| 451 | Ga0495627_071272 | 3300046453 | Bacteria | 1015 |
| 452 | Ga0495592_0006004 | 3300046454 | Bacteria | 9028 |
| 453 | Ga0495592_0150394 | 3300046454 | Bacteria | 1610 |
| 454 | Ga0495603_0037122 | 3300046455 | Bacteria | 2923 |
| 455 | Ga0495603_0061077 | 3300046455 | Bacteria | 2226 |
| 456 | Ga0495603_0063725 | 3300046455 | Bacteria | 2174 |
| 457 | Ga0495603_0076487 | 3300046455 | Bacteria | 1964 |
| 458 | Ga0495590_0001575 | 3300046457 | Bacteria | 9773 |
| 459 | Ga0495590_0003243 | 3300046457 | Bacteria | 6651 |
| 460 | Ga0495590_0009707 | 3300046457 | Bacteria | 3648 |
| 461 | Ga0495629_0000309 | 3300046459 | Bacteria | 41866 |
| 462 | Ga0495629_0000625 | 3300046459 | Bacteria | 28762 |
| 463 | Ga0495629_0001021 | 3300046459 | Bacteria | 22468 |
| 464 | Ga0495629_0002634 | 3300046459 | Bacteria | 13750 |
| 465 | Ga0495629_0003835 | 3300046459 | Bacteria | 11343 |
| 466 | Ga0495629_0081801 | 3300046459 | Bacteria | 2254 |
| 467 | Ga0495638_0000517 | 3300046460 | Bacteria | 45154 |
| 468 | Ga0495638_0000875 | 3300046460 | Bacteria | 31213 |
| 469 | Ga0495638_0001208 | 3300046460 | Bacteria | 24646 |
| 470 | Ga0495638_0014896 | 3300046460 | Bacteria | 5238 |
| 471 | Ga0495638_0026681 | 3300046460 | Bacteria | 3743 |
| 472 | Ga0495641_0053756 | 3300046461 | Bacteria | 1831 |
| 473 | Ga0495641_0111852 | 3300046461 | Bacteria | 1218 |
| 474 | Ga0495651_0002383 | 3300046462 | Bacteria | 14520 |
| 475 | Ga0495651_0010274 | 3300046462 | Bacteria | 7189 |
| 476 | Ga0495651_0043092 | 3300046462 | Bacteria | 3502 |
| 477 | Ga0495651_0087012 | 3300046462 | Bacteria | 2350 |
| 478 | Ga0495651_0102367 | 3300046462 | Bacteria | 2130 |
| 479 | Ga0495651_0327166 | 3300046462 | Bacteria | 1020 |
| 480 | Ga0495653_0003619 | 3300046463 | Bacteria | 12470 |
| 481 | Ga0495653_0003799 | 3300046463 | Bacteria | 12219 |
| 482 | Ga0495653_0047038 | 3300046463 | Bacteria | 3338 |
| 483 | Ga0495653_0072119 | 3300046463 | Bacteria | 2579 |
| 484 | Ga0495653_0155902 | 3300046463 | Bacteria | 1590 |
| 485 | Ga0495653_0183391 | 3300046463 | Bacteria | 1434 |
| 486 | Ga0495650_0000007 | 3300046471 | Bacteria | 718072 |
| 487 | Ga0495650_0001711 | 3300046471 | Bacteria | 20137 |
| 488 | Ga0495650_0010003 | 3300046471 | Bacteria | 5337 |
| 489 | Ga0495650_0038166 | 3300046471 | Bacteria | 2083 |
| 490 | Ga0495650_0039764 | 3300046471 | Bacteria | 2026 |
| 491 | Ga0495650_0072034 | 3300046471 | Bacteria | 1353 |
| 492 | Ga0495580_0000302 | 3300046472 | Bacteria | 40112 |
| 493 | Ga0495580_0001573 | 3300046472 | Bacteria | 20072 |
| 494 | Ga0495580_0009825 | 3300046472 | Bacteria | 7503 |
| 495 | Ga0495580_0014037 | 3300046472 | Bacteria | 6092 |
| 496 | Ga0495580_0016553 | 3300046472 | Bacteria | 5531 |
| 497 | Ga0495580_0027489 | 3300046472 | Bacteria | 4139 |
| 498 | Ga0495580_0112366 | 3300046472 | Bacteria | 1892 |
| 499 | Ga0495582_0005015 | 3300046473 | Bacteria | 7419 |
| 500 | Ga0495582_0065691 | 3300046473 | Bacteria | 2004 |
| 501 | Ga0495605_0002667 | 3300046474 | Bacteria | 10920 |
| 502 | Ga0495605_0009236 | 3300046474 | Bacteria | 5540 |
| 503 | Ga0495605_0010282 | 3300046474 | Bacteria | 5240 |
| 504 | Ga0495605_0028952 | 3300046474 | Bacteria | 2855 |
| 505 | Ga0495639_0134711 | 3300046475 | Bacteria | 1184 |
| 506 | Ga0495662_0004987 | 3300046476 | Bacteria | 6649 |
| 507 | Ga0495662_0022988 | 3300046476 | Bacteria | 3010 |
| 508 | Ga0495662_0061546 | 3300046476 | Bacteria | 1814 |
| 509 | Ga0495662_0064588 | 3300046476 | Bacteria | 1769 |
| 510 | Ga0495664_0001157 | 3300046477 | Bacteria | 13713 |
| 511 | Ga0495664_0012877 | 3300046477 | Bacteria | 4739 |
| 512 | Ga0495585_0046538 | 3300046492 | Bacteria | 2419 |
| 513 | Ga0495594_0027143 | 3300046499 | Bacteria | 3084 |
| 514 | Ga0495596_0001981 | 3300046500 | Bacteria | 11294 |
| 515 | Ga0495596_0051859 | 3300046500 | Bacteria | 1606 |
| 516 | Ga0495596_0177340 | 3300046500 | Bacteria | 828 |
| 517 | Ga0495607_0058749 | 3300046501 | Bacteria | 2197 |
| 518 | Ga0495607_0154216 | 3300046501 | Bacteria | 1173 |
| 519 | Ga0495583_0000209 | 3300046506 | Bacteria | 98671 |
| 520 | Ga0495583_0004759 | 3300046506 | Bacteria | 9536 |
| 521 | Ga0495606_0019943 | 3300046507 | Bacteria | 4963 |
| 522 | Ga0495606_0035281 | 3300046507 | Bacteria | 3421 |
| 523 | Ga0495606_0067238 | 3300046507 | Bacteria | 2270 |
| 524 | Ga0495606_0197918 | 3300046507 | Bacteria | 1147 |
| 525 | Ga0495608_0000721 | 3300046511 | Bacteria | 23015 |
| 526 | Ga0495608_0002463 | 3300046511 | Bacteria | 13294 |
| 527 | Ga0495608_0013647 | 3300046511 | Bacteria | 5636 |
| 528 | Ga0495608_0136355 | 3300046511 | Bacteria | 1568 |
| 529 | Ga0495610_0000127 | 3300046512 | Bacteria | 84143 |
| 530 | Ga0495610_0000195 | 3300046512 | Bacteria | 67472 |
| 531 | Ga0495610_0001399 | 3300046512 | Bacteria | 21428 |
| 532 | Ga0495616_0001431 | 3300046513 | Bacteria | 16614 |
| 533 | Ga0495616_0042489 | 3300046513 | Bacteria | 2314 |
| 534 | Ga0495618_0005667 | 3300046514 | Bacteria | 7591 |
| 535 | Ga0495618_0011010 | 3300046514 | Bacteria | 5481 |
| 536 | Ga0495618_0097707 | 3300046514 | Bacteria | 1879 |
| 537 | Ga0495628_0019540 | 3300046516 | Bacteria | 5598 |
| 538 | Ga0495628_0022733 | 3300046516 | Bacteria | 5149 |
| 539 | Ga0495628_0061401 | 3300046516 | Bacteria | 2947 |
| 540 | Ga0495628_0121769 | 3300046516 | Bacteria | 2000 |
| 541 | Ga0495628_0223216 | 3300046516 | Bacteria | 1414 |
| 542 | Ga0495630_0000005 | 3300046517 | Bacteria | 406219 |
| 543 | Ga0495630_0084812 | 3300046517 | Bacteria | 2391 |
| 544 | Ga0495630_0120180 | 3300046517 | Bacteria | 1993 |
| 545 | Ga0495630_0192089 | 3300046517 | Bacteria | 1557 |
| 546 | Ga0495630_0409124 | 3300046517 | Bacteria | 1039 |
| 547 | Ga0495631_0002603 | 3300046518 | Bacteria | 10084 |
| 548 | Ga0495637_0004227 | 3300046520 | Bacteria | 7459 |
| 549 | Ga0495637_0007583 | 3300046520 | Bacteria | 5368 |
| 550 | Ga0495637_0012422 | 3300046520 | Bacteria | 4072 |
| 551 | Ga0495643_0006927 | 3300046522 | Bacteria | 7374 |
| 552 | Ga0495643_0023390 | 3300046522 | Bacteria | 3514 |
| 553 | Ga0495643_0169892 | 3300046522 | Bacteria | 1067 |
| 554 | Ga0495648_0002225 | 3300046524 | Bacteria | 18134 |
| 555 | Ga0495648_0012803 | 3300046524 | Bacteria | 6228 |
| 556 | Ga0495648_0017826 | 3300046524 | Bacteria | 5060 |
| 557 | Ga0495648_0040724 | 3300046524 | Bacteria | 2942 |
| 558 | Ga0495648_0071733 | 3300046524 | Bacteria | 2006 |
| 559 | Ga0495648_0107219 | 3300046524 | Bacteria | 1527 |
| 560 | Ga0495648_0112160 | 3300046524 | Bacteria | 1482 |
| 561 | Ga0495663_0008082 | 3300046525 | Bacteria | 2911 |
| 562 | Ga0495666_0001199 | 3300046526 | Bacteria | 12516 |
| 563 | Ga0495666_0006920 | 3300046526 | Bacteria | 5695 |
| 564 | Ga0495666_0013815 | 3300046526 | Bacteria | 4026 |
| 565 | Ga0495666_0016418 | 3300046526 | Bacteria | 3686 |
| 566 | Ga0495666_0043695 | 3300046526 | Bacteria | 2164 |
| 567 | Ga0495666_0083087 | 3300046526 | Bacteria | 1514 |
| 568 | Ga0495652_0010784 | 3300046529 | Bacteria | 8283 |
| 569 | Ga0495652_0013894 | 3300046529 | Bacteria | 7241 |
| 570 | Ga0495652_0098010 | 3300046529 | Bacteria | 2383 |
| 571 | Ga0495652_0122887 | 3300046529 | Bacteria | 2067 |
| 572 | Ga0495652_0156120 | 3300046529 | Bacteria | 1777 |
| 573 | Ga0495652_0194512 | 3300046529 | Bacteria | 1545 |
| 574 | Ga0495654_0000262 | 3300046530 | Bacteria | 47780 |
| 575 | Ga0495654_0040990 | 3300046530 | Bacteria | 2305 |
| 576 | Ga0495654_0064725 | 3300046530 | Bacteria | 1747 |
| 577 | Ga0495654_0119728 | 3300046530 | Bacteria | 1193 |
| 578 | Ga0495665_0007143 | 3300046531 | Bacteria | 6029 |
| 579 | Ga0495665_0017791 | 3300046531 | Bacteria | 3820 |
| 580 | Ga0495665_0019537 | 3300046531 | Bacteria | 3643 |
| 581 | Ga0495665_0043147 | 3300046531 | Bacteria | 2398 |
| 582 | Ga0495665_0095573 | 3300046531 | Bacteria | 1560 |
| 583 | Ga0495640_0005747 | 3300046533 | Bacteria | 9856 |
| 584 | Ga0495640_0016145 | 3300046533 | Bacteria | 5592 |
| 585 | Ga0495640_0022717 | 3300046533 | Bacteria | 4580 |
| 586 | Ga0495640_0134679 | 3300046533 | Bacteria | 1596 |
| 587 | Ga0495586_0000830 | 3300046535 | Bacteria | 17768 |
| 588 | Ga0495586_0020449 | 3300046535 | Bacteria | 3525 |
| 589 | Ga0495587_0003407 | 3300046536 | Bacteria | 10605 |
| 590 | Ga0495587_0037840 | 3300046536 | Bacteria | 2894 |
| 591 | Ga0495587_0042110 | 3300046536 | Bacteria | 2724 |
| 592 | Ga0495587_0084174 | 3300046536 | Bacteria | 1842 |
| 593 | Ga0495597_0011826 | 3300046542 | Bacteria | 4225 |
| 594 | Ga0495645_0001202 | 3300046543 | Bacteria | 17703 |
| 595 | Ga0495645_0001234 | 3300046543 | Bacteria | 17452 |
| 596 | Ga0495645_0017810 | 3300046543 | Bacteria | 5095 |
| 597 | Ga0495645_0034844 | 3300046543 | Bacteria | 3670 |
| 598 | Ga0495645_0109585 | 3300046543 | Bacteria | 1955 |
| 599 | Ga0495622_0000416 | 3300046557 | Bacteria | 28234 |
| 600 | Ga0495622_0066630 | 3300046557 | Bacteria | 1664 |
| 601 | Ga0495622_0070803 | 3300046557 | Bacteria | 1609 |
| 602 | Ga0495622_0119980 | 3300046557 | Bacteria | 1201 |
| 603 | Ga0495633_0000486 | 3300046558 | Bacteria | 40273 |
| 604 | Ga0495667_0000319 | 3300046559 | Bacteria | 30374 |
| 605 | Ga0495667_0063791 | 3300046559 | Bacteria | 2411 |
| 606 | Ga0495667_0082886 | 3300046559 | Bacteria | 2083 |
| 607 | Ga0495668_0002183 | 3300046616 | Bacteria | 16740 |
| 608 | Ga0495668_0081593 | 3300046616 | Bacteria | 1774 |
| 609 | Ga0495634_0002073 | 3300046642 | Bacteria | 16965 |
| 610 | Ga0495634_0014012 | 3300046642 | Bacteria | 5789 |
| 611 | Ga0495634_0021151 | 3300046642 | Bacteria | 4603 |
| 612 | Ga0495634_0046559 | 3300046642 | Bacteria | 2926 |
| 613 | Ga0495611_0041064 | 3300046648 | Bacteria | 2063 |
| 614 | Ga0495611_0054433 | 3300046648 | Bacteria | 1809 |
| 615 | Ga0495611_0142766 | 3300046648 | Bacteria | 1118 |
| 616 | Ga0495625_0041628 | 3300046660 | Bacteria | 3342 |
| 617 | Ga0495625_0068433 | 3300046660 | Bacteria | 2496 |
| 618 | Ga0495635_0000180 | 3300046663 | Bacteria | 40008 |
| 619 | Ga0495635_0000986 | 3300046663 | Bacteria | 18758 |
| 620 | Ga0495635_0004865 | 3300046663 | Bacteria | 9346 |
| 621 | Ga0495635_0045947 | 3300046663 | Bacteria | 3012 |
| 622 | Ga0495661_0001100 | 3300046665 | Bacteria | 23680 |
| 623 | Ga0495661_0009353 | 3300046665 | Bacteria | 6727 |
| 624 | Ga0495661_0027764 | 3300046665 | Bacteria | 3630 |
| 625 | Ga0495588_0028684 | 3300046674 | Bacteria | 2788 |
| 626 | Ga0495657_0006534 | 3300046675 | Bacteria | 9117 |
| 627 | Ga0495657_0052534 | 3300046675 | Bacteria | 2731 |
| 628 | Ga0495657_0228912 | 3300046675 | Bacteria | 1125 |
| 629 | Ga0495599_0000885 | 3300046678 | Bacteria | 16722 |
| 630 | Ga0495599_0009795 | 3300046678 | Bacteria | 5865 |
| 631 | Ga0495599_0017908 | 3300046678 | Bacteria | 4411 |
| 632 | Ga0495599_0123309 | 3300046678 | Bacteria | 1611 |
| 633 | Ga0495623_0002524 | 3300046679 | Bacteria | 12120 |
| 634 | Ga0495623_0007636 | 3300046679 | Bacteria | 7025 |
| 635 | Ga0495623_0023038 | 3300046679 | Bacteria | 4020 |
| 636 | Ga0495623_0054728 | 3300046679 | Bacteria | 2517 |
| 637 | Ga0495623_0057306 | 3300046679 | Bacteria | 2451 |
| 638 | Ga0495623_0140124 | 3300046679 | Bacteria | 1440 |
| 639 | Ga0495646_0002312 | 3300046680 | Bacteria | 11665 |
| 640 | Ga0495646_0003646 | 3300046680 | Bacteria | 9606 |
| 641 | Ga0495646_0005817 | 3300046680 | Bacteria | 7820 |
| 642 | Ga0495646_0012263 | 3300046680 | Bacteria | 5450 |
| 643 | Ga0495646_0026685 | 3300046680 | Bacteria | 3626 |
| 644 | Ga0495646_0187937 | 3300046680 | Bacteria | 1130 |
| 645 | Ga0495647_0024093 | 3300046681 | Unclassified | 2213 |
| 646 | Ga0495647_0051090 | 3300046681 | Bacteria | 1606 |
| 647 | Ga0495658_0287112 | 3300046683 | Bacteria | 1039 |
| 648 | Ga0495669_0029409 | 3300046684 | Bacteria | 2409 |
| 649 | Ga0495669_0062496 | 3300046684 | Bacteria | 1687 |
| 650 | Ga0495613_0000699 | 3300046689 | Bacteria | 26439 |
| 651 | Ga0495613_0001221 | 3300046689 | Bacteria | 19632 |
| 652 | Ga0495613_0026003 | 3300046689 | Bacteria | 4361 |
| 653 | Ga0495613_0412259 | 3300046689 | Bacteria | 920 |
| 654 | Ga0495624_0028174 | 3300046690 | Bacteria | 3672 |
| 655 | Ga0495624_0031854 | 3300046690 | Bacteria | 3423 |
| 656 | Ga0495624_0036841 | 3300046690 | Bacteria | 3150 |
| 657 | Ga0495624_0052917 | 3300046690 | Bacteria | 2564 |
| 658 | Ga0495624_0074205 | 3300046690 | Bacteria | 2114 |
| 659 | Ga0495624_0082759 | 3300046690 | Bacteria | 1985 |
| 660 | Ga0495624_0264272 | 3300046690 | Bacteria | 1039 |
| 661 | Ga0495670_0000160 | 3300046691 | Bacteria | 29343 |
| 662 | Ga0495670_0061459 | 3300046691 | Bacteria | 1889 |
| 663 | Ga0495671_0002938 | 3300046692 | Bacteria | 10608 |
| 664 | Ga0495671_0005670 | 3300046692 | Bacteria | 7282 |
| 665 | Ga0495671_0016873 | 3300046692 | Bacteria | 3892 |
| 666 | Ga0495671_0074841 | 3300046692 | Bacteria | 1661 |
| 667 | Ga0495649_0022385 | 3300046694 | Bacteria | 3536 |
| 668 | Ga0495649_0050840 | 3300046694 | Bacteria | 2248 |
| 669 | Ga0495589_0000838 | 3300046794 | Bacteria | 19307 |
| 670 | Ga0495589_0001288 | 3300046794 | Bacteria | 14823 |
| 671 | Ga0495589_0003149 | 3300046794 | Bacteria | 9026 |
| 672 | Ga0495589_0043248 | 3300046794 | Bacteria | 2243 |
| 673 | Ga0495600_0003931 | 3300046809 | Bacteria | 8829 |
| 674 | Ga0495600_0005333 | 3300046809 | Bacteria | 7748 |
| 675 | Ga0495600_0008525 | 3300046809 | Bacteria | 6303 |
| 676 | Ga0495600_0085655 | 3300046809 | Bacteria | 2056 |
| 677 | Ga0495660_0029848 | 3300046810 | Bacteria | 3075 |
| 678 | Ga0495660_0096562 | 3300046810 | Bacteria | 1527 |
| 679 | Ga0495660_0100688 | 3300046810 | Bacteria | 1488 |
| 680 | Ga0495581_0000663 | 3300047315 | Bacteria | 18068 |
| 681 | Ga0495581_0006131 | 3300047315 | Bacteria | 6969 |
| 682 | Ga0495581_0016518 | 3300047315 | Bacteria | 4289 |
| 683 | Ga0495604_0004307 | 3300047317 | Bacteria | 11263 |
| 684 | Ga0495604_0018287 | 3300047317 | Bacteria | 5613 |
| 685 | Ga0495604_0037638 | 3300047317 | Bacteria | 3809 |
| 686 | Ga0495604_0055582 | 3300047317 | Bacteria | 3050 |
| 687 | Ga0495604_0079211 | 3300047317 | Bacteria | 2464 |
| 688 | Ga0495674_0020526 | 3300047319 | Bacteria | 6114 |
| 689 | Ga0495674_0024016 | 3300047319 | Bacteria | 5609 |
| 690 | Ga0495674_0027200 | 3300047319 | Bacteria | 5227 |
| 691 | Ga0495674_0060517 | 3300047319 | Bacteria | 3304 |
| 692 | Ga0495674_0063290 | 3300047319 | Bacteria | 3218 |
| 693 | Ga0495674_0070202 | 3300047319 | Bacteria | 3027 |
| 694 | Ga0495674_0093373 | 3300047319 | Bacteria | 2567 |
| 695 | Ga0495674_0146060 | 3300047319 | Bacteria | 1985 |
| 696 | Ga0495674_0198659 | 3300047319 | Bacteria | 1664 |
| 697 | Ga0495672_0001435 | 3300047320 | Bacteria | 23387 |
| 698 | Ga0495672_0131500 | 3300047320 | Bacteria | 1316 |
| 699 | Ga0495676_0046877 | 3300047321 | Bacteria | 3502 |
| 700 | Ga0495676_0066032 | 3300047321 | Bacteria | 2806 |
| 701 | Ga0495676_0085241 | 3300047321 | Bacteria | 2380 |
| 702 | Ga0495676_0181988 | 3300047321 | Bacteria | 1472 |
| 703 | Ga0495680_0003458 | 3300047322 | Bacteria | 15547 |
| 704 | Ga0495680_0012704 | 3300047322 | Bacteria | 7392 |
| 705 | Ga0495680_0015798 | 3300047322 | Bacteria | 6498 |
| 706 | Ga0495680_0023379 | 3300047322 | Bacteria | 5140 |
| 707 | Ga0495680_0069916 | 3300047322 | Bacteria | 2677 |
| 708 | Ga0495680_0124547 | 3300047322 | Bacteria | 1900 |
| 709 | Ga0495683_0002777 | 3300047323 | Bacteria | 10424 |
| 710 | Ga0495683_0007542 | 3300047323 | Bacteria | 5869 |
| 711 | Ga0495683_0012486 | 3300047323 | Bacteria | 4457 |
| 712 | Ga0495683_0014509 | 3300047323 | Bacteria | 4106 |
| 713 | Ga0495683_0016995 | 3300047323 | Bacteria | 3773 |
| 714 | Ga0495683_0071782 | 3300047323 | Bacteria | 1698 |
| 715 | Ga0495683_0096904 | 3300047323 | Bacteria | 1422 |
| 716 | Ga0495683_0138861 | 3300047323 | Bacteria | 1140 |
| 717 | Ga0495683_0214739 | 3300047323 | Bacteria | 861 |
| 718 | Ga0495687_000419 | 3300047443 | Bacteria | 52487 |
| 719 | Ga0495687_006987 | 3300047443 | Bacteria | 6777 |
| 720 | Ga0495687_032079 | 3300047443 | Bacteria | 2403 |
| 721 | Ga0495687_059797 | 3300047443 | Bacteria | 1574 |
| 722 | Ga0495687_127075 | 3300047443 | Bacteria | 909 |
| 723 | Ga0495675_0001691 | 3300047444 | Bacteria | 13223 |
| 724 | Ga0495675_0002275 | 3300047444 | Bacteria | 11467 |
| 725 | Ga0495675_0006134 | 3300047444 | Bacteria | 7360 |
| 726 | Ga0495675_0016472 | 3300047444 | Bacteria | 4675 |
| 727 | Ga0495675_0167805 | 3300047444 | Bacteria | 1349 |
| 728 | Ga0495679_000271 | 3300047446 | Bacteria | 43383 |
| 729 | Ga0495679_007135 | 3300047446 | Bacteria | 4702 |
| 730 | Ga0495679_009458 | 3300047446 | Bacteria | 3901 |
| 731 | Ga0495685_061841 | 3300047447 | Bacteria | 1261 |
| 732 | Ga0495673_0000743 | 3300047469 | Bacteria | 31064 |
| 733 | Ga0495673_0001213 | 3300047469 | Bacteria | 21466 |
| 734 | Ga0495673_0001789 | 3300047469 | Bacteria | 16305 |
| 735 | Ga0495673_0015862 | 3300047469 | Bacteria | 3868 |
| 736 | Ga0495673_0056281 | 3300047469 | Bacteria | 1702 |
| 737 | Ga0495681_0000155 | 3300047470 | Bacteria | 57469 |
| 738 | Ga0495684_0000023 | 3300047471 | Bacteria | 133626 |
| 739 | Ga0495684_0031282 | 3300047471 | Bacteria | 4086 |
| 740 | Ga0495684_0139743 | 3300047471 | Bacteria | 1816 |
| 741 | Ga0495686_0000233 | 3300047472 | Bacteria | 101644 |
| 742 | Ga0495686_0000518 | 3300047472 | Bacteria | 55768 |
| 743 | Ga0495686_0000540 | 3300047472 | Bacteria | 54110 |
| 744 | Ga0495686_0006648 | 3300047472 | Bacteria | 8809 |
| 745 | Ga0495686_0030290 | 3300047472 | Bacteria | 3515 |
| 746 | Ga0495593_0000221 | 3300047673 | Bacteria | 30321 |
| 747 | Ga0495593_0009056 | 3300047673 | Bacteria | 5775 |
| 748 | Ga0495593_0010249 | 3300047673 | Bacteria | 5419 |
| 749 | Ga0495593_0015012 | 3300047673 | Bacteria | 4398 |
| 750 | Ga0495593_0057770 | 3300047673 | Bacteria | 2036 |
| 751 | Ga0495593_0077371 | 3300047673 | Bacteria | 1723 |
| 752 | Ga0495602_0005453 | 3300048088 | Bacteria | 13340 |
| 753 | Ga0495602_0013760 | 3300048088 | Bacteria | 8250 |
| 754 | Ga0495602_0036088 | 3300048088 | Bacteria | 4604 |
| 755 | Ga0495602_0067720 | 3300048088 | Bacteria | 3069 |
| 756 | Ga0495602_0096917 | 3300048088 | Bacteria | 2431 |
| 757 | Ga0495602_0107756 | 3300048088 | Bacteria | 2270 |
| 758 | Ga0495602_0135232 | 3300048088 | Bacteria | 1959 |
| 759 | Ga0495602_0233404 | 3300048088 | Bacteria | 1380 |
| 760 | Ga0495602_0493724 | 3300048088 | Bacteria | 857 |
| 761 | Ga0495614_0000451 | 3300048089 | Bacteria | 16848 |
| 762 | Ga0495614_0019573 | 3300048089 | Bacteria | 2929 |
| 763 | Ga0495626_0017385 | 3300048091 | Bacteria | 3632 |
| 764 | Ga0495626_0060458 | 3300048091 | Bacteria | 1726 |
| 765 | Ga0496100_0016120 | 3300048903 | Bacteria | 4380 |
| 766 | Ga0496100_0024752 | 3300048903 | Bacteria | 3665 |
| 767 | Ga0496100_0111857 | 3300048903 | Bacteria | 1898 |
| 768 | Ga0496101_0012888 | 3300048904 | Bacteria | 5592 |
| 769 | Ga0496101_0056916 | 3300048904 | Bacteria | 2826 |
| 770 | Ga0496101_0107050 | 3300048904 | Bacteria | 2100 |
| 771 | Ga0496101_0186228 | 3300048904 | Bacteria | 1600 |
| 772 | Ga0496101_0359572 | 3300048904 | Bacteria | 1144 |
| 773 | Ga0496102_0008993 | 3300048905 | Bacteria | 8571 |
| 774 | Ga0496102_0055366 | 3300048905 | Bacteria | 3617 |
| 775 | Ga0496102_0793079 | 3300048905 | Bacteria | 870 |
| 776 | Ga0496103_0002058 | 3300048906 | Bacteria | 12871 |
| 777 | Ga0496103_0004787 | 3300048906 | Bacteria | 8181 |
| 778 | Ga0496103_0134127 | 3300048906 | Bacteria | 1582 |
| 779 | Ga0496104_0000055 | 3300048907 | Bacteria | 124267 |
| 780 | Ga0496104_0090976 | 3300048907 | Bacteria | 2916 |
| 781 | Ga0496104_0124176 | 3300048907 | Bacteria | 2478 |
| 782 | Ga0496104_0216510 | 3300048907 | Bacteria | 1827 |
| 783 | Ga0496104_0543270 | 3300048907 | Bacteria | 1073 |
| 784 | Ga0496105_0062824 | 3300048908 | Bacteria | 3064 |
| 785 | Ga0496105_0123359 | 3300048908 | Bacteria | 2135 |
| 786 | Ga0496105_0130301 | 3300048908 | Bacteria | 2074 |
| 787 | Ga0496105_0150056 | 3300048908 | Bacteria | 1916 |
| 788 | Ga0496105_0334484 | 3300048908 | Bacteria | 1212 |
| 789 | Ga0496106_0002838 | 3300048909 | Bacteria | 12857 |
| 790 | Ga0496106_0004759 | 3300048909 | Bacteria | 10033 |
| 791 | Ga0496107_0027843 | 3300048910 | Bacteria | 4015 |
| 792 | Ga0496107_0339683 | 3300048910 | Bacteria | 1117 |
| 793 | Ga0496109_0141124 | 3300048912 | Bacteria | 2252 |
| 794 | Ga0496109_0393014 | 3300048912 | Bacteria | 1310 |
| 795 | Ga0496111_0008723 | 3300048914 | Bacteria | 6728 |
| 796 | Ga0496113_0023434 | 3300048916 | Bacteria | 4377 |
| 797 | Ga0496114_0026363 | 3300048917 | Bacteria | 4757 |
| 798 | Ga0496114_0237392 | 3300048917 | Bacteria | 1602 |
| 799 | Ga0496115_0033943 | 3300048918 | Bacteria | 4032 |
| 800 | Ga0496115_0200891 | 3300048918 | Bacteria | 1647 |
| 801 | Ga0496116_0070588 | 3300048919 | Bacteria | 2216 |
| 802 | Ga0496116_0087016 | 3300048919 | Bacteria | 1914 |
| 803 | Ga0496116_0098192 | 3300048919 | Bacteria | 1758 |
| 804 | Ga0496116_0133908 | 3300048919 | Bacteria | 1407 |
| 805 | Ga0496116_0143858 | 3300048919 | Bacteria | 1336 |
| 806 | Ga0496117_0005798 | 3300048920 | Bacteria | 12808 |
| 807 | Ga0496117_0011530 | 3300048920 | Bacteria | 7910 |
| 808 | Ga0496117_0019287 | 3300048920 | Bacteria | 5609 |
| 809 | Ga0496117_0022924 | 3300048920 | Bacteria | 4996 |
| 810 | Ga0496117_0061518 | 3300048920 | Bacteria | 2580 |
| 811 | Ga0496117_0085023 | 3300048920 | Bacteria | 2061 |
| 812 | Ga0496118_0002114 | 3300048921 | Bacteria | 27831 |
| 813 | Ga0496118_0002552 | 3300048921 | Bacteria | 24370 |
| 814 | Ga0496118_0012795 | 3300048921 | Bacteria | 8008 |
| 815 | Ga0496118_0022621 | 3300048921 | Bacteria | 5487 |
| 816 | Ga0496118_0098992 | 3300048921 | Bacteria | 1978 |
| 817 | Ga0496118_0104571 | 3300048921 | Bacteria | 1900 |
| 818 | Ga0496118_0107393 | 3300048921 | Bacteria | 1864 |
| 819 | Ga0496118_0122723 | 3300048921 | Bacteria | 1689 |
| 820 | Ga0496118_0139404 | 3300048921 | Bacteria | 1541 |
| 821 | Ga0496118_0159568 | 3300048921 | Bacteria | 1397 |
| 822 | Ga0496119_0086537 | 3300048922 | Bacteria | 1791 |
| 823 | Ga0496119_0193487 | 3300048922 | Bacteria | 1058 |
| 824 | Ga0496121_0000757 | 3300048924 | Bacteria | 59348 |
| 825 | Ga0496121_0002288 | 3300048924 | Bacteria | 29774 |
| 826 | Ga0496121_0006568 | 3300048924 | Bacteria | 14361 |
| 827 | Ga0496121_0011728 | 3300048924 | Bacteria | 9671 |
| 828 | Ga0496121_0037278 | 3300048924 | Bacteria | 4321 |
| 829 | Ga0496121_0049486 | 3300048924 | Bacteria | 3563 |
| 830 | Ga0496121_0049639 | 3300048924 | Bacteria | 3555 |
| 831 | Ga0496121_0059437 | 3300048924 | Bacteria | 3152 |
| 832 | Ga0496121_0130767 | 3300048924 | Bacteria | 1879 |
| 833 | Ga0496122_0065255 | 3300048925 | Bacteria | 2641 |
| 834 | Ga0496122_0108735 | 3300048925 | Bacteria | 1828 |
| 835 | Ga0496124_0003589 | 3300048927 | Bacteria | 18856 |
| 836 | Ga0496124_0099710 | 3300048927 | Bacteria | 2355 |
| 837 | Ga0496124_0136301 | 3300048927 | Bacteria | 1943 |
| 838 | Ga0496124_0373346 | 3300048927 | Bacteria | 1000 |
| 839 | Ga0496125_0095734 | 3300048928 | Bacteria | 2207 |
| 840 | Ga0496125_0146896 | 3300048928 | Bacteria | 1628 |
| 841 | Ga0496126_0000538 | 3300048929 | Bacteria | 73271 |
| 842 | Ga0496126_0002311 | 3300048929 | Bacteria | 26148 |
| 843 | Ga0496126_0008981 | 3300048929 | Bacteria | 10696 |
| 844 | Ga0496126_0020776 | 3300048929 | Bacteria | 6427 |
| 845 | Ga0496126_0064964 | 3300048929 | Bacteria | 3267 |
| 846 | Ga0496126_0084304 | 3300048929 | Bacteria | 2803 |
| 847 | Ga0495678_000801 | 3300049459 | Bacteria | 28160 |
| 848 | Ga0495678_054660 | 3300049459 | Bacteria | 1528 |
| 849 | Ga0495678_059696 | 3300049459 | Bacteria | 1437 |
| 850 | Ga0495682_0051384 | 3300049460 | Bacteria | 1499 |
| 851 | Ga0495682_0100826 | 3300049460 | Bacteria | 1035 |
| 852 | Ga0501032_0001988 | 3300049569 | Bacteria | 16106 |
| 853 | Ga0501034_0077093 | 3300049571 | Bacteria | 3339 |
| 854 | Ga0501034_0435982 | 3300049571 | Bacteria | 1229 |
| 855 | Ga0501036_0040681 | 3300049572 | Bacteria | 3932 |
| 856 | Ga0501036_0282131 | 3300049572 | Bacteria | 1390 |
| 857 | Ga0501038_0011461 | 3300049574 | Bacteria | 8088 |
| 858 | Ga0501043_0001461 | 3300049579 | Bacteria | 20653 |
| 859 | Ga0501043_0044039 | 3300049579 | Bacteria | 3508 |
| 860 | Ga0501047_0045113 | 3300049581 | Bacteria | 4261 |
| 861 | Ga0501067_0000017 | 3300049583 | Bacteria | 102087 |
| 862 | Ga0501073_0000021 | 3300049589 | Bacteria | 135534 |
| 863 | Ga0501073_0007819 | 3300049589 | Bacteria | 7938 |
| 864 | Ga0501077_0002351 | 3300049593 | Bacteria | 11397 |
| 865 | Ga0501249_000121 | 3300049679 | Bacteria | 23955 |
| 866 | Ga0501080_0004783 | 3300049742 | Bacteria | 12074 |
| 867 | Ga0501080_0012022 | 3300049742 | Bacteria | 7928 |
| 868 | Ga0501083_0064868 | 3300049744 | Bacteria | 2433 |
| 869 | Ga0501044_0024149 | 3300049823 | Bacteria | 6458 |
| 870 | Ga0501044_0037129 | 3300049823 | Bacteria | 5093 |
| 871 | nmdc:mga03683_16824_c1 | 3300050489 | Bacteria | 2756 |
| 872 | nmdc:mga03683_2_c1 | 3300050489 | Bacteria | 289140 |
| 873 | nmdc:mga03n38_388_c1 | 3300050490 | Bacteria | 10864 |
| 874 | nmdc:mga03n38_40367_c1 | 3300050490 | Bacteria | 2028 |
| 875 | nmdc:mga00v17_168803_c1 | 3300050491 | Bacteria | 1410 |
| 876 | nmdc:mga00v17_52090_c1 | 3300050491 | Bacteria | 2490 |
| 877 | nmdc:mga00v17_72568_c1 | 3300050491 | Bacteria | 2136 |
| 878 | nmdc:mga0yw44_47820_c1 | 3300050492 | Bacteria | 2577 |
| 879 | nmdc:mga0k408_25420_c1 | 3300050493 | Bacteria | 3354 |
| 880 | nmdc:mga0k408_256998_c1 | 3300050493 | Bacteria | 1043 |
| 881 | nmdc:mga0k408_2699_c1 | 3300050493 | Bacteria | 9415 |
| 882 | nmdc:mga0k408_64881_c1 | 3300050493 | Bacteria | 2125 |
| 883 | nmdc:mga0k408_71796_c1 | 3300050493 | Bacteria | 2021 |
| 884 | nmdc:mga06z11_50299_c1 | 3300050494 | Bacteria | 2130 |
| 885 | nmdc:mga06z11_6779_c1 | 3300050494 | Bacteria | 4680 |
| 886 | nmdc:mga07m45_178570_c1 | 3300050496 | Bacteria | 1235 |
| 887 | nmdc:mga07m45_208857_c1 | 3300050496 | Bacteria | 1136 |
| 888 | nmdc:mga07m45_2_c1 | 3300050496 | Bacteria | 451154 |
| 889 | nmdc:mga07m45_35130_c1 | 3300050496 | Bacteria | 2788 |
| 890 | nmdc:mga07m45_37057_c1 | 3300050496 | Bacteria | 2720 |
| 891 | nmdc:mga07m45_52383_c1 | 3300050496 | Bacteria | 2304 |
| 892 | nmdc:mga09592_1643_c1 | 3300050508 | Bacteria | 18008 |
| 893 | nmdc:mga0qj67_27966_c1 | 3300050509 | Bacteria | 4374 |
| 894 | nmdc:mga08y16_36637_c1 | 3300050511 | Bacteria | 5151 |
| 895 | nmdc:mga08x19_44375_c1 | 3300050514 | Bacteria | 2838 |
| 896 | nmdc:mga0sz30_28568_c1 | 3300050516 | Bacteria | 2296 |
| 897 | nmdc:mga0sz30_43518_c1 | 3300050516 | Bacteria | 1565 |
| 898 | Ga0495601_0000087 | 3300053077 | Bacteria | 49790 |
| 899 | Ga0495601_0037088 | 3300053077 | Bacteria | 3047 |
| 900 | Ga0495601_0083025 | 3300053077 | Bacteria | 2057 |
| 901 | Ga0495601_0160555 | 3300053077 | Bacteria | 1469 |
| 902 | Ga0495612_0001669 | 3300053078 | Bacteria | 9134 |
| 903 | Ga0495612_0040056 | 3300053078 | Bacteria | 1908 |
| 904 | Ga0500635_0000511 | 3300053080 | Bacteria | 10708 |
| 905 | Ga0495595_0000218 | 3300053084 | Bacteria | 23092 |
| 906 | Ga0495595_0000375 | 3300053084 | Bacteria | 16884 |
| 907 | Ga0495619_0000111 | 3300053085 | Bacteria | 61304 |
| 908 | Ga0495619_0000951 | 3300053085 | Bacteria | 18980 |
| 909 | Ga0495619_0056365 | 3300053085 | Bacteria | 2605 |
| 910 | Ga0495619_0063582 | 3300053085 | Bacteria | 2458 |
| 911 | Ga0495619_0421866 | 3300053085 | Bacteria | 920 |
| 912 | Ga0500643_000211 | 3300053087 | Bacteria | 54924 |
| 913 | Ga0500643_001276 | 3300053087 | Bacteria | 14875 |
| 914 | Ga0500643_022003 | 3300053087 | Bacteria | 2060 |
| 915 | Ga0500644_0000524 | 3300053088 | Bacteria | 16194 |
| 916 | Ga0500644_0000551 | 3300053088 | Bacteria | 15106 |
| 917 | Ga0500644_0001360 | 3300053088 | Bacteria | 6535 |
| 918 | Ga0500581_041001 | 3300053089 | Bacteria | 2371 |
| 919 | Ga0500647_0014896 | 3300053091 | Bacteria | 3545 |
| 920 | Ga0500566_0002826 | 3300053094 | Bacteria | 10332 |
| 921 | Ga0500641_0008524 | 3300053096 | Bacteria | 3663 |
| 922 | Ga0500641_0037746 | 3300053096 | Bacteria | 1938 |
| 923 | Ga0500648_081059 | 3300053097 | Bacteria | 1826 |
| 924 | Ga0500555_012652 | 3300053103 | Bacteria | 2430 |
| 925 | Ga0500556_0000005 | 3300053104 | Bacteria | 581135 |
| 926 | Ga0500562_000144 | 3300053108 | Bacteria | 20946 |
| 927 | Ga0500562_005970 | 3300053108 | Bacteria | 3067 |
| 928 | Ga0500572_000899 | 3300053111 | Bacteria | 9215 |
| 929 | Ga0500594_0000525 | 3300053118 | Bacteria | 8309 |
| 930 | Ga0500595_020332 | 3300053119 | Bacteria | 2392 |
| 931 | Ga0500595_030197 | 3300053119 | Bacteria | 1829 |
| 932 | Ga0500607_000011 | 3300053121 | Bacteria | 110773 |
| 933 | Ga0500608_023846 | 3300053122 | Bacteria | 2851 |
| 934 | Ga0500608_037185 | 3300053122 | Bacteria | 2325 |
| 935 | Ga0500618_000145 | 3300053125 | Bacteria | 58724 |
| 936 | Ga0500618_004368 | 3300053125 | Bacteria | 4545 |
| 937 | Ga0500628_102911 | 3300053129 | Bacteria | 758 |
| 938 | Ga0500642_0000006 | 3300053130 | Bacteria | 350064 |
| 939 | Ga0500642_0000621 | 3300053130 | Bacteria | 10565 |
| 940 | Ga0500655_000072 | 3300053133 | Bacteria | 27038 |
| 941 | Ga0500655_005301 | 3300053133 | Bacteria | 2329 |
| 942 | Ga0500658_0001897 | 3300053134 | Bacteria | 8203 |
| 943 | Ga0500559_0000007 | 3300053136 | Bacteria | 226236 |
| 944 | Ga0500559_0000067 | 3300053136 | Bacteria | 83330 |
| 945 | Ga0500559_0000624 | 3300053136 | Bacteria | 24044 |
| 946 | Ga0500559_0000915 | 3300053136 | Bacteria | 18771 |
| 947 | Ga0500559_0002226 | 3300053136 | Bacteria | 10252 |
| 948 | Ga0500559_0002389 | 3300053136 | Bacteria | 9751 |
| 949 | Ga0500559_0007361 | 3300053136 | Bacteria | 4881 |
| 950 | Ga0500559_0103399 | 3300053136 | Bacteria | 1314 |
| 951 | Ga0500559_0173205 | 3300053136 | Bacteria | 1015 |
| 952 | Ga0500559_0198050 | 3300053136 | Bacteria | 947 |
| 953 | Ga0500564_000882 | 3300053138 | Bacteria | 9678 |
| 954 | Ga0500573_0095935 | 3300053140 | Bacteria | 1671 |
| 955 | Ga0500577_0001180 | 3300053142 | Bacteria | 6685 |
| 956 | Ga0500590_000281 | 3300053148 | Bacteria | 16107 |
| 957 | Ga0500604_0005013 | 3300053151 | Unclassified | 3505 |
| 958 | Ga0500616_0053160 | 3300053153 | Bacteria | 2126 |
| 959 | Ga0500622_0000060 | 3300053156 | Bacteria | 133737 |
| 960 | Ga0500622_0000172 | 3300053156 | Bacteria | 69427 |
| 961 | Ga0500624_000027 | 3300053157 | Bacteria | 108821 |
| 962 | Ga0500627_0000127 | 3300053158 | Bacteria | 23450 |
| 963 | Ga0500633_0022831 | 3300053160 | Bacteria | 1922 |
| 964 | Ga0500639_026870 | 3300053163 | Bacteria | 3041 |
| 965 | Ga0500636_0000098 | 3300053177 | Bacteria | 44586 |
| 966 | Ga0500636_0000129 | 3300053177 | Bacteria | 39152 |
| 967 | Ga0500636_0000334 | 3300053177 | Bacteria | 26118 |
| 968 | Ga0500636_0058824 | 3300053177 | Bacteria | 2246 |
| 969 | Ga0500637_0000020 | 3300053178 | Bacteria | 63918 |
| 970 | Ga0500570_000563 | 3300053724 | Bacteria | 14733 |
| 971 | Ga0500645_005267 | 3300053730 | Bacteria | 4794 |
| 972 | Ga0500645_016825 | 3300053730 | Bacteria | 2299 |
| 973 | Ga0500596_000465 | 3300053735 | Bacteria | 7540 |
| 974 | Ga0500661_000478 | 3300055283 | Bacteria | 7428 |
| 975 | Ga0500661_002807 | 3300055283 | Bacteria | 3283 |
| 976 | Ga0501082_0050481 | 3300060353 | Bacteria | 3587 |
| 977 | Ga0501082_0215159 | 3300060353 | Bacteria | 1672 |
| 978 | Ga0466962_0004545 | 3300061719 | Bacteria | 6655 |
| 979 | Ga0466962_0004735 | 3300061719 | Bacteria | 6540 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026089 | Ga0207648_10204744 | Ga0207648_102047441 | 180 |
| 2 | 3300042876 | Ga0451577_0711638 | Ga0451577_0711638_33_647 | 199 |
| 3 | 3300053129 | Ga0500628_102911 | Ga0500628_102911_23_712 | 211 |
| 4 | 3300053136 | Ga0500559_0000915 | Ga0500559_0000915_17299_17967 | 213 |
| 5 | 3300049581 | Ga0501047_0045113 | Ga0501047_0045113_27_710 | 215 |
| 6 | 3300044712 | Ga0453684_0518630 | Ga0453684_0518630_28_696 | 217 |
| 7 | 3300005435 | Ga0070714_100015389 | Ga0070714_1000153893 | 222 |
| 8 | 3300025929 | Ga0207664_10006538 | Ga0207664_100065383 | 222 |
| 9 | 3300053122 | Ga0500608_037185 | Ga0500608_037185_66_767 | 223 |
| 10 | 3300025937 | Ga0207669_10121095 | Ga0207669_101210951 | 230 |
| 11 | 3300006186 | Ga0075369_10010043 | Ga0075369_100100432 | 237 |
| 12 | 3300006195 | Ga0075366_10014611 | Ga0075366_100146114 | 237 |
| 13 | 3300009176 | Ga0105242_10483129 | Ga0105242_104831292 | 237 |
| 14 | 3300014969 | Ga0157376_10230952 | Ga0157376_102309522 | 237 |
| 15 | 3300026078 | Ga0207702_10035282 | Ga0207702_100352822 | 239 |
| 16 | 3300049571 | Ga0501034_0435982 | Ga0501034_0435982_460_1212 | 239 |
| 17 | 3300060353 | Ga0501082_0215159 | Ga0501082_0215159_15_767 | 239 |
| 18 | 3300005466 | Ga0070685_10002911 | Ga0070685_100029117 | 241 |
| 19 | 3300006880 | Ga0075429_100001195 | Ga0075429_10000119517 | 242 |
| 20 | 3300005336 | Ga0070680_100112515 | Ga0070680_1001125151 | 243 |
| 21 | 3300005563 | Ga0068855_100216159 | Ga0068855_1002161592 | 243 |
| 22 | 3300009093 | Ga0105240_10106844 | Ga0105240_101068443 | 243 |
| 23 | 3300013104 | Ga0157370_10244972 | Ga0157370_102449724 | 243 |
| 24 | 3300013104 | Ga0157370_10600392 | Ga0157370_106003921 | 243 |
| 25 | 3300025913 | Ga0207695_10332538 | Ga0207695_103325382 | 243 |
| 26 | 3300031711 | Ga0265314_10068772 | Ga0265314_100687722 | 243 |
| 27 | 3300032002 | Ga0307416_100240652 | Ga0307416_1002406522 | 243 |
| 28 | 3300044842 | Ga0466957_0305047 | Ga0466957_0305047_34_789 | 243 |
| 29 | 3300025898 | Ga0207692_10137091 | Ga0207692_101370912 | 244 |
| 30 | 3300053111 | Ga0500572_000899 | Ga0500572_000899_1854_2657 | 244 |
| 31 | 3300053136 | Ga0500559_0000624 | Ga0500559_0000624_12368_13171 | 245 |
| 32 | 3300003322 | rootL2_10337834 | rootL2_103378342 | 246 |
| 33 | 3300028573 | Ga0265334_10000033 | Ga0265334_1000003396 | 246 |
| 34 | 3300037466 | Ga0395898_0000283 | Ga0395898_0000283_54988_55845 | 246 |
| 35 | 3300046454 | Ga0495592_0150394 | Ga0495592_0150394_860_1600 | 246 |
| 36 | 3300048927 | Ga0496124_0099710 | Ga0496124_0099710_42_782 | 246 |
| 37 | 3300037418 | Ga0395900_0000058 | Ga0395900_0000058_106572_107429 | 247 |
| 38 | 3300045051 | Ga0451576_0000246 | Ga0451576_0000246_117803_118564 | 247 |
| 39 | 3300045051 | Ga0451576_0103717 | Ga0451576_0103717_1228_2010 | 247 |
| 40 | 3300046476 | Ga0495662_0004987 | Ga0495662_0004987_1156_1926 | 247 |
| 41 | 3300046517 | Ga0495630_0000005 | Ga0495630_0000005_151385_152155 | 247 |
| 42 | 3300046526 | Ga0495666_0013815 | Ga0495666_0013815_92_862 | 247 |
| 43 | 3300046681 | Ga0495647_0024093 | Ga0495647_0024093_1200_1970 | 247 |
| 44 | 3300025926 | Ga0207659_10230218 | Ga0207659_102302181 | 248 |
| 45 | iso_pu_bacteria | 2846033681 | 2846036069 | 248 |
| 46 | iso_pu_bacteria | 2846037992 | 2846041103 | 248 |
| 47 | 3300005545 | Ga0070695_100017779 | Ga0070695_1000177792 | 249 |
| 48 | 3300037471 | Ga0395905_0070884 | Ga0395905_0070884_453_1295 | 249 |
| 49 | 3300037471 | Ga0395905_0183778 | Ga0395905_0183778_798_1589 | 249 |
| 50 | 3300044684 | Ga0466966_0031126 | Ga0466966_0031126_938_1717 | 249 |
| 51 | 3300045049 | Ga0466959_0062688 | Ga0466959_0062688_629_1408 | 249 |
| 52 | 3300046500 | Ga0495596_0177340 | Ga0495596_0177340_46_795 | 249 |
| 53 | 3300047472 | Ga0495686_0000233 | Ga0495686_0000233_69966_70745 | 249 |
| 54 | iso_pu_bacteria | 2582581280 | 2585154912 | 249 |
| 55 | iso_pu_bacteria | 2721755763 | 2723876544 | 249 |
| 56 | iso_pu_bacteria | 2849560528 | 2849563886 | 249 |
| 57 | iso_pu_bacteria | 2849573788 | 2849578749 | 249 |
| 58 | 3300002459 | JGI24751J29686_10003654 | JGI24751J29686_100036542 | 250 |
| 59 | 3300005331 | Ga0070670_100019902 | Ga0070670_1000199023 | 250 |
| 60 | 3300005335 | Ga0070666_10001588 | Ga0070666_100015883 | 250 |
| 61 | 3300005353 | Ga0070669_100000004 | Ga0070669_100000004266 | 250 |
| 62 | 3300005355 | Ga0070671_100000004 | Ga0070671_100000004122 | 250 |
| 63 | 3300005544 | Ga0070686_100094455 | Ga0070686_1000944552 | 250 |
| 64 | 3300005548 | Ga0070665_100023540 | Ga0070665_10002354010 | 250 |
| 65 | 3300005617 | Ga0068859_100003632 | Ga0068859_10000363217 | 250 |
| 66 | 3300005618 | Ga0068864_100004715 | Ga0068864_1000047152 | 250 |
| 67 | 3300005719 | Ga0068861_100025417 | Ga0068861_1000254172 | 250 |
| 68 | 3300005841 | Ga0068863_100037037 | Ga0068863_1000370377 | 250 |
| 69 | 3300005842 | Ga0068858_100002081 | Ga0068858_10000208121 | 250 |
| 70 | 3300005844 | Ga0068862_100002536 | Ga0068862_1000025362 | 250 |
| 71 | 3300006048 | Ga0075363_100000129 | Ga0075363_1000001292 | 250 |
| 72 | 3300006177 | Ga0075362_10000024 | Ga0075362_1000002420 | 250 |
| 73 | 3300006186 | Ga0075369_10000380 | Ga0075369_1000038012 | 250 |
| 74 | 3300006195 | Ga0075366_10000115 | Ga0075366_100001155 | 250 |
| 75 | 3300006195 | Ga0075366_10091455 | Ga0075366_100914553 | 250 |
| 76 | 3300006353 | Ga0075370_10000001 | Ga0075370_10000001242 | 250 |
| 77 | 3300006931 | Ga0097620_100003632 | Ga0097620_10000363217 | 250 |
| 78 | 3300009101 | Ga0105247_10006203 | Ga0105247_100062037 | 250 |
| 79 | 3300009177 | Ga0105248_10070883 | Ga0105248_100708832 | 250 |
| 80 | 3300012490 | Ga0157322_1002390 | Ga0157322_10023902 | 250 |
| 81 | 3300013306 | Ga0163162_10325829 | Ga0163162_103258292 | 250 |
| 82 | 3300014968 | Ga0157379_10152384 | Ga0157379_101523842 | 250 |
| 83 | 3300025254 | Ga0209148_1001511 | Ga0209148_10015115 | 250 |
| 84 | 3300025272 | Ga0209455_1000760 | Ga0209455_10007604 | 250 |
| 85 | 3300025315 | Ga0207697_10002018 | Ga0207697_1000201810 | 250 |
| 86 | 3300025900 | Ga0207710_10012334 | Ga0207710_100123346 | 250 |
| 87 | 3300025903 | Ga0207680_10001639 | Ga0207680_100016392 | 250 |
| 88 | 3300025923 | Ga0207681_10000010 | Ga0207681_10000010141 | 250 |
| 89 | 3300025925 | Ga0207650_10009672 | Ga0207650_100096728 | 250 |
| 90 | 3300025931 | Ga0207644_10000007 | Ga0207644_10000007127 | 250 |
| 91 | 3300025941 | Ga0207711_10157661 | Ga0207711_101576612 | 250 |
| 92 | 3300025961 | Ga0207712_10385909 | Ga0207712_103859092 | 250 |
| 93 | 3300025972 | Ga0207668_10003062 | Ga0207668_100030623 | 250 |
| 94 | 3300025986 | Ga0207658_10001394 | Ga0207658_100013944 | 250 |
| 95 | 3300026035 | Ga0207703_10003496 | Ga0207703_100034969 | 250 |
| 96 | 3300026088 | Ga0207641_10024523 | Ga0207641_100245233 | 250 |
| 97 | 3300026095 | Ga0207676_10000953 | Ga0207676_100009533 | 250 |
| 98 | 3300026118 | Ga0207675_100000329 | Ga0207675_10000032915 | 250 |
| 99 | 3300028379 | Ga0268266_10109492 | Ga0268266_101094922 | 250 |
| 100 | 3300028380 | Ga0268265_10000058 | Ga0268265_1000005844 | 250 |
| 101 | 3300028381 | Ga0268264_10000106 | Ga0268264_10000106164 | 250 |
| 102 | 3300034817 | Ga0373948_0019631 | Ga0373948_0019631_359_1135 | 250 |
| 103 | 3300035691 | Ga0373931_0045141 | Ga0373931_0045141_1289_2065 | 250 |
| 104 | 3300037853 | Ga0436364_1182640 | Ga0436364_1182640_317_1093 | 250 |
| 105 | 3300048905 | Ga0496102_0793079 | Ga0496102_0793079_59_841 | 250 |
| 106 | 3300048909 | Ga0496106_0004759 | Ga0496106_0004759_8630_9451 | 250 |
| 107 | 3300048912 | Ga0496109_0141124 | Ga0496109_0141124_959_1840 | 250 |
| 108 | 3300048917 | Ga0496114_0237392 | Ga0496114_0237392_708_1589 | 250 |
| 109 | 3300050489 | nmdc:mga03683_2_c1 | nmdc:mga03683_2_c1_47067_47843 | 250 |
| 110 | 3300050490 | nmdc:mga03n38_388_c1 | nmdc:mga03n38_388_c1_1554_2330 | 250 |
| 111 | 3300050493 | nmdc:mga0k408_64881_c1 | nmdc:mga0k408_64881_c1_1258_2034 | 250 |
| 112 | 3300050496 | nmdc:mga07m45_2_c1 | nmdc:mga07m45_2_c1_17519_18295 | 250 |
| 113 | 3300005354 | Ga0070675_100118645 | Ga0070675_1001186452 | 251 |
| 114 | 3300005439 | Ga0070711_100273159 | Ga0070711_1002731592 | 251 |
| 115 | 3300005456 | Ga0070678_100072220 | Ga0070678_1000722204 | 251 |
| 116 | 3300005458 | Ga0070681_10027823 | Ga0070681_100278233 | 251 |
| 117 | 3300005458 | Ga0070681_10440419 | Ga0070681_104404191 | 251 |
| 118 | 3300005530 | Ga0070679_100063148 | Ga0070679_1000631486 | 251 |
| 119 | 3300005530 | Ga0070679_100792895 | Ga0070679_1007928951 | 251 |
| 120 | 3300005563 | Ga0068855_100338109 | Ga0068855_1003381091 | 251 |
| 121 | 3300005564 | Ga0070664_100221985 | Ga0070664_1002219852 | 251 |
| 122 | 3300009101 | Ga0105247_10008016 | Ga0105247_100080163 | 251 |
| 123 | 3300013297 | Ga0157378_10887720 | Ga0157378_108877201 | 251 |
| 124 | 3300025900 | Ga0207710_10022648 | Ga0207710_100226483 | 251 |
| 125 | 3300025912 | Ga0207707_10061038 | Ga0207707_100610383 | 251 |
| 126 | 3300025912 | Ga0207707_10433340 | Ga0207707_104333401 | 251 |
| 127 | 3300025915 | Ga0207693_10021011 | Ga0207693_100210115 | 251 |
| 128 | 3300025916 | Ga0207663_10265978 | Ga0207663_102659783 | 251 |
| 129 | 3300025921 | Ga0207652_10034939 | Ga0207652_100349395 | 251 |
| 130 | 3300025949 | Ga0207667_10273513 | Ga0207667_102735133 | 251 |
| 131 | 3300028800 | Ga0265338_10003732 | Ga0265338_100037323 | 251 |
| 132 | 3300031241 | Ga0265325_10000290 | Ga0265325_1000029024 | 251 |
| 133 | 3300031241 | Ga0265325_10046724 | Ga0265325_100467243 | 251 |
| 134 | 3300031595 | Ga0265313_10033376 | Ga0265313_100333762 | 251 |
| 135 | 3300035113 | Ga0373936_0089331 | Ga0373936_0089331_216_1010 | 251 |
| 136 | 3300035172 | Ga0373955_0043872 | Ga0373955_0043872_304_1113 | 251 |
| 137 | 3300035410 | Ga0373924_0029313 | Ga0373924_0029313_227_1036 | 251 |
| 138 | 3300035724 | Ga0373933_0093813 | Ga0373933_0093813_42_851 | 251 |
| 139 | 3300036401 | Ga0373937_0038202 | Ga0373937_0038202_3140_3949 | 251 |
| 140 | 3300037466 | Ga0395898_0053488 | Ga0395898_0053488_1218_2015 | 251 |
| 141 | 3300039438 | Ga0436360_1339610 | Ga0436360_1339610_236_1021 | 251 |
| 142 | 3300039447 | Ga0436361_1134714 | Ga0436361_1134714_1843_2634 | 251 |
| 143 | 3300039447 | Ga0436361_1185506 | Ga0436361_1185506_372_1157 | 251 |
| 144 | 3300046454 | Ga0495592_0006004 | Ga0495592_0006004_2389_3198 | 251 |
| 145 | 3300046459 | Ga0495629_0081801 | Ga0495629_0081801_304_1089 | 251 |
| 146 | 3300046462 | Ga0495651_0043092 | Ga0495651_0043092_1637_2446 | 251 |
| 147 | 3300046472 | Ga0495580_0112366 | Ga0495580_0112366_929_1714 | 251 |
| 148 | 3300046516 | Ga0495628_0061401 | Ga0495628_0061401_1444_2253 | 251 |
| 149 | 3300046529 | Ga0495652_0122887 | Ga0495652_0122887_187_996 | 251 |
| 150 | 3300046536 | Ga0495587_0084174 | Ga0495587_0084174_504_1313 | 251 |
| 151 | 3300046675 | Ga0495657_0228912 | Ga0495657_0228912_230_1039 | 251 |
| 152 | 3300046679 | Ga0495623_0057306 | Ga0495623_0057306_485_1294 | 251 |
| 153 | 3300046681 | Ga0495647_0051090 | Ga0495647_0051090_249_1034 | 251 |
| 154 | 3300046809 | Ga0495600_0008525 | Ga0495600_0008525_5214_6023 | 251 |
| 155 | 3300047319 | Ga0495674_0024016 | Ga0495674_0024016_1561_2346 | 251 |
| 156 | 3300047322 | Ga0495680_0023379 | Ga0495680_0023379_4067_4876 | 251 |
| 157 | 3300048907 | Ga0496104_0000055 | Ga0496104_0000055_111494_112303 | 251 |
| 158 | 3300048922 | Ga0496119_0193487 | Ga0496119_0193487_194_1018 | 251 |
| 159 | 3300049569 | Ga0501032_0001988 | Ga0501032_0001988_3520_4308 | 251 |
| 160 | 3300049571 | Ga0501034_0077093 | Ga0501034_0077093_439_1221 | 251 |
| 161 | 3300049572 | Ga0501036_0040681 | Ga0501036_0040681_2368_3156 | 251 |
| 162 | 3300049572 | Ga0501036_0282131 | Ga0501036_0282131_119_907 | 251 |
| 163 | 3300049574 | Ga0501038_0011461 | Ga0501038_0011461_3400_4188 | 251 |
| 164 | 3300049579 | Ga0501043_0001461 | Ga0501043_0001461_8755_9543 | 251 |
| 165 | 3300049579 | Ga0501043_0044039 | Ga0501043_0044039_2706_3494 | 251 |
| 166 | 3300049583 | Ga0501067_0000017 | Ga0501067_0000017_69037_69825 | 251 |
| 167 | 3300049589 | Ga0501073_0000021 | Ga0501073_0000021_7028_7816 | 251 |
| 168 | 3300049589 | Ga0501073_0007819 | Ga0501073_0007819_5976_6764 | 251 |
| 169 | 3300049593 | Ga0501077_0002351 | Ga0501077_0002351_3365_4153 | 251 |
| 170 | 3300049742 | Ga0501080_0004783 | Ga0501080_0004783_2583_3371 | 251 |
| 171 | 3300049742 | Ga0501080_0012022 | Ga0501080_0012022_4332_5120 | 251 |
| 172 | 3300049744 | Ga0501083_0064868 | Ga0501083_0064868_1408_2196 | 251 |
| 173 | 3300049823 | Ga0501044_0024149 | Ga0501044_0024149_1998_2786 | 251 |
| 174 | 3300049823 | Ga0501044_0037129 | Ga0501044_0037129_1338_2126 | 251 |
| 175 | 3300050493 | nmdc:mga0k408_25420_c1 | nmdc:mga0k408_25420_c1_348_1163 | 251 |
| 176 | 3300050516 | nmdc:mga0sz30_28568_c1 | nmdc:mga0sz30_28568_c1_1404_2219 | 251 |
| 177 | 3300053077 | Ga0495601_0000087 | Ga0495601_0000087_11359_12168 | 251 |
| 178 | 3300053078 | Ga0495612_0001669 | Ga0495612_0001669_5999_6808 | 251 |
| 179 | 3300053084 | Ga0495595_0000375 | Ga0495595_0000375_10066_10875 | 251 |
| 180 | 3300053085 | Ga0495619_0000951 | Ga0495619_0000951_13430_14239 | 251 |
| 181 | 3300053085 | Ga0495619_0056365 | Ga0495619_0056365_1095_1904 | 251 |
| 182 | 3300053096 | Ga0500641_0008524 | Ga0500641_0008524_1798_2610 | 251 |
| 183 | 3300053119 | Ga0500595_030197 | Ga0500595_030197_872_1660 | 251 |
| 184 | 3300053177 | Ga0500636_0000334 | Ga0500636_0000334_18546_19328 | 251 |
| 185 | 3300060353 | Ga0501082_0050481 | Ga0501082_0050481_349_1137 | 251 |
| 186 | 3300005435 | Ga0070714_100002166 | Ga0070714_1000021669 | 252 |
| 187 | 3300005467 | Ga0070706_100553234 | Ga0070706_1005532342 | 252 |
| 188 | 3300006051 | Ga0075364_10004589 | Ga0075364_100045893 | 252 |
| 189 | 3300006177 | Ga0075362_10020589 | Ga0075362_100205894 | 252 |
| 190 | 3300021441 | Ga0213871_10015669 | Ga0213871_100156692 | 252 |
| 191 | 3300025929 | Ga0207664_10074075 | Ga0207664_100740752 | 252 |
| 192 | 3300031249 | Ga0265339_10004298 | Ga0265339_100042983 | 252 |
| 193 | 3300039438 | Ga0436360_0564642 | Ga0436360_0564642_7104_7910 | 252 |
| 194 | 3300039453 | Ga0436362_0922352 | Ga0436362_0922352_100_906 | 252 |
| 195 | 3300042004 | Ga0439445_0005202 | Ga0439445_0005202_1754_2560 | 252 |
| 196 | 3300044712 | Ga0453684_0595088 | Ga0453684_0595088_155_961 | 252 |
| 197 | 3300045049 | Ga0466959_0118491 | Ga0466959_0118491_28_816 | 252 |
| 198 | 3300046453 | Ga0495627_002847 | Ga0495627_002847_1614_2405 | 252 |
| 199 | 3300046453 | Ga0495627_071272 | Ga0495627_071272_27_818 | 252 |
| 200 | 3300046501 | Ga0495607_0058749 | Ga0495607_0058749_330_1121 | 252 |
| 201 | 3300046512 | Ga0495610_0000127 | Ga0495610_0000127_4675_5466 | 252 |
| 202 | 3300046513 | Ga0495616_0042489 | Ga0495616_0042489_927_1718 | 252 |
| 203 | 3300046520 | Ga0495637_0007583 | Ga0495637_0007583_4188_4979 | 252 |
| 204 | 3300046522 | Ga0495643_0169892 | Ga0495643_0169892_105_896 | 252 |
| 205 | 3300046524 | Ga0495648_0017826 | Ga0495648_0017826_630_1421 | 252 |
| 206 | 3300046530 | Ga0495654_0040990 | Ga0495654_0040990_1161_1952 | 252 |
| 207 | 3300046557 | Ga0495622_0070803 | Ga0495622_0070803_586_1377 | 252 |
| 208 | 3300046558 | Ga0495633_0000486 | Ga0495633_0000486_9950_10741 | 252 |
| 209 | 3300046648 | Ga0495611_0041064 | Ga0495611_0041064_129_920 | 252 |
| 210 | 3300046648 | Ga0495611_0142766 | Ga0495611_0142766_149_940 | 252 |
| 211 | 3300046691 | Ga0495670_0000160 | Ga0495670_0000160_561_1352 | 252 |
| 212 | 3300046692 | Ga0495671_0002938 | Ga0495671_0002938_8123_8914 | 252 |
| 213 | 3300046692 | Ga0495671_0005670 | Ga0495671_0005670_776_1567 | 252 |
| 214 | 3300047470 | Ga0495681_0000155 | Ga0495681_0000155_43929_44720 | 252 |
| 215 | 3300047472 | Ga0495686_0000518 | Ga0495686_0000518_27824_28615 | 252 |
| 216 | 3300049679 | Ga0501249_000121 | Ga0501249_000121_4258_5049 | 252 |
| 217 | 3300050489 | nmdc:mga03683_16824_c1 | nmdc:mga03683_16824_c1_1911_2702 | 252 |
| 218 | 3300050516 | nmdc:mga0sz30_43518_c1 | nmdc:mga0sz30_43518_c1_744_1535 | 252 |
| 219 | 3300053080 | Ga0500635_0000511 | Ga0500635_0000511_6658_7494 | 252 |
| 220 | 3300053087 | Ga0500643_000211 | Ga0500643_000211_8112_8903 | 252 |
| 221 | 3300053087 | Ga0500643_001276 | Ga0500643_001276_9238_10029 | 252 |
| 222 | 3300053087 | Ga0500643_022003 | Ga0500643_022003_547_1338 | 252 |
| 223 | 3300053088 | Ga0500644_0000524 | Ga0500644_0000524_12902_13693 | 252 |
| 224 | 3300053089 | Ga0500581_041001 | Ga0500581_041001_1562_2353 | 252 |
| 225 | 3300053096 | Ga0500641_0037746 | Ga0500641_0037746_237_1028 | 252 |
| 226 | 3300053104 | Ga0500556_0000005 | Ga0500556_0000005_233701_234492 | 252 |
| 227 | 3300053108 | Ga0500562_000144 | Ga0500562_000144_16850_17641 | 252 |
| 228 | 3300053118 | Ga0500594_0000525 | Ga0500594_0000525_2195_2986 | 252 |
| 229 | 3300053121 | Ga0500607_000011 | Ga0500607_000011_11491_12282 | 252 |
| 230 | 3300053122 | Ga0500608_023846 | Ga0500608_023846_1791_2630 | 252 |
| 231 | 3300053130 | Ga0500642_0000006 | Ga0500642_0000006_160972_161763 | 252 |
| 232 | 3300053134 | Ga0500658_0001897 | Ga0500658_0001897_952_1743 | 252 |
| 233 | 3300053136 | Ga0500559_0000067 | Ga0500559_0000067_33584_34375 | 252 |
| 234 | 3300053136 | Ga0500559_0002389 | Ga0500559_0002389_4152_4943 | 252 |
| 235 | 3300053136 | Ga0500559_0103399 | Ga0500559_0103399_117_965 | 252 |
| 236 | 3300053136 | Ga0500559_0173205 | Ga0500559_0173205_104_901 | 252 |
| 237 | 3300053151 | Ga0500604_0005013 | Ga0500604_0005013_288_1079 | 252 |
| 238 | 3300053156 | Ga0500622_0000060 | Ga0500622_0000060_88734_89525 | 252 |
| 239 | 3300053157 | Ga0500624_000027 | Ga0500624_000027_57253_58044 | 252 |
| 240 | 3300053160 | Ga0500633_0022831 | Ga0500633_0022831_138_929 | 252 |
| 241 | 3300053177 | Ga0500636_0000098 | Ga0500636_0000098_9324_10115 | 252 |
| 242 | 3300053177 | Ga0500636_0000129 | Ga0500636_0000129_15592_16383 | 252 |
| 243 | 3300053177 | Ga0500636_0058824 | Ga0500636_0058824_1421_2215 | 252 |
| 244 | 3300055283 | Ga0500661_002807 | Ga0500661_002807_245_1036 | 252 |
| 245 | 3300005331 | Ga0070670_100558992 | Ga0070670_1005589922 | 253 |
| 246 | 3300005434 | Ga0070709_10094073 | Ga0070709_100940732 | 253 |
| 247 | 3300005435 | Ga0070714_100267561 | Ga0070714_1002675613 | 253 |
| 248 | 3300005439 | Ga0070711_100140983 | Ga0070711_1001409832 | 253 |
| 249 | 3300005458 | Ga0070681_10062338 | Ga0070681_100623384 | 253 |
| 250 | 3300005458 | Ga0070681_10121087 | Ga0070681_101210872 | 253 |
| 251 | 3300005530 | Ga0070679_100078433 | Ga0070679_1000784332 | 253 |
| 252 | 3300005530 | Ga0070679_100162930 | Ga0070679_1001629302 | 253 |
| 253 | 3300005535 | Ga0070684_100022062 | Ga0070684_1000220622 | 253 |
| 254 | 3300005578 | Ga0068854_100132023 | Ga0068854_1001320232 | 253 |
| 255 | 3300005614 | Ga0068856_100133357 | Ga0068856_1001333573 | 253 |
| 256 | 3300005843 | Ga0068860_100001690 | Ga0068860_10000169014 | 253 |
| 257 | 3300006038 | Ga0075365_10102819 | Ga0075365_101028192 | 253 |
| 258 | 3300006048 | Ga0075363_100015629 | Ga0075363_1000156294 | 253 |
| 259 | 3300006051 | Ga0075364_10071428 | Ga0075364_100714283 | 253 |
| 260 | 3300006051 | Ga0075364_10083829 | Ga0075364_100838293 | 253 |
| 261 | 3300006175 | Ga0070712_100173343 | Ga0070712_1001733432 | 253 |
| 262 | 3300006177 | Ga0075362_10027731 | Ga0075362_100277312 | 253 |
| 263 | 3300006178 | Ga0075367_10000197 | Ga0075367_100001978 | 253 |
| 264 | 3300006178 | Ga0075367_10070406 | Ga0075367_100704062 | 253 |
| 265 | 3300006186 | Ga0075369_10042650 | Ga0075369_100426503 | 253 |
| 266 | 3300006186 | Ga0075369_10054877 | Ga0075369_100548773 | 253 |
| 267 | 3300006195 | Ga0075366_10269720 | Ga0075366_102697202 | 253 |
| 268 | 3300006353 | Ga0075370_10036581 | Ga0075370_100365813 | 253 |
| 269 | 3300006353 | Ga0075370_10111603 | Ga0075370_101116032 | 253 |
| 270 | 3300006353 | Ga0075370_10228638 | Ga0075370_102286382 | 253 |
| 271 | 3300009174 | Ga0105241_10030298 | Ga0105241_100302983 | 253 |
| 272 | 3300009551 | Ga0105238_10045913 | Ga0105238_100459133 | 253 |
| 273 | 3300013100 | Ga0157373_10014587 | Ga0157373_100145872 | 253 |
| 274 | 3300013105 | Ga0157369_10256173 | Ga0157369_102561732 | 253 |
| 275 | 3300013307 | Ga0157372_10067793 | Ga0157372_100677934 | 253 |
| 276 | 3300025909 | Ga0207705_10058067 | Ga0207705_100580672 | 253 |
| 277 | 3300025912 | Ga0207707_10042279 | Ga0207707_100422793 | 253 |
| 278 | 3300025913 | Ga0207695_10383498 | Ga0207695_103834981 | 253 |
| 279 | 3300025916 | Ga0207663_10109936 | Ga0207663_101099362 | 253 |
| 280 | 3300025919 | Ga0207657_10058090 | Ga0207657_100580903 | 253 |
| 281 | 3300025929 | Ga0207664_10316985 | Ga0207664_103169852 | 253 |
| 282 | 3300025949 | Ga0207667_10038744 | Ga0207667_100387445 | 253 |
| 283 | 3300025949 | Ga0207667_10154251 | Ga0207667_101542512 | 253 |
| 284 | 3300025981 | Ga0207640_10086724 | Ga0207640_100867243 | 253 |
| 285 | 3300026035 | Ga0207703_10339664 | Ga0207703_103396641 | 253 |
| 286 | 3300026041 | Ga0207639_10429963 | Ga0207639_104299632 | 253 |
| 287 | 3300026116 | Ga0207674_10622728 | Ga0207674_106227282 | 253 |
| 288 | 3300027907 | Ga0207428_10091617 | Ga0207428_100916172 | 253 |
| 289 | 3300028381 | Ga0268264_10000048 | Ga0268264_10000048187 | 253 |
| 290 | 3300028573 | Ga0265334_10005691 | Ga0265334_100056917 | 253 |
| 291 | 3300031235 | Ga0265330_10006525 | Ga0265330_100065256 | 253 |
| 292 | 3300031235 | Ga0265330_10028702 | Ga0265330_100287022 | 253 |
| 293 | 3300031235 | Ga0265330_10037338 | Ga0265330_100373383 | 253 |
| 294 | 3300031238 | Ga0265332_10049842 | Ga0265332_100498422 | 253 |
| 295 | 3300031241 | Ga0265325_10026252 | Ga0265325_100262524 | 253 |
| 296 | 3300031247 | Ga0265340_10006819 | Ga0265340_100068196 | 253 |
| 297 | 3300031249 | Ga0265339_10065229 | Ga0265339_100652292 | 253 |
| 298 | 3300031249 | Ga0265339_10097479 | Ga0265339_100974792 | 253 |
| 299 | 3300031250 | Ga0265331_10012529 | Ga0265331_100125292 | 253 |
| 300 | 3300031250 | Ga0265331_10062262 | Ga0265331_100622622 | 253 |
| 301 | 3300031250 | Ga0265331_10070234 | Ga0265331_100702342 | 253 |
| 302 | 3300031250 | Ga0265331_10143931 | Ga0265331_101439311 | 253 |
| 303 | 3300031344 | Ga0265316_10043368 | Ga0265316_100433682 | 253 |
| 304 | 3300031507 | Ga0307509_10022838 | Ga0307509_100228381 | 253 |
| 305 | 3300031507 | Ga0307509_10161044 | Ga0307509_101610441 | 253 |
| 306 | 3300031616 | Ga0307508_10000249 | Ga0307508_1000024952 | 253 |
| 307 | 3300031616 | Ga0307508_10296125 | Ga0307508_102961251 | 253 |
| 308 | 3300031711 | Ga0265314_10001283 | Ga0265314_1000128323 | 253 |
| 309 | 3300031711 | Ga0265314_10035129 | Ga0265314_100351292 | 253 |
| 310 | 3300032133 | Ga0316583_10000941 | Ga0316583_1000094113 | 253 |
| 311 | 3300035086 | Ga0373934_0002476 | Ga0373934_0002476_3377_4231 | 253 |
| 312 | 3300035111 | Ga0373923_0000171 | Ga0373923_0000171_5176_6030 | 253 |
| 313 | 3300035117 | Ga0373953_0010573 | Ga0373953_0010573_635_1489 | 253 |
| 314 | 3300035118 | Ga0373954_0000518 | Ga0373954_0000518_3074_3928 | 253 |
| 315 | 3300035120 | Ga0373957_0000722 | Ga0373957_0000722_2723_3577 | 253 |
| 316 | 3300035120 | Ga0373957_0028764 | Ga0373957_0028764_635_1474 | 253 |
| 317 | 3300035172 | Ga0373955_0003463 | Ga0373955_0003463_257_1096 | 253 |
| 318 | 3300035398 | Ga0316574_0158678 | Ga0316574_0158678_225_1103 | 253 |
| 319 | 3300035410 | Ga0373924_0002025 | Ga0373924_0002025_4850_5704 | 253 |
| 320 | 3300035695 | Ga0373927_0000002 | Ga0373927_0000002_618077_618853 | 253 |
| 321 | 3300035695 | Ga0373927_0014461 | Ga0373927_0014461_2144_2938 | 253 |
| 322 | 3300035724 | Ga0373933_0000274 | Ga0373933_0000274_24557_25411 | 253 |
| 323 | 3300035724 | Ga0373933_0003540 | Ga0373933_0003540_6149_6988 | 253 |
| 324 | 3300035724 | Ga0373933_0277349 | Ga0373933_0277349_152_1000 | 253 |
| 325 | 3300035725 | Ga0373947_0128176 | Ga0373947_0128176_430_1257 | 253 |
| 326 | 3300036401 | Ga0373937_0005546 | Ga0373937_0005546_7173_8012 | 253 |
| 327 | 3300037068 | Ga0373925_0081160 | Ga0373925_0081160_57_890 | 253 |
| 328 | 3300039437 | Ga0436365_0174471 | Ga0436365_0174471_148_954 | 253 |
| 329 | 3300046457 | Ga0495590_0001575 | Ga0495590_0001575_1764_2558 | 253 |
| 330 | 3300046459 | Ga0495629_0001021 | Ga0495629_0001021_6792_7646 | 253 |
| 331 | 3300046460 | Ga0495638_0000517 | Ga0495638_0000517_36398_37192 | 253 |
| 332 | 3300046460 | Ga0495638_0001208 | Ga0495638_0001208_22066_22860 | 253 |
| 333 | 3300046460 | Ga0495638_0014896 | Ga0495638_0014896_409_1203 | 253 |
| 334 | 3300046462 | Ga0495651_0002383 | Ga0495651_0002383_10323_11177 | 253 |
| 335 | 3300046463 | Ga0495653_0003619 | Ga0495653_0003619_11203_12057 | 253 |
| 336 | 3300046471 | Ga0495650_0000007 | Ga0495650_0000007_671397_672191 | 253 |
| 337 | 3300046506 | Ga0495583_0000209 | Ga0495583_0000209_58259_59053 | 253 |
| 338 | 3300046511 | Ga0495608_0000721 | Ga0495608_0000721_3074_3928 | 253 |
| 339 | 3300046511 | Ga0495608_0136355 | Ga0495608_0136355_369_1208 | 253 |
| 340 | 3300046512 | Ga0495610_0000195 | Ga0495610_0000195_19420_20214 | 253 |
| 341 | 3300046513 | Ga0495616_0001431 | Ga0495616_0001431_12895_13689 | 253 |
| 342 | 3300046514 | Ga0495618_0097707 | Ga0495618_0097707_742_1596 | 253 |
| 343 | 3300046518 | Ga0495631_0002603 | Ga0495631_0002603_2125_2919 | 253 |
| 344 | 3300046520 | Ga0495637_0004227 | Ga0495637_0004227_642_1436 | 253 |
| 345 | 3300046520 | Ga0495637_0012422 | Ga0495637_0012422_523_1317 | 253 |
| 346 | 3300046522 | Ga0495643_0006927 | Ga0495643_0006927_1884_2678 | 253 |
| 347 | 3300046524 | Ga0495648_0002225 | Ga0495648_0002225_12028_12822 | 253 |
| 348 | 3300046524 | Ga0495648_0012803 | Ga0495648_0012803_4118_4912 | 253 |
| 349 | 3300046525 | Ga0495663_0008082 | Ga0495663_0008082_1524_2318 | 253 |
| 350 | 3300046529 | Ga0495652_0194512 | Ga0495652_0194512_538_1377 | 253 |
| 351 | 3300046530 | Ga0495654_0000262 | Ga0495654_0000262_17019_17813 | 253 |
| 352 | 3300046533 | Ga0495640_0005747 | Ga0495640_0005747_2521_3375 | 253 |
| 353 | 3300046536 | Ga0495587_0042110 | Ga0495587_0042110_561_1400 | 253 |
| 354 | 3300046542 | Ga0495597_0011826 | Ga0495597_0011826_955_1749 | 253 |
| 355 | 3300046543 | Ga0495645_0034844 | Ga0495645_0034844_2709_3563 | 253 |
| 356 | 3300046557 | Ga0495622_0066630 | Ga0495622_0066630_790_1620 | 253 |
| 357 | 3300046559 | Ga0495667_0000319 | Ga0495667_0000319_21308_22162 | 253 |
| 358 | 3300046559 | Ga0495667_0063791 | Ga0495667_0063791_1008_1847 | 253 |
| 359 | 3300046616 | Ga0495668_0002183 | Ga0495668_0002183_12694_13488 | 253 |
| 360 | 3300046616 | Ga0495668_0081593 | Ga0495668_0081593_529_1323 | 253 |
| 361 | 3300046642 | Ga0495634_0002073 | Ga0495634_0002073_4821_5675 | 253 |
| 362 | 3300046660 | Ga0495625_0041628 | Ga0495625_0041628_1783_2577 | 253 |
| 363 | 3300046660 | Ga0495625_0068433 | Ga0495625_0068433_1254_2048 | 253 |
| 364 | 3300046663 | Ga0495635_0000180 | Ga0495635_0000180_9068_9922 | 253 |
| 365 | 3300046675 | Ga0495657_0006534 | Ga0495657_0006534_4854_5708 | 253 |
| 366 | 3300046675 | Ga0495657_0052534 | Ga0495657_0052534_1323_2162 | 253 |
| 367 | 3300046678 | Ga0495599_0000885 | Ga0495599_0000885_5354_6208 | 253 |
| 368 | 3300046679 | Ga0495623_0054728 | Ga0495623_0054728_1187_2026 | 253 |
| 369 | 3300046680 | Ga0495646_0012263 | Ga0495646_0012263_3108_3962 | 253 |
| 370 | 3300046683 | Ga0495658_0287112 | Ga0495658_0287112_87_917 | 253 |
| 371 | 3300046689 | Ga0495613_0026003 | Ga0495613_0026003_508_1362 | 253 |
| 372 | 3300046692 | Ga0495671_0016873 | Ga0495671_0016873_1685_2479 | 253 |
| 373 | 3300046692 | Ga0495671_0074841 | Ga0495671_0074841_413_1207 | 253 |
| 374 | 3300046794 | Ga0495589_0000838 | Ga0495589_0000838_5686_6480 | 253 |
| 375 | 3300046809 | Ga0495600_0085655 | Ga0495600_0085655_238_1077 | 253 |
| 376 | 3300046810 | Ga0495660_0100688 | Ga0495660_0100688_18_812 | 253 |
| 377 | 3300047319 | Ga0495674_0020526 | Ga0495674_0020526_3756_4610 | 253 |
| 378 | 3300047320 | Ga0495672_0001435 | Ga0495672_0001435_20778_21572 | 253 |
| 379 | 3300047322 | Ga0495680_0015798 | Ga0495680_0015798_2433_3287 | 253 |
| 380 | 3300047444 | Ga0495675_0002275 | Ga0495675_0002275_5092_5946 | 253 |
| 381 | 3300047446 | Ga0495679_007135 | Ga0495679_007135_2822_3616 | 253 |
| 382 | 3300047469 | Ga0495673_0000743 | Ga0495673_0000743_19750_20544 | 253 |
| 383 | 3300047469 | Ga0495673_0001213 | Ga0495673_0001213_14435_15229 | 253 |
| 384 | 3300047469 | Ga0495673_0001789 | Ga0495673_0001789_3401_4195 | 253 |
| 385 | 3300047471 | Ga0495684_0000023 | Ga0495684_0000023_106869_107723 | 253 |
| 386 | 3300047472 | Ga0495686_0006648 | Ga0495686_0006648_4025_4819 | 253 |
| 387 | 3300047673 | Ga0495593_0000221 | Ga0495593_0000221_10308_11162 | 253 |
| 388 | 3300048088 | Ga0495602_0013760 | Ga0495602_0013760_4964_5818 | 253 |
| 389 | 3300048088 | Ga0495602_0107756 | Ga0495602_0107756_1270_2109 | 253 |
| 390 | 3300048919 | Ga0496116_0070588 | Ga0496116_0070588_142_972 | 253 |
| 391 | 3300048919 | Ga0496116_0087016 | Ga0496116_0087016_243_1004 | 253 |
| 392 | 3300048920 | Ga0496117_0011530 | Ga0496117_0011530_6486_7316 | 253 |
| 393 | 3300048921 | Ga0496118_0002114 | Ga0496118_0002114_20271_21101 | 253 |
| 394 | 3300048924 | Ga0496121_0000757 | Ga0496121_0000757_46585_47415 | 253 |
| 395 | 3300048927 | Ga0496124_0003589 | Ga0496124_0003589_14893_15723 | 253 |
| 396 | 3300048929 | Ga0496126_0020776 | Ga0496126_0020776_4497_5327 | 253 |
| 397 | 3300049459 | Ga0495678_000801 | Ga0495678_000801_19904_20698 | 253 |
| 398 | 3300050490 | nmdc:mga03n38_40367_c1 | nmdc:mga03n38_40367_c1_22_834 | 253 |
| 399 | 3300050491 | nmdc:mga00v17_168803_c1 | nmdc:mga00v17_168803_c1_14_826 | 253 |
| 400 | 3300050491 | nmdc:mga00v17_52090_c1 | nmdc:mga00v17_52090_c1_1379_2320 | 253 |
| 401 | 3300050491 | nmdc:mga00v17_72568_c1 | nmdc:mga00v17_72568_c1_717_1517 | 253 |
| 402 | 3300050492 | nmdc:mga0yw44_47820_c1 | nmdc:mga0yw44_47820_c1_1594_2535 | 253 |
| 403 | 3300050494 | nmdc:mga06z11_50299_c1 | nmdc:mga06z11_50299_c1_620_1420 | 253 |
| 404 | 3300050494 | nmdc:mga06z11_6779_c1 | nmdc:mga06z11_6779_c1_1361_2173 | 253 |
| 405 | 3300050496 | nmdc:mga07m45_178570_c1 | nmdc:mga07m45_178570_c1_153_953 | 253 |
| 406 | 3300050496 | nmdc:mga07m45_208857_c1 | nmdc:mga07m45_208857_c1_280_1080 | 253 |
| 407 | 3300050496 | nmdc:mga07m45_37057_c1 | nmdc:mga07m45_37057_c1_186_998 | 253 |
| 408 | 3300050496 | nmdc:mga07m45_52383_c1 | nmdc:mga07m45_52383_c1_781_1593 | 253 |
| 409 | 3300050511 | nmdc:mga08y16_36637_c1 | nmdc:mga08y16_36637_c1_1501_2334 | 253 |
| 410 | 3300050514 | nmdc:mga08x19_44375_c1 | nmdc:mga08x19_44375_c1_1309_2139 | 253 |
| 411 | 3300053077 | Ga0495601_0037088 | Ga0495601_0037088_1939_2793 | 253 |
| 412 | 3300053077 | Ga0495601_0083025 | Ga0495601_0083025_178_1017 | 253 |
| 413 | 3300053077 | Ga0495601_0160555 | Ga0495601_0160555_555_1385 | 253 |
| 414 | 3300053078 | Ga0495612_0040056 | Ga0495612_0040056_564_1418 | 253 |
| 415 | 3300053084 | Ga0495595_0000218 | Ga0495595_0000218_18791_19645 | 253 |
| 416 | 3300053085 | Ga0495619_0000111 | Ga0495619_0000111_5064_5918 | 253 |
| 417 | 3300053085 | Ga0495619_0063582 | Ga0495619_0063582_682_1521 | 253 |
| 418 | 3300053085 | Ga0495619_0421866 | Ga0495619_0421866_59_904 | 253 |
| 419 | 3300053088 | Ga0500644_0000551 | Ga0500644_0000551_11568_12362 | 253 |
| 420 | 3300053088 | Ga0500644_0001360 | Ga0500644_0001360_4561_5355 | 253 |
| 421 | 3300053091 | Ga0500647_0014896 | Ga0500647_0014896_1590_2399 | 253 |
| 422 | 3300053097 | Ga0500648_081059 | Ga0500648_081059_803_1633 | 253 |
| 423 | 3300053103 | Ga0500555_012652 | Ga0500555_012652_1123_1917 | 253 |
| 424 | 3300053108 | Ga0500562_005970 | Ga0500562_005970_123_917 | 253 |
| 425 | 3300053119 | Ga0500595_020332 | Ga0500595_020332_31_861 | 253 |
| 426 | 3300053125 | Ga0500618_000145 | Ga0500618_000145_56605_57399 | 253 |
| 427 | 3300053125 | Ga0500618_004368 | Ga0500618_004368_1315_2124 | 253 |
| 428 | 3300053130 | Ga0500642_0000621 | Ga0500642_0000621_4075_4869 | 253 |
| 429 | 3300053133 | Ga0500655_000072 | Ga0500655_000072_20582_21376 | 253 |
| 430 | 3300053133 | Ga0500655_005301 | Ga0500655_005301_240_1034 | 253 |
| 431 | 3300053136 | Ga0500559_0000007 | Ga0500559_0000007_121954_122748 | 253 |
| 432 | 3300053136 | Ga0500559_0002226 | Ga0500559_0002226_8339_9133 | 253 |
| 433 | 3300053136 | Ga0500559_0007361 | Ga0500559_0007361_3544_4374 | 253 |
| 434 | 3300053138 | Ga0500564_000882 | Ga0500564_000882_6835_7629 | 253 |
| 435 | 3300053140 | Ga0500573_0095935 | Ga0500573_0095935_130_960 | 253 |
| 436 | 3300053142 | Ga0500577_0001180 | Ga0500577_0001180_2926_3720 | 253 |
| 437 | 3300053148 | Ga0500590_000281 | Ga0500590_000281_1586_2380 | 253 |
| 438 | 3300053153 | Ga0500616_0053160 | Ga0500616_0053160_54_848 | 253 |
| 439 | 3300053156 | Ga0500622_0000172 | Ga0500622_0000172_51805_52599 | 253 |
| 440 | 3300053158 | Ga0500627_0000127 | Ga0500627_0000127_15592_16386 | 253 |
| 441 | 3300053163 | Ga0500639_026870 | Ga0500639_026870_40_843 | 253 |
| 442 | 3300053724 | Ga0500570_000563 | Ga0500570_000563_3934_4728 | 253 |
| 443 | 3300053730 | Ga0500645_005267 | Ga0500645_005267_895_1689 | 253 |
| 444 | 3300053730 | Ga0500645_016825 | Ga0500645_016825_1231_2025 | 253 |
| 445 | 3300053735 | Ga0500596_000465 | Ga0500596_000465_6109_6939 | 253 |
| 446 | 3300003752 | Ga0055539_1002880 | Ga0055539_10028802 | 254 |
| 447 | 3300005436 | Ga0070713_100060518 | Ga0070713_1000605182 | 254 |
| 448 | 3300005617 | Ga0068859_100468779 | Ga0068859_1004687792 | 254 |
| 449 | 3300006931 | Ga0097620_100468845 | Ga0097620_1004688451 | 254 |
| 450 | 3300009551 | Ga0105238_10184432 | Ga0105238_101844322 | 254 |
| 451 | 3300010375 | Ga0105239_10021398 | Ga0105239_100213987 | 254 |
| 452 | 3300014326 | Ga0157380_10723724 | Ga0157380_107237241 | 254 |
| 453 | 3300021384 | Ga0213876_10131643 | Ga0213876_101316431 | 254 |
| 454 | 3300025253 | Ga0209677_100644 | Ga0209677_1006445 | 254 |
| 455 | 3300025261 | Ga0209233_1000791 | Ga0209233_10007914 | 254 |
| 456 | 3300025272 | Ga0209455_1003360 | Ga0209455_10033603 | 254 |
| 457 | 3300025272 | Ga0209455_1005077 | Ga0209455_10050772 | 254 |
| 458 | 3300025924 | Ga0207694_10077803 | Ga0207694_100778032 | 254 |
| 459 | 3300025928 | Ga0207700_10481503 | Ga0207700_104815031 | 254 |
| 460 | 3300025928 | Ga0207700_10692257 | Ga0207700_106922571 | 254 |
| 461 | 3300028577 | Ga0265318_10047837 | Ga0265318_100478372 | 254 |
| 462 | 3300028653 | Ga0265323_10025771 | Ga0265323_100257712 | 254 |
| 463 | 3300028666 | Ga0265336_10003085 | Ga0265336_100030852 | 254 |
| 464 | 3300028794 | Ga0307515_10000103 | Ga0307515_1000010375 | 254 |
| 465 | 3300028800 | Ga0265338_10000328 | Ga0265338_1000032871 | 254 |
| 466 | 3300029957 | Ga0265324_10011635 | Ga0265324_100116353 | 254 |
| 467 | 3300035724 | Ga0373933_0125499 | Ga0373933_0125499_710_1492 | 254 |
| 468 | 3300039437 | Ga0436365_0371724 | Ga0436365_0371724_3003_3812 | 254 |
| 469 | 3300045976 | Ga0466967_0408380 | Ga0466967_0408380_497_1306 | 254 |
| 470 | 3300046517 | Ga0495630_0120180 | Ga0495630_0120180_71_850 | 254 |
| 471 | 3300048921 | Ga0496118_0104571 | Ga0496118_0104571_869_1681 | 254 |
| 472 | 3300048921 | Ga0496118_0159568 | Ga0496118_0159568_352_1170 | 254 |
| 473 | 3300048924 | Ga0496121_0049639 | Ga0496121_0049639_1997_2809 | 254 |
| 474 | 3300048924 | Ga0496121_0130767 | Ga0496121_0130767_30_842 | 254 |
| 475 | 3300048929 | Ga0496126_0064964 | Ga0496126_0064964_1578_2396 | 254 |
| 476 | 3300053094 | Ga0500566_0002826 | Ga0500566_0002826_4379_5197 | 254 |
| 477 | 3300053136 | Ga0500559_0198050 | Ga0500559_0198050_113_931 | 254 |
| 478 | 3300053178 | Ga0500637_0000020 | Ga0500637_0000020_32452_33270 | 254 |
| 479 | 3300055283 | Ga0500661_000478 | Ga0500661_000478_6089_6907 | 254 |
| 480 | 3300005459 | Ga0068867_100108471 | Ga0068867_1001084712 | 255 |
| 481 | 3300005843 | Ga0068860_100080142 | Ga0068860_1000801422 | 255 |
| 482 | 3300006048 | Ga0075363_100097600 | Ga0075363_1000976002 | 255 |
| 483 | 3300006195 | Ga0075366_10004537 | Ga0075366_100045373 | 255 |
| 484 | 3300006846 | Ga0075430_100121858 | Ga0075430_1001218582 | 255 |
| 485 | 3300009148 | Ga0105243_10182488 | Ga0105243_101824881 | 255 |
| 486 | 3300013296 | Ga0157374_10192269 | Ga0157374_101922692 | 255 |
| 487 | 3300014968 | Ga0157379_10007612 | Ga0157379_100076127 | 255 |
| 488 | 3300025935 | Ga0207709_10067808 | Ga0207709_100678082 | 255 |
| 489 | 3300026089 | Ga0207648_10120659 | Ga0207648_101206592 | 255 |
| 490 | 3300028381 | Ga0268264_10461769 | Ga0268264_104617692 | 255 |
| 491 | 3300028800 | Ga0265338_10001296 | Ga0265338_1000129642 | 255 |
| 492 | 3300031456 | Ga0307513_10002845 | Ga0307513_1000284514 | 255 |
| 493 | 3300031456 | Ga0307513_10182885 | Ga0307513_101828852 | 255 |
| 494 | 3300031507 | Ga0307509_10158527 | Ga0307509_101585272 | 255 |
| 495 | 3300032005 | Ga0307411_10095442 | Ga0307411_100954422 | 255 |
| 496 | 3300037466 | Ga0395898_0474067 | Ga0395898_0474067_222_1124 | 255 |
| 497 | 3300037471 | Ga0395905_0067442 | Ga0395905_0067442_1866_2768 | 255 |
| 498 | 3300042876 | Ga0451577_0367131 | Ga0451577_0367131_161_1009 | 255 |
| 499 | 3300046457 | Ga0495590_0009707 | Ga0495590_0009707_2656_3510 | 255 |
| 500 | 3300050493 | nmdc:mga0k408_256998_c1 | nmdc:mga0k408_256998_c1_124_981 | 255 |
| 501 | 3300050493 | nmdc:mga0k408_2699_c1 | nmdc:mga0k408_2699_c1_3828_4703 | 255 |
| 502 | 3300050493 | nmdc:mga0k408_71796_c1 | nmdc:mga0k408_71796_c1_537_1391 | 255 |
| 503 | 3300050496 | nmdc:mga07m45_35130_c1 | nmdc:mga07m45_35130_c1_1735_2610 | 255 |
| 504 | 3300050508 | nmdc:mga09592_1643_c1 | nmdc:mga09592_1643_c1_2143_2985 | 255 |
| 505 | 3300050509 | nmdc:mga0qj67_27966_c1 | nmdc:mga0qj67_27966_c1_1042_1884 | 255 |
| 506 | 3300005458 | Ga0070681_10122299 | Ga0070681_101222993 | 256 |
| 507 | iso_pu_bacteria | 2508501125 | 2509130749 | 257 |
| 508 | iso_pu_bacteria | 2510065045 | 2510252489 | 257 |
| 509 | iso_pu_bacteria | 2512047030 | 2512348345 | 257 |
| 510 | iso_pu_bacteria | 2513237151 | 2513962695 | 257 |
| 511 | iso_pu_bacteria | 2513237166 | 2514053188 | 257 |
| 512 | iso_pu_bacteria | 2515154122 | 2515684762 | 257 |
| 513 | iso_pu_bacteria | 2515154123 | 2515690828 | 257 |
| 514 | iso_pu_bacteria | 2519103095 | 2519457649 | 257 |
| 515 | iso_pu_bacteria | 2526164713 | 2527079932 | 257 |
| 516 | iso_pu_bacteria | 2562617112 | 2563061625 | 257 |
| 517 | iso_pu_bacteria | 2582581311 | 2585294032 | 257 |
| 518 | iso_pu_bacteria | 2599185239 | 2599741173 | 257 |
| 519 | iso_pu_bacteria | 2599185240 | 2599747730 | 257 |
| 520 | iso_pu_bacteria | 2599185355 | 2600209735 | 257 |
| 521 | iso_pu_bacteria | 2675903129 | 2676745912 | 257 |
| 522 | iso_pu_bacteria | 2711768613 | 2713478508 | 257 |
| 523 | iso_pu_bacteria | 2718217991 | 2719641587 | 257 |
| 524 | iso_pu_bacteria | 2738541296 | 2738824582 | 257 |
| 525 | iso_pu_bacteria | 2738541298 | 2738837049 | 257 |
| 526 | iso_pu_bacteria | 2738541306 | 2738878579 | 257 |
| 527 | iso_pu_bacteria | 2738543002 | 2739190271 | 257 |
| 528 | iso_pu_bacteria | 2738543008 | 2739225172 | 257 |
| 529 | iso_pu_bacteria | 2744054900 | 2746087322 | 257 |
| 530 | iso_pu_bacteria | 2744054901 | 2746093171 | 257 |
| 531 | iso_pu_bacteria | 2751185846 | 2753566073 | 257 |
| 532 | iso_pu_bacteria | 2791355137 | 2792832836 | 257 |
| 533 | iso_pu_bacteria | 2808606384 | 2808972969 | 257 |
| 534 | iso_pu_bacteria | 2808606390 | 2809007866 | 257 |
| 535 | iso_pu_bacteria | 2808606391 | 2809015494 | 257 |
| 536 | iso_pu_bacteria | 2816332253 | 2817259842 | 257 |
| 537 | iso_pu_bacteria | 2816332256 | 2817277504 | 257 |
| 538 | iso_pu_bacteria | 2816332286 | 2817456637 | 257 |
| 539 | iso_pu_bacteria | 2818991450 | 2819624260 | 257 |
| 540 | iso_pu_bacteria | 2818991452 | 2819637028 | 257 |
| 541 | iso_pu_bacteria | 2842324504 | 2842332088 | 257 |
| 542 | iso_pu_bacteria | 2842348783 | 2842356460 | 257 |
| 543 | iso_pu_bacteria | 2842454564 | 2842461186 | 257 |
| 544 | iso_pu_bacteria | 2863421361 | 2863426370 | 257 |
| 545 | iso_pu_bacteria | 2870068957 | 2870069257 | 257 |
| 546 | iso_pu_bacteria | 2885270888 | 2885272463 | 257 |
| 547 | iso_pu_bacteria | 2900634093 | 2900637169 | 257 |
| 548 | iso_pu_bacteria | 2902682994 | 2902686776 | 257 |
| 549 | iso_pu_bacteria | 2904483920 | 2904490215 | 257 |
| 550 | iso_pu_bacteria | 2904564687 | 2904569515 | 257 |
| 551 | iso_pu_bacteria | 2904571731 | 2904576648 | 257 |
| 552 | iso_pu_bacteria | 2919527303 | 2919533385 | 257 |
| 553 | iso_pu_bacteria | 2921643360 | 2921655467 | 257 |
| 554 | iso_pu_bacteria | 2928108538 | 2928114114 | 257 |
| 555 | iso_pu_bacteria | 2928135762 | 2928141138 | 257 |
| 556 | iso_pu_bacteria | 2928157003 | 2928163179 | 257 |
| 557 | iso_pu_bacteria | 2928163908 | 2928170075 | 257 |
| 558 | iso_pu_bacteria | 2928170801 | 2928176184 | 257 |
| 559 | iso_pu_bacteria | 2928503688 | 2928509109 | 257 |
| 560 | iso_pu_bacteria | 2928536128 | 2928542136 | 257 |
| 561 | iso_pu_bacteria | 2945934425 | 2945934467 | 257 |
| 562 | iso_pu_bacteria | 2981990288 | 2981995970 | 257 |
| 563 | iso_pu_bacteria | 2990703756 | 2990704973 | 257 |
| 564 | iso_pu_bacteria | 641736151 | 642427079 | 257 |
| 565 | iso_pu_bacteria | 641736154 | 642418385 | 257 |
| 566 | iso_pu_bacteria | 642555112 | 642594520 | 257 |
| 567 | iso_pu_bacteria | 642555113 | 642623105 | 257 |
| 568 | iso_pu_bacteria | 8018845410 | 8018848774 | 257 |
| 569 | iso_pu_bacteria | 8020807995 | 8020810813 | 257 |
| 570 | iso_pu_bacteria | 8020938398 | 8020938910 | 257 |
| 571 | iso_pu_bacteria | 8020945358 | 8020950452 | 257 |
| 572 | iso_pu_bacteria | 8020953355 | 8020953546 | 257 |
| 573 | iso_pu_bacteria | 8021120328 | 8021127929 | 257 |
| 574 | iso_pu_bacteria | 8039098773 | 8039102044 | 257 |
| 575 | iso_pu_bacteria | 8040167225 | 8040172660 | 257 |
| 576 | iso_pu_bacteria | 8040173305 | 8040176382 | 257 |
| 577 | iso_pu_bacteria | 8055301274 | 8055307315 | 257 |
| 578 | iso_pu_bacteria | 2501025501 | 2501070349 | 258 |
| 579 | iso_pu_bacteria | 2501025502 | 2501084028 | 258 |
| 580 | iso_pu_bacteria | 2501025504 | 2501412715 | 258 |
| 581 | iso_pu_bacteria | 2510917013 | 2511093417 | 258 |
| 582 | iso_pu_bacteria | 2510917014 | 2511099867 | 258 |
| 583 | iso_pu_bacteria | 2510917015 | 2511102348 | 258 |
| 584 | iso_pu_bacteria | 2515154189 | 2516024930 | 258 |
| 585 | iso_pu_bacteria | 2856287931 | 2856289317 | 258 |
| 586 | iso_pu_bacteria | 2857357740 | 2857362175 | 258 |
| 587 | iso_pu_bacteria | 2883087390 | 2883094861 | 258 |
| 588 | 3300013105 | Ga0157369_10000410 | Ga0157369_1000041029 | 259 |
| 589 | 3300020081 | Ga0206354_10237220 | Ga0206354_102372202 | 259 |
| 590 | 3300020082 | Ga0206353_10068211 | Ga0206353_100682112 | 259 |
| 591 | 3300037312 | Ga0395899_0107386 | Ga0395899_0107386_657_1436 | 259 |
| 592 | 3300037418 | Ga0395900_0000411 | Ga0395900_0000411_58587_59366 | 259 |
| 593 | 3300037418 | Ga0395900_0066243 | Ga0395900_0066243_905_1684 | 259 |
| 594 | 3300037418 | Ga0395900_0097596 | Ga0395900_0097596_1915_2694 | 259 |
| 595 | 3300037466 | Ga0395898_0000559 | Ga0395898_0000559_14388_15167 | 259 |
| 596 | 3300037466 | Ga0395898_0159522 | Ga0395898_0159522_483_1262 | 259 |
| 597 | 3300038443 | Ga0395901_0000328 | Ga0395901_0000328_55570_56349 | 259 |
| 598 | 3300038443 | Ga0395901_0141800 | Ga0395901_0141800_858_1637 | 259 |
| 599 | 3300044694 | Ga0466963_0003869 | Ga0466963_0003869_3126_3905 | 259 |
| 600 | 3300044719 | Ga0466971_0001186 | Ga0466971_0001186_8033_8812 | 259 |
| 601 | 3300045836 | Ga0466958_0005251 | Ga0466958_0005251_3128_3907 | 259 |
| 602 | 3300046471 | Ga0495650_0072034 | Ga0495650_0072034_562_1341 | 259 |
| 603 | 3300061719 | Ga0466962_0004735 | Ga0466962_0004735_1849_2628 | 259 |
| 604 | 3300003320 | rootH2_10253312 | rootH2_102533122 | 260 |
| 605 | 3300013104 | Ga0157370_10000439 | Ga0157370_1000043926 | 260 |
| 606 | 3300013105 | Ga0157369_10001022 | Ga0157369_1000102212 | 260 |
| 607 | 3300020080 | Ga0206350_11077195 | Ga0206350_110771953 | 260 |
| 608 | 3300020081 | Ga0206354_10883746 | Ga0206354_108837463 | 260 |
| 609 | 3300020082 | Ga0206353_10562420 | Ga0206353_105624206 | 260 |
| 610 | 3300022467 | Ga0224712_10000055 | Ga0224712_100000559 | 260 |
| 611 | 3300025932 | Ga0207690_10060622 | Ga0207690_100606224 | 260 |
| 612 | 3300037312 | Ga0395899_0000080 | Ga0395899_0000080_38691_39473 | 260 |
| 613 | 3300037418 | Ga0395900_0000087 | Ga0395900_0000087_132096_132878 | 260 |
| 614 | 3300037418 | Ga0395900_0161091 | Ga0395900_0161091_1453_2235 | 260 |
| 615 | 3300037466 | Ga0395898_0000679 | Ga0395898_0000679_38691_39473 | 260 |
| 616 | 3300038443 | Ga0395901_0001663 | Ga0395901_0001663_18293_19075 | 260 |
| 617 | 3300044656 | Ga0466969_0214799 | Ga0466969_0214799_45_827 | 260 |
| 618 | 3300044684 | Ga0466966_0000058 | Ga0466966_0000058_40068_40850 | 260 |
| 619 | 3300044684 | Ga0466966_0003945 | Ga0466966_0003945_7467_8249 | 260 |
| 620 | 3300044693 | Ga0466961_0000204 | Ga0466961_0000204_14704_15486 | 260 |
| 621 | 3300044694 | Ga0466963_0036883 | Ga0466963_0036883_2333_3115 | 260 |
| 622 | 3300044706 | Ga0466964_0204704 | Ga0466964_0204704_151_933 | 260 |
| 623 | 3300044719 | Ga0466971_0074685 | Ga0466971_0074685_686_1468 | 260 |
| 624 | 3300044735 | Ga0466968_0028681 | Ga0466968_0028681_1311_2093 | 260 |
| 625 | 3300044765 | Ga0466970_0030302 | Ga0466970_0030302_1370_2152 | 260 |
| 626 | 3300044842 | Ga0466957_0002537 | Ga0466957_0002537_8177_8959 | 260 |
| 627 | 3300045049 | Ga0466959_0095700 | Ga0466959_0095700_691_1473 | 260 |
| 628 | 3300045049 | Ga0466959_0286590 | Ga0466959_0286590_129_911 | 260 |
| 629 | 3300061719 | Ga0466962_0004545 | Ga0466962_0004545_5771_6553 | 260 |
| 630 | iso_pu_bacteria | 2600255067 | 2600813930 | 260 |
| 631 | 3300001989 | JGI24739J22299_10029710 | JGI24739J22299_100297102 | 261 |
| 632 | 3300001989 | JGI24739J22299_10038296 | JGI24739J22299_100382962 | 261 |
| 633 | 3300001990 | JGI24737J22298_10012651 | JGI24737J22298_100126512 | 261 |
| 634 | 3300002067 | JGI24735J21928_10006038 | JGI24735J21928_100060383 | 261 |
| 635 | 3300002067 | JGI24735J21928_10006346 | JGI24735J21928_100063462 | 261 |
| 636 | 3300002067 | JGI24735J21928_10101600 | JGI24735J21928_101016001 | 261 |
| 637 | 3300002705 | JGI25156J39149_1005451 | JGI25156J39149_10054512 | 261 |
| 638 | 3300003320 | rootH2_10255524 | rootH2_102555242 | 261 |
| 639 | 3300003323 | rootH1_10176638 | rootH1_101766384 | 261 |
| 640 | 3300003756 | Ga0055533_1002644 | Ga0055533_10026443 | 261 |
| 641 | 3300003758 | Ga0055532_1000718 | Ga0055532_100071812 | 261 |
| 642 | 3300003758 | Ga0055532_1004042 | Ga0055532_10040423 | 261 |
| 643 | 3300003758 | Ga0055532_1004063 | Ga0055532_10040633 | 261 |
| 644 | 3300003760 | Ga0055527_1003540 | Ga0055527_10035403 | 261 |
| 645 | 3300003760 | Ga0055527_1003554 | Ga0055527_10035542 | 261 |
| 646 | 3300003761 | Ga0055535_1006604 | Ga0055535_10066043 | 261 |
| 647 | 3300003761 | Ga0055535_1006637 | Ga0055535_10066373 | 261 |
| 648 | 3300003762 | Ga0055542_1004393 | Ga0055542_10043935 | 261 |
| 649 | 3300003762 | Ga0055542_1006925 | Ga0055542_10069253 | 261 |
| 650 | 3300003763 | Ga0055529_1003991 | Ga0055529_10039913 | 261 |
| 651 | 3300003763 | Ga0055529_1003997 | Ga0055529_10039973 | 261 |
| 652 | 3300003790 | Ga0055528_1001636 | Ga0055528_10016366 | 261 |
| 653 | 3300003856 | Ga0058692_1004095 | Ga0058692_10040954 | 261 |
| 654 | 3300005262 | Ga0065165_1000648 | Ga0065165_100064844 | 261 |
| 655 | 3300005331 | Ga0070670_100305927 | Ga0070670_1003059272 | 261 |
| 656 | 3300005339 | Ga0070660_100000204 | Ga0070660_10000020440 | 261 |
| 657 | 3300005339 | Ga0070660_100001152 | Ga0070660_1000011528 | 261 |
| 658 | 3300005344 | Ga0070661_100087551 | Ga0070661_1000875512 | 261 |
| 659 | 3300005366 | Ga0070659_100000156 | Ga0070659_10000015639 | 261 |
| 660 | 3300005367 | Ga0070667_100027200 | Ga0070667_1000272006 | 261 |
| 661 | 3300005455 | Ga0070663_100007485 | Ga0070663_1000074857 | 261 |
| 662 | 3300005455 | Ga0070663_100011786 | Ga0070663_1000117862 | 261 |
| 663 | 3300005456 | Ga0070678_100461535 | Ga0070678_1004615352 | 261 |
| 664 | 3300005563 | Ga0068855_100004044 | Ga0068855_1000040449 | 261 |
| 665 | 3300005563 | Ga0068855_100074923 | Ga0068855_1000749234 | 261 |
| 666 | 3300005577 | Ga0068857_100529192 | Ga0068857_1005291921 | 261 |
| 667 | 3300005616 | Ga0068852_100025272 | Ga0068852_1000252722 | 261 |
| 668 | 3300005844 | Ga0068862_100506019 | Ga0068862_1005060192 | 261 |
| 669 | 3300009011 | Ga0105251_10000758 | Ga0105251_1000075820 | 261 |
| 670 | 3300009011 | Ga0105251_10001262 | Ga0105251_100012626 | 261 |
| 671 | 3300009011 | Ga0105251_10081877 | Ga0105251_100818771 | 261 |
| 672 | 3300009036 | Ga0105244_10178424 | Ga0105244_101784242 | 261 |
| 673 | 3300009092 | Ga0105250_10026968 | Ga0105250_100269683 | 261 |
| 674 | 3300009092 | Ga0105250_10096753 | Ga0105250_100967531 | 261 |
| 675 | 3300009093 | Ga0105240_10001922 | Ga0105240_1000192225 | 261 |
| 676 | 3300009093 | Ga0105240_10029364 | Ga0105240_100293643 | 261 |
| 677 | 3300009093 | Ga0105240_10031832 | Ga0105240_100318323 | 261 |
| 678 | 3300009093 | Ga0105240_10315871 | Ga0105240_103158712 | 261 |
| 679 | 3300009174 | Ga0105241_10458896 | Ga0105241_104588961 | 261 |
| 680 | 3300009177 | Ga0105248_10020642 | Ga0105248_100206422 | 261 |
| 681 | 3300009177 | Ga0105248_10077726 | Ga0105248_100777262 | 261 |
| 682 | 3300009545 | Ga0105237_10021860 | Ga0105237_100218602 | 261 |
| 683 | 3300009545 | Ga0105237_10097080 | Ga0105237_100970804 | 261 |
| 684 | 3300009551 | Ga0105238_10013695 | Ga0105238_100136952 | 261 |
| 685 | 3300009551 | Ga0105238_10195917 | Ga0105238_101959172 | 261 |
| 686 | 3300009551 | Ga0105238_10244838 | Ga0105238_102448382 | 261 |
| 687 | 3300010375 | Ga0105239_10003468 | Ga0105239_100034688 | 261 |
| 688 | 3300010375 | Ga0105239_10119618 | Ga0105239_101196182 | 261 |
| 689 | 3300010375 | Ga0105239_10547472 | Ga0105239_105474722 | 261 |
| 690 | 3300013100 | Ga0157373_10008296 | Ga0157373_100082966 | 261 |
| 691 | 3300013104 | Ga0157370_10002253 | Ga0157370_1000225314 | 261 |
| 692 | 3300013104 | Ga0157370_10118451 | Ga0157370_101184512 | 261 |
| 693 | 3300013105 | Ga0157369_10001007 | Ga0157369_1000100721 | 261 |
| 694 | 3300013105 | Ga0157369_10060127 | Ga0157369_100601273 | 261 |
| 695 | 3300013105 | Ga0157369_10120622 | Ga0157369_101206222 | 261 |
| 696 | 3300013296 | Ga0157374_10000146 | Ga0157374_1000014623 | 261 |
| 697 | 3300013306 | Ga0163162_10000877 | Ga0163162_100008779 | 261 |
| 698 | 3300013307 | Ga0157372_10000323 | Ga0157372_100003232 | 261 |
| 699 | 3300013307 | Ga0157372_10066434 | Ga0157372_100664342 | 261 |
| 700 | 3300014497 | Ga0182008_10068800 | Ga0182008_100688001 | 261 |
| 701 | 3300014497 | Ga0182008_10117141 | Ga0182008_101171411 | 261 |
| 702 | 3300015261 | Ga0182006_1078219 | Ga0182006_10782192 | 261 |
| 703 | 3300015262 | Ga0182007_10003995 | Ga0182007_100039952 | 261 |
| 704 | 3300015265 | Ga0182005_1015290 | Ga0182005_10152902 | 261 |
| 705 | 3300016635 | Ga0183361_10015 | Ga0183361_10015141 | 261 |
| 706 | 3300025206 | Ga0209435_102614 | Ga0209435_1026142 | 261 |
| 707 | 3300025225 | Ga0209566_101192 | Ga0209566_1011923 | 261 |
| 708 | 3300025226 | Ga0209674_100260 | Ga0209674_1002602 | 261 |
| 709 | 3300025226 | Ga0209674_104036 | Ga0209674_1040362 | 261 |
| 710 | 3300025228 | Ga0209672_100054 | Ga0209672_10005440 | 261 |
| 711 | 3300025228 | Ga0209672_100072 | Ga0209672_100072127 | 261 |
| 712 | 3300025228 | Ga0209672_100185 | Ga0209672_10018528 | 261 |
| 713 | 3300025229 | Ga0209147_100085 | Ga0209147_100085150 | 261 |
| 714 | 3300025229 | Ga0209147_100100 | Ga0209147_100100119 | 261 |
| 715 | 3300025229 | Ga0209147_100278 | Ga0209147_10027825 | 261 |
| 716 | 3300025242 | Ga0209258_100168 | Ga0209258_100168149 | 261 |
| 717 | 3300025242 | Ga0209258_100331 | Ga0209258_10033128 | 261 |
| 718 | 3300025254 | Ga0209148_1001174 | Ga0209148_100117412 | 261 |
| 719 | 3300025256 | Ga0209759_1000351 | Ga0209759_100035143 | 261 |
| 720 | 3300025256 | Ga0209759_1000502 | Ga0209759_100050239 | 261 |
| 721 | 3300025256 | Ga0209759_1021861 | Ga0209759_10218612 | 261 |
| 722 | 3300025263 | Ga0209565_1018615 | Ga0209565_10186152 | 261 |
| 723 | 3300025272 | Ga0209455_1000279 | Ga0209455_100027937 | 261 |
| 724 | 3300025273 | Ga0209673_1000098 | Ga0209673_100009841 | 261 |
| 725 | 3300025295 | Ga0209564_1007078 | Ga0209564_10070784 | 261 |
| 726 | 3300025302 | Ga0207426_1000199 | Ga0207426_1000199115 | 261 |
| 727 | 3300025711 | Ga0207696_1019421 | Ga0207696_10194212 | 261 |
| 728 | 3300025735 | Ga0207713_1000186 | Ga0207713_100018655 | 261 |
| 729 | 3300025735 | Ga0207713_1023306 | Ga0207713_10233062 | 261 |
| 730 | 3300025903 | Ga0207680_10016281 | Ga0207680_100162812 | 261 |
| 731 | 3300025904 | Ga0207647_10000126 | Ga0207647_1000012664 | 261 |
| 732 | 3300025904 | Ga0207647_10005134 | Ga0207647_100051342 | 261 |
| 733 | 3300025904 | Ga0207647_10007932 | Ga0207647_100079322 | 261 |
| 734 | 3300025904 | Ga0207647_10046048 | Ga0207647_100460482 | 261 |
| 735 | 3300025911 | Ga0207654_10278119 | Ga0207654_102781191 | 261 |
| 736 | 3300025913 | Ga0207695_10000971 | Ga0207695_1000097128 | 261 |
| 737 | 3300025913 | Ga0207695_10004600 | Ga0207695_100046006 | 261 |
| 738 | 3300025913 | Ga0207695_10005877 | Ga0207695_100058779 | 261 |
| 739 | 3300025913 | Ga0207695_10177134 | Ga0207695_101771343 | 261 |
| 740 | 3300025914 | Ga0207671_10067446 | Ga0207671_100674462 | 261 |
| 741 | 3300025914 | Ga0207671_10108323 | Ga0207671_101083232 | 261 |
| 742 | 3300025914 | Ga0207671_10256833 | Ga0207671_102568332 | 261 |
| 743 | 3300025919 | Ga0207657_10000096 | Ga0207657_1000009639 | 261 |
| 744 | 3300025919 | Ga0207657_10006312 | Ga0207657_100063122 | 261 |
| 745 | 3300025924 | Ga0207694_10194661 | Ga0207694_101946611 | 261 |
| 746 | 3300025924 | Ga0207694_10342557 | Ga0207694_103425572 | 261 |
| 747 | 3300025931 | Ga0207644_10148919 | Ga0207644_101489192 | 261 |
| 748 | 3300025932 | Ga0207690_10000074 | Ga0207690_1000007440 | 261 |
| 749 | 3300025941 | Ga0207711_10014166 | Ga0207711_100141664 | 261 |
| 750 | 3300025949 | Ga0207667_10018190 | Ga0207667_100181902 | 261 |
| 751 | 3300025949 | Ga0207667_10070621 | Ga0207667_100706212 | 261 |
| 752 | 3300025949 | Ga0207667_10460213 | Ga0207667_104602131 | 261 |
| 753 | 3300025981 | Ga0207640_10342737 | Ga0207640_103427371 | 261 |
| 754 | 3300025986 | Ga0207658_10133928 | Ga0207658_101339283 | 261 |
| 755 | 3300026067 | Ga0207678_10000061 | Ga0207678_1000006141 | 261 |
| 756 | 3300026067 | Ga0207678_10113488 | Ga0207678_101134882 | 261 |
| 757 | 3300026067 | Ga0207678_10290489 | Ga0207678_102904892 | 261 |
| 758 | 3300026067 | Ga0207678_10325757 | Ga0207678_103257572 | 261 |
| 759 | 3300026116 | Ga0207674_10413453 | Ga0207674_104134531 | 261 |
| 760 | 3300026121 | Ga0207683_10473685 | Ga0207683_104736852 | 261 |
| 761 | 3300026142 | Ga0207698_10010491 | Ga0207698_100104915 | 261 |
| 762 | 3300027312 | Ga0209371_1000141 | Ga0209371_100014186 | 261 |
| 763 | 3300027312 | Ga0209371_1001782 | Ga0209371_100178213 | 261 |
| 764 | 3300028380 | Ga0268265_10659145 | Ga0268265_106591451 | 261 |
| 765 | 3300030500 | Ga0268256_1000418 | Ga0268256_10004186 | 261 |
| 766 | 3300030500 | Ga0268256_1007322 | Ga0268256_10073224 | 261 |
| 767 | 3300031548 | Ga0307408_100000422 | Ga0307408_10000042231 | 261 |
| 768 | 3300031911 | Ga0307412_10000056 | Ga0307412_10000056121 | 261 |
| 769 | 3300031911 | Ga0307412_10124282 | Ga0307412_101242822 | 261 |
| 770 | 3300031995 | Ga0307409_100024795 | Ga0307409_1000247955 | 261 |
| 771 | 3300037418 | Ga0395900_0042730 | Ga0395900_0042730_394_1185 | 261 |
| 772 | 3300037418 | Ga0395900_0594919 | Ga0395900_0594919_199_990 | 261 |
| 773 | 3300037466 | Ga0395898_0009374 | Ga0395898_0009374_4124_4915 | 261 |
| 774 | 3300039437 | Ga0436365_1636570 | Ga0436365_1636570_859_1773 | 261 |
| 775 | 3300039447 | Ga0436361_0870638 | Ga0436361_0870638_1744_2544 | 261 |
| 776 | 3300042005 | Ga0439448_0000429 | Ga0439448_0000429_2180_2971 | 261 |
| 777 | 3300044656 | Ga0466969_0000833 | Ga0466969_0000833_5360_6148 | 261 |
| 778 | 3300044659 | Ga0466973_0070919 | Ga0466973_0070919_1552_2340 | 261 |
| 779 | 3300044684 | Ga0466966_0194802 | Ga0466966_0194802_193_978 | 261 |
| 780 | 3300044693 | Ga0466961_0000224 | Ga0466961_0000224_4340_5128 | 261 |
| 781 | 3300044693 | Ga0466961_0132237 | Ga0466961_0132237_411_1268 | 261 |
| 782 | 3300044693 | Ga0466961_0177919 | Ga0466961_0177919_204_995 | 261 |
| 783 | 3300044735 | Ga0466968_0030208 | Ga0466968_0030208_1112_1900 | 261 |
| 784 | 3300044765 | Ga0466970_0001740 | Ga0466970_0001740_8792_9583 | 261 |
| 785 | 3300044765 | Ga0466970_0015169 | Ga0466970_0015169_2085_2873 | 261 |
| 786 | 3300044842 | Ga0466957_0000621 | Ga0466957_0000621_4467_5255 | 261 |
| 787 | 3300045049 | Ga0466959_0005343 | Ga0466959_0005343_3148_3939 | 261 |
| 788 | 3300046455 | Ga0495603_0037122 | Ga0495603_0037122_241_1026 | 261 |
| 789 | 3300046455 | Ga0495603_0061077 | Ga0495603_0061077_302_1087 | 261 |
| 790 | 3300046455 | Ga0495603_0063725 | Ga0495603_0063725_422_1207 | 261 |
| 791 | 3300046455 | Ga0495603_0076487 | Ga0495603_0076487_952_1737 | 261 |
| 792 | 3300046457 | Ga0495590_0003243 | Ga0495590_0003243_5342_6127 | 261 |
| 793 | 3300046459 | Ga0495629_0000309 | Ga0495629_0000309_177_962 | 261 |
| 794 | 3300046459 | Ga0495629_0000625 | Ga0495629_0000625_10364_11149 | 261 |
| 795 | 3300046459 | Ga0495629_0002634 | Ga0495629_0002634_2073_2858 | 261 |
| 796 | 3300046459 | Ga0495629_0003835 | Ga0495629_0003835_8629_9414 | 261 |
| 797 | 3300046460 | Ga0495638_0000875 | Ga0495638_0000875_10265_11050 | 261 |
| 798 | 3300046460 | Ga0495638_0026681 | Ga0495638_0026681_1065_1850 | 261 |
| 799 | 3300046461 | Ga0495641_0053756 | Ga0495641_0053756_695_1480 | 261 |
| 800 | 3300046461 | Ga0495641_0111852 | Ga0495641_0111852_194_979 | 261 |
| 801 | 3300046462 | Ga0495651_0010274 | Ga0495651_0010274_4259_5044 | 261 |
| 802 | 3300046462 | Ga0495651_0087012 | Ga0495651_0087012_1025_1810 | 261 |
| 803 | 3300046462 | Ga0495651_0102367 | Ga0495651_0102367_875_1660 | 261 |
| 804 | 3300046462 | Ga0495651_0327166 | Ga0495651_0327166_34_819 | 261 |
| 805 | 3300046463 | Ga0495653_0003799 | Ga0495653_0003799_2083_2868 | 261 |
| 806 | 3300046463 | Ga0495653_0047038 | Ga0495653_0047038_2377_3162 | 261 |
| 807 | 3300046463 | Ga0495653_0072119 | Ga0495653_0072119_241_1026 | 261 |
| 808 | 3300046463 | Ga0495653_0155902 | Ga0495653_0155902_14_799 | 261 |
| 809 | 3300046463 | Ga0495653_0183391 | Ga0495653_0183391_514_1299 | 261 |
| 810 | 3300046471 | Ga0495650_0001711 | Ga0495650_0001711_10494_11279 | 261 |
| 811 | 3300046471 | Ga0495650_0010003 | Ga0495650_0010003_2602_3387 | 261 |
| 812 | 3300046471 | Ga0495650_0038166 | Ga0495650_0038166_1033_1818 | 261 |
| 813 | 3300046471 | Ga0495650_0039764 | Ga0495650_0039764_1104_1889 | 261 |
| 814 | 3300046472 | Ga0495580_0000302 | Ga0495580_0000302_29313_30098 | 261 |
| 815 | 3300046472 | Ga0495580_0001573 | Ga0495580_0001573_14510_15295 | 261 |
| 816 | 3300046472 | Ga0495580_0009825 | Ga0495580_0009825_6016_6801 | 261 |
| 817 | 3300046472 | Ga0495580_0014037 | Ga0495580_0014037_2128_2913 | 261 |
| 818 | 3300046472 | Ga0495580_0016553 | Ga0495580_0016553_3611_4396 | 261 |
| 819 | 3300046472 | Ga0495580_0027489 | Ga0495580_0027489_178_963 | 261 |
| 820 | 3300046473 | Ga0495582_0005015 | Ga0495582_0005015_4250_5035 | 261 |
| 821 | 3300046473 | Ga0495582_0065691 | Ga0495582_0065691_1065_1850 | 261 |
| 822 | 3300046474 | Ga0495605_0002667 | Ga0495605_0002667_8186_8971 | 261 |
| 823 | 3300046474 | Ga0495605_0009236 | Ga0495605_0009236_239_1024 | 261 |
| 824 | 3300046474 | Ga0495605_0010282 | Ga0495605_0010282_610_1395 | 261 |
| 825 | 3300046474 | Ga0495605_0028952 | Ga0495605_0028952_346_1131 | 261 |
| 826 | 3300046475 | Ga0495639_0134711 | Ga0495639_0134711_38_823 | 261 |
| 827 | 3300046476 | Ga0495662_0022988 | Ga0495662_0022988_1366_2151 | 261 |
| 828 | 3300046476 | Ga0495662_0061546 | Ga0495662_0061546_363_1148 | 261 |
| 829 | 3300046476 | Ga0495662_0064588 | Ga0495662_0064588_464_1249 | 261 |
| 830 | 3300046477 | Ga0495664_0001157 | Ga0495664_0001157_10708_11493 | 261 |
| 831 | 3300046477 | Ga0495664_0012877 | Ga0495664_0012877_2063_2848 | 261 |
| 832 | 3300046492 | Ga0495585_0046538 | Ga0495585_0046538_437_1222 | 261 |
| 833 | 3300046499 | Ga0495594_0027143 | Ga0495594_0027143_937_1722 | 261 |
| 834 | 3300046500 | Ga0495596_0001981 | Ga0495596_0001981_5134_5919 | 261 |
| 835 | 3300046500 | Ga0495596_0051859 | Ga0495596_0051859_710_1495 | 261 |
| 836 | 3300046501 | Ga0495607_0154216 | Ga0495607_0154216_53_838 | 261 |
| 837 | 3300046506 | Ga0495583_0004759 | Ga0495583_0004759_8303_9088 | 261 |
| 838 | 3300046507 | Ga0495606_0019943 | Ga0495606_0019943_2081_2866 | 261 |
| 839 | 3300046507 | Ga0495606_0035281 | Ga0495606_0035281_1414_2199 | 261 |
| 840 | 3300046507 | Ga0495606_0067238 | Ga0495606_0067238_848_1633 | 261 |
| 841 | 3300046507 | Ga0495606_0197918 | Ga0495606_0197918_217_1002 | 261 |
| 842 | 3300046511 | Ga0495608_0002463 | Ga0495608_0002463_4278_5063 | 261 |
| 843 | 3300046511 | Ga0495608_0013647 | Ga0495608_0013647_599_1384 | 261 |
| 844 | 3300046512 | Ga0495610_0001399 | Ga0495610_0001399_775_1560 | 261 |
| 845 | 3300046514 | Ga0495618_0005667 | Ga0495618_0005667_3247_4032 | 261 |
| 846 | 3300046514 | Ga0495618_0011010 | Ga0495618_0011010_2607_3392 | 261 |
| 847 | 3300046516 | Ga0495628_0019540 | Ga0495628_0019540_2732_3517 | 261 |
| 848 | 3300046516 | Ga0495628_0022733 | Ga0495628_0022733_589_1374 | 261 |
| 849 | 3300046516 | Ga0495628_0121769 | Ga0495628_0121769_147_932 | 261 |
| 850 | 3300046516 | Ga0495628_0223216 | Ga0495628_0223216_396_1181 | 261 |
| 851 | 3300046517 | Ga0495630_0084812 | Ga0495630_0084812_1146_1931 | 261 |
| 852 | 3300046517 | Ga0495630_0192089 | Ga0495630_0192089_687_1472 | 261 |
| 853 | 3300046517 | Ga0495630_0409124 | Ga0495630_0409124_191_976 | 261 |
| 854 | 3300046522 | Ga0495643_0023390 | Ga0495643_0023390_2088_2873 | 261 |
| 855 | 3300046524 | Ga0495648_0040724 | Ga0495648_0040724_799_1584 | 261 |
| 856 | 3300046524 | Ga0495648_0071733 | Ga0495648_0071733_436_1221 | 261 |
| 857 | 3300046524 | Ga0495648_0107219 | Ga0495648_0107219_705_1490 | 261 |
| 858 | 3300046524 | Ga0495648_0112160 | Ga0495648_0112160_584_1369 | 261 |
| 859 | 3300046526 | Ga0495666_0001199 | Ga0495666_0001199_7710_8495 | 261 |
| 860 | 3300046526 | Ga0495666_0006920 | Ga0495666_0006920_2221_3006 | 261 |
| 861 | 3300046526 | Ga0495666_0016418 | Ga0495666_0016418_660_1445 | 261 |
| 862 | 3300046526 | Ga0495666_0043695 | Ga0495666_0043695_411_1196 | 261 |
| 863 | 3300046526 | Ga0495666_0083087 | Ga0495666_0083087_128_913 | 261 |
| 864 | 3300046529 | Ga0495652_0010784 | Ga0495652_0010784_5589_6374 | 261 |
| 865 | 3300046529 | Ga0495652_0013894 | Ga0495652_0013894_589_1374 | 261 |
| 866 | 3300046529 | Ga0495652_0098010 | Ga0495652_0098010_240_1025 | 261 |
| 867 | 3300046529 | Ga0495652_0156120 | Ga0495652_0156120_212_997 | 261 |
| 868 | 3300046530 | Ga0495654_0064725 | Ga0495654_0064725_447_1232 | 261 |
| 869 | 3300046530 | Ga0495654_0119728 | Ga0495654_0119728_332_1117 | 261 |
| 870 | 3300046531 | Ga0495665_0007143 | Ga0495665_0007143_3776_4561 | 261 |
| 871 | 3300046531 | Ga0495665_0017791 | Ga0495665_0017791_244_1029 | 261 |
| 872 | 3300046531 | Ga0495665_0019537 | Ga0495665_0019537_1492_2277 | 261 |
| 873 | 3300046531 | Ga0495665_0043147 | Ga0495665_0043147_1290_2075 | 261 |
| 874 | 3300046531 | Ga0495665_0095573 | Ga0495665_0095573_179_964 | 261 |
| 875 | 3300046533 | Ga0495640_0016145 | Ga0495640_0016145_2674_3459 | 261 |
| 876 | 3300046533 | Ga0495640_0022717 | Ga0495640_0022717_861_1646 | 261 |
| 877 | 3300046533 | Ga0495640_0134679 | Ga0495640_0134679_458_1243 | 261 |
| 878 | 3300046535 | Ga0495586_0000830 | Ga0495586_0000830_13080_13865 | 261 |
| 879 | 3300046535 | Ga0495586_0020449 | Ga0495586_0020449_2702_3487 | 261 |
| 880 | 3300046536 | Ga0495587_0003407 | Ga0495587_0003407_6495_7280 | 261 |
| 881 | 3300046536 | Ga0495587_0037840 | Ga0495587_0037840_2078_2863 | 261 |
| 882 | 3300046543 | Ga0495645_0001202 | Ga0495645_0001202_2835_3620 | 261 |
| 883 | 3300046543 | Ga0495645_0001234 | Ga0495645_0001234_6627_7412 | 261 |
| 884 | 3300046543 | Ga0495645_0017810 | Ga0495645_0017810_3184_3969 | 261 |
| 885 | 3300046543 | Ga0495645_0109585 | Ga0495645_0109585_568_1353 | 261 |
| 886 | 3300046557 | Ga0495622_0000416 | Ga0495622_0000416_11249_12034 | 261 |
| 887 | 3300046557 | Ga0495622_0119980 | Ga0495622_0119980_93_878 | 261 |
| 888 | 3300046559 | Ga0495667_0082886 | Ga0495667_0082886_36_821 | 261 |
| 889 | 3300046642 | Ga0495634_0014012 | Ga0495634_0014012_2593_3378 | 261 |
| 890 | 3300046642 | Ga0495634_0021151 | Ga0495634_0021151_15_800 | 261 |
| 891 | 3300046642 | Ga0495634_0046559 | Ga0495634_0046559_1282_2067 | 261 |
| 892 | 3300046648 | Ga0495611_0054433 | Ga0495611_0054433_985_1770 | 261 |
| 893 | 3300046663 | Ga0495635_0000986 | Ga0495635_0000986_13953_14738 | 261 |
| 894 | 3300046663 | Ga0495635_0004865 | Ga0495635_0004865_5993_6778 | 261 |
| 895 | 3300046663 | Ga0495635_0045947 | Ga0495635_0045947_942_1727 | 261 |
| 896 | 3300046665 | Ga0495661_0001100 | Ga0495661_0001100_12146_12931 | 261 |
| 897 | 3300046665 | Ga0495661_0009353 | Ga0495661_0009353_5410_6195 | 261 |
| 898 | 3300046665 | Ga0495661_0027764 | Ga0495661_0027764_421_1206 | 261 |
| 899 | 3300046674 | Ga0495588_0028684 | Ga0495588_0028684_1492_2277 | 261 |
| 900 | 3300046678 | Ga0495599_0009795 | Ga0495599_0009795_4274_5059 | 261 |
| 901 | 3300046678 | Ga0495599_0017908 | Ga0495599_0017908_830_1615 | 261 |
| 902 | 3300046678 | Ga0495599_0123309 | Ga0495599_0123309_746_1531 | 261 |
| 903 | 3300046679 | Ga0495623_0002524 | Ga0495623_0002524_2395_3180 | 261 |
| 904 | 3300046679 | Ga0495623_0007636 | Ga0495623_0007636_5389_6174 | 261 |
| 905 | 3300046679 | Ga0495623_0023038 | Ga0495623_0023038_1109_1894 | 261 |
| 906 | 3300046679 | Ga0495623_0140124 | Ga0495623_0140124_292_1077 | 261 |
| 907 | 3300046680 | Ga0495646_0002312 | Ga0495646_0002312_3008_3793 | 261 |
| 908 | 3300046680 | Ga0495646_0003646 | Ga0495646_0003646_661_1446 | 261 |
| 909 | 3300046680 | Ga0495646_0005817 | Ga0495646_0005817_4922_5707 | 261 |
| 910 | 3300046680 | Ga0495646_0026685 | Ga0495646_0026685_2693_3478 | 261 |
| 911 | 3300046680 | Ga0495646_0187937 | Ga0495646_0187937_16_801 | 261 |
| 912 | 3300046684 | Ga0495669_0029409 | Ga0495669_0029409_448_1233 | 261 |
| 913 | 3300046684 | Ga0495669_0062496 | Ga0495669_0062496_86_871 | 261 |
| 914 | 3300046689 | Ga0495613_0000699 | Ga0495613_0000699_14082_14867 | 261 |
| 915 | 3300046689 | Ga0495613_0001221 | Ga0495613_0001221_10687_11472 | 261 |
| 916 | 3300046689 | Ga0495613_0412259 | Ga0495613_0412259_43_828 | 261 |
| 917 | 3300046690 | Ga0495624_0028174 | Ga0495624_0028174_1156_1941 | 261 |
| 918 | 3300046690 | Ga0495624_0031854 | Ga0495624_0031854_241_1026 | 261 |
| 919 | 3300046690 | Ga0495624_0036841 | Ga0495624_0036841_1337_2122 | 261 |
| 920 | 3300046690 | Ga0495624_0052917 | Ga0495624_0052917_1068_1853 | 261 |
| 921 | 3300046690 | Ga0495624_0074205 | Ga0495624_0074205_605_1390 | 261 |
| 922 | 3300046690 | Ga0495624_0082759 | Ga0495624_0082759_1024_1809 | 261 |
| 923 | 3300046690 | Ga0495624_0264272 | Ga0495624_0264272_240_1025 | 261 |
| 924 | 3300046691 | Ga0495670_0061459 | Ga0495670_0061459_693_1478 | 261 |
| 925 | 3300046694 | Ga0495649_0022385 | Ga0495649_0022385_1205_1990 | 261 |
| 926 | 3300046694 | Ga0495649_0050840 | Ga0495649_0050840_911_1696 | 261 |
| 927 | 3300046794 | Ga0495589_0001288 | Ga0495589_0001288_11881_12666 | 261 |
| 928 | 3300046794 | Ga0495589_0003149 | Ga0495589_0003149_6983_7768 | 261 |
| 929 | 3300046794 | Ga0495589_0043248 | Ga0495589_0043248_705_1490 | 261 |
| 930 | 3300046809 | Ga0495600_0003931 | Ga0495600_0003931_239_1024 | 261 |
| 931 | 3300046809 | Ga0495600_0005333 | Ga0495600_0005333_1278_2063 | 261 |
| 932 | 3300046810 | Ga0495660_0029848 | Ga0495660_0029848_1275_2060 | 261 |
| 933 | 3300046810 | Ga0495660_0096562 | Ga0495660_0096562_690_1475 | 261 |
| 934 | 3300047315 | Ga0495581_0000663 | Ga0495581_0000663_5013_5798 | 261 |
| 935 | 3300047315 | Ga0495581_0006131 | Ga0495581_0006131_2289_3074 | 261 |
| 936 | 3300047315 | Ga0495581_0016518 | Ga0495581_0016518_1289_2074 | 261 |
| 937 | 3300047317 | Ga0495604_0004307 | Ga0495604_0004307_8401_9186 | 261 |
| 938 | 3300047317 | Ga0495604_0018287 | Ga0495604_0018287_2603_3388 | 261 |
| 939 | 3300047317 | Ga0495604_0037638 | Ga0495604_0037638_2444_3229 | 261 |
| 940 | 3300047317 | Ga0495604_0055582 | Ga0495604_0055582_956_1741 | 261 |
| 941 | 3300047317 | Ga0495604_0079211 | Ga0495604_0079211_12_797 | 261 |
| 942 | 3300047319 | Ga0495674_0027200 | Ga0495674_0027200_3910_4695 | 261 |
| 943 | 3300047319 | Ga0495674_0060517 | Ga0495674_0060517_115_900 | 261 |
| 944 | 3300047319 | Ga0495674_0063290 | Ga0495674_0063290_2211_2996 | 261 |
| 945 | 3300047319 | Ga0495674_0070202 | Ga0495674_0070202_1029_1814 | 261 |
| 946 | 3300047319 | Ga0495674_0093373 | Ga0495674_0093373_937_1722 | 261 |
| 947 | 3300047319 | Ga0495674_0146060 | Ga0495674_0146060_1024_1809 | 261 |
| 948 | 3300047319 | Ga0495674_0198659 | Ga0495674_0198659_806_1591 | 261 |
| 949 | 3300047320 | Ga0495672_0131500 | Ga0495672_0131500_384_1169 | 261 |
| 950 | 3300047321 | Ga0495676_0046877 | Ga0495676_0046877_2571_3356 | 261 |
| 951 | 3300047321 | Ga0495676_0066032 | Ga0495676_0066032_93_878 | 261 |
| 952 | 3300047321 | Ga0495676_0085241 | Ga0495676_0085241_1377_2162 | 261 |
| 953 | 3300047321 | Ga0495676_0181988 | Ga0495676_0181988_64_849 | 261 |
| 954 | 3300047322 | Ga0495680_0003458 | Ga0495680_0003458_4453_5238 | 261 |
| 955 | 3300047322 | Ga0495680_0012704 | Ga0495680_0012704_240_1025 | 261 |
| 956 | 3300047322 | Ga0495680_0069916 | Ga0495680_0069916_1032_1817 | 261 |
| 957 | 3300047322 | Ga0495680_0124547 | Ga0495680_0124547_733_1518 | 261 |
| 958 | 3300047323 | Ga0495683_0002777 | Ga0495683_0002777_5720_6505 | 261 |
| 959 | 3300047323 | Ga0495683_0007542 | Ga0495683_0007542_2071_2856 | 261 |
| 960 | 3300047323 | Ga0495683_0012486 | Ga0495683_0012486_194_979 | 261 |
| 961 | 3300047323 | Ga0495683_0014509 | Ga0495683_0014509_89_874 | 261 |
| 962 | 3300047323 | Ga0495683_0016995 | Ga0495683_0016995_857_1642 | 261 |
| 963 | 3300047323 | Ga0495683_0071782 | Ga0495683_0071782_889_1674 | 261 |
| 964 | 3300047323 | Ga0495683_0096904 | Ga0495683_0096904_141_926 | 261 |
| 965 | 3300047323 | Ga0495683_0138861 | Ga0495683_0138861_145_930 | 261 |
| 966 | 3300047323 | Ga0495683_0214739 | Ga0495683_0214739_24_809 | 261 |
| 967 | 3300047443 | Ga0495687_000419 | Ga0495687_000419_17476_18261 | 261 |
| 968 | 3300047443 | Ga0495687_006987 | Ga0495687_006987_169_954 | 261 |
| 969 | 3300047443 | Ga0495687_032079 | Ga0495687_032079_653_1438 | 261 |
| 970 | 3300047443 | Ga0495687_059797 | Ga0495687_059797_233_1018 | 261 |
| 971 | 3300047443 | Ga0495687_127075 | Ga0495687_127075_69_854 | 261 |
| 972 | 3300047444 | Ga0495675_0001691 | Ga0495675_0001691_11778_12563 | 261 |
| 973 | 3300047444 | Ga0495675_0006134 | Ga0495675_0006134_532_1317 | 261 |
| 974 | 3300047444 | Ga0495675_0016472 | Ga0495675_0016472_1249_2034 | 261 |
| 975 | 3300047444 | Ga0495675_0167805 | Ga0495675_0167805_427_1212 | 261 |
| 976 | 3300047446 | Ga0495679_000271 | Ga0495679_000271_2429_3214 | 261 |
| 977 | 3300047446 | Ga0495679_009458 | Ga0495679_009458_853_1638 | 261 |
| 978 | 3300047447 | Ga0495685_061841 | Ga0495685_061841_250_1035 | 261 |
| 979 | 3300047469 | Ga0495673_0015862 | Ga0495673_0015862_2112_2897 | 261 |
| 980 | 3300047469 | Ga0495673_0056281 | Ga0495673_0056281_500_1285 | 261 |
| 981 | 3300047471 | Ga0495684_0031282 | Ga0495684_0031282_2235_3020 | 261 |
| 982 | 3300047471 | Ga0495684_0139743 | Ga0495684_0139743_985_1770 | 261 |
| 983 | 3300047472 | Ga0495686_0000540 | Ga0495686_0000540_15403_16188 | 261 |
| 984 | 3300047472 | Ga0495686_0030290 | Ga0495686_0030290_1914_2699 | 261 |
| 985 | 3300047673 | Ga0495593_0009056 | Ga0495593_0009056_2075_2860 | 261 |
| 986 | 3300047673 | Ga0495593_0010249 | Ga0495593_0010249_2540_3325 | 261 |
| 987 | 3300047673 | Ga0495593_0015012 | Ga0495593_0015012_3051_3836 | 261 |
| 988 | 3300047673 | Ga0495593_0057770 | Ga0495593_0057770_776_1561 | 261 |
| 989 | 3300047673 | Ga0495593_0077371 | Ga0495593_0077371_795_1580 | 261 |
| 990 | 3300048088 | Ga0495602_0005453 | Ga0495602_0005453_2119_2904 | 261 |
| 991 | 3300048088 | Ga0495602_0036088 | Ga0495602_0036088_1395_2180 | 261 |
| 992 | 3300048088 | Ga0495602_0067720 | Ga0495602_0067720_1416_2201 | 261 |
| 993 | 3300048088 | Ga0495602_0096917 | Ga0495602_0096917_1154_1939 | 261 |
| 994 | 3300048088 | Ga0495602_0135232 | Ga0495602_0135232_559_1344 | 261 |
| 995 | 3300048088 | Ga0495602_0233404 | Ga0495602_0233404_63_848 | 261 |
| 996 | 3300048088 | Ga0495602_0493724 | Ga0495602_0493724_59_844 | 261 |
| 997 | 3300048089 | Ga0495614_0000451 | Ga0495614_0000451_10831_11616 | 261 |
| 998 | 3300048089 | Ga0495614_0019573 | Ga0495614_0019573_1948_2733 | 261 |
| 999 | 3300048091 | Ga0495626_0017385 | Ga0495626_0017385_102_887 | 261 |
| 1000 | 3300048091 | Ga0495626_0060458 | Ga0495626_0060458_715_1500 | 261 |
| 1001 | 3300048903 | Ga0496100_0016120 | Ga0496100_0016120_1478_2263 | 261 |
| 1002 | 3300048903 | Ga0496100_0024752 | Ga0496100_0024752_2552_3337 | 261 |
| 1003 | 3300048903 | Ga0496100_0111857 | Ga0496100_0111857_895_1680 | 261 |
| 1004 | 3300048904 | Ga0496101_0012888 | Ga0496101_0012888_2703_3488 | 261 |
| 1005 | 3300048904 | Ga0496101_0056916 | Ga0496101_0056916_2017_2802 | 261 |
| 1006 | 3300048904 | Ga0496101_0107050 | Ga0496101_0107050_224_1009 | 261 |
| 1007 | 3300048904 | Ga0496101_0186228 | Ga0496101_0186228_415_1200 | 261 |
| 1008 | 3300048904 | Ga0496101_0359572 | Ga0496101_0359572_19_804 | 261 |
| 1009 | 3300048905 | Ga0496102_0008993 | Ga0496102_0008993_5415_6200 | 261 |
| 1010 | 3300048905 | Ga0496102_0055366 | Ga0496102_0055366_2052_2837 | 261 |
| 1011 | 3300048906 | Ga0496103_0002058 | Ga0496103_0002058_7014_7799 | 261 |
| 1012 | 3300048906 | Ga0496103_0004787 | Ga0496103_0004787_5471_6256 | 261 |
| 1013 | 3300048906 | Ga0496103_0134127 | Ga0496103_0134127_706_1491 | 261 |
| 1014 | 3300048907 | Ga0496104_0090976 | Ga0496104_0090976_368_1153 | 261 |
| 1015 | 3300048907 | Ga0496104_0124176 | Ga0496104_0124176_895_1680 | 261 |
| 1016 | 3300048907 | Ga0496104_0216510 | Ga0496104_0216510_337_1122 | 261 |
| 1017 | 3300048907 | Ga0496104_0543270 | Ga0496104_0543270_116_901 | 261 |
| 1018 | 3300048908 | Ga0496105_0062824 | Ga0496105_0062824_2241_3026 | 261 |
| 1019 | 3300048908 | Ga0496105_0123359 | Ga0496105_0123359_1301_2086 | 261 |
| 1020 | 3300048908 | Ga0496105_0130301 | Ga0496105_0130301_1171_1956 | 261 |
| 1021 | 3300048908 | Ga0496105_0150056 | Ga0496105_0150056_681_1466 | 261 |
| 1022 | 3300048908 | Ga0496105_0334484 | Ga0496105_0334484_129_914 | 261 |
| 1023 | 3300048909 | Ga0496106_0002838 | Ga0496106_0002838_10816_11601 | 261 |
| 1024 | 3300048910 | Ga0496107_0027843 | Ga0496107_0027843_1411_2196 | 261 |
| 1025 | 3300048910 | Ga0496107_0339683 | Ga0496107_0339683_276_1061 | 261 |
| 1026 | 3300048912 | Ga0496109_0393014 | Ga0496109_0393014_307_1092 | 261 |
| 1027 | 3300048914 | Ga0496111_0008723 | Ga0496111_0008723_1060_1845 | 261 |
| 1028 | 3300048916 | Ga0496113_0023434 | Ga0496113_0023434_3086_3871 | 261 |
| 1029 | 3300048917 | Ga0496114_0026363 | Ga0496114_0026363_1559_2344 | 261 |
| 1030 | 3300048918 | Ga0496115_0033943 | Ga0496115_0033943_2163_2948 | 261 |
| 1031 | 3300048918 | Ga0496115_0200891 | Ga0496115_0200891_774_1559 | 261 |
| 1032 | 3300048919 | Ga0496116_0098192 | Ga0496116_0098192_621_1406 | 261 |
| 1033 | 3300048919 | Ga0496116_0133908 | Ga0496116_0133908_508_1293 | 261 |
| 1034 | 3300048919 | Ga0496116_0143858 | Ga0496116_0143858_344_1135 | 261 |
| 1035 | 3300048920 | Ga0496117_0005798 | Ga0496117_0005798_6472_7257 | 261 |
| 1036 | 3300048920 | Ga0496117_0019287 | Ga0496117_0019287_1651_2436 | 261 |
| 1037 | 3300048920 | Ga0496117_0022924 | Ga0496117_0022924_3766_4551 | 261 |
| 1038 | 3300048920 | Ga0496117_0061518 | Ga0496117_0061518_331_1116 | 261 |
| 1039 | 3300048920 | Ga0496117_0085023 | Ga0496117_0085023_1221_2012 | 261 |
| 1040 | 3300048921 | Ga0496118_0002552 | Ga0496118_0002552_16133_16918 | 261 |
| 1041 | 3300048921 | Ga0496118_0012795 | Ga0496118_0012795_2438_3223 | 261 |
| 1042 | 3300048921 | Ga0496118_0022621 | Ga0496118_0022621_2682_3467 | 261 |
| 1043 | 3300048921 | Ga0496118_0098992 | Ga0496118_0098992_650_1435 | 261 |
| 1044 | 3300048921 | Ga0496118_0107393 | Ga0496118_0107393_167_952 | 261 |
| 1045 | 3300048921 | Ga0496118_0122723 | Ga0496118_0122723_702_1487 | 261 |
| 1046 | 3300048921 | Ga0496118_0139404 | Ga0496118_0139404_87_872 | 261 |
| 1047 | 3300048922 | Ga0496119_0086537 | Ga0496119_0086537_143_928 | 261 |
| 1048 | 3300048924 | Ga0496121_0002288 | Ga0496121_0002288_10993_11778 | 261 |
| 1049 | 3300048924 | Ga0496121_0006568 | Ga0496121_0006568_12697_13482 | 261 |
| 1050 | 3300048924 | Ga0496121_0011728 | Ga0496121_0011728_2231_3016 | 261 |
| 1051 | 3300048924 | Ga0496121_0037278 | Ga0496121_0037278_1116_1901 | 261 |
| 1052 | 3300048924 | Ga0496121_0049486 | Ga0496121_0049486_2454_3239 | 261 |
| 1053 | 3300048924 | Ga0496121_0059437 | Ga0496121_0059437_286_1071 | 261 |
| 1054 | 3300048925 | Ga0496122_0065255 | Ga0496122_0065255_63_848 | 261 |
| 1055 | 3300048925 | Ga0496122_0108735 | Ga0496122_0108735_469_1260 | 261 |
| 1056 | 3300048927 | Ga0496124_0136301 | Ga0496124_0136301_1115_1900 | 261 |
| 1057 | 3300048927 | Ga0496124_0373346 | Ga0496124_0373346_14_799 | 261 |
| 1058 | 3300048928 | Ga0496125_0095734 | Ga0496125_0095734_1248_2033 | 261 |
| 1059 | 3300048928 | Ga0496125_0146896 | Ga0496125_0146896_779_1564 | 261 |
| 1060 | 3300048929 | Ga0496126_0000538 | Ga0496126_0000538_33169_33954 | 261 |
| 1061 | 3300048929 | Ga0496126_0002311 | Ga0496126_0002311_9807_10592 | 261 |
| 1062 | 3300048929 | Ga0496126_0008981 | Ga0496126_0008981_7295_8080 | 261 |
| 1063 | 3300048929 | Ga0496126_0084304 | Ga0496126_0084304_809_1594 | 261 |
| 1064 | 3300049459 | Ga0495678_054660 | Ga0495678_054660_155_940 | 261 |
| 1065 | 3300049459 | Ga0495678_059696 | Ga0495678_059696_143_928 | 261 |
| 1066 | 3300049460 | Ga0495682_0051384 | Ga0495682_0051384_405_1190 | 261 |
| 1067 | 3300049460 | Ga0495682_0100826 | Ga0495682_0100826_82_867 | 261 |
| 1068 | iso_pu_bacteria | 2513237083 | 2513565591 | 261 |
| 1069 | iso_pu_bacteria | 2904615490 | 2904623282 | 261 |
| 1070 | iso_pu_bacteria | 8003955200 | 8003961980 | 261 |
| 1071 | iso_pu_bacteria | 8055266321 | 8055269523 | 261 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pw6-assembly1.cif.gz_A-2 | crystal structure of uncharacterized protein jw3007 from escherichia coli k12 | 0.8606 | 3 | 259 |
| 2pw6-assembly1.cif.gz_A-2 | crystal structure of uncharacterized protein jw3007 from escherichia coli k12 | 0.8573 | 3 | 259 |
| 7txy-assembly2.cif.gz_E | crystal structure of the 2-aminophenol 1,6-dioxygenase from the aro bacterial microcompartment of micromonospora rosaria | 0.7831 | 2 | 257 |
| 8iq8-assembly1.cif.gz_D | crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii | 0.7711 | 1 | 261 |
| 8iq8-assembly1.cif.gz_D | crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii | 0.7684 | 1 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MQB9_2_262_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.9543 | 5 | 258 | 3.40.830.10 |
| af_P24197_1_271_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.943 | 2 | 259 | 3.40.830.10 |
| af_P24197_1_271_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.929 | 2 | 259 | 3.40.830.10 |
| af_Q54W77_1_267_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.8834 | 1 | 259 | 3.40.830.10 |
| af_Q54W77_1_267_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.8738 | 1 | 259 | 3.40.830.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A158DJN0-F1-model_v4 | Extradiol ring-cleavage dioxygenase III subunit B | 1.002 | 42 | 261 |
GO:0008198
GO:0008270 GO:0016701 GO:0051213 |
| AF-A0A7Y9WM76-F1-model_v4 | 4,5-DOPA dioxygenase extradiol (EC 1.13.11.-) | 1.001 | 4 | 261 |
GO:0008198
GO:0008270 GO:0016701 GO:0051213 |
| AF-A0A158DJN0-F1-model_v4 | Extradiol ring-cleavage dioxygenase III subunit B | 0.9975 | 42 | 261 |
GO:0008198
GO:0008270 GO:0016701 GO:0051213 |
| AF-A0A7Y9WM76-F1-model_v4 | 4,5-DOPA dioxygenase extradiol (EC 1.13.11.-) | 0.9974 | 4 | 261 |
GO:0008198
GO:0008270 GO:0016701 GO:0051213 |
| AF-A0A3G3LPH2-F1-model_v4 | stizolobate synthase (EC 1.13.11.29) | 0.9858 | 35 | 136 |
GO:0008198
GO:0008270 GO:0050297 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar