F489475

General Info

Members Datasets Scaffolds Average Seq Length
1070 534 998 269

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_002981|Ga0500618_002981_4591_5514
Length 307
Sequence MDTTMRLQDANDAAGVSANIKATGVVDVPNPIPESISGAGQHMTSGLGHIVKPDTIDVSHGPILYLEDVTVSFDGFRALNKLSLSIDDGELRCVIGPNGAGKTTMMDVITGKTRAQEGKVFLGQTLDLRRMDEPSIARAGIGRKFQKPTVFEQHPVWENLELAMKSDKRWFAALRAKLDPASQARIEEVLTTIRLEDAAYRTAGELSHGQKQRLEIGMLLMQQPQLLLLDEPAAGITDDETMELAGLLNSLRGRCSMMVVEHDMDFVAALAGETGRVTVMAEGSVLAEGTLDQVKRDERVIESYLGR

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
5 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
6 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
7 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
8 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
9 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
10 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
11 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
12 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
13 2519103095 Burkholderia sp. KJ006 Isolate Nodule
14 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
15 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
16 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
17 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
18 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
19 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
20 2643221645 Massilia sp. Root351 Isolate Unclassified
21 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
22 2738541297 Duganella sp. GV083 Isolate Unclassified
23 2738541357 Duganella sp. GV053 Isolate Unclassified
24 2738543003 Duganella sp. GV066 Isolate Unclassified
25 2738543013 Variovorax sp. BT01 Isolate Unclassified
26 2738543026 Duganella sp. GV089 Isolate Unclassified
27 2738543029 Duganella sp. GV039 Isolate Unclassified
28 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
29 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
30 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
31 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
32 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
33 2842711865 Duganella sp. R-73148 Isolate Unclassified
34 2842733646 Variovorax sp. R-72446 Isolate Unclassified
35 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
36 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
37 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
38 2857553236 Duganella sp. R-74557 Isolate Unclassified
39 2857558681 Duganella sp. R-74565 Isolate Unclassified
40 2857564685 Duganella sp. R-74599 Isolate Unclassified
41 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
42 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
43 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
44 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
45 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
46 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
47 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
48 2904424332 Duganella sp. 1411 Isolate Rhizosphere
49 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
50 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
51 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
52 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
53 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
54 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
55 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
56 2919476304 Duganella sp. 3397 Isolate Unclassified
57 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
58 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
59 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
60 2928163908 Burkholderia sp. 567 Isolate Unclassified
61 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
62 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
63 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
64 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
65 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
66 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
67 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
68 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
69 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
70 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
71 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
72 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
73 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
74 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
75 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
76 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
77 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
78 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
79 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
80 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
81 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
82 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
83 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
84 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
85 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
86 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
87 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
88 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
89 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
90 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
91 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
92 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
93 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
94 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
95 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
96 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
97 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
98 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
99 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
100 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
101 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
102 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
103 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
104 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
105 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
106 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
107 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
108 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
109 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
110 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
111 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
112 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
113 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
114 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
115 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
116 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
117 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
118 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
119 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
120 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
121 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
122 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
123 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
124 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
125 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
126 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
127 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
128 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
129 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
130 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
131 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
132 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
133 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
134 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
135 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
136 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
137 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
138 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
139 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
140 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
141 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
142 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
143 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
144 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
145 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
146 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
147 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
148 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
149 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
150 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
151 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
152 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
153 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
154 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
155 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
156 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
157 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
158 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
159 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
160 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
161 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
162 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
163 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
164 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
165 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
166 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
167 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
168 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
169 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
170 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
171 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
172 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
173 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
174 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
175 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
176 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
177 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
178 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
179 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
180 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
181 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
182 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
183 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
184 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
185 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
186 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
187 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
188 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
189 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
190 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
191 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
192 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
193 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
194 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
195 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
196 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
197 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
198 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
199 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
200 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
201 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
202 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
203 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
204 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
205 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
206 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
207 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
208 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
209 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
210 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
217 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
218 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
220 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
221 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
222 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
225 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
226 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
227 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
228 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
230 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
231 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
232 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
234 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
235 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
236 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
238 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
239 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
296 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
297 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
301 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
302 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
303 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
304 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
305 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
306 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
307 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
308 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
309 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
310 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
311 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
312 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
313 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
314 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
315 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
316 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
317 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
318 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
319 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
320 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
321 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
322 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
323 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
324 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
325 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
327 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
328 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
329 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
330 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
331 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
332 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
333 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
334 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
335 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
336 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
337 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
338 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
339 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
340 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
341 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
342 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
343 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
344 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
345 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
346 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
347 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
348 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
349 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
350 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
351 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
352 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
353 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
354 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
355 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
356 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
357 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
358 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
359 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
360 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
361 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
362 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
363 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
364 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
365 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
366 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
367 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
368 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
369 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
370 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
371 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
372 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
373 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
374 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
375 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
376 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
377 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
378 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
379 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
380 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
381 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
382 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
383 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
384 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
385 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
386 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
387 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
388 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
389 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
390 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
391 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
392 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
393 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
394 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
395 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
396 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
397 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
398 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
399 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
400 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
401 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
402 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
403 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
404 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
405 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
406 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
407 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
408 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
409 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
410 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
411 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
412 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
413 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
414 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
415 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
416 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
417 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
418 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
419 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
420 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
421 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
422 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
423 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
424 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
425 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
426 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
427 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
428 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
429 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
430 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
431 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
432 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
433 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
434 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
435 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
436 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
437 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
438 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
439 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
440 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
441 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
442 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
443 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
444 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
445 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
446 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
447 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
448 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
449 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
450 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
451 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
452 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
453 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
454 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
455 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
456 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
457 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
458 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
459 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
460 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
461 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
462 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
463 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
464 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
465 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
466 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
467 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
468 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
469 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
470 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
471 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
472 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
473 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
474 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
476 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
479 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
484 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
485 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
486 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
487 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
488 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
489 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
490 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
491 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
492 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
493 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
494 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
495 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
496 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
497 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
499 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
500 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
501 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
502 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
503 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
504 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
505 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
506 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
507 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
508 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
509 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
510 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
511 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
512 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
513 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
514 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
515 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
516 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
517 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
518 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
519 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
520 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
521 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
522 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
523 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
524 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
525 639633007 Azoarcus olearius BH72 Isolate Unclassified
526 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
527 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
528 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
529 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
530 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
531 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
532 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
533 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
534 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.08
Metatranscriptomes 0.19
Isolates 6.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.57
Nodule 1.5
Rhizoplane 2.99
Rhizosphere 68.6
Stem 0
Stem Tuber 0
Unclassified 9.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000096 3300002067 Bacteria 32409
2 JGI25155J39150_1000813 3300002704 Bacteria 4887
3 JGI25156J39149_1001146 3300002705 Bacteria 11872
4 JGI25162J39368_1000036 3300002737 Bacteria 180433
5 JGI25162J39368_1003311 3300002737 Bacteria 4835
6 JGI25154J39366_1001229 3300002738 Bacteria 9652
7 JGI25157J39369_1000796 3300002741 Bacteria 16066
8 JGI25150J39212_1008568 3300002774 Bacteria 1994
9 JGI25159J45721_1000166 3300002987 Bacteria 30609
10 JGI25151J46595_10001128 3300003187 Bacteria 19432
11 JGI25151J46595_10001423 3300003187 Bacteria 16347
12 JGI25151J46595_10022278 3300003187 Bacteria 2633
13 JGI25165J46597_1000022 3300003214 Bacteria 357959
14 rootL2_10010907 3300003322 Bacteria 8662
15 JGI25160J50197_1000352 3300003354 Bacteria 30609
16 JGI25161J50226_1000268 3300003374 Bacteria 30609
17 Ga0055538_1000011 3300003751 Bacteria 357959
18 Ga0055538_1000024 3300003751 Bacteria 241526
19 Ga0055539_1000016 3300003752 Bacteria 358248
20 Ga0055539_1000031 3300003752 Bacteria 241526
21 Ga0055533_1000019 3300003756 Bacteria 357959
22 Ga0055533_1000041 3300003756 Bacteria 241526
23 Ga0055532_1000074 3300003758 Bacteria 125513
24 Ga0055532_1000801 3300003758 Bacteria 10873
25 Ga0055532_1006666 3300003758 Bacteria 1529
26 Ga0055525_1000042 3300003759 Bacteria 279804
27 Ga0055525_1000049 3300003759 Bacteria 241526
28 Ga0055527_1000332 3300003760 Bacteria 25122
29 Ga0055527_1002750 3300003760 Bacteria 2845
30 Ga0055535_1000760 3300003761 Bacteria 23926
31 Ga0055535_1001462 3300003761 Bacteria 11901
32 Ga0055542_1000127 3300003762 Bacteria 100078
33 Ga0055542_1007926 3300003762 Bacteria 2112
34 Ga0055529_1000015 3300003763 Bacteria 366950
35 Ga0055529_1004858 3300003763 Bacteria 2008
36 Ga0055526_1000411 3300003771 Bacteria 34678
37 Ga0055537_1000209 3300003773 Bacteria 43625
38 Ga0055537_1008280 3300003773 Bacteria 2415
39 Ga0055537_1008698 3300003773 Bacteria 2318
40 Ga0055536_1005808 3300003781 Bacteria 5937
41 Ga0055536_1021092 3300003781 Bacteria 1989
42 Ga0055534_1000204 3300003784 Bacteria 43602
43 Ga0055528_1000531 3300003790 Bacteria 29380
44 Ga0055528_1034292 3300003790 Bacteria 1254
45 Ga0055530_10000929 3300003791 Bacteria 24035
46 Ga0055530_10003395 3300003791 Bacteria 9087
47 Ga0055530_10005486 3300003791 Bacteria 6008
48 Ga0055530_10044041 3300003791 Bacteria 1073
49 Ga0055540_1001184 3300003792 Bacteria 16088
50 Ga0055540_1001797 3300003792 Bacteria 12200
51 Ga0055540_1004397 3300003792 Bacteria 6378
52 Ga0055531_10000566 3300003794 Bacteria 32450
53 Ga0055531_10001763 3300003794 Bacteria 15421
54 Ga0055541_1000017 3300003841 Bacteria 286811
55 Ga0055541_1000022 3300003841 Bacteria 241526
56 Ga0055543_1000361 3300004625 Bacteria 30407
57 Ga0055543_1001214 3300004625 Bacteria 10824
58 Ga0065165_1004330 3300005262 Bacteria 8913
59 Ga0065165_1004677 3300005262 Bacteria 8264
60 Ga0065165_1008599 3300005262 Bacteria 4743
61 Ga0065165_1028618 3300005262 Bacteria 1796
62 Ga0065714_10022629 3300005288 Bacteria 1648
63 Ga0065704_10005654 3300005289 Bacteria 3379
64 Ga0070683_100093142 3300005329 Bacteria 2830
65 Ga0070683_100506879 3300005329 Bacteria 1153
66 Ga0070690_100287651 3300005330 Bacteria 1175
67 Ga0070670_100150757 3300005331 Bacteria 2012
68 Ga0070677_10037616 3300005333 Bacteria 1889
69 Ga0068869_100001022 3300005334 Bacteria 16269
70 Ga0068869_100011250 3300005334 Bacteria 5862
71 Ga0070666_10008187 3300005335 Bacteria 6478
72 Ga0070680_100188240 3300005336 Bacteria 1739
73 Ga0070682_100056181 3300005337 Bacteria 2475
74 Ga0068868_100189855 3300005338 Bacteria 1708
75 Ga0068868_100360833 3300005338 Bacteria 1246
76 Ga0070660_100000008 3300005339 Bacteria 155650
77 Ga0070660_100090113 3300005339 Bacteria 2417
78 Ga0070661_100381930 3300005344 Bacteria 1110
79 Ga0070668_100214473 3300005347 Bacteria 1585
80 Ga0070668_100309274 3300005347 Bacteria 1327
81 Ga0070668_100474225 3300005347 Bacteria 1080
82 Ga0070669_100012521 3300005353 Bacteria 6018
83 Ga0070675_100008605 3300005354 Bacteria 7924
84 Ga0070671_100040429 3300005355 Bacteria 3873
85 Ga0070671_100252295 3300005355 Bacteria 1499
86 Ga0070671_100338804 3300005355 Bacteria 1282
87 Ga0070671_100348900 3300005355 Bacteria 1263
88 Ga0070674_100126848 3300005356 Bacteria 1897
89 Ga0070673_100053368 3300005364 Bacteria 3175
90 Ga0070673_100112110 3300005364 Bacteria 2263
91 Ga0070673_100131740 3300005364 Bacteria 2099
92 Ga0070688_100318799 3300005365 Bacteria 1129
93 Ga0070659_100000014 3300005366 Bacteria 178272
94 Ga0070659_100033084 3300005366 Bacteria 4014
95 Ga0070659_100055093 3300005366 Bacteria 3133
96 Ga0070659_100104663 3300005366 Bacteria 2280
97 Ga0070667_100184810 3300005367 Bacteria 1844
98 Ga0070667_100188207 3300005367 Bacteria 1828
99 Ga0070667_100228928 3300005367 Bacteria 1657
100 Ga0070709_10019138 3300005434 Bacteria 3952
101 Ga0070713_100000039 3300005436 Bacteria 83384
102 Ga0070713_100417020 3300005436 Bacteria 1256
103 Ga0070713_100566618 3300005436 Bacteria 1077
104 Ga0070710_10224337 3300005437 Bacteria 1197
105 Ga0070711_100218548 3300005439 Bacteria 1480
106 Ga0070678_100581294 3300005456 Bacteria 998
107 Ga0070662_100021829 3300005457 Bacteria 4375
108 Ga0070681_10118465 3300005458 Bacteria 2584
109 Ga0070698_100025906 3300005471 Bacteria 6109
110 Ga0070679_100040681 3300005530 Bacteria 4625
111 Ga0068853_100025396 3300005539 Bacteria 4969
112 Ga0068853_100354689 3300005539 Bacteria 1365
113 Ga0070672_100011632 3300005543 Bacteria 6141
114 Ga0070672_100096157 3300005543 Bacteria 2396
115 Ga0070696_100554915 3300005546 Bacteria 921
116 Ga0070693_100082994 3300005547 Bacteria 1914
117 Ga0070665_100025091 3300005548 Bacteria 6008
118 Ga0070665_100246022 3300005548 Bacteria 1789
119 Ga0070665_100774911 3300005548 Bacteria 972
120 Ga0068855_100042177 3300005563 Bacteria 5406
121 Ga0068855_100137218 3300005563 Bacteria 2790
122 Ga0068855_100249151 3300005563 Bacteria 1982
123 Ga0068855_100354900 3300005563 Bacteria 1615
124 Ga0070664_100078181 3300005564 Bacteria 2846
125 Ga0068857_100022658 3300005577 Bacteria 5525
126 Ga0068857_100034613 3300005577 Bacteria 4467
127 Ga0068857_100194748 3300005577 Bacteria 1847
128 Ga0068857_100591030 3300005577 Bacteria 1049
129 Ga0068854_100622411 3300005578 Bacteria 924
130 Ga0068856_100054154 3300005614 Bacteria 3957
131 Ga0070702_100057523 3300005615 Bacteria 2250
132 Ga0068852_100001737 3300005616 Bacteria 14834
133 Ga0068852_100167306 3300005616 Bacteria 2058
134 Ga0068859_100082222 3300005617 Bacteria 3263
135 Ga0068859_100146800 3300005617 Bacteria 2434
136 Ga0068864_100007739 3300005618 Bacteria 8853
137 Ga0068866_10290534 3300005718 Bacteria 1017
138 Ga0068861_100002859 3300005719 Bacteria 11364
139 Ga0068861_100231314 3300005719 Bacteria 1568
140 Ga0068851_10024197 3300005834 Bacteria 2972
141 Ga0068851_10031045 3300005834 Bacteria 2652
142 Ga0068870_10230271 3300005840 Bacteria 1139
143 Ga0068863_100036693 3300005841 Bacteria 4669
144 Ga0068863_100127257 3300005841 Bacteria 2431
145 Ga0068863_100165244 3300005841 Bacteria 2122
146 Ga0068863_100291278 3300005841 Bacteria 1582
147 Ga0068858_100056949 3300005842 Bacteria 3612
148 Ga0068858_100188139 3300005842 Bacteria 1951
149 Ga0068860_100238517 3300005843 Bacteria 1768
150 Ga0068862_100017882 3300005844 Bacteria 5902
151 Ga0068862_100022469 3300005844 Bacteria 5276
152 Ga0068862_100112543 3300005844 Bacteria 2391
153 Ga0068862_100783512 3300005844 Bacteria 930
154 Ga0081455_10153169 3300005937 Bacteria 1775
155 Ga0081540_1000032 3300005983 Bacteria 144522
156 Ga0075365_10048131 3300006038 Bacteria 2805
157 Ga0075365_10062701 3300006038 Bacteria 2487
158 Ga0075368_10034956 3300006042 Bacteria 1960
159 Ga0075363_100049349 3300006048 Bacteria 2241
160 Ga0075364_10003171 3300006051 Bacteria 9309
161 Ga0075432_10077550 3300006058 Bacteria 1201
162 Ga0070712_100260309 3300006175 Bacteria 1390
163 Ga0075362_10002819 3300006177 Bacteria 5932
164 Ga0075362_10012593 3300006177 Bacteria 3363
165 Ga0075367_10019309 3300006178 Bacteria 3778
166 Ga0075367_10196528 3300006178 Bacteria 1260
167 Ga0075369_10024329 3300006186 Bacteria 2509
168 Ga0075366_10030457 3300006195 Bacteria 3172
169 Ga0075366_10060205 3300006195 Bacteria 2255
170 Ga0075366_10310309 3300006195 Bacteria 965
171 Ga0097621_100009938 3300006237 Bacteria 6933
172 Ga0097621_100024893 3300006237 Bacteria 4679
173 Ga0097621_100130963 3300006237 Bacteria 2135
174 Ga0075370_10056153 3300006353 Bacteria 2237
175 Ga0075370_10066117 3300006353 Bacteria 2062
176 Ga0068871_100003785 3300006358 Bacteria 10418
177 Ga0068871_100071670 3300006358 Bacteria 2851
178 Ga0075428_100406871 3300006844 Bacteria 1458
179 Ga0075430_100005392 3300006846 Bacteria 10800
180 Ga0075430_100049829 3300006846 Bacteria 3533
181 Ga0075431_100020149 3300006847 Bacteria 6811
182 Ga0075434_100014084 3300006871 Bacteria 7637
183 Ga0068865_100215397 3300006881 Bacteria 1499
184 Ga0068865_100461839 3300006881 Bacteria 1052
185 Ga0097620_100082225 3300006931 Bacteria 3263
186 Ga0097620_100146805 3300006931 Bacteria 2434
187 Ga0079104_1005965 3300006946 Bacteria 4724
188 Ga0079104_1021330 3300006946 Bacteria 1766
189 Ga0079104_1040558 3300006946 Bacteria 1089
190 Ga0099826_10000004 3300006948 Bacteria 802669
191 Ga0099826_10003943 3300006948 Bacteria 10263
192 Ga0075435_100099622 3300007076 Bacteria 2407
193 Ga0099795_10017173 3300007788 Bacteria 2303
194 Ga0105251_10012206 3300009011 Bacteria 4874
195 Ga0105251_10162159 3300009011 Bacteria 1008
196 Ga0105244_10003810 3300009036 Bacteria 10640
197 Ga0105244_10029659 3300009036 Bacteria 2920
198 Ga0105244_10071206 3300009036 Bacteria 1734
199 Ga0105244_10171220 3300009036 Bacteria 1033
200 Ga0105240_10016169 3300009093 Bacteria 10112
201 Ga0105240_10095751 3300009093 Bacteria 3619
202 Ga0105240_10110333 3300009093 Bacteria 3330
203 Ga0105240_10307314 3300009093 Bacteria 1812
204 Ga0105240_10313783 3300009093 Bacteria 1789
205 Ga0105240_10319900 3300009093 Bacteria 1769
206 Ga0105240_10343084 3300009093 Bacteria 1696
207 Ga0111539_10053706 3300009094 Bacteria 4796
208 Ga0111539_10302127 3300009094 Bacteria 1863
209 Ga0111539_10621460 3300009094 Bacteria 1258
210 Ga0105245_10002213 3300009098 Bacteria 17601
211 Ga0105245_10085324 3300009098 Bacteria 2894
212 Ga0105245_10145723 3300009098 Bacteria 2234
213 Ga0105245_10285321 3300009098 Bacteria 1615
214 Ga0114129_10016867 3300009147 Bacteria 10398
215 Ga0114129_10372132 3300009147 Bacteria 1888
216 Ga0105243_10004131 3300009148 Bacteria 11546
217 Ga0105243_10019383 3300009148 Bacteria 5158
218 Ga0105241_10083754 3300009174 Bacteria 2502
219 Ga0105242_10086337 3300009176 Bacteria 2633
220 Ga0105242_10381003 3300009176 Bacteria 1311
221 Ga0105248_10009668 3300009177 Bacteria 10623
222 Ga0105248_10021120 3300009177 Bacteria 7215
223 Ga0105248_10178802 3300009177 Bacteria 2391
224 Ga0105248_10327176 3300009177 Bacteria 1726
225 Ga0105248_10408393 3300009177 Bacteria 1529
226 Ga0105237_10010158 3300009545 Bacteria 10032
227 Ga0105237_10049330 3300009545 Bacteria 4232
228 Ga0105237_10075212 3300009545 Bacteria 3369
229 Ga0105237_10165516 3300009545 Bacteria 2210
230 Ga0105237_10239013 3300009545 Bacteria 1817
231 Ga0105237_10333826 3300009545 Bacteria 1520
232 Ga0105238_10000107 3300009551 Bacteria 91765
233 Ga0105238_10018714 3300009551 Bacteria 7054
234 Ga0105238_10076514 3300009551 Bacteria 3338
235 Ga0105238_10165334 3300009551 Bacteria 2188
236 Ga0105249_10402713 3300009553 Bacteria 1399
237 Ga0105249_10687517 3300009553 Bacteria 1082
238 Ga0105239_10001202 3300010375 Bacteria 35405
239 Ga0105239_10038533 3300010375 Bacteria 5238
240 Ga0105239_10181094 3300010375 Bacteria 2358
241 Ga0105239_10254137 3300010375 Bacteria 1974
242 Ga0105239_10286758 3300010375 Bacteria 1854
243 Ga0105239_10319843 3300010375 Bacteria 1750
244 Ga0105239_10434352 3300010375 Bacteria 1488
245 Ga0105246_10084927 3300011119 Bacteria 2266
246 Ga0105246_10147303 3300011119 Bacteria 1778
247 Ga0157347_1005273 3300012502 Bacteria 1231
248 Ga0157373_10048268 3300013100 Bacteria 3035
249 Ga0157371_10482293 3300013102 Bacteria 914
250 Ga0157370_10001210 3300013104 Bacteria 32282
251 Ga0157369_10105708 3300013105 Bacteria 2996
252 Ga0157369_10136063 3300013105 Bacteria 2601
253 Ga0157369_10231310 3300013105 Bacteria 1933
254 Ga0157369_10331675 3300013105 Bacteria 1581
255 Ga0157369_10420836 3300013105 Bacteria 1385
256 Ga0157378_10400448 3300013297 Bacteria 1352
257 Ga0163162_10003435 3300013306 Bacteria 15121
258 Ga0163162_10098476 3300013306 Bacteria 3013
259 Ga0163162_10489793 3300013306 Bacteria 1361
260 Ga0157372_10120514 3300013307 Bacteria 3012
261 Ga0157372_10409925 3300013307 Bacteria 1579
262 Ga0157375_10044984 3300013308 Bacteria 4295
263 Ga0157375_10127589 3300013308 Bacteria 2660
264 Ga0157380_10033626 3300014326 Bacteria 3949
265 Ga0182008_10003552 3300014497 Bacteria 9360
266 Ga0182008_10016132 3300014497 Bacteria 3885
267 Ga0182008_10038719 3300014497 Bacteria 2384
268 Ga0182008_10049109 3300014497 Bacteria 2094
269 Ga0182008_10121734 3300014497 Bacteria 1297
270 Ga0157379_10063212 3300014968 Bacteria 3310
271 Ga0157376_10008428 3300014969 Bacteria 7438
272 Ga0157376_10017098 3300014969 Bacteria 5525
273 Ga0157376_10032848 3300014969 Bacteria 4171
274 Ga0182006_1000231 3300015261 Bacteria 52984
275 Ga0182006_1013901 3300015261 Bacteria 3479
276 Ga0182006_1041366 3300015261 Bacteria 1810
277 Ga0182007_10008818 3300015262 Bacteria 4113
278 Ga0182007_10046516 3300015262 Bacteria 1437
279 Ga0182005_1000037 3300015265 Bacteria 166102
280 Ga0182005_1005071 3300015265 Bacteria 4155
281 Ga0183362_10003 3300015683 Bacteria 977584
282 Ga0163161_10000118 3300017792 Bacteria 75123
283 Ga0163161_10026761 3300017792 Bacteria 4088
284 Ga0163161_10449467 3300017792 Bacteria 1041
285 Ga0213872_10095751 3300021361 Bacteria 1326
286 Ga0213871_10011521 3300021441 Bacteria 2033
287 Ga0209435_100094 3300025206 Bacteria 39577
288 Ga0209784_100018 3300025224 Bacteria 456816
289 Ga0209784_100019 3300025224 Bacteria 453558
290 Ga0209566_100016 3300025225 Bacteria 456824
291 Ga0209566_100017 3300025225 Bacteria 453558
292 Ga0209674_100030 3300025226 Bacteria 456824
293 Ga0209674_100031 3300025226 Bacteria 453558
294 Ga0209672_100083 3300025228 Bacteria 135473
295 Ga0209672_102400 3300025228 Bacteria 4643
296 Ga0209147_100097 3300025229 Bacteria 164034
297 Ga0209147_100244 3300025229 Bacteria 53002
298 Ga0209147_101037 3300025229 Bacteria 11826
299 Ga0209563_100034 3300025230 Bacteria 456824
300 Ga0209563_100035 3300025230 Bacteria 453558
301 Ga0207427_100315 3300025231 Bacteria 32969
302 Ga0209437_100038 3300025233 Bacteria 453558
303 Ga0209437_100372 3300025233 Bacteria 45954
304 Ga0209437_108698 3300025233 Bacteria 1614
305 Ga0209437_117772 3300025233 Bacteria 927
306 Ga0209258_100078 3300025242 Bacteria 263996
307 Ga0209258_100192 3300025242 Bacteria 125565
308 Ga0209258_100405 3300025242 Bacteria 53002
309 Ga0207425_1000455 3300025245 Bacteria 26503
310 Ga0207425_1000952 3300025245 Bacteria 13673
311 Ga0209646_1000051 3300025246 Bacteria 296525
312 Ga0209646_1000103 3300025246 Bacteria 164034
313 Ga0209646_1013337 3300025246 Bacteria 1251
314 Ga0209026_1001208 3300025250 Bacteria 11962
315 Ga0209677_100019 3300025253 Bacteria 456824
316 Ga0209677_100020 3300025253 Bacteria 453558
317 Ga0209148_1000086 3300025254 Bacteria 263996
318 Ga0209148_1002102 3300025254 Bacteria 7539
319 Ga0209759_1000091 3300025256 Bacteria 164034
320 Ga0209759_1003935 3300025256 Bacteria 5717
321 Ga0209129_1000116 3300025258 Bacteria 140716
322 Ga0209129_1000830 3300025258 Bacteria 19469
323 Ga0209129_1007819 3300025258 Bacteria 3093
324 Ga0209129_1019257 3300025258 Bacteria 1293
325 Ga0209233_1000049 3300025261 Bacteria 453558
326 Ga0209565_1000067 3300025263 Bacteria 171247
327 Ga0209565_1000133 3300025263 Bacteria 104054
328 Ga0209565_1005683 3300025263 Bacteria 3599
329 Ga0209565_1012255 3300025263 Bacteria 2053
330 Ga0209455_1000031 3300025272 Bacteria 519952
331 Ga0209455_1001485 3300025272 Bacteria 10503
332 Ga0209455_1006271 3300025272 Bacteria 3537
333 Ga0209673_1000190 3300025273 Bacteria 123411
334 Ga0209673_1000813 3300025273 Bacteria 41247
335 Ga0209673_1002954 3300025273 Bacteria 10655
336 Ga0209673_1005012 3300025273 Bacteria 6843
337 Ga0209673_1012551 3300025273 Bacteria 3406
338 Ga0209673_1028546 3300025273 Bacteria 1793
339 Ga0209673_1046401 3300025273 Bacteria 1186
340 Ga0209130_1000202 3300025284 Bacteria 80333
341 Ga0209130_1001910 3300025284 Bacteria 11746
342 Ga0209130_1005820 3300025284 Bacteria 4165
343 Ga0209130_1008843 3300025284 Bacteria 2930
344 Ga0209675_1000038 3300025291 Bacteria 250481
345 Ga0209675_1004428 3300025291 Bacteria 6245
346 Ga0209675_1006283 3300025291 Bacteria 4798
347 Ga0209675_1007038 3300025291 Bacteria 4386
348 Ga0209675_1009003 3300025291 Bacteria 3582
349 Ga0209675_1015821 3300025291 Bacteria 2223
350 Ga0209675_1035674 3300025291 Bacteria 1132
351 Ga0209676_1000125 3300025292 Bacteria 191565
352 Ga0209676_1001114 3300025292 Bacteria 29761
353 Ga0209676_1019055 3300025292 Bacteria 2372
354 Ga0209025_1000769 3300025294 Bacteria 53174
355 Ga0209025_1000811 3300025294 Bacteria 50182
356 Ga0209025_1001608 3300025294 Bacteria 28307
357 Ga0209025_1002825 3300025294 Bacteria 17474
358 Ga0209025_1002969 3300025294 Bacteria 16837
359 Ga0209025_1012056 3300025294 Bacteria 5599
360 Ga0209025_1014639 3300025294 Bacteria 4802
361 Ga0209025_1065058 3300025294 Bacteria 1334
362 Ga0209564_1000011 3300025295 Bacteria 822327
363 Ga0209564_1002219 3300025295 Bacteria 16157
364 Ga0209564_1002684 3300025295 Bacteria 13489
365 Ga0209564_1009762 3300025295 Bacteria 4515
366 Ga0209758_1000034 3300025297 Bacteria 467637
367 Ga0209758_1000286 3300025297 Bacteria 99636
368 Ga0209758_1013003 3300025297 Bacteria 4591
369 Ga0209050_1000012 3300025298 Bacteria 813717
370 Ga0209050_1001325 3300025298 Bacteria 27578
371 Ga0209050_1004979 3300025298 Bacteria 8645
372 Ga0209050_1007763 3300025298 Bacteria 5914
373 Ga0209256_1000066 3300025299 Bacteria 247534
374 Ga0209256_1000270 3300025299 Bacteria 90996
375 Ga0209256_1000726 3300025299 Bacteria 43520
376 Ga0209256_1026104 3300025299 Bacteria 1689
377 Ga0207426_1000067 3300025302 Bacteria 342108
378 Ga0207426_1000145 3300025302 Bacteria 191065
379 Ga0207426_1002489 3300025302 Bacteria 11681
380 Ga0207426_1012223 3300025302 Bacteria 3234
381 Ga0209051_1000134 3300025303 Bacteria 138380
382 Ga0209051_1000388 3300025303 Bacteria 62011
383 Ga0209051_1000991 3300025303 Bacteria 27413
384 Ga0209051_1001829 3300025303 Bacteria 16828
385 Ga0209051_1010900 3300025303 Bacteria 4539
386 Ga0209051_1012848 3300025303 Bacteria 4026
387 Ga0209257_1000022 3300025304 Bacteria 765258
388 Ga0209257_1000024 3300025304 Bacteria 726068
389 Ga0209257_1001367 3300025304 Bacteria 29437
390 Ga0207656_10006731 3300025321 Bacteria 4153
391 Ga0207656_10045081 3300025321 Bacteria 1886
392 Ga0207656_10103733 3300025321 Bacteria 1306
393 Ga0207655_1025647 3300025728 Bacteria 2855
394 Ga0207655_1062846 3300025728 Bacteria 1426
395 Ga0207713_1012892 3300025735 Bacteria 4437
396 Ga0207682_10038204 3300025893 Bacteria 1947
397 Ga0207692_10068585 3300025898 Bacteria 1860
398 Ga0207642_10215147 3300025899 Bacteria 1070
399 Ga0207680_10002625 3300025903 Bacteria 8394
400 Ga0207647_10006741 3300025904 Bacteria 8340
401 Ga0207647_10013565 3300025904 Bacteria 5642
402 Ga0207699_10080349 3300025906 Bacteria 2020
403 Ga0207645_10021161 3300025907 Bacteria 4245
404 Ga0207705_10004503 3300025909 Bacteria 10528
405 Ga0207705_10076640 3300025909 Bacteria 2431
406 Ga0207684_10091257 3300025910 Bacteria 2596
407 Ga0207654_10046374 3300025911 Bacteria 2478
408 Ga0207654_10178580 3300025911 Bacteria 1384
409 Ga0207707_10524161 3300025912 Bacteria 1009
410 Ga0207695_10001362 3300025913 Bacteria 41437
411 Ga0207695_10009442 3300025913 Bacteria 12064
412 Ga0207695_10014244 3300025913 Bacteria 9432
413 Ga0207695_10135148 3300025913 Bacteria 2420
414 Ga0207695_10164918 3300025913 Bacteria 2144
415 Ga0207695_10217866 3300025913 Bacteria 1817
416 Ga0207695_10234924 3300025913 Bacteria 1736
417 Ga0207671_10001336 3300025914 Bacteria 28835
418 Ga0207671_10024297 3300025914 Bacteria 4559
419 Ga0207671_10047846 3300025914 Bacteria 3165
420 Ga0207671_10082299 3300025914 Bacteria 2415
421 Ga0207671_10098691 3300025914 Bacteria 2209
422 Ga0207671_10269697 3300025914 Bacteria 1341
423 Ga0207693_10234326 3300025915 Bacteria 1442
424 Ga0207657_10000018 3300025919 Bacteria 172140
425 Ga0207657_10022908 3300025919 Bacteria 5828
426 Ga0207649_10261078 3300025920 Bacteria 1251
427 Ga0207652_10122862 3300025921 Bacteria 2311
428 Ga0207652_10155238 3300025921 Bacteria 2050
429 Ga0207646_10049764 3300025922 Bacteria 3752
430 Ga0207681_10088404 3300025923 Bacteria 2207
431 Ga0207694_10000130 3300025924 Bacteria 77624
432 Ga0207694_10045075 3300025924 Bacteria 3406
433 Ga0207694_10421926 3300025924 Bacteria 1111
434 Ga0207659_10165511 3300025926 Bacteria 1740
435 Ga0207659_10192180 3300025926 Bacteria 1625
436 Ga0207659_10353556 3300025926 Bacteria 1220
437 Ga0207687_10142411 3300025927 Bacteria 1820
438 Ga0207700_10000082 3300025928 Bacteria 58939
439 Ga0207700_10051865 3300025928 Bacteria 3064
440 Ga0207644_10025628 3300025931 Bacteria 4056
441 Ga0207690_10000006 3300025932 Bacteria 433880
442 Ga0207690_10420557 3300025932 Bacteria 1069
443 Ga0207706_10000892 3300025933 Bacteria 30643
444 Ga0207706_10192847 3300025933 Bacteria 1788
445 Ga0207709_10001889 3300025935 Bacteria 13830
446 Ga0207709_10027454 3300025935 Bacteria 3280
447 Ga0207670_10100241 3300025936 Bacteria 2067
448 Ga0207669_10077219 3300025937 Bacteria 2117
449 Ga0207704_10135171 3300025938 Bacteria 1715
450 Ga0207691_10022198 3300025940 Bacteria 5987
451 Ga0207691_10204250 3300025940 Bacteria 1718
452 Ga0207711_10031413 3300025941 Bacteria 4482
453 Ga0207711_10153394 3300025941 Bacteria 2080
454 Ga0207711_10176446 3300025941 Bacteria 1941
455 Ga0207689_10000393 3300025942 Bacteria 41140
456 Ga0207689_10004760 3300025942 Bacteria 12243
457 Ga0207661_10063210 3300025944 Bacteria 2997
458 Ga0207679_10120278 3300025945 Bacteria 2089
459 Ga0207679_10194028 3300025945 Bacteria 1691
460 Ga0207667_10002863 3300025949 Bacteria 21405
461 Ga0207667_10004521 3300025949 Bacteria 17039
462 Ga0207667_10035111 3300025949 Bacteria 5380
463 Ga0207667_10103988 3300025949 Bacteria 2929
464 Ga0207667_10190569 3300025949 Bacteria 2104
465 Ga0207651_10040769 3300025960 Bacteria 3076
466 Ga0207651_10048141 3300025960 Bacteria 2880
467 Ga0207651_10084821 3300025960 Bacteria 2296
468 Ga0207651_10099224 3300025960 Bacteria 2156
469 Ga0207712_10189254 3300025961 Bacteria 1623
470 Ga0207668_10004274 3300025972 Bacteria 8376
471 Ga0207668_10118695 3300025972 Bacteria 1999
472 Ga0207668_10337266 3300025972 Bacteria 1256
473 Ga0207668_10367426 3300025972 Bacteria 1207
474 Ga0207640_10008616 3300025981 Bacteria 5668
475 Ga0207640_10141902 3300025981 Bacteria 1752
476 Ga0207658_10110774 3300025986 Bacteria 2170
477 Ga0207677_10004381 3300026023 Bacteria 7564
478 Ga0207677_10466367 3300026023 Bacteria 1085
479 Ga0207703_10051154 3300026035 Bacteria 3347
480 Ga0207703_10101296 3300026035 Bacteria 2442
481 Ga0207703_10328392 3300026035 Bacteria 1402
482 Ga0207639_10041283 3300026041 Bacteria 3450
483 Ga0207639_10338404 3300026041 Bacteria 1341
484 Ga0207678_10019804 3300026067 Bacteria 5917
485 Ga0207678_10152990 3300026067 Bacteria 1970
486 Ga0207702_10038205 3300026078 Bacteria 4021
487 Ga0207702_10151144 3300026078 Bacteria 2112
488 Ga0207641_10009992 3300026088 Bacteria 7810
489 Ga0207641_10038171 3300026088 Bacteria 4014
490 Ga0207641_10065097 3300026088 Bacteria 3117
491 Ga0207641_10119125 3300026088 Bacteria 2353
492 Ga0207641_10632051 3300026088 Bacteria 1050
493 Ga0207674_10078055 3300026116 Bacteria 3317
494 Ga0207674_10206403 3300026116 Bacteria 1914
495 Ga0207674_10212886 3300026116 Bacteria 1881
496 Ga0207675_100009503 3300026118 Bacteria 9100
497 Ga0207675_100041541 3300026118 Bacteria 4295
498 Ga0207675_100047608 3300026118 Bacteria 4002
499 Ga0207683_10123968 3300026121 Bacteria 2321
500 Ga0207683_10242392 3300026121 Bacteria 1644
501 Ga0207683_10494145 3300026121 Bacteria 1130
502 Ga0207698_10001988 3300026142 Bacteria 12027
503 Ga0207698_10106897 3300026142 Bacteria 2335
504 Ga0209281_1022964 3300027111 Bacteria 1189
505 Ga0209282_1000015 3300027666 Bacteria 206531
506 Ga0209282_1015645 3300027666 Bacteria 4828
507 Ga0268266_10005293 3300028379 Bacteria 12110
508 Ga0268266_10254787 3300028379 Bacteria 1624
509 Ga0268266_10259595 3300028379 Bacteria 1610
510 Ga0268266_10308091 3300028379 Bacteria 1479
511 Ga0268265_10071330 3300028380 Bacteria 2705
512 Ga0268265_10618361 3300028380 Bacteria 1037
513 Ga0268264_10021658 3300028381 Bacteria 5248
514 Ga0307515_10013446 3300028794 Bacteria 15298
515 Ga0307515_10107895 3300028794 Bacteria 3286
516 Ga0265338_10000057 3300028800 Bacteria 200477
517 Ga0307511_10001004 3300030521 Bacteria 30016
518 Ga0314311_1168092 3300030733 Bacteria 3560
519 Ga0265340_10034005 3300031247 Bacteria 2536
520 Ga0265327_10001504 3300031251 Bacteria 28880
521 Ga0265327_10007858 3300031251 Bacteria 8112
522 Ga0265327_10014466 3300031251 Bacteria 5159
523 Ga0265327_10111907 3300031251 Bacteria 1303
524 Ga0265316_10151084 3300031344 Bacteria 1740
525 Ga0307513_10000004 3300031456 Bacteria 558931
526 Ga0307513_10000549 3300031456 Bacteria 53746
527 Ga0307408_100000425 3300031548 Bacteria 37508
528 Ga0307408_100000521 3300031548 Bacteria 33246
529 Ga0307408_100010654 3300031548 Bacteria 6063
530 Ga0307408_100087374 3300031548 Bacteria 2345
531 Ga0307514_10072345 3300031649 Bacteria 2582
532 Ga0316575_10000019 3300031665 Bacteria 42637
533 Ga0316575_10023424 3300031665 Bacteria 2387
534 Ga0316579_10056447 3300031691 Bacteria 1843
535 Ga0316579_10059174 3300031691 Bacteria 1801
536 Ga0265314_10058736 3300031711 Bacteria 2635
537 Ga0316576_10182334 3300031727 Bacteria 1583
538 Ga0316578_10003864 3300031728 Bacteria 6956
539 Ga0316578_10008771 3300031728 Bacteria 5165
540 Ga0316578_10016759 3300031728 Bacteria 3973
541 Ga0307405_10053326 3300031731 Bacteria 2518
542 Ga0316577_10031426 3300031733 Bacteria 2966
543 Ga0316577_10120463 3300031733 Bacteria 1474
544 Ga0307410_10165527 3300031852 Bacteria 1661
545 Ga0307406_10002492 3300031901 Bacteria 10032
546 Ga0307406_10006980 3300031901 Bacteria 6253
547 Ga0307412_10470811 3300031911 Bacteria 1039
548 Ga0307414_10162842 3300032004 Bacteria 1774
549 Ga0307414_10194131 3300032004 Bacteria 1645
550 Ga0307411_10350680 3300032005 Bacteria 1203
551 Ga0316583_10007052 3300032133 Bacteria 4043
552 Ga0316583_10024330 3300032133 Bacteria 2163
553 Ga0316585_10009490 3300032137 Bacteria 2841
554 Ga0316585_10085674 3300032137 Bacteria 1028
555 Ga0316580_10011290 3300032139 Bacteria 2709
556 Ga0316580_10013716 3300032139 Bacteria 2469
557 Ga0316593_10003759 3300032168 Bacteria 3814
558 Ga0316593_10009070 3300032168 Bacteria 2796
559 Ga0373939_0077781 3300035114 Bacteria 1095
560 Ga0373962_0020529 3300035242 Bacteria 1736
561 Ga0316574_0005050 3300035398 Bacteria 7008
562 Ga0316574_0009706 3300035398 Bacteria 5405
563 Ga0373931_0003777 3300035691 Bacteria 6851
564 Ga0373935_0119168 3300035692 Bacteria 1761
565 Ga0373935_0175318 3300035692 Bacteria 1469
566 Ga0373927_0133664 3300035695 Bacteria 1621
567 Ga0373937_0206448 3300036401 Bacteria 1848
568 Ga0316582_0027041 3300036647 Bacteria 3460
569 Ga0316584_0065584 3300036712 Bacteria 2720
570 Ga0373925_0013472 3300037068 Bacteria 5918
571 Ga0373925_0054709 3300037068 Bacteria 2986
572 Ga0373925_0167723 3300037068 Bacteria 1732
573 Ga0395899_0000008 3300037312 Bacteria 567572
574 Ga0395899_0000637 3300037312 Bacteria 36229
575 Ga0395899_0002108 3300037312 Bacteria 16341
576 Ga0395899_0019864 3300037312 Bacteria 5098
577 Ga0395899_0039931 3300037312 Bacteria 3511
578 Ga0395899_0048495 3300037312 Bacteria 3160
579 Ga0395899_0079830 3300037312 Bacteria 2382
580 Ga0395900_0000252 3300037418 Bacteria 83358
581 Ga0395900_0000273 3300037418 Bacteria 78527
582 Ga0395900_0001610 3300037418 Bacteria 26610
583 Ga0395900_0008082 3300037418 Bacteria 10830
584 Ga0395900_0024372 3300037418 Bacteria 6196
585 Ga0395900_0073562 3300037418 Bacteria 3514
586 Ga0395900_0177755 3300037418 Bacteria 2164
587 Ga0395900_0217281 3300037418 Bacteria 1928
588 Ga0395900_0222095 3300037418 Bacteria 1904
589 Ga0395900_0314768 3300037418 Bacteria 1547
590 Ga0395898_0000072 3300037466 Bacteria 249505
591 Ga0395898_0004624 3300037466 Bacteria 15023
592 Ga0395898_0314771 3300037466 Bacteria 1493
593 Ga0395898_0330480 3300037466 Bacteria 1453
594 Ga0395905_0000600 3300037471 Bacteria 48145
595 Ga0395905_0084816 3300037471 Bacteria 2968
596 Ga0395905_0118838 3300037471 Bacteria 2484
597 Ga0395905_0134292 3300037471 Bacteria 2327
598 Ga0395905_0250215 3300037471 Bacteria 1655
599 Ga0395905_0286976 3300037471 Bacteria 1532
600 Ga0436364_0445393 3300037853 Bacteria 1837
601 Ga0395901_0000963 3300038443 Bacteria 31334
602 Ga0395901_0003504 3300038443 Bacteria 15808
603 Ga0395901_0023068 3300038443 Bacteria 6378
604 Ga0395901_0106032 3300038443 Bacteria 2949
605 Ga0395901_0433124 3300038443 Bacteria 1347
606 Ga0436365_0998154 3300039437 Bacteria 1221
607 Ga0436360_0627319 3300039438 Bacteria 3961
608 Ga0436361_0597437 3300039447 Bacteria 3065
609 Ga0436363_1260698 3300039450 Bacteria 11308
610 Ga0436362_0178065 3300039453 Bacteria 1992
611 Ga0439466_0026806 3300041411 Bacteria 2000
612 Ga0451797_0514870 3300041453 Bacteria 1082
613 Ga0439431_0015246 3300041997 Bacteria 1787
614 Ga0439442_011867 3300042002 Bacteria 1778
615 Ga0439448_0014554 3300042005 Bacteria 2374
616 Ga0439432_002972 3300042006 Bacteria 6315
617 Ga0439449_0049113 3300042007 Bacteria 1561
618 Ga0439450_019338 3300042008 Bacteria 1442
619 Ga0439457_013461 3300042014 Bacteria 1839
620 Ga0439462_0005441 3300042015 Bacteria 3139
621 Ga0450921_000720 3300042123 Bacteria 1717
622 Ga0450918_005739 3300042531 Bacteria 2220
623 Ga0451577_0000142 3300042876 Bacteria 160598
624 Ga0451577_0000479 3300042876 Bacteria 68148
625 Ga0451577_0012374 3300042876 Bacteria 8012
626 Ga0466969_0025226 3300044656 Bacteria 3058
627 Ga0466969_0029612 3300044656 Bacteria 2795
628 Ga0466972_0000070 3300044658 Bacteria 100242
629 Ga0453683_0034446 3300044673 Bacteria 3192
630 Ga0466965_0017310 3300044683 Bacteria 3443
631 Ga0466965_0082097 3300044683 Bacteria 1630
632 Ga0466966_0000008 3300044684 Bacteria 155597
633 Ga0466966_0000712 3300044684 Bacteria 21100
634 Ga0466966_0026979 3300044684 Bacteria 3746
635 Ga0466966_0131208 3300044684 Bacteria 1534
636 Ga0466961_0000845 3300044693 Bacteria 19158
637 Ga0466961_0006638 3300044693 Bacteria 7359
638 Ga0466964_0000224 3300044706 Bacteria 16209
639 Ga0466964_0046016 3300044706 Bacteria 1777
640 Ga0453684_0000126 3300044712 Bacteria 336395
641 Ga0453684_0002411 3300044712 Bacteria 45566
642 Ga0453684_0028832 3300044712 Bacteria 7902
643 Ga0453684_0056585 3300044712 Bacteria 5086
644 Ga0466971_0016897 3300044719 Bacteria 3224
645 Ga0466968_0005916 3300044735 Bacteria 4589
646 Ga0466970_0223719 3300044765 Bacteria 1051
647 Ga0466957_0002849 3300044842 Bacteria 9355
648 Ga0466957_0015317 3300044842 Bacteria 4479
649 Ga0466957_0020426 3300044842 Bacteria 3897
650 Ga0466957_0080072 3300044842 Bacteria 2033
651 Ga0466960_0132986 3300044901 Bacteria 1315
652 Ga0466959_0008703 3300045049 Bacteria 7186
653 Ga0466959_0020254 3300045049 Bacteria 4898
654 Ga0451576_0041903 3300045051 Bacteria 4837
655 Ga0451576_0074358 3300045051 Bacteria 3536
656 Ga0451576_0351790 3300045051 Bacteria 1542
657 Ga0451576_0437782 3300045051 Bacteria 1372
658 Ga0466958_0002090 3300045836 Bacteria 9888
659 Ga0466958_0003846 3300045836 Bacteria 7850
660 Ga0495617_000096 3300046452 Bacteria 62625
661 Ga0495627_000059 3300046453 Bacteria 142466
662 Ga0495603_0010749 3300046455 Bacteria 5552
663 Ga0495590_0000002 3300046457 Bacteria 485720
664 Ga0495590_0002012 3300046457 Bacteria 8549
665 Ga0495590_0021765 3300046457 Bacteria 2271
666 Ga0495590_0046800 3300046457 Bacteria 1509
667 Ga0495629_0000692 3300046459 Bacteria 27301
668 Ga0495629_0135803 3300046459 Bacteria 1712
669 Ga0495629_0226796 3300046459 Bacteria 1288
670 Ga0495638_0000367 3300046460 Bacteria 55964
671 Ga0495638_0015361 3300046460 Bacteria 5144
672 Ga0495651_0010800 3300046462 Bacteria 7020
673 Ga0495651_0183498 3300046462 Bacteria 1479
674 Ga0495650_0000019 3300046471 Bacteria 533849
675 Ga0495650_0000276 3300046471 Bacteria 98048
676 Ga0495650_0000530 3300046471 Bacteria 55501
677 Ga0495650_0001558 3300046471 Bacteria 21622
678 Ga0495650_0003997 3300046471 Bacteria 10352
679 Ga0495650_0006041 3300046471 Bacteria 7651
680 Ga0495650_0034111 3300046471 Bacteria 2257
681 Ga0495650_0054316 3300046471 Bacteria 1635
682 Ga0495650_0084299 3300046471 Bacteria 1220
683 Ga0495580_0028776 3300046472 Bacteria 4037
684 Ga0495582_0010500 3300046473 Bacteria 5094
685 Ga0495582_0071794 3300046473 Bacteria 1915
686 Ga0495605_0000023 3300046474 Bacteria 236732
687 Ga0495605_0000063 3300046474 Bacteria 140789
688 Ga0495605_0005172 3300046474 Bacteria 7600
689 Ga0495605_0084818 3300046474 Bacteria 1476
690 Ga0495639_0033278 3300046475 Bacteria 2302
691 Ga0495639_0073336 3300046475 Bacteria 1584
692 Ga0495584_0000788 3300046491 Bacteria 20907
693 Ga0495584_0012628 3300046491 Bacteria 4312
694 Ga0495585_0002085 3300046492 Bacteria 14641
695 Ga0495596_0006610 3300046500 Bacteria 5320
696 Ga0495596_0009131 3300046500 Bacteria 4374
697 Ga0495607_0000300 3300046501 Bacteria 51872
698 Ga0495607_0004194 3300046501 Bacteria 10702
699 Ga0495607_0007716 3300046501 Bacteria 7408
700 Ga0495607_0029177 3300046501 Bacteria 3397
701 Ga0495607_0039243 3300046501 Bacteria 2828
702 Ga0495607_0096620 3300046501 Bacteria 1590
703 Ga0495583_0000404 3300046506 Bacteria 65523
704 Ga0495583_0001717 3300046506 Bacteria 21041
705 Ga0495583_0038678 3300046506 Bacteria 2253
706 Ga0495606_0000001 3300046507 Bacteria 592123
707 Ga0495606_0000089 3300046507 Bacteria 154743
708 Ga0495606_0000526 3300046507 Bacteria 61953
709 Ga0495606_0002377 3300046507 Bacteria 22071
710 Ga0495606_0003493 3300046507 Bacteria 16645
711 Ga0495606_0005324 3300046507 Bacteria 12372
712 Ga0495606_0005973 3300046507 Bacteria 11420
713 Ga0495606_0015771 3300046507 Bacteria 5801
714 Ga0495606_0016928 3300046507 Bacteria 5534
715 Ga0495606_0059145 3300046507 Bacteria 2459
716 Ga0495606_0094533 3300046507 Bacteria 1832
717 Ga0495606_0124712 3300046507 Bacteria 1537
718 Ga0495608_0095698 3300046511 Bacteria 1918
719 Ga0495610_0000106 3300046512 Bacteria 97582
720 Ga0495610_0003895 3300046512 Bacteria 11325
721 Ga0495610_0003952 3300046512 Bacteria 11224
722 Ga0495610_0009910 3300046512 Bacteria 5963
723 Ga0495610_0014892 3300046512 Bacteria 4547
724 Ga0495610_0054009 3300046512 Bacteria 1942
725 Ga0495616_0000111 3300046513 Bacteria 71395
726 Ga0495616_0012896 3300046513 Bacteria 4728
727 Ga0495616_0014794 3300046513 Bacteria 4357
728 Ga0495616_0060210 3300046513 Bacteria 1866
729 Ga0495628_0001262 3300046516 Bacteria 23180
730 Ga0495628_0204342 3300046516 Bacteria 1487
731 Ga0495632_0002784 3300046519 Bacteria 12967
732 Ga0495637_0058832 3300046520 Bacteria 1583
733 Ga0495643_0000312 3300046522 Bacteria 67022
734 Ga0495643_0001280 3300046522 Bacteria 24099
735 Ga0495643_0002513 3300046522 Bacteria 14389
736 Ga0495643_0013623 3300046522 Bacteria 4860
737 Ga0495643_0013971 3300046522 Bacteria 4786
738 Ga0495644_0007048 3300046523 Bacteria 4349
739 Ga0495644_0009384 3300046523 Bacteria 3773
740 Ga0495648_0000037 3300046524 Bacteria 195401
741 Ga0495648_0004385 3300046524 Bacteria 12074
742 Ga0495648_0009791 3300046524 Bacteria 7374
743 Ga0495648_0029713 3300046524 Bacteria 3623
744 Ga0495642_0000535 3300046528 Bacteria 19288
745 Ga0495654_0000015 3300046530 Bacteria 307873
746 Ga0495654_0003446 3300046530 Bacteria 9679
747 Ga0495654_0009030 3300046530 Bacteria 5472
748 Ga0495665_0009106 3300046531 Bacteria 5380
749 Ga0495609_0000002 3300046538 Bacteria 739816
750 Ga0495609_0000334 3300046538 Bacteria 41567
751 Ga0495609_0001009 3300046538 Bacteria 20017
752 Ga0495609_0002742 3300046538 Bacteria 10603
753 Ga0495621_0005728 3300046539 Bacteria 3588
754 Ga0495597_0000024 3300046542 Bacteria 143948
755 Ga0495597_0000874 3300046542 Bacteria 23420
756 Ga0495597_0002290 3300046542 Bacteria 12434
757 Ga0495645_0009956 3300046543 Bacteria 6655
758 Ga0495645_0063919 3300046543 Bacteria 2663
759 Ga0495622_0000969 3300046557 Bacteria 15397
760 Ga0495633_0000244 3300046558 Bacteria 65398
761 Ga0495633_0000433 3300046558 Bacteria 43302
762 Ga0495633_0014264 3300046558 Bacteria 4161
763 Ga0495633_0015529 3300046558 Bacteria 3948
764 Ga0495633_0023233 3300046558 Bacteria 3073
765 Ga0495633_0101553 3300046558 Bacteria 1335
766 Ga0495667_0161275 3300046559 Bacteria 1442
767 Ga0495656_0005116 3300046615 Bacteria 4519
768 Ga0495668_0000241 3300046616 Bacteria 78040
769 Ga0495668_0001675 3300046616 Bacteria 20557
770 Ga0495668_0001687 3300046616 Bacteria 20430
771 Ga0495611_0018206 3300046648 Bacteria 3010
772 Ga0495625_0000317 3300046660 Bacteria 73568
773 Ga0495625_0001881 3300046660 Bacteria 23817
774 Ga0495625_0014029 3300046660 Bacteria 6414
775 Ga0495625_0021505 3300046660 Bacteria 4967
776 Ga0495625_0026803 3300046660 Bacteria 4348
777 Ga0495625_0076863 3300046660 Bacteria 2333
778 Ga0495661_0000183 3300046665 Bacteria 72020
779 Ga0495661_0038946 3300046665 Bacteria 2956
780 Ga0495661_0064705 3300046665 Bacteria 2157
781 Ga0495661_0205407 3300046665 Bacteria 1029
782 Ga0495588_0000127 3300046674 Bacteria 125854
783 Ga0495588_0070690 3300046674 Bacteria 1814
784 Ga0495623_0031408 3300046679 Bacteria 3414
785 Ga0495646_0012603 3300046680 Bacteria 5373
786 Ga0495646_0134589 3300046680 Bacteria 1388
787 Ga0495647_0017512 3300046681 Bacteria 2536
788 Ga0495658_0002829 3300046683 Bacteria 8717
789 Ga0495669_0038374 3300046684 Bacteria 2121
790 Ga0495669_0091817 3300046684 Bacteria 1402
791 Ga0495624_0054694 3300046690 Bacteria 2516
792 Ga0495624_0172427 3300046690 Bacteria 1320
793 Ga0495670_0024761 3300046691 Bacteria 2967
794 Ga0495671_0000006 3300046692 Bacteria 500471
795 Ga0495671_0005302 3300046692 Bacteria 7564
796 Ga0495671_0007566 3300046692 Bacteria 6180
797 Ga0495649_0008178 3300046694 Bacteria 6307
798 Ga0495649_0088312 3300046694 Bacteria 1654
799 Ga0495649_0103208 3300046694 Bacteria 1514
800 Ga0495649_0111947 3300046694 Bacteria 1447
801 Ga0495589_0000083 3300046794 Bacteria 87058
802 Ga0495589_0001488 3300046794 Bacteria 13479
803 Ga0495660_0000365 3300046810 Bacteria 39810
804 Ga0495660_0000625 3300046810 Bacteria 27722
805 Ga0495660_0025700 3300046810 Bacteria 3343
806 Ga0495660_0032884 3300046810 Bacteria 2911
807 Ga0495660_0061619 3300046810 Bacteria 2012
808 Ga0495581_0115185 3300047315 Bacteria 1563
809 Ga0495604_0027537 3300047317 Bacteria 4519
810 Ga0495636_0063802 3300047318 Bacteria 1562
811 Ga0495674_0031179 3300047319 Bacteria 4844
812 Ga0495672_0000021 3300047320 Bacteria 422795
813 Ga0495672_0000707 3300047320 Bacteria 36700
814 Ga0495672_0002916 3300047320 Bacteria 15128
815 Ga0495672_0069170 3300047320 Bacteria 2005
816 Ga0495672_0082684 3300047320 Bacteria 1785
817 Ga0495680_0137293 3300047322 Bacteria 1792
818 Ga0495683_0001181 3300047323 Bacteria 17821
819 Ga0495683_0024470 3300047323 Bacteria 3098
820 Ga0495683_0119960 3300047323 Bacteria 1249
821 Ga0495687_000075 3300047443 Bacteria 152218
822 Ga0495687_000104 3300047443 Bacteria 128704
823 Ga0495687_000197 3300047443 Bacteria 86694
824 Ga0495687_000701 3300047443 Bacteria 37406
825 Ga0495687_001598 3300047443 Bacteria 20448
826 Ga0495687_032607 3300047443 Bacteria 2375
827 Ga0495677_0000030 3300047445 Bacteria 87817
828 Ga0495679_001504 3300047446 Bacteria 13174
829 Ga0495679_011288 3300047446 Bacteria 3457
830 Ga0495679_036998 3300047446 Bacteria 1537
831 Ga0495673_0000003 3300047469 Bacteria 1491337
832 Ga0495673_0000061 3300047469 Bacteria 230647
833 Ga0495673_0000482 3300047469 Bacteria 42471
834 Ga0495681_0027176 3300047470 Bacteria 2965
835 Ga0495684_0228986 3300047471 Bacteria 1360
836 Ga0495686_0000032 3300047472 Bacteria 345132
837 Ga0495686_0000321 3300047472 Bacteria 79813
838 Ga0495593_0087226 3300047673 Bacteria 1609
839 Ga0495593_0090669 3300047673 Bacteria 1574
840 Ga0495602_0009621 3300048088 Bacteria 10045
841 Ga0495615_0013849 3300048090 Bacteria 1693
842 Ga0495626_0000111 3300048091 Bacteria 105401
843 Ga0495626_0001501 3300048091 Bacteria 18401
844 Ga0495626_0005215 3300048091 Bacteria 7692
845 Ga0495626_0008949 3300048091 Bacteria 5434
846 Ga0495626_0024727 3300048091 Bacteria 2942
847 Ga0495626_0137219 3300048091 Bacteria 1039
848 Ga0496100_0329855 3300048903 Bacteria 1148
849 Ga0496101_0013191 3300048904 Bacteria 5532
850 Ga0496101_0154023 3300048904 Bacteria 1759
851 Ga0496101_0184877 3300048904 Bacteria 1606
852 Ga0496101_0205393 3300048904 Bacteria 1524
853 Ga0496101_0365187 3300048904 Bacteria 1135
854 Ga0496101_0375661 3300048904 Bacteria 1118
855 Ga0496102_0002066 3300048905 Bacteria 17293
856 Ga0496102_0017450 3300048905 Bacteria 6288
857 Ga0496102_0118990 3300048905 Bacteria 2466
858 Ga0496102_0138631 3300048905 Bacteria 2280
859 Ga0496102_0210216 3300048905 Bacteria 1834
860 Ga0496103_0005550 3300048906 Bacteria 7538
861 Ga0496103_0124176 3300048906 Bacteria 1645
862 Ga0496104_0037582 3300048907 Bacteria 4528
863 Ga0496104_0156828 3300048907 Bacteria 2184
864 Ga0496105_0123909 3300048908 Bacteria 2130
865 Ga0496106_0000074 3300048909 Bacteria 80191
866 Ga0496106_0002714 3300048909 Bacteria 13113
867 Ga0496106_0012232 3300048909 Bacteria 6334
868 Ga0496106_0013407 3300048909 Bacteria 6052
869 Ga0496107_0006958 3300048910 Bacteria 7794
870 Ga0496108_0171706 3300048911 Bacteria 1876
871 Ga0496109_0057477 3300048912 Bacteria 3551
872 Ga0496109_0114677 3300048912 Bacteria 2507
873 Ga0496110_0152920 3300048913 Bacteria 2089
874 Ga0496110_0187063 3300048913 Bacteria 1881
875 Ga0496112_0444813 3300048915 Bacteria 1234
876 Ga0496114_0088778 3300048917 Bacteria 2623
877 Ga0496114_0190586 3300048917 Bacteria 1794
878 Ga0496114_0500447 3300048917 Bacteria 1075
879 Ga0496116_0026363 3300048919 Bacteria 4254
880 Ga0496116_0034917 3300048919 Bacteria 3538
881 Ga0496116_0053557 3300048919 Bacteria 2664
882 Ga0496117_0006812 3300048920 Bacteria 11376
883 Ga0496117_0049092 3300048920 Bacteria 3006
884 Ga0496118_0003604 3300048921 Bacteria 19255
885 Ga0496118_0023850 3300048921 Bacteria 5301
886 Ga0496118_0082126 3300048921 Bacteria 2259
887 Ga0496118_0210772 3300048921 Bacteria 1140
888 Ga0496121_0000941 3300048924 Bacteria 52704
889 Ga0496121_0004681 3300048924 Bacteria 18152
890 Ga0496121_0021261 3300048924 Bacteria 6367
891 Ga0496121_0034037 3300048924 Bacteria 4594
892 Ga0496121_0096223 3300048924 Bacteria 2298
893 Ga0496121_0135274 3300048924 Bacteria 1837
894 Ga0496121_0158818 3300048924 Bacteria 1656
895 Ga0496122_0005686 3300048925 Bacteria 14721
896 Ga0496122_0009086 3300048925 Bacteria 10539
897 Ga0496122_0014636 3300048925 Bacteria 7571
898 Ga0496122_0022841 3300048925 Bacteria 5541
899 Ga0496122_0161621 3300048925 Bacteria 1365
900 Ga0496122_0166245 3300048925 Bacteria 1337
901 Ga0496123_0007120 3300048926 Bacteria 10623
902 Ga0496123_0011977 3300048926 Bacteria 7441
903 Ga0496123_0102873 3300048926 Bacteria 1656
904 Ga0496124_0000007 3300048927 Bacteria 883534
905 Ga0496124_0020891 3300048927 Bacteria 6040
906 Ga0496124_0044825 3300048927 Bacteria 3793
907 Ga0496124_0106637 3300048927 Bacteria 2262
908 Ga0496124_0136831 3300048927 Bacteria 1938
909 Ga0496125_0009075 3300048928 Bacteria 10289
910 Ga0496125_0022520 3300048928 Bacteria 5847
911 Ga0496125_0049552 3300048928 Bacteria 3489
912 Ga0496126_0000571 3300048929 Bacteria 70542
913 Ga0496126_0012111 3300048929 Bacteria 8853
914 Ga0496126_0069666 3300048929 Bacteria 3136
915 Ga0496126_0159782 3300048929 Bacteria 1926
916 Ga0496126_0246949 3300048929 Bacteria 1489
917 Ga0495678_000030 3300049459 Bacteria 217986
918 Ga0495678_001619 3300049459 Bacteria 17175
919 Ga0495678_004565 3300049459 Bacteria 7965
920 Ga0501031_0417905 3300049568 Bacteria 867
921 Ga0501032_0127527 3300049569 Bacteria 1680
922 Ga0501033_0200807 3300049570 Bacteria 1424
923 Ga0501034_0000588 3300049571 Bacteria 57446
924 Ga0501034_0002376 3300049571 Bacteria 22856
925 Ga0501034_0070335 3300049571 Bacteria 3511
926 Ga0501036_0011863 3300049572 Bacteria 7222
927 Ga0501036_0137477 3300049572 Bacteria 2062
928 Ga0501036_0401942 3300049572 Bacteria 1143
929 Ga0501037_0010598 3300049573 Bacteria 6772
930 Ga0501038_0001224 3300049574 Bacteria 23265
931 Ga0501039_0013076 3300049575 Bacteria 6346
932 Ga0501039_0106296 3300049575 Bacteria 2192
933 Ga0501040_0016487 3300049576 Bacteria 4892
934 Ga0501041_0005223 3300049577 Bacteria 7583
935 Ga0501042_0029726 3300049578 Bacteria 3854
936 Ga0501043_0010497 3300049579 Bacteria 7252
937 Ga0501046_0034605 3300049580 Bacteria 4075
938 Ga0501047_0001745 3300049581 Bacteria 21067
939 Ga0501047_0021370 3300049581 Bacteria 6212
940 Ga0501072_0006553 3300049588 Bacteria 8867
941 Ga0501074_0152065 3300049590 Bacteria 1654
942 Ga0501075_0003826 3300049591 Bacteria 10132
943 Ga0501075_0087072 3300049591 Bacteria 2367
944 Ga0501076_0000538 3300049592 Bacteria 24148
945 Ga0501076_0146857 3300049592 Bacteria 1917
946 Ga0501208_016508 3300049655 Bacteria 1150
947 Ga0501079_0144454 3300049741 Bacteria 1854
948 Ga0501080_0233382 3300049742 Bacteria 1681
949 Ga0501080_0243333 3300049742 Bacteria 1641
950 Ga0501081_0006631 3300049743 Bacteria 7525
951 Ga0501083_0017537 3300049744 Bacteria 4991
952 Ga0501262_000211 3300049759 Bacteria 7263
953 Ga0501269_000655 3300049766 Bacteria 5945
954 Ga0501035_0002263 3300049822 Bacteria 19027
955 Ga0501035_0004536 3300049822 Bacteria 13179
956 Ga0501035_0049247 3300049822 Bacteria 3776
957 Ga0501044_0001571 3300049823 Bacteria 26728
958 Ga0501044_0005080 3300049823 Bacteria 14681
959 Ga0501045_0004030 3300049824 Bacteria 10122
960 nmdc:mga03683_26853_c1 3300050489 Bacteria 2275
961 nmdc:mga00v17_23749_c1 3300050491 Bacteria 3550
962 nmdc:mga00v17_28740_c1 3300050491 Bacteria 3259
963 nmdc:mga0k408_31611_c1 3300050493 Bacteria 3023
964 nmdc:mga0k408_43461_c1 3300050493 Bacteria 2589
965 nmdc:mga0k408_65032_c1 3300050493 Bacteria 2122
966 nmdc:mga07m45_136330_c1 3300050496 Bacteria 1421
967 nmdc:mga07m45_45703_c1 3300050496 Bacteria 2459
968 nmdc:mga05p37_497045_c1 3300050507 Bacteria 1401
969 nmdc:mga0qj67_218355_c1 3300050509 Bacteria 1548
970 nmdc:mga06r32_15835_c1 3300050510 Bacteria 6858
971 nmdc:mga08y16_168023_c1 3300050511 Bacteria 2279
972 nmdc:mga08y16_520259_c1 3300050511 Bacteria 1207
973 nmdc:mga0n895_23960_c1 3300050512 Bacteria 5745
974 nmdc:mga0rr50_11953_c1 3300050513 Bacteria 5585
975 nmdc:mga0rr50_513266_c1 3300050513 Bacteria 1019
976 nmdc:mga0sz30_19901_c1 3300050516 Bacteria 2702
977 Ga0500610_0001020 3300053079 Bacteria 9139
978 Ga0500610_0001866 3300053079 Bacteria 7465
979 Ga0500651_0001691 3300053093 Bacteria 11269
980 Ga0500650_0000068 3300053098 Bacteria 31846
981 Ga0500595_048810 3300053119 Bacteria 1321
982 Ga0500618_000543 3300053125 Bacteria 23454
983 Ga0500618_002981 3300053125 Bacteria 6040
984 Ga0500655_003191 3300053133 Bacteria 2974
985 Ga0500658_0000902 3300053134 Bacteria 12176
986 Ga0500586_000310 3300053145 Bacteria 9716
987 Ga0500622_0000011 3300053156 Bacteria 386096
988 Ga0500634_0051201 3300053161 Bacteria 2222
989 Ga0500645_000459 3300053730 Bacteria 27920
990 Ga0501084_0033378 3300054114 Bacteria 4306
991 Ga0501084_0219539 3300054114 Bacteria 1604
992 Ga0501082_0001529 3300060353 Bacteria 20359
993 Ga0501082_0125077 3300060353 Bacteria 2230
994 Ga0466962_0000474 3300061719 Bacteria 17440
995 Ga0466962_0022225 3300061719 Bacteria 3047
996 Ga0466962_0121293 3300061719 Bacteria 1261
997 Ga0466962_0130238 3300061719 Bacteria 1215
998 Ga0530510_0001545 3300061734 Bacteria 15520

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_100025906 Ga0070698_1000259062 211
2 3300025922 Ga0207646_10049764 Ga0207646_100497643 215
3 3300007076 Ga0075435_100099622 Ga0075435_1000996222 217
4 3300009098 Ga0105245_10145723 Ga0105245_101457232 219
5 3300009177 Ga0105248_10178802 Ga0105248_101788022 219
6 3300013307 Ga0157372_10120514 Ga0157372_101205144 219
7 3300014968 Ga0157379_10063212 Ga0157379_100632125 219
8 3300014969 Ga0157376_10017098 Ga0157376_100170986 219
9 3300035242 Ga0373962_0020529 Ga0373962_0020529_579_1454 219
10 3300035691 Ga0373931_0003777 Ga0373931_0003777_2196_3071 219
11 3300048904 Ga0496101_0205393 Ga0496101_0205393_289_1164 219
12 3300048909 Ga0496106_0013407 Ga0496106_0013407_3168_4043 219
13 3300048910 Ga0496107_0006958 Ga0496107_0006958_4892_5767 219
14 3300048912 Ga0496109_0057477 Ga0496109_0057477_2304_3179 219
15 3300048917 Ga0496114_0190586 Ga0496114_0190586_539_1414 219
16 3300050512 nmdc:mga0n895_23960_c1 nmdc:mga0n895_23960_c1_1202_2047 220
17 3300050513 nmdc:mga0rr50_11953_c1 nmdc:mga0rr50_11953_c1_2015_2860 220
18 3300005330 Ga0070690_100287651 Ga0070690_1002876511 222
19 3300005333 Ga0070677_10037616 Ga0070677_100376162 222
20 3300005334 Ga0068869_100001022 Ga0068869_10000102210 222
21 3300005338 Ga0068868_100189855 Ga0068868_1001898552 222
22 3300005354 Ga0070675_100008605 Ga0070675_1000086056 222
23 3300005355 Ga0070671_100338804 Ga0070671_1003388042 222
24 3300005366 Ga0070659_100033084 Ga0070659_1000330845 222
25 3300005457 Ga0070662_100021829 Ga0070662_1000218293 222
26 3300005539 Ga0068853_100025396 Ga0068853_1000253966 222
27 3300005547 Ga0070693_100082994 Ga0070693_1000829942 222
28 3300005563 Ga0068855_100137218 Ga0068855_1001372182 222
29 3300005614 Ga0068856_100054154 Ga0068856_1000541542 222
30 3300005615 Ga0070702_100057523 Ga0070702_1000575232 222
31 3300005618 Ga0068864_100007739 Ga0068864_1000077392 222
32 3300005719 Ga0068861_100002859 Ga0068861_1000028594 222
33 3300005834 Ga0068851_10024197 Ga0068851_100241972 222
34 3300005844 Ga0068862_100112543 Ga0068862_1001125432 222
35 3300006237 Ga0097621_100009938 Ga0097621_1000099382 222
36 3300006358 Ga0068871_100003785 Ga0068871_1000037853 222
37 3300013105 Ga0157369_10331675 Ga0157369_103316752 222
38 3300017792 Ga0163161_10026761 Ga0163161_100267615 222
39 3300025893 Ga0207682_10038204 Ga0207682_100382042 222
40 3300025907 Ga0207645_10021161 Ga0207645_100211612 222
41 3300025911 Ga0207654_10046374 Ga0207654_100463742 222
42 3300025914 Ga0207671_10269697 Ga0207671_102696972 222
43 3300025919 Ga0207657_10022908 Ga0207657_100229082 222
44 3300025924 Ga0207694_10421926 Ga0207694_104219262 222
45 3300025926 Ga0207659_10165511 Ga0207659_101655112 222
46 3300025927 Ga0207687_10142411 Ga0207687_101424111 222
47 3300025933 Ga0207706_10000892 Ga0207706_1000089229 222
48 3300025941 Ga0207711_10153394 Ga0207711_101533942 222
49 3300025942 Ga0207689_10000393 Ga0207689_100003932 222
50 3300025949 Ga0207667_10103988 Ga0207667_101039882 222
51 3300025981 Ga0207640_10008616 Ga0207640_100086162 222
52 3300026023 Ga0207677_10004381 Ga0207677_100043816 222
53 3300026035 Ga0207703_10328392 Ga0207703_103283922 222
54 3300026067 Ga0207678_10019804 Ga0207678_100198042 222
55 3300026078 Ga0207702_10038205 Ga0207702_100382054 222
56 3300026088 Ga0207641_10038171 Ga0207641_100381713 222
57 3300026118 Ga0207675_100009503 Ga0207675_1000095034 222
58 3300028380 Ga0268265_10071330 Ga0268265_100713302 222
59 3300031456 Ga0307513_10000004 Ga0307513_1000000435 225
60 3300005353 Ga0070669_100012521 Ga0070669_1000125213 226
61 3300009174 Ga0105241_10083754 Ga0105241_100837542 227
62 3300009545 Ga0105237_10010158 Ga0105237_100101589 227
63 3300013105 Ga0157369_10420836 Ga0157369_104208361 227
64 3300013100 Ga0157373_10048268 Ga0157373_100482682 228
65 3300014497 Ga0182008_10038719 Ga0182008_100387192 228
66 3300015262 Ga0182007_10046516 Ga0182007_100465162 228
67 3300031548 Ga0307408_100010654 Ga0307408_1000106543 228
68 3300031901 Ga0307406_10002492 Ga0307406_100024922 228
69 3300035692 Ga0373935_0175318 Ga0373935_0175318_392_1162 228
70 3300048904 Ga0496101_0375661 Ga0496101_0375661_105_893 228
71 3300005329 Ga0070683_100093142 Ga0070683_1000931422 231
72 3300005577 Ga0068857_100022658 Ga0068857_1000226585 231
73 3300025944 Ga0207661_10063210 Ga0207661_100632103 231
74 3300025945 Ga0207679_10120278 Ga0207679_101202783 231
75 3300003792 Ga0055540_1001184 Ga0055540_10011843 232
76 3300005289 Ga0065704_10005654 Ga0065704_100056543 232
77 3300005367 Ga0070667_100228928 Ga0070667_1002289282 232
78 3300006846 Ga0075430_100005392 Ga0075430_10000539211 232
79 3300006847 Ga0075431_100020149 Ga0075431_1000201493 232
80 3300009147 Ga0114129_10372132 Ga0114129_103721323 232
81 3300025303 Ga0209051_1000991 Ga0209051_100099126 232
82 3300050489 nmdc:mga03683_26853_c1 nmdc:mga03683_26853_c1_873_1751 232
83 3300050507 nmdc:mga05p37_497045_c1 nmdc:mga05p37_497045_c1_437_1177 232
84 3300050509 nmdc:mga0qj67_218355_c1 nmdc:mga0qj67_218355_c1_675_1415 232
85 3300050510 nmdc:mga06r32_15835_c1 nmdc:mga06r32_15835_c1_6079_6819 232
86 3300037068 Ga0373925_0013472 Ga0373925_0013472_79_858 233
87 3300005546 Ga0070696_100554915 Ga0070696_1005549151 234
88 3300006871 Ga0075434_100014084 Ga0075434_1000140843 234
89 3300025910 Ga0207684_10091257 Ga0207684_100912572 234
90 3300037853 Ga0436364_0445393 Ga0436364_0445393_321_1160 234
91 3300037312 Ga0395899_0019864 Ga0395899_0019864_152_940 236
92 3300037418 Ga0395900_0001610 Ga0395900_0001610_25732_26520 236
93 3300037418 Ga0395900_0314768 Ga0395900_0314768_185_973 236
94 3300037466 Ga0395898_0330480 Ga0395898_0330480_118_906 236
95 3300038443 Ga0395901_0000963 Ga0395901_0000963_22316_23104 236
96 3300039437 Ga0436365_0998154 Ga0436365_0998154_115_954 236
97 3300039450 Ga0436363_1260698 Ga0436363_1260698_6329_7168 236
98 3300042007 Ga0439449_0049113 Ga0439449_0049113_128_916 236
99 3300044706 Ga0466964_0000224 Ga0466964_0000224_8437_9225 236
100 3300044842 Ga0466957_0015317 Ga0466957_0015317_897_1685 236
101 3300005347 Ga0070668_100474225 Ga0070668_1004742251 237
102 3300005367 Ga0070667_100184810 Ga0070667_1001848102 237
103 3300005937 Ga0081455_10153169 Ga0081455_101531692 237
104 3300013306 Ga0163162_10489793 Ga0163162_104897932 237
105 3300014497 Ga0182008_10003552 Ga0182008_100035524 237
106 3300025972 Ga0207668_10118695 Ga0207668_101186951 237
107 3300026121 Ga0207683_10123968 Ga0207683_101239683 237
108 3300031251 Ga0265327_10111907 Ga0265327_101119072 237
109 3300037068 Ga0373925_0167723 Ga0373925_0167723_175_999 237
110 3300037471 Ga0395905_0250215 Ga0395905_0250215_664_1452 237
111 3300041453 Ga0451797_0514870 Ga0451797_0514870_255_1031 237
112 3300048911 Ga0496108_0171706 Ga0496108_0171706_496_1368 237
113 3300049572 Ga0501036_0401942 Ga0501036_0401942_24_866 237
114 3300003792 Ga0055540_1004397 Ga0055540_10043973 238
115 3300003794 Ga0055531_10000566 Ga0055531_100005665 238
116 3300005336 Ga0070680_100188240 Ga0070680_1001882402 238
117 3300005347 Ga0070668_100309274 Ga0070668_1003092742 238
118 3300005366 Ga0070659_100104663 Ga0070659_1001046633 238
119 3300005436 Ga0070713_100417020 Ga0070713_1004170202 238
120 3300005437 Ga0070710_10224337 Ga0070710_102243371 238
121 3300005458 Ga0070681_10118465 Ga0070681_101184653 238
122 3300005530 Ga0070679_100040681 Ga0070679_1000406814 238
123 3300005539 Ga0068853_100354689 Ga0068853_1003546891 238
124 3300005577 Ga0068857_100034613 Ga0068857_1000346133 238
125 3300005577 Ga0068857_100591030 Ga0068857_1005910302 238
126 3300005983 Ga0081540_1000032 Ga0081540_10000324 238
127 3300006038 Ga0075365_10062701 Ga0075365_100627014 238
128 3300006042 Ga0075368_10034956 Ga0075368_100349562 238
129 3300006177 Ga0075362_10012593 Ga0075362_100125935 238
130 3300006178 Ga0075367_10019309 Ga0075367_100193094 238
131 3300006178 Ga0075367_10196528 Ga0075367_101965282 238
132 3300006195 Ga0075366_10060205 Ga0075366_100602052 238
133 3300006195 Ga0075366_10310309 Ga0075366_103103091 238
134 3300006353 Ga0075370_10056153 Ga0075370_100561533 238
135 3300009094 Ga0111539_10053706 Ga0111539_100537063 238
136 3300009176 Ga0105242_10381003 Ga0105242_103810032 238
137 3300013102 Ga0157371_10482293 Ga0157371_104822931 238
138 3300013306 Ga0163162_10098476 Ga0163162_100984763 238
139 3300015683 Ga0183362_10003 Ga0183362_10003476 238
140 3300025273 Ga0209673_1046401 Ga0209673_10464012 238
141 3300025303 Ga0209051_1000388 Ga0209051_10003883 238
142 3300025304 Ga0209257_1000022 Ga0209257_1000022640 238
143 3300025914 Ga0207671_10047846 Ga0207671_100478461 238
144 3300025921 Ga0207652_10155238 Ga0207652_101552382 238
145 3300025923 Ga0207681_10088404 Ga0207681_100884041 238
146 3300026041 Ga0207639_10338404 Ga0207639_103384042 238
147 3300026116 Ga0207674_10206403 Ga0207674_102064032 238
148 3300026118 Ga0207675_100041541 Ga0207675_1000415413 238
149 3300031251 Ga0265327_10014466 Ga0265327_100144665 238
150 3300041411 Ga0439466_0026806 Ga0439466_0026806_727_1602 238
151 3300041997 Ga0439431_0015246 Ga0439431_0015246_738_1613 238
152 3300042002 Ga0439442_011867 Ga0439442_011867_167_1042 238
153 3300042006 Ga0439432_002972 Ga0439432_002972_663_1538 238
154 3300042014 Ga0439457_013461 Ga0439457_013461_473_1348 238
155 3300042015 Ga0439462_0005441 Ga0439462_0005441_1561_2436 238
156 3300050493 nmdc:mga0k408_43461_c1 nmdc:mga0k408_43461_c1_1642_2517 238
157 3300050493 nmdc:mga0k408_65032_c1 nmdc:mga0k408_65032_c1_612_1490 238
158 3300050511 nmdc:mga08y16_168023_c1 nmdc:mga08y16_168023_c1_786_1556 238
159 3300053730 Ga0500645_000459 Ga0500645_000459_14756_15640 238
160 iso_pu_bacteria 2739367655 2739612289 238
161 3300002987 JGI25159J45721_1000166 JGI25159J45721_100016620 239
162 3300003354 JGI25160J50197_1000352 JGI25160J50197_100035220 239
163 3300003374 JGI25161J50226_1000268 JGI25161J50226_100026820 239
164 3300003758 Ga0055532_1006666 Ga0055532_10066662 239
165 3300003760 Ga0055527_1002750 Ga0055527_10027503 239
166 3300003761 Ga0055535_1000760 Ga0055535_10007608 239
167 3300003762 Ga0055542_1000127 Ga0055542_10001278 239
168 3300003773 Ga0055537_1008280 Ga0055537_10082802 239
169 3300003773 Ga0055537_1008698 Ga0055537_10086982 239
170 3300003781 Ga0055536_1021092 Ga0055536_10210922 239
171 3300003790 Ga0055528_1034292 Ga0055528_10342922 239
172 3300003791 Ga0055530_10000929 Ga0055530_1000092918 239
173 3300003791 Ga0055530_10003395 Ga0055530_100033954 239
174 3300003791 Ga0055530_10044041 Ga0055530_100440411 239
175 3300004625 Ga0055543_1000361 Ga0055543_100036120 239
176 3300004625 Ga0055543_1001214 Ga0055543_10012148 239
177 3300005262 Ga0065165_1004330 Ga0065165_10043303 239
178 3300005262 Ga0065165_1004677 Ga0065165_10046773 239
179 3300005262 Ga0065165_1008599 Ga0065165_10085995 239
180 3300005262 Ga0065165_1028618 Ga0065165_10286181 239
181 3300005339 Ga0070660_100090113 Ga0070660_1000901132 239
182 3300005548 Ga0070665_100025091 Ga0070665_1000250913 239
183 3300005834 Ga0068851_10031045 Ga0068851_100310453 239
184 3300005841 Ga0068863_100127257 Ga0068863_1001272572 239
185 3300006177 Ga0075362_10002819 Ga0075362_100028195 239
186 3300006881 Ga0068865_100215397 Ga0068865_1002153972 239
187 3300009093 Ga0105240_10343084 Ga0105240_103430842 239
188 3300010375 Ga0105239_10254137 Ga0105239_102541372 239
189 3300025228 Ga0209672_102400 Ga0209672_1024003 239
190 3300025229 Ga0209147_101037 Ga0209147_1010376 239
191 3300025242 Ga0209258_100078 Ga0209258_100078154 239
192 3300025245 Ga0207425_1000952 Ga0207425_10009523 239
193 3300025254 Ga0209148_1000086 Ga0209148_1000086154 239
194 3300025258 Ga0209129_1000116 Ga0209129_100011610 239
195 3300025258 Ga0209129_1007819 Ga0209129_10078193 239
196 3300025258 Ga0209129_1019257 Ga0209129_10192572 239
197 3300025263 Ga0209565_1000133 Ga0209565_10001333 239
198 3300025263 Ga0209565_1005683 Ga0209565_10056832 239
199 3300025273 Ga0209673_1000190 Ga0209673_1000190116 239
200 3300025273 Ga0209673_1002954 Ga0209673_10029549 239
201 3300025284 Ga0209130_1000202 Ga0209130_100020227 239
202 3300025284 Ga0209130_1001910 Ga0209130_10019109 239
203 3300025284 Ga0209130_1008843 Ga0209130_10088432 239
204 3300025291 Ga0209675_1006283 Ga0209675_10062834 239
205 3300025291 Ga0209675_1007038 Ga0209675_10070382 239
206 3300025291 Ga0209675_1009003 Ga0209675_10090032 239
207 3300025292 Ga0209676_1000125 Ga0209676_1000125153 239
208 3300025294 Ga0209025_1002825 Ga0209025_100282512 239
209 3300025294 Ga0209025_1014639 Ga0209025_10146391 239
210 3300025295 Ga0209564_1002219 Ga0209564_10022194 239
211 3300025295 Ga0209564_1002684 Ga0209564_10026844 239
212 3300025295 Ga0209564_1009762 Ga0209564_10097625 239
213 3300025297 Ga0209758_1000034 Ga0209758_1000034130 239
214 3300025297 Ga0209758_1013003 Ga0209758_10130033 239
215 3300025298 Ga0209050_1000012 Ga0209050_1000012631 239
216 3300025298 Ga0209050_1004979 Ga0209050_10049799 239
217 3300025299 Ga0209256_1000066 Ga0209256_100006694 239
218 3300025299 Ga0209256_1000270 Ga0209256_10002704 239
219 3300025302 Ga0207426_1000067 Ga0207426_100006732 239
220 3300025302 Ga0207426_1000145 Ga0207426_1000145134 239
221 3300025302 Ga0207426_1002489 Ga0207426_10024894 239
222 3300025303 Ga0209051_1000134 Ga0209051_100013491 239
223 3300025303 Ga0209051_1012848 Ga0209051_10128482 239
224 3300025304 Ga0209257_1000024 Ga0209257_1000024577 239
225 3300025321 Ga0207656_10045081 Ga0207656_100450812 239
226 3300025909 Ga0207705_10004503 Ga0207705_100045032 239
227 3300025913 Ga0207695_10164918 Ga0207695_101649182 239
228 3300026078 Ga0207702_10151144 Ga0207702_101511442 239
229 3300026088 Ga0207641_10065097 Ga0207641_100650972 239
230 3300026116 Ga0207674_10212886 Ga0207674_102128862 239
231 3300028379 Ga0268266_10005293 Ga0268266_100052935 239
232 3300031251 Ga0265327_10007858 Ga0265327_100078585 239
233 3300031456 Ga0307513_10000549 Ga0307513_1000054927 239
234 3300031548 Ga0307408_100000425 Ga0307408_10000042518 239
235 3300031901 Ga0307406_10006980 Ga0307406_100069803 239
236 3300037312 Ga0395899_0048495 Ga0395899_0048495_37_825 239
237 3300037418 Ga0395900_0024372 Ga0395900_0024372_3234_4022 239
238 3300038443 Ga0395901_0433124 Ga0395901_0433124_11_871 239
239 3300046491 Ga0495584_0012628 Ga0495584_0012628_2565_3353 239
240 3300046500 Ga0495596_0006610 Ga0495596_0006610_2125_2913 239
241 3300046501 Ga0495607_0007716 Ga0495607_0007716_3410_4198 239
242 3300046507 Ga0495606_0124712 Ga0495606_0124712_484_1272 239
243 3300046513 Ga0495616_0000111 Ga0495616_0000111_55144_55932 239
244 3300046530 Ga0495654_0003446 Ga0495654_0003446_3200_4108 239
245 3300046538 Ga0495609_0000002 Ga0495609_0000002_263669_264457 239
246 3300046542 Ga0495597_0000024 Ga0495597_0000024_11494_12372 239
247 3300046615 Ga0495656_0005116 Ga0495656_0005116_661_1536 239
248 3300046648 Ga0495611_0018206 Ga0495611_0018206_1367_2155 239
249 3300046665 Ga0495661_0000183 Ga0495661_0000183_68151_68939 239
250 3300046794 Ga0495589_0000083 Ga0495589_0000083_3082_3870 239
251 3300047320 Ga0495672_0069170 Ga0495672_0069170_858_1646 239
252 3300047443 Ga0495687_000197 Ga0495687_000197_82825_83613 239
253 3300047445 Ga0495677_0000030 Ga0495677_0000030_3082_3870 239
254 3300048090 Ga0495615_0013849 Ga0495615_0013849_77_865 239
255 3300048091 Ga0495626_0001501 Ga0495626_0001501_3572_4360 239
256 3300048926 Ga0496123_0102873 Ga0496123_0102873_161_949 239
257 3300005331 Ga0070670_100150757 Ga0070670_1001507572 240
258 3300005334 Ga0068869_100011250 Ga0068869_1000112502 240
259 3300005338 Ga0068868_100360833 Ga0068868_1003608332 240
260 3300005355 Ga0070671_100040429 Ga0070671_1000404293 240
261 3300005364 Ga0070673_100131740 Ga0070673_1001317402 240
262 3300005365 Ga0070688_100318799 Ga0070688_1003187992 240
263 3300005543 Ga0070672_100011632 Ga0070672_1000116325 240
264 3300005548 Ga0070665_100774911 Ga0070665_1007749111 240
265 3300005617 Ga0068859_100146800 Ga0068859_1001468002 240
266 3300005718 Ga0068866_10290534 Ga0068866_102905341 240
267 3300005719 Ga0068861_100231314 Ga0068861_1002313142 240
268 3300005841 Ga0068863_100036693 Ga0068863_1000366933 240
269 3300005841 Ga0068863_100165244 Ga0068863_1001652442 240
270 3300005842 Ga0068858_100056949 Ga0068858_1000569494 240
271 3300005844 Ga0068862_100022469 Ga0068862_1000224691 240
272 3300006237 Ga0097621_100130963 Ga0097621_1001309633 240
273 3300006358 Ga0068871_100071670 Ga0068871_1000716702 240
274 3300006881 Ga0068865_100461839 Ga0068865_1004618391 240
275 3300006931 Ga0097620_100146805 Ga0097620_1001468052 240
276 3300009094 Ga0111539_10621460 Ga0111539_106214602 240
277 3300009098 Ga0105245_10285321 Ga0105245_102853212 240
278 3300009177 Ga0105248_10009668 Ga0105248_1000966811 240
279 3300009177 Ga0105248_10021120 Ga0105248_100211206 240
280 3300009553 Ga0105249_10402713 Ga0105249_104027132 240
281 3300010375 Ga0105239_10434352 Ga0105239_104343522 240
282 3300013297 Ga0157378_10400448 Ga0157378_104004482 240
283 3300013308 Ga0157375_10044984 Ga0157375_100449843 240
284 3300014969 Ga0157376_10032848 Ga0157376_100328483 240
285 3300017792 Ga0163161_10449467 Ga0163161_104494672 240
286 3300025899 Ga0207642_10215147 Ga0207642_102151472 240
287 3300025926 Ga0207659_10192180 Ga0207659_101921802 240
288 3300025940 Ga0207691_10022198 Ga0207691_100221985 240
289 3300025941 Ga0207711_10031413 Ga0207711_100314134 240
290 3300025942 Ga0207689_10004760 Ga0207689_100047604 240
291 3300025960 Ga0207651_10040769 Ga0207651_100407692 240
292 3300025960 Ga0207651_10048141 Ga0207651_100481413 240
293 3300025972 Ga0207668_10337266 Ga0207668_103372662 240
294 3300026023 Ga0207677_10466367 Ga0207677_104663671 240
295 3300026035 Ga0207703_10101296 Ga0207703_101012962 240
296 3300026088 Ga0207641_10119125 Ga0207641_101191252 240
297 3300026088 Ga0207641_10632051 Ga0207641_106320511 240
298 3300028380 Ga0268265_10618361 Ga0268265_106183611 240
299 3300038443 Ga0395901_0106032 Ga0395901_0106032_1266_2054 240
300 3300042005 Ga0439448_0014554 Ga0439448_0014554_1194_1994 240
301 3300042008 Ga0439450_019338 Ga0439450_019338_382_1182 240
302 3300044765 Ga0466970_0223719 Ga0466970_0223719_210_1010 240
303 3300046810 Ga0495660_0061619 Ga0495660_0061619_899_1687 240
304 3300048925 Ga0496122_0022841 Ga0496122_0022841_1994_2782 240
305 3300049569 Ga0501032_0127527 Ga0501032_0127527_76_903 240
306 3300049571 Ga0501034_0002376 Ga0501034_0002376_16635_17462 240
307 3300049572 Ga0501036_0137477 Ga0501036_0137477_519_1346 240
308 3300049573 Ga0501037_0010598 Ga0501037_0010598_5524_6351 240
309 3300049574 Ga0501038_0001224 Ga0501038_0001224_4752_5579 240
310 3300049575 Ga0501039_0106296 Ga0501039_0106296_697_1524 240
311 3300049579 Ga0501043_0010497 Ga0501043_0010497_2441_3268 240
312 3300049581 Ga0501047_0021370 Ga0501047_0021370_5179_6006 240
313 3300049742 Ga0501080_0243333 Ga0501080_0243333_769_1596 240
314 3300049744 Ga0501083_0017537 Ga0501083_0017537_452_1279 240
315 3300049822 Ga0501035_0049247 Ga0501035_0049247_334_1161 240
316 3300049823 Ga0501044_0001571 Ga0501044_0001571_14653_15480 240
317 3300054114 Ga0501084_0219539 Ga0501084_0219539_412_1239 240
318 3300060353 Ga0501082_0125077 Ga0501082_0125077_694_1521 240
319 3300003187 JGI25151J46595_10001423 JGI25151J46595_1000142312 241
320 3300003187 JGI25151J46595_10022278 JGI25151J46595_100222782 241
321 3300003773 Ga0055537_1000209 Ga0055537_10002094 241
322 3300003781 Ga0055536_1005808 Ga0055536_10058081 241
323 3300003784 Ga0055534_1000204 Ga0055534_10002044 241
324 3300003790 Ga0055528_1000531 Ga0055528_10005319 241
325 3300003791 Ga0055530_10005486 Ga0055530_100054864 241
326 3300003792 Ga0055540_1001797 Ga0055540_100179711 241
327 3300003794 Ga0055531_10001763 Ga0055531_100017634 241
328 3300005344 Ga0070661_100381930 Ga0070661_1003819301 241
329 3300005563 Ga0068855_100249151 Ga0068855_1002491511 241
330 3300005844 Ga0068862_100017882 Ga0068862_1000178822 241
331 3300006048 Ga0075363_100049349 Ga0075363_1000493493 241
332 3300006195 Ga0075366_10030457 Ga0075366_100304573 241
333 3300006353 Ga0075370_10066117 Ga0075370_100661172 241
334 3300006946 Ga0079104_1040558 Ga0079104_10405582 241
335 3300006948 Ga0099826_10003943 Ga0099826_100039432 241
336 3300009036 Ga0105244_10029659 Ga0105244_100296593 241
337 3300009036 Ga0105244_10071206 Ga0105244_100712062 241
338 3300009093 Ga0105240_10313783 Ga0105240_103137832 241
339 3300009148 Ga0105243_10019383 Ga0105243_100193834 241
340 3300009545 Ga0105237_10239013 Ga0105237_102390132 241
341 3300011119 Ga0105246_10084927 Ga0105246_100849272 241
342 3300012502 Ga0157347_1005273 Ga0157347_10052731 241
343 3300013104 Ga0157370_10001210 Ga0157370_1000121028 241
344 3300013105 Ga0157369_10231310 Ga0157369_102313102 241
345 3300014497 Ga0182008_10049109 Ga0182008_100491092 241
346 3300014497 Ga0182008_10121734 Ga0182008_101217342 241
347 3300015261 Ga0182006_1041366 Ga0182006_10413662 241
348 3300017792 Ga0163161_10000118 Ga0163161_100001183 241
349 3300025258 Ga0209129_1000830 Ga0209129_10008304 241
350 3300025263 Ga0209565_1000067 Ga0209565_100006745 241
351 3300025273 Ga0209673_1000813 Ga0209673_100081345 241
352 3300025273 Ga0209673_1005012 Ga0209673_10050123 241
353 3300025291 Ga0209675_1000038 Ga0209675_1000038199 241
354 3300025291 Ga0209675_1004428 Ga0209675_10044286 241
355 3300025291 Ga0209675_1015821 Ga0209675_10158212 241
356 3300025292 Ga0209676_1001114 Ga0209676_100111414 241
357 3300025292 Ga0209676_1019055 Ga0209676_10190552 241
358 3300025294 Ga0209025_1001608 Ga0209025_10016082 241
359 3300025294 Ga0209025_1002969 Ga0209025_10029692 241
360 3300025294 Ga0209025_1065058 Ga0209025_10650582 241
361 3300025298 Ga0209050_1001325 Ga0209050_100132517 241
362 3300025298 Ga0209050_1007763 Ga0209050_10077634 241
363 3300025299 Ga0209256_1026104 Ga0209256_10261042 241
364 3300025303 Ga0209051_1001829 Ga0209051_100182914 241
365 3300025304 Ga0209257_1001367 Ga0209257_100136714 241
366 3300025728 Ga0207655_1062846 Ga0207655_10628462 241
367 3300025911 Ga0207654_10178580 Ga0207654_101785801 241
368 3300025913 Ga0207695_10217866 Ga0207695_102178662 241
369 3300025932 Ga0207690_10420557 Ga0207690_104205572 241
370 3300025935 Ga0207709_10001889 Ga0207709_100018893 241
371 3300025949 Ga0207667_10190569 Ga0207667_101905691 241
372 3300026041 Ga0207639_10041283 Ga0207639_100412833 241
373 3300027666 Ga0209282_1015645 Ga0209282_10156453 241
374 3300028379 Ga0268266_10259595 Ga0268266_102595952 241
375 3300028794 Ga0307515_10013446 Ga0307515_100134465 241
376 3300030733 Ga0314311_1168092 Ga0314311_11680923 241
377 3300031548 Ga0307408_100087374 Ga0307408_1000873742 241
378 3300031649 Ga0307514_10072345 Ga0307514_100723452 241
379 3300031731 Ga0307405_10053326 Ga0307405_100533263 241
380 3300031852 Ga0307410_10165527 Ga0307410_101655272 241
381 3300031911 Ga0307412_10470811 Ga0307412_104708112 241
382 3300036401 Ga0373937_0206448 Ga0373937_0206448_753_1616 241
383 3300042123 Ga0450921_000720 Ga0450921_000720_411_1289 241
384 3300042531 Ga0450918_005739 Ga0450918_005739_371_1249 241
385 3300046512 Ga0495610_0014892 Ga0495610_0014892_504_1382 241
386 3300046513 Ga0495616_0014794 Ga0495616_0014794_507_1385 241
387 3300046523 Ga0495644_0009384 Ga0495644_0009384_198_959 241
388 3300046660 Ga0495625_0000317 Ga0495625_0000317_3933_4811 241
389 3300046660 Ga0495625_0076863 Ga0495625_0076863_736_1614 241
390 3300046674 Ga0495588_0070690 Ga0495588_0070690_311_1189 241
391 3300047323 Ga0495683_0024470 Ga0495683_0024470_485_1246 241
392 3300047446 Ga0495679_001504 Ga0495679_001504_5446_6207 241
393 3300048921 Ga0496118_0082126 Ga0496118_0082126_244_1122 241
394 3300048924 Ga0496121_0096223 Ga0496121_0096223_296_1174 241
395 3300048924 Ga0496121_0135274 Ga0496121_0135274_823_1701 241
396 3300048928 Ga0496125_0049552 Ga0496125_0049552_87_965 241
397 3300049759 Ga0501262_000211 Ga0501262_000211_3475_4353 241
398 3300050491 nmdc:mga00v17_23749_c1 nmdc:mga00v17_23749_c1_2260_3138 241
399 3300050493 nmdc:mga0k408_31611_c1 nmdc:mga0k408_31611_c1_232_1110 241
400 3300050496 nmdc:mga07m45_136330_c1 nmdc:mga07m45_136330_c1_481_1359 241
401 3300050496 nmdc:mga07m45_45703_c1 nmdc:mga07m45_45703_c1_1005_1883 241
402 3300053079 Ga0500610_0001020 Ga0500610_0001020_7402_8280 241
403 3300053079 Ga0500610_0001866 Ga0500610_0001866_5165_6043 241
404 3300053093 Ga0500651_0001691 Ga0500651_0001691_7478_8356 241
405 3300053133 Ga0500655_003191 Ga0500655_003191_788_1666 241
406 3300053134 Ga0500658_0000902 Ga0500658_0000902_10204_11082 241
407 iso_pu_bacteria 2643221645 2644249708 241
408 iso_pu_bacteria 2894510363 2894510616 241
409 iso_pu_bacteria 2989392574 2989394256 241
410 3300005288 Ga0065714_10022629 Ga0065714_100226292 242
411 3300005366 Ga0070659_100055093 Ga0070659_1000550934 242
412 3300025273 Ga0209673_1028546 Ga0209673_10285462 242
413 3300025284 Ga0209130_1005820 Ga0209130_10058201 242
414 3300025921 Ga0207652_10122862 Ga0207652_101228621 242
415 3300025926 Ga0207659_10353556 Ga0207659_103535561 242
416 3300037418 Ga0395900_0222095 Ga0395900_0222095_579_1448 242
417 3300037471 Ga0395905_0000600 Ga0395905_0000600_35209_36078 242
418 3300037471 Ga0395905_0118838 Ga0395905_0118838_939_1814 242
419 3300042876 Ga0451577_0012374 Ga0451577_0012374_5299_6180 242
420 3300044712 Ga0453684_0028832 Ga0453684_0028832_1830_2711 242
421 3300045051 Ga0451576_0351790 Ga0451576_0351790_185_1066 242
422 3300049655 Ga0501208_016508 Ga0501208_016508_224_1099 242
423 3300005355 Ga0070671_100252295 Ga0070671_1002522952 243
424 3300005434 Ga0070709_10019138 Ga0070709_100191382 243
425 3300005436 Ga0070713_100566618 Ga0070713_1005666181 243
426 3300005439 Ga0070711_100218548 Ga0070711_1002185482 243
427 3300005563 Ga0068855_100042177 Ga0068855_1000421775 243
428 3300006175 Ga0070712_100260309 Ga0070712_1002603092 243
429 3300009098 Ga0105245_10085324 Ga0105245_100853243 243
430 3300009148 Ga0105243_10004131 Ga0105243_100041318 243
431 3300009176 Ga0105242_10086337 Ga0105242_100863373 243
432 3300013307 Ga0157372_10409925 Ga0157372_104099252 243
433 3300025906 Ga0207699_10080349 Ga0207699_100803492 243
434 3300025915 Ga0207693_10234326 Ga0207693_102343262 243
435 3300025920 Ga0207649_10261078 Ga0207649_102610782 243
436 3300025928 Ga0207700_10051865 Ga0207700_100518652 243
437 3300025931 Ga0207644_10025628 Ga0207644_100256285 243
438 3300025935 Ga0207709_10027454 Ga0207709_100274543 243
439 3300031251 Ga0265327_10001504 Ga0265327_1000150419 243
440 3300037418 Ga0395900_0177755 Ga0395900_0177755_1179_1979 243
441 3300037466 Ga0395898_0314771 Ga0395898_0314771_116_916 243
442 3300037471 Ga0395905_0286976 Ga0395905_0286976_504_1304 243
443 3300048091 Ga0495626_0024727 Ga0495626_0024727_1317_2105 243
444 3300048909 Ga0496106_0002714 Ga0496106_0002714_9085_9873 243
445 3300048915 Ga0496112_0444813 Ga0496112_0444813_363_1151 243
446 3300053156 Ga0500622_0000011 Ga0500622_0000011_97684_98502 243
447 iso_pu_bacteria 2547132103 2547374511 243
448 3300005364 Ga0070673_100053368 Ga0070673_1000533682 244
449 3300007788 Ga0099795_10017173 Ga0099795_100171733 244
450 3300009147 Ga0114129_10016867 Ga0114129_100168678 244
451 3300009553 Ga0105249_10687517 Ga0105249_106875171 244
452 3300025933 Ga0207706_10192847 Ga0207706_101928472 244
453 3300025938 Ga0207704_10135171 Ga0207704_101351712 244
454 3300025960 Ga0207651_10099224 Ga0207651_100992242 244
455 3300025961 Ga0207712_10189254 Ga0207712_101892541 244
456 3300025986 Ga0207658_10110774 Ga0207658_101107742 244
457 3300031344 Ga0265316_10151084 Ga0265316_101510842 244
458 3300031728 Ga0316578_10003864 Ga0316578_100038644 244
459 3300037471 Ga0395905_0084816 Ga0395905_0084816_1613_2401 244
460 3300042876 Ga0451577_0000479 Ga0451577_0000479_3402_4208 244
461 3300044712 Ga0453684_0002411 Ga0453684_0002411_20784_21590 244
462 3300044712 Ga0453684_0056585 Ga0453684_0056585_3093_3902 244
463 3300045051 Ga0451576_0041903 Ga0451576_0041903_3600_4406 244
464 3300046522 Ga0495643_0013971 Ga0495643_0013971_3370_4143 244
465 3300053125 Ga0500618_000543 Ga0500618_000543_17211_18002 244
466 iso_pu_bacteria 2857558681 2857561018 244
467 3300009011 Ga0105251_10162159 Ga0105251_101621591 245
468 3300025898 Ga0207692_10068585 Ga0207692_100685852 245
469 3300031665 Ga0316575_10023424 Ga0316575_100234244 245
470 3300031691 Ga0316579_10059174 Ga0316579_100591742 245
471 3300031728 Ga0316578_10008771 Ga0316578_100087714 245
472 3300032139 Ga0316580_10013716 Ga0316580_100137162 245
473 3300035398 Ga0316574_0005050 Ga0316574_0005050_3597_4427 245
474 3300049568 Ga0501031_0417905 Ga0501031_0417905_64_852 245
475 3300049570 Ga0501033_0200807 Ga0501033_0200807_334_1158 245
476 3300049571 Ga0501034_0070335 Ga0501034_0070335_2151_2939 245
477 3300049572 Ga0501036_0011863 Ga0501036_0011863_1684_2508 245
478 3300049575 Ga0501039_0013076 Ga0501039_0013076_4752_5576 245
479 3300049576 Ga0501040_0016487 Ga0501040_0016487_2160_2984 245
480 3300049577 Ga0501041_0005223 Ga0501041_0005223_1895_2719 245
481 3300049578 Ga0501042_0029726 Ga0501042_0029726_109_933 245
482 3300049580 Ga0501046_0034605 Ga0501046_0034605_2967_3791 245
483 3300049581 Ga0501047_0001745 Ga0501047_0001745_3431_4219 245
484 3300049588 Ga0501072_0006553 Ga0501072_0006553_3484_4308 245
485 3300049590 Ga0501074_0152065 Ga0501074_0152065_792_1616 245
486 3300049591 Ga0501075_0003826 Ga0501075_0003826_6673_7497 245
487 3300049591 Ga0501075_0087072 Ga0501075_0087072_915_1739 245
488 3300049592 Ga0501076_0000538 Ga0501076_0000538_23014_23838 245
489 3300049592 Ga0501076_0146857 Ga0501076_0146857_377_1201 245
490 3300049741 Ga0501079_0144454 Ga0501079_0144454_778_1602 245
491 3300049742 Ga0501080_0233382 Ga0501080_0233382_546_1370 245
492 3300049743 Ga0501081_0006631 Ga0501081_0006631_3273_4097 245
493 3300049822 Ga0501035_0004536 Ga0501035_0004536_3538_4326 245
494 3300049823 Ga0501044_0005080 Ga0501044_0005080_2818_3606 245
495 3300049824 Ga0501045_0004030 Ga0501045_0004030_3207_4031 245
496 3300050513 nmdc:mga0rr50_513266_c1 nmdc:mga0rr50_513266_c1_160_972 245
497 3300054114 Ga0501084_0033378 Ga0501084_0033378_756_1580 245
498 3300060353 Ga0501082_0001529 Ga0501082_0001529_3478_4302 245
499 3300061734 Ga0530510_0001545 Ga0530510_0001545_13715_14539 245
500 iso_pu_bacteria 8001522603 8001525924 245
501 iso_pu_bacteria 8047673197 8047677987 245
502 3300005840 Ga0068870_10230271 Ga0068870_102302712 246
503 3300031691 Ga0316579_10056447 Ga0316579_100564472 246
504 3300031733 Ga0316577_10120463 Ga0316577_101204632 246
505 3300032137 Ga0316585_10085674 Ga0316585_100856742 246
506 3300032168 Ga0316593_10009070 Ga0316593_100090703 246
507 3300036647 Ga0316582_0027041 Ga0316582_0027041_628_1443 246
508 3300036712 Ga0316584_0065584 Ga0316584_0065584_1486_2301 246
509 3300046520 Ga0495637_0058832 Ga0495637_0058832_221_1000 246
510 3300046522 Ga0495643_0001280 Ga0495643_0001280_1846_2625 246
511 3300048091 Ga0495626_0005215 Ga0495626_0005215_3412_4191 246
512 3300048091 Ga0495626_0008949 Ga0495626_0008949_1344_2123 246
513 3300048924 Ga0496121_0158818 Ga0496121_0158818_53_904 246
514 3300048927 Ga0496124_0000007 Ga0496124_0000007_648683_649534 246
515 3300053119 Ga0500595_048810 Ga0500595_048810_340_1161 246
516 iso_pu_bacteria 2738541297 2738830185 246
517 iso_pu_bacteria 2738541357 2739153981 246
518 iso_pu_bacteria 2738543003 2739195901 246
519 iso_pu_bacteria 2738543026 2739322377 246
520 iso_pu_bacteria 2738543029 2739340618 246
521 3300006844 Ga0075428_100406871 Ga0075428_1004068712 247
522 3300031548 Ga0307408_100000521 Ga0307408_10000052120 247
523 3300037418 Ga0395900_0000252 Ga0395900_0000252_13615_14400 247
524 3300044656 Ga0466969_0025226 Ga0466969_0025226_1842_2702 247
525 3300045049 Ga0466959_0008703 Ga0466959_0008703_489_1349 247
526 3300049822 Ga0501035_0002263 Ga0501035_0002263_7015_7800 247
527 iso_pu_bacteria 2857564685 2857568458 247
528 3300005436 Ga0070713_100000039 Ga0070713_10000003916 248
529 3300005841 Ga0068863_100291278 Ga0068863_1002912782 248
530 3300005844 Ga0068862_100783512 Ga0068862_1007835122 248
531 3300006058 Ga0075432_10077550 Ga0075432_100775502 248
532 3300006237 Ga0097621_100024893 Ga0097621_1000248934 248
533 3300009093 Ga0105240_10307314 Ga0105240_103073142 248
534 3300014969 Ga0157376_10008428 Ga0157376_100084286 248
535 3300025321 Ga0207656_10006731 Ga0207656_100067315 248
536 3300025928 Ga0207700_10000082 Ga0207700_1000008236 248
537 3300026088 Ga0207641_10009992 Ga0207641_100099922 248
538 3300026121 Ga0207683_10494145 Ga0207683_104941451 248
539 3300026142 Ga0207698_10001988 Ga0207698_100019884 248
540 3300031665 Ga0316575_10000019 Ga0316575_1000001924 248
541 3300031711 Ga0265314_10058736 Ga0265314_100587362 248
542 3300035398 Ga0316574_0009706 Ga0316574_0009706_2843_3667 248
543 3300035692 Ga0373935_0119168 Ga0373935_0119168_672_1511 248
544 3300044684 Ga0466966_0000712 Ga0466966_0000712_7257_8102 248
545 3300044719 Ga0466971_0016897 Ga0466971_0016897_620_1465 248
546 3300044842 Ga0466957_0002849 Ga0466957_0002849_2183_3028 248
547 3300046471 Ga0495650_0034111 Ga0495650_0034111_838_1623 248
548 3300046474 Ga0495605_0000023 Ga0495605_0000023_232343_233128 248
549 3300046507 Ga0495606_0005324 Ga0495606_0005324_2702_3493 248
550 3300046530 Ga0495654_0000015 Ga0495654_0000015_133355_134140 248
551 3300046539 Ga0495621_0005728 Ga0495621_0005728_813_1700 248
552 3300048907 Ga0496104_0037582 Ga0496104_0037582_855_1787 248
553 3300061719 Ga0466962_0000474 Ga0466962_0000474_2304_3149 248
554 iso_pu_bacteria 2891633521 2891634376 248
555 iso_pu_bacteria 2904424332 2904425450 248
556 3300005617 Ga0068859_100082222 Ga0068859_1000822223 249
557 3300006186 Ga0075369_10024329 Ga0075369_100243292 249
558 3300006931 Ga0097620_100082225 Ga0097620_1000822253 249
559 3300009094 Ga0111539_10302127 Ga0111539_103021272 249
560 3300010375 Ga0105239_10319843 Ga0105239_103198432 249
561 3300021361 Ga0213872_10095751 Ga0213872_100957512 249
562 3300021441 Ga0213871_10011521 Ga0213871_100115212 249
563 3300025936 Ga0207670_10100241 Ga0207670_101002412 249
564 3300030521 Ga0307511_10001004 Ga0307511_1000100414 249
565 3300032004 Ga0307414_10162842 Ga0307414_101628421 249
566 3300035114 Ga0373939_0077781 Ga0373939_0077781_215_1072 249
567 3300037312 Ga0395899_0079830 Ga0395899_0079830_458_1246 249
568 3300039438 Ga0436360_0627319 Ga0436360_0627319_1777_2562 249
569 3300039447 Ga0436361_0597437 Ga0436361_0597437_788_1573 249
570 3300039453 Ga0436362_0178065 Ga0436362_0178065_826_1611 249
571 3300044683 Ga0466965_0017310 Ga0466965_0017310_760_1548 249
572 3300044684 Ga0466966_0131208 Ga0466966_0131208_35_886 249
573 3300044706 Ga0466964_0046016 Ga0466964_0046016_514_1302 249
574 3300044735 Ga0466968_0005916 Ga0466968_0005916_1854_2642 249
575 3300044842 Ga0466957_0080072 Ga0466957_0080072_965_1753 249
576 3300044901 Ga0466960_0132986 Ga0466960_0132986_83_871 249
577 3300045049 Ga0466959_0020254 Ga0466959_0020254_1218_2006 249
578 3300045051 Ga0451576_0074358 Ga0451576_0074358_568_1425 249
579 3300045836 Ga0466958_0003846 Ga0466958_0003846_6042_6893 249
580 3300046457 Ga0495590_0046800 Ga0495590_0046800_409_1197 249
581 3300046474 Ga0495605_0000063 Ga0495605_0000063_75174_75962 249
582 3300046474 Ga0495605_0084818 Ga0495605_0084818_155_943 249
583 3300046491 Ga0495584_0000788 Ga0495584_0000788_16810_17598 249
584 3300046501 Ga0495607_0029177 Ga0495607_0029177_2393_3181 249
585 3300046506 Ga0495583_0000404 Ga0495583_0000404_10447_11235 249
586 3300046507 Ga0495606_0000089 Ga0495606_0000089_78933_79727 249
587 3300046507 Ga0495606_0002377 Ga0495606_0002377_1901_2689 249
588 3300046513 Ga0495616_0060210 Ga0495616_0060210_714_1502 249
589 3300046519 Ga0495632_0002784 Ga0495632_0002784_5343_6131 249
590 3300046522 Ga0495643_0013623 Ga0495643_0013623_1038_1826 249
591 3300046523 Ga0495644_0007048 Ga0495644_0007048_1135_1938 249
592 3300046528 Ga0495642_0000535 Ga0495642_0000535_18225_19013 249
593 3300046558 Ga0495633_0101553 Ga0495633_0101553_118_906 249
594 3300046665 Ga0495661_0038946 Ga0495661_0038946_1975_2763 249
595 3300046665 Ga0495661_0064705 Ga0495661_0064705_399_1187 249
596 3300046674 Ga0495588_0000127 Ga0495588_0000127_22103_22891 249
597 3300046794 Ga0495589_0001488 Ga0495589_0001488_3050_3838 249
598 3300046810 Ga0495660_0000625 Ga0495660_0000625_22059_22847 249
599 3300047320 Ga0495672_0002916 Ga0495672_0002916_12528_13316 249
600 3300047443 Ga0495687_000075 Ga0495687_000075_55058_55846 249
601 3300047443 Ga0495687_000701 Ga0495687_000701_33584_34372 249
602 3300048091 Ga0495626_0000111 Ga0495626_0000111_40631_41419 249
603 3300048925 Ga0496122_0161621 Ga0496122_0161621_176_964 249
604 3300048927 Ga0496124_0020891 Ga0496124_0020891_3103_3891 249
605 3300048927 Ga0496124_0136831 Ga0496124_0136831_998_1786 249
606 3300050511 nmdc:mga08y16_520259_c1 nmdc:mga08y16_520259_c1_18_875 249
607 3300050516 nmdc:mga0sz30_19901_c1 nmdc:mga0sz30_19901_c1_1071_1883 249
608 3300061719 Ga0466962_0130238 Ga0466962_0130238_165_953 249
609 iso_pu_bacteria 2511231026 2511387924 249
610 iso_pu_bacteria 2521172590 2521560651 249
611 iso_pu_bacteria 2551306416 2553008015 249
612 iso_pu_bacteria 2904439833 2904442969 249
613 iso_pu_bacteria 2904530477 2904534823 249
614 iso_pu_bacteria 2904584206 2904588848 249
615 iso_pu_bacteria 2904589729 2904594079 249
616 iso_pu_bacteria 2904601388 2904605077 249
617 iso_pu_bacteria 2919079590 2919083309 249
618 iso_pu_bacteria 2923510766 2923514458 249
619 iso_pu_bacteria 2928130867 2928133166 249
620 3300006038 Ga0075365_10048131 Ga0075365_100481313 250
621 3300006846 Ga0075430_100049829 Ga0075430_1000498293 250
622 3300025273 Ga0209673_1012551 Ga0209673_10125512 250
623 3300031727 Ga0316576_10182334 Ga0316576_101823342 250
624 3300031728 Ga0316578_10016759 Ga0316578_100167593 250
625 3300031733 Ga0316577_10031426 Ga0316577_100314262 250
626 3300032133 Ga0316583_10007052 Ga0316583_100070523 250
627 3300032137 Ga0316585_10009490 Ga0316585_100094902 250
628 3300032139 Ga0316580_10011290 Ga0316580_100112903 250
629 3300032168 Ga0316593_10003759 Ga0316593_100037592 250
630 3300037312 Ga0395899_0000008 Ga0395899_0000008_76733_77587 250
631 3300037312 Ga0395899_0039931 Ga0395899_0039931_898_1749 250
632 3300037418 Ga0395900_0000273 Ga0395900_0000273_76608_77462 250
633 3300037418 Ga0395900_0073562 Ga0395900_0073562_1931_2806 250
634 3300037466 Ga0395898_0000072 Ga0395898_0000072_114030_114884 250
635 3300037471 Ga0395905_0134292 Ga0395905_0134292_1441_2316 250
636 3300042876 Ga0451577_0000142 Ga0451577_0000142_145662_146537 250
637 3300044656 Ga0466969_0029612 Ga0466969_0029612_12_863 250
638 3300044693 Ga0466961_0000845 Ga0466961_0000845_73_924 250
639 3300044712 Ga0453684_0000126 Ga0453684_0000126_321459_322334 250
640 3300044842 Ga0466957_0020426 Ga0466957_0020426_44_898 250
641 3300045836 Ga0466958_0002090 Ga0466958_0002090_7236_8087 250
642 3300046452 Ga0495617_000096 Ga0495617_000096_39326_40117 250
643 3300046471 Ga0495650_0000530 Ga0495650_0000530_26199_26990 250
644 3300046492 Ga0495585_0002085 Ga0495585_0002085_262_1053 250
645 3300046512 Ga0495610_0000106 Ga0495610_0000106_19909_20700 250
646 3300046512 Ga0495610_0009910 Ga0495610_0009910_4919_5710 250
647 3300046524 Ga0495648_0004385 Ga0495648_0004385_629_1420 250
648 3300046524 Ga0495648_0029713 Ga0495648_0029713_2217_3008 250
649 3300046530 Ga0495654_0009030 Ga0495654_0009030_3409_4200 250
650 3300046558 Ga0495633_0015529 Ga0495633_0015529_2842_3633 250
651 3300046558 Ga0495633_0023233 Ga0495633_0023233_653_1444 250
652 3300046616 Ga0495668_0001675 Ga0495668_0001675_19480_20271 250
653 3300046665 Ga0495661_0205407 Ga0495661_0205407_85_876 250
654 3300046692 Ga0495671_0000006 Ga0495671_0000006_425219_426010 250
655 3300046692 Ga0495671_0007566 Ga0495671_0007566_4879_5670 250
656 3300046810 Ga0495660_0025700 Ga0495660_0025700_2040_2831 250
657 3300047323 Ga0495683_0119960 Ga0495683_0119960_174_965 250
658 3300047446 Ga0495679_011288 Ga0495679_011288_1489_2280 250
659 3300047446 Ga0495679_036998 Ga0495679_036998_352_1143 250
660 3300047469 Ga0495673_0000003 Ga0495673_0000003_700934_701725 250
661 3300047469 Ga0495673_0000061 Ga0495673_0000061_33911_34702 250
662 3300047469 Ga0495673_0000482 Ga0495673_0000482_41223_42014 250
663 3300048925 Ga0496122_0166245 Ga0496122_0166245_24_815 250
664 3300048929 Ga0496126_0012111 Ga0496126_0012111_909_1700 250
665 3300053145 Ga0500586_000310 Ga0500586_000310_2830_3621 250
666 iso_pu_bacteria 2511231002 2511247284 250
667 iso_pu_bacteria 2738543013 2739248904 250
668 iso_pu_bacteria 2842733646 2842736268 250
669 iso_pu_bacteria 639633007 639785789 250
670 3300002774 JGI25150J39212_1008568 JGI25150J39212_10085682 251
671 3300003763 Ga0055529_1000015 Ga0055529_1000015313 251
672 3300005347 Ga0070668_100214473 Ga0070668_1002144731 251
673 3300005456 Ga0070678_100581294 Ga0070678_1005812941 251
674 3300005842 Ga0068858_100188139 Ga0068858_1001881392 251
675 3300005843 Ga0068860_100238517 Ga0068860_1002385172 251
676 3300009098 Ga0105245_10002213 Ga0105245_100022137 251
677 3300025233 Ga0209437_117772 Ga0209437_1177721 251
678 3300025245 Ga0207425_1000455 Ga0207425_100045510 251
679 3300025272 Ga0209455_1000031 Ga0209455_1000031315 251
680 3300025297 Ga0209758_1000286 Ga0209758_100028665 251
681 3300025912 Ga0207707_10524161 Ga0207707_105241611 251
682 3300025972 Ga0207668_10367426 Ga0207668_103674261 251
683 3300026035 Ga0207703_10051154 Ga0207703_100511543 251
684 3300028381 Ga0268264_10021658 Ga0268264_100216585 251
685 3300032133 Ga0316583_10024330 Ga0316583_100243302 251
686 3300035695 Ga0373927_0133664 Ga0373927_0133664_515_1354 251
687 3300037068 Ga0373925_0054709 Ga0373925_0054709_1689_2528 251
688 3300037312 Ga0395899_0000637 Ga0395899_0000637_13487_14311 251
689 3300037312 Ga0395899_0002108 Ga0395899_0002108_4227_5051 251
690 3300037418 Ga0395900_0008082 Ga0395900_0008082_929_1753 251
691 3300037418 Ga0395900_0217281 Ga0395900_0217281_319_1143 251
692 3300037466 Ga0395898_0004624 Ga0395898_0004624_2751_3575 251
693 3300038443 Ga0395901_0003504 Ga0395901_0003504_2540_3364 251
694 3300038443 Ga0395901_0023068 Ga0395901_0023068_5123_5947 251
695 3300044683 Ga0466965_0082097 Ga0466965_0082097_304_1149 251
696 3300044684 Ga0466966_0000008 Ga0466966_0000008_38144_38995 251
697 3300044684 Ga0466966_0026979 Ga0466966_0026979_407_1252 251
698 3300046459 Ga0495629_0135803 Ga0495629_0135803_521_1360 251
699 3300046471 Ga0495650_0000276 Ga0495650_0000276_94148_94942 251
700 3300046472 Ga0495580_0028776 Ga0495580_0028776_1005_1844 251
701 3300046473 Ga0495582_0010500 Ga0495582_0010500_3384_4223 251
702 3300046475 Ga0495639_0073336 Ga0495639_0073336_351_1190 251
703 3300046531 Ga0495665_0009106 Ga0495665_0009106_1127_1966 251
704 3300046660 Ga0495625_0001881 Ga0495625_0001881_1227_2021 251
705 3300046681 Ga0495647_0017512 Ga0495647_0017512_875_1714 251
706 3300046683 Ga0495658_0002829 Ga0495658_0002829_4943_5782 251
707 3300047471 Ga0495684_0228986 Ga0495684_0228986_41_880 251
708 3300053098 Ga0500650_0000068 Ga0500650_0000068_12974_13795 251
709 3300061719 Ga0466962_0121293 Ga0466962_0121293_243_1088 251
710 iso_pu_bacteria 2574179768 2574431238 251
711 iso_pu_bacteria 2919476304 2919477298 251
712 3300003322 rootL2_10010907 rootL2_100109077 252
713 3300005548 Ga0070665_100246022 Ga0070665_1002460222 252
714 3300009551 Ga0105238_10076514 Ga0105238_100765142 252
715 3300010375 Ga0105239_10286758 Ga0105239_102867582 252
716 3300025263 Ga0209565_1012255 Ga0209565_10122551 252
717 3300025291 Ga0209675_1035674 Ga0209675_10356742 252
718 3300028379 Ga0268266_10254787 Ga0268266_102547872 252
719 3300046507 Ga0495606_0003493 Ga0495606_0003493_3298_4095 252
720 3300047472 Ga0495686_0000321 Ga0495686_0000321_35798_36628 252
721 3300049766 Ga0501269_000655 Ga0501269_000655_2105_2902 252
722 iso_pu_bacteria 2857542790 2857544340 252
723 iso_pu_bacteria 2857553236 2857557646 252
724 3300003751 Ga0055538_1000024 Ga0055538_100002419 253
725 3300003752 Ga0055539_1000031 Ga0055539_100003119 253
726 3300003756 Ga0055533_1000041 Ga0055533_100004119 253
727 3300003759 Ga0055525_1000049 Ga0055525_100004919 253
728 3300003841 Ga0055541_1000022 Ga0055541_100002219 253
729 3300006946 Ga0079104_1005965 Ga0079104_10059653 253
730 3300009093 Ga0105240_10095751 Ga0105240_100957513 253
731 3300009545 Ga0105237_10075212 Ga0105237_100752122 253
732 3300009551 Ga0105238_10000107 Ga0105238_1000010770 253
733 3300010375 Ga0105239_10001202 Ga0105239_100012029 253
734 3300025224 Ga0209784_100018 Ga0209784_10001819 253
735 3300025225 Ga0209566_100016 Ga0209566_10001619 253
736 3300025226 Ga0209674_100030 Ga0209674_10003019 253
737 3300025230 Ga0209563_100034 Ga0209563_10003419 253
738 3300025253 Ga0209677_100019 Ga0209677_10001919 253
739 3300025321 Ga0207656_10103733 Ga0207656_101037332 253
740 3300025913 Ga0207695_10009442 Ga0207695_100094424 253
741 3300025914 Ga0207671_10001336 Ga0207671_1000133621 253
742 3300025924 Ga0207694_10000130 Ga0207694_1000013018 253
743 3300025949 Ga0207667_10002863 Ga0207667_1000286310 253
744 3300025981 Ga0207640_10141902 Ga0207640_101419022 253
745 3300044673 Ga0453683_0034446 Ga0453683_0034446_1193_2083 253
746 3300045051 Ga0451576_0437782 Ga0451576_0437782_405_1280 253
747 3300046453 Ga0495627_000059 Ga0495627_000059_69637_70467 253
748 3300046538 Ga0495609_0000334 Ga0495609_0000334_4392_5222 253
749 3300046810 Ga0495660_0000365 Ga0495660_0000365_35618_36448 253
750 3300047470 Ga0495681_0027176 Ga0495681_0027176_1016_1846 253
751 3300048928 Ga0496125_0022520 Ga0496125_0022520_4586_5431 253
752 3300049459 Ga0495678_000030 Ga0495678_000030_48442_49272 253
753 iso_pu_bacteria 2511231003 2511250587 253
754 iso_pu_bacteria 2818991445 2819595331 253
755 iso_pu_bacteria 2884811622 2884814346 253
756 iso_pu_bacteria 2884836552 2884839281 253
757 iso_pu_bacteria 2884852848 2884856909 253
758 iso_pu_bacteria 2896154374 2896158255 253
759 iso_pu_bacteria 2904434214 2904436009 253
760 3300032004 Ga0307414_10194131 Ga0307414_101941312 254
761 iso_pu_bacteria 2513237150 2513953008 254
762 iso_pu_bacteria 2513237165 2514043889 254
763 iso_pu_bacteria 2643221603 2644026682 254
764 iso_pu_bacteria 644736347 644747378 254
765 3300006946 Ga0079104_1021330 Ga0079104_10213302 255
766 3300006948 Ga0099826_10000004 Ga0099826_10000004557 255
767 3300015261 Ga0182006_1000231 Ga0182006_100023122 255
768 3300015265 Ga0182005_1000037 Ga0182005_100003776 255
769 3300027111 Ga0209281_1022964 Ga0209281_10229642 255
770 3300027666 Ga0209282_1000015 Ga0209282_100001563 255
771 3300046474 Ga0495605_0005172 Ga0495605_0005172_3575_4444 255
772 3300046500 Ga0495596_0009131 Ga0495596_0009131_638_1507 255
773 3300046501 Ga0495607_0096620 Ga0495607_0096620_395_1264 255
774 3300046512 Ga0495610_0003895 Ga0495610_0003895_9827_10696 255
775 3300046513 Ga0495616_0012896 Ga0495616_0012896_3142_4011 255
776 3300046538 Ga0495609_0002742 Ga0495609_0002742_6628_7497 255
777 3300046692 Ga0495671_0005302 Ga0495671_0005302_3539_4408 255
778 3300047320 Ga0495672_0082684 Ga0495672_0082684_686_1555 255
779 3300048919 Ga0496116_0034917 Ga0496116_0034917_1812_2681 255
780 3300048924 Ga0496121_0034037 Ga0496121_0034037_732_1601 255
781 3300048925 Ga0496122_0014636 Ga0496122_0014636_3118_3987 255
782 3300048926 Ga0496123_0011977 Ga0496123_0011977_3407_4276 255
783 3300053161 Ga0500634_0051201 Ga0500634_0051201_1211_2050 255
784 iso_pu_bacteria 2721755763 2723875898 255
785 3300002704 JGI25155J39150_1000813 JGI25155J39150_10008132 256
786 3300002705 JGI25156J39149_1001146 JGI25156J39149_100114610 256
787 3300002737 JGI25162J39368_1000036 JGI25162J39368_1000036141 256
788 3300002737 JGI25162J39368_1003311 JGI25162J39368_10033113 256
789 3300002738 JGI25154J39366_1001229 JGI25154J39366_100122910 256
790 3300002741 JGI25157J39369_1000796 JGI25157J39369_100079610 256
791 3300003214 JGI25165J46597_1000022 JGI25165J46597_1000022218 256
792 3300003751 Ga0055538_1000011 Ga0055538_1000011139 256
793 3300003752 Ga0055539_1000016 Ga0055539_1000016218 256
794 3300003756 Ga0055533_1000019 Ga0055533_1000019218 256
795 3300003758 Ga0055532_1000074 Ga0055532_1000074109 256
796 3300003759 Ga0055525_1000042 Ga0055525_1000042141 256
797 3300003841 Ga0055541_1000017 Ga0055541_1000017153 256
798 3300005337 Ga0070682_100056181 Ga0070682_1000561812 256
799 3300005563 Ga0068855_100354900 Ga0068855_1003549002 256
800 3300005616 Ga0068852_100001737 Ga0068852_1000017378 256
801 3300009011 Ga0105251_10012206 Ga0105251_100122066 256
802 3300009093 Ga0105240_10016169 Ga0105240_1001616911 256
803 3300009093 Ga0105240_10110333 Ga0105240_101103332 256
804 3300009545 Ga0105237_10333826 Ga0105237_103338262 256
805 3300010375 Ga0105239_10181094 Ga0105239_101810943 256
806 3300014497 Ga0182008_10016132 Ga0182008_100161321 256
807 3300015261 Ga0182006_1013901 Ga0182006_10139014 256
808 3300015262 Ga0182007_10008818 Ga0182007_100088183 256
809 3300015265 Ga0182005_1005071 Ga0182005_10050713 256
810 3300025206 Ga0209435_100094 Ga0209435_10009411 256
811 3300025224 Ga0209784_100019 Ga0209784_100019296 256
812 3300025225 Ga0209566_100017 Ga0209566_100017296 256
813 3300025226 Ga0209674_100031 Ga0209674_100031296 256
814 3300025229 Ga0209147_100097 Ga0209147_100097142 256
815 3300025230 Ga0209563_100035 Ga0209563_100035296 256
816 3300025231 Ga0207427_100315 Ga0207427_10031516 256
817 3300025233 Ga0209437_100038 Ga0209437_100038296 256
818 3300025233 Ga0209437_100372 Ga0209437_10037234 256
819 3300025242 Ga0209258_100192 Ga0209258_100192108 256
820 3300025246 Ga0209646_1000103 Ga0209646_1000103142 256
821 3300025250 Ga0209026_1001208 Ga0209026_10012084 256
822 3300025253 Ga0209677_100020 Ga0209677_100020296 256
823 3300025256 Ga0209759_1000091 Ga0209759_1000091142 256
824 3300025261 Ga0209233_1000049 Ga0209233_1000049296 256
825 3300025272 Ga0209455_1006271 Ga0209455_10062712 256
826 3300025913 Ga0207695_10001362 Ga0207695_1000136211 256
827 3300025913 Ga0207695_10014244 Ga0207695_100142446 256
828 3300025914 Ga0207671_10098691 Ga0207671_100986913 256
829 3300025924 Ga0207694_10045075 Ga0207694_100450752 256
830 3300025949 Ga0207667_10004521 Ga0207667_100045217 256
831 3300044658 Ga0466972_0000070 Ga0466972_0000070_95764_96609 256
832 3300046457 Ga0495590_0000002 Ga0495590_0000002_66441_67250 256
833 3300046460 Ga0495638_0000367 Ga0495638_0000367_9419_10228 256
834 3300046462 Ga0495651_0010800 Ga0495651_0010800_5836_6702 256
835 3300046471 Ga0495650_0003997 Ga0495650_0003997_404_1213 256
836 3300046501 Ga0495607_0000300 Ga0495607_0000300_3454_4308 256
837 3300046501 Ga0495607_0004194 Ga0495607_0004194_2915_3724 256
838 3300046506 Ga0495583_0001717 Ga0495583_0001717_3199_4008 256
839 3300046507 Ga0495606_0005973 Ga0495606_0005973_3027_3836 256
840 3300046507 Ga0495606_0016928 Ga0495606_0016928_3294_4139 256
841 3300046511 Ga0495608_0095698 Ga0495608_0095698_324_1190 256
842 3300046516 Ga0495628_0001262 Ga0495628_0001262_3723_4589 256
843 3300046524 Ga0495648_0000037 Ga0495648_0000037_13214_14023 256
844 3300046538 Ga0495609_0001009 Ga0495609_0001009_6040_6849 256
845 3300046543 Ga0495645_0009956 Ga0495645_0009956_3021_3875 256
846 3300046557 Ga0495622_0000969 Ga0495622_0000969_13979_14788 256
847 3300046558 Ga0495633_0000433 Ga0495633_0000433_28730_29539 256
848 3300046616 Ga0495668_0001687 Ga0495668_0001687_16144_16953 256
849 3300046660 Ga0495625_0014029 Ga0495625_0014029_5351_6160 256
850 3300046660 Ga0495625_0021505 Ga0495625_0021505_581_1435 256
851 3300046680 Ga0495646_0012603 Ga0495646_0012603_1594_2448 256
852 3300046810 Ga0495660_0032884 Ga0495660_0032884_1732_2562 256
853 3300047320 Ga0495672_0000021 Ga0495672_0000021_28430_29260 256
854 3300047443 Ga0495687_001598 Ga0495687_001598_9336_10145 256
855 3300048925 Ga0496122_0009086 Ga0496122_0009086_8196_9050 256
856 3300048926 Ga0496123_0007120 Ga0496123_0007120_651_1505 256
857 3300049459 Ga0495678_004565 Ga0495678_004565_3202_4011 256
858 iso_pu_bacteria 2842711865 2842712648 256
859 3300009177 Ga0105248_10327176 Ga0105248_103271762 257
860 3300009177 Ga0105248_10408393 Ga0105248_104083932 257
861 3300025941 Ga0207711_10176446 Ga0207711_101764462 257
862 3300048904 Ga0496101_0365187 Ga0496101_0365187_92_943 257
863 3300048909 Ga0496106_0000074 Ga0496106_0000074_20552_21400 257
864 3300048921 Ga0496118_0210772 Ga0496118_0210772_267_1118 257
865 3300048924 Ga0496121_0000941 Ga0496121_0000941_20475_21323 257
866 3300048924 Ga0496121_0021261 Ga0496121_0021261_1645_2496 257
867 3300048929 Ga0496126_0000571 Ga0496126_0000571_50325_51167 257
868 3300003187 JGI25151J46595_10001128 JGI25151J46595_100011285 258
869 3300006051 Ga0075364_10003171 Ga0075364_100031716 258
870 3300025294 Ga0209025_1000769 Ga0209025_100076930 258
871 3300025294 Ga0209025_1000811 Ga0209025_10008117 258
872 3300025294 Ga0209025_1012056 Ga0209025_10120562 258
873 3300025299 Ga0209256_1000726 Ga0209256_10007267 258
874 3300025303 Ga0209051_1010900 Ga0209051_10109002 258
875 3300047317 Ga0495604_0027537 Ga0495604_0027537_411_1259 258
876 3300047318 Ga0495636_0063802 Ga0495636_0063802_395_1243 258
877 3300048905 Ga0496102_0118990 Ga0496102_0118990_188_1072 258
878 3300049571 Ga0501034_0000588 Ga0501034_0000588_35598_36446 258
879 3300050491 nmdc:mga00v17_28740_c1 nmdc:mga00v17_28740_c1_623_1462 258
880 3300048920 Ga0496117_0006812 Ga0496117_0006812_7755_8603 259
881 3300048921 Ga0496118_0003604 Ga0496118_0003604_7764_8612 259
882 iso_pu_bacteria 2501025502 2501078623 259
883 iso_pu_bacteria 2501025504 2501414262 259
884 iso_pu_bacteria 2510917013 2511089273 259
885 iso_pu_bacteria 2510917014 2511094483 259
886 iso_pu_bacteria 2510917015 2511104253 259
887 iso_pu_bacteria 2513237082 2513552863 259
888 iso_pu_bacteria 2513237083 2513561654 259
889 iso_pu_bacteria 2519103095 2519458036 259
890 iso_pu_bacteria 2582581311 2585294333 259
891 iso_pu_bacteria 2816332253 2817260201 259
892 iso_pu_bacteria 2816332256 2817277868 259
893 iso_pu_bacteria 2816332286 2817451054 259
894 iso_pu_bacteria 2856287931 2856291572 259
895 iso_pu_bacteria 2857357740 2857364630 259
896 iso_pu_bacteria 2883087390 2883093884 259
897 iso_pu_bacteria 2928157003 2928159693 259
898 iso_pu_bacteria 2928163908 2928164253 259
899 iso_pu_bacteria 2981990288 2981994128 259
900 iso_pu_bacteria 641736154 642416824 259
901 iso_pu_bacteria 8003955200 8003958510 259
902 iso_pu_bacteria 8020807995 8020813851 259
903 iso_pu_bacteria 8039098773 8039099342 259
904 iso_pu_bacteria 8040167225 8040170491 259
905 iso_pu_bacteria 8040173305 8040178862 259
906 3300003771 Ga0055526_1000411 Ga0055526_100041115 260
907 3300005356 Ga0070674_100126848 Ga0070674_1001268482 260
908 3300005543 Ga0070672_100096157 Ga0070672_1000961573 260
909 3300009036 Ga0105244_10003810 Ga0105244_100038102 260
910 3300014326 Ga0157380_10033626 Ga0157380_100336263 260
911 3300025233 Ga0209437_108698 Ga0209437_1086982 260
912 3300025246 Ga0209646_1000051 Ga0209646_1000051267 260
913 3300025295 Ga0209564_1000011 Ga0209564_1000011324 260
914 3300025728 Ga0207655_1025647 Ga0207655_10256472 260
915 3300025937 Ga0207669_10077219 Ga0207669_100772192 260
916 3300025940 Ga0207691_10204250 Ga0207691_102042502 260
917 3300025972 Ga0207668_10004274 Ga0207668_100042746 260
918 3300026118 Ga0207675_100047608 Ga0207675_1000476083 260
919 3300028794 Ga0307515_10107895 Ga0307515_101078952 260
920 3300028800 Ga0265338_10000057 Ga0265338_10000057179 260
921 3300031247 Ga0265340_10034005 Ga0265340_100340052 260
922 3300032005 Ga0307411_10350680 Ga0307411_103506802 260
923 3300046471 Ga0495650_0000019 Ga0495650_0000019_355148_356008 260
924 3300046471 Ga0495650_0001558 Ga0495650_0001558_3320_4177 260
925 3300046501 Ga0495607_0039243 Ga0495607_0039243_1474_2331 260
926 3300046507 Ga0495606_0000001 Ga0495606_0000001_580256_581113 260
927 3300046507 Ga0495606_0000526 Ga0495606_0000526_15746_16606 260
928 3300046507 Ga0495606_0015771 Ga0495606_0015771_4318_5175 260
929 3300046512 Ga0495610_0003952 Ga0495610_0003952_591_1448 260
930 3300046512 Ga0495610_0054009 Ga0495610_0054009_133_990 260
931 3300046522 Ga0495643_0000312 Ga0495643_0000312_62616_63473 260
932 3300046522 Ga0495643_0002513 Ga0495643_0002513_529_1386 260
933 3300046524 Ga0495648_0009791 Ga0495648_0009791_3500_4357 260
934 3300046542 Ga0495597_0000874 Ga0495597_0000874_9360_10217 260
935 3300046542 Ga0495597_0002290 Ga0495597_0002290_609_1466 260
936 3300046558 Ga0495633_0000244 Ga0495633_0000244_22306_23163 260
937 3300046558 Ga0495633_0014264 Ga0495633_0014264_2783_3640 260
938 3300046616 Ga0495668_0000241 Ga0495668_0000241_15028_15885 260
939 3300046660 Ga0495625_0026803 Ga0495625_0026803_2990_3847 260
940 3300046694 Ga0495649_0088312 Ga0495649_0088312_665_1522 260
941 3300046694 Ga0495649_0111947 Ga0495649_0111947_441_1298 260
942 3300047320 Ga0495672_0000707 Ga0495672_0000707_35270_36127 260
943 3300048905 Ga0496102_0138631 Ga0496102_0138631_1253_2116 260
944 3300048919 Ga0496116_0053557 Ga0496116_0053557_229_1086 260
945 3300048927 Ga0496124_0106637 Ga0496124_0106637_155_1012 260
946 3300049459 Ga0495678_001619 Ga0495678_001619_3387_4244 260
947 3300046462 Ga0495651_0183498 Ga0495651_0183498_21_884 261
948 3300046679 Ga0495623_0031408 Ga0495623_0031408_852_1715 261
949 3300048088 Ga0495602_0009621 Ga0495602_0009621_2508_3371 261
950 3300047443 Ga0495687_032607 Ga0495687_032607_1458_2324 262
951 3300003758 Ga0055532_1000801 Ga0055532_100080111 263
952 3300003760 Ga0055527_1000332 Ga0055527_10003326 263
953 3300003761 Ga0055535_1001462 Ga0055535_10014623 263
954 3300003762 Ga0055542_1007926 Ga0055542_10079262 263
955 3300003763 Ga0055529_1004858 Ga0055529_10048582 263
956 3300005329 Ga0070683_100506879 Ga0070683_1005068792 263
957 3300005339 Ga0070660_100000008 Ga0070660_100000008102 263
958 3300005366 Ga0070659_100000014 Ga0070659_100000014179 263
959 3300005564 Ga0070664_100078181 Ga0070664_1000781812 263
960 3300005577 Ga0068857_100194748 Ga0068857_1001947482 263
961 3300005578 Ga0068854_100622411 Ga0068854_1006224111 263
962 3300005616 Ga0068852_100167306 Ga0068852_1001673062 263
963 3300009545 Ga0105237_10049330 Ga0105237_100493302 263
964 3300009551 Ga0105238_10018714 Ga0105238_100187144 263
965 3300010375 Ga0105239_10038533 Ga0105239_100385334 263
966 3300013105 Ga0157369_10105708 Ga0157369_101057083 263
967 3300025228 Ga0209672_100083 Ga0209672_10008313 263
968 3300025229 Ga0209147_100244 Ga0209147_10024449 263
969 3300025242 Ga0209258_100405 Ga0209258_10040549 263
970 3300025254 Ga0209148_1002102 Ga0209148_10021024 263
971 3300025256 Ga0209759_1003935 Ga0209759_10039353 263
972 3300025272 Ga0209455_1001485 Ga0209455_10014853 263
973 3300025904 Ga0207647_10006741 Ga0207647_100067418 263
974 3300025909 Ga0207705_10076640 Ga0207705_100766402 263
975 3300025913 Ga0207695_10135148 Ga0207695_101351482 263
976 3300025914 Ga0207671_10024297 Ga0207671_100242973 263
977 3300025919 Ga0207657_10000018 Ga0207657_1000001850 263
978 3300025932 Ga0207690_10000006 Ga0207690_10000006102 263
979 3300025945 Ga0207679_10194028 Ga0207679_101940282 263
980 3300025949 Ga0207667_10035111 Ga0207667_100351114 263
981 3300026116 Ga0207674_10078055 Ga0207674_100780553 263
982 3300026142 Ga0207698_10106897 Ga0207698_101068972 263
983 3300047472 Ga0495686_0000032 Ga0495686_0000032_14734_15612 263
984 3300061719 Ga0466962_0022225 Ga0466962_0022225_1559_2416 263
985 3300002067 JGI24735J21928_10000096 JGI24735J21928_100000963 265
986 3300005335 Ga0070666_10008187 Ga0070666_100081875 265
987 3300005355 Ga0070671_100348900 Ga0070671_1003489001 265
988 3300005364 Ga0070673_100112110 Ga0070673_1001121102 265
989 3300005367 Ga0070667_100188207 Ga0070667_1001882071 265
990 3300009036 Ga0105244_10171220 Ga0105244_101712201 265
991 3300009093 Ga0105240_10319900 Ga0105240_103199002 265
992 3300009545 Ga0105237_10165516 Ga0105237_101655162 265
993 3300009551 Ga0105238_10165334 Ga0105238_101653342 265
994 3300011119 Ga0105246_10147303 Ga0105246_101473031 265
995 3300013105 Ga0157369_10136063 Ga0157369_101360631 265
996 3300013306 Ga0163162_10003435 Ga0163162_1000343513 265
997 3300013308 Ga0157375_10127589 Ga0157375_101275893 265
998 3300025246 Ga0209646_1013337 Ga0209646_10133372 265
999 3300025302 Ga0207426_1012223 Ga0207426_10122233 265
1000 3300025735 Ga0207713_1012892 Ga0207713_10128923 265
1001 3300025903 Ga0207680_10002625 Ga0207680_100026257 265
1002 3300025904 Ga0207647_10013565 Ga0207647_100135653 265
1003 3300025913 Ga0207695_10234924 Ga0207695_102349241 265
1004 3300025914 Ga0207671_10082299 Ga0207671_100822993 265
1005 3300025960 Ga0207651_10084821 Ga0207651_100848211 265
1006 3300026067 Ga0207678_10152990 Ga0207678_101529902 265
1007 3300026121 Ga0207683_10242392 Ga0207683_102423922 265
1008 3300028379 Ga0268266_10308091 Ga0268266_103080912 265
1009 3300044693 Ga0466961_0006638 Ga0466961_0006638_5040_5924 265
1010 3300046455 Ga0495603_0010749 Ga0495603_0010749_4571_5437 265
1011 3300046457 Ga0495590_0002012 Ga0495590_0002012_4551_5435 265
1012 3300046457 Ga0495590_0021765 Ga0495590_0021765_702_1568 265
1013 3300046459 Ga0495629_0000692 Ga0495629_0000692_155_1021 265
1014 3300046459 Ga0495629_0226796 Ga0495629_0226796_278_1144 265
1015 3300046460 Ga0495638_0015361 Ga0495638_0015361_814_1680 265
1016 3300046471 Ga0495650_0006041 Ga0495650_0006041_5995_6861 265
1017 3300046471 Ga0495650_0054316 Ga0495650_0054316_345_1211 265
1018 3300046471 Ga0495650_0084299 Ga0495650_0084299_122_988 265
1019 3300046473 Ga0495582_0071794 Ga0495582_0071794_286_1152 265
1020 3300046475 Ga0495639_0033278 Ga0495639_0033278_1339_2205 265
1021 3300046506 Ga0495583_0038678 Ga0495583_0038678_1363_2229 265
1022 3300046507 Ga0495606_0059145 Ga0495606_0059145_66_932 265
1023 3300046507 Ga0495606_0094533 Ga0495606_0094533_611_1477 265
1024 3300046516 Ga0495628_0204342 Ga0495628_0204342_40_924 265
1025 3300046543 Ga0495645_0063919 Ga0495645_0063919_1429_2295 265
1026 3300046559 Ga0495667_0161275 Ga0495667_0161275_414_1280 265
1027 3300046680 Ga0495646_0134589 Ga0495646_0134589_122_1006 265
1028 3300046684 Ga0495669_0038374 Ga0495669_0038374_653_1519 265
1029 3300046684 Ga0495669_0091817 Ga0495669_0091817_280_1146 265
1030 3300046690 Ga0495624_0054694 Ga0495624_0054694_25_909 265
1031 3300046690 Ga0495624_0172427 Ga0495624_0172427_287_1171 265
1032 3300046691 Ga0495670_0024761 Ga0495670_0024761_1560_2426 265
1033 3300046694 Ga0495649_0008178 Ga0495649_0008178_2006_2872 265
1034 3300046694 Ga0495649_0103208 Ga0495649_0103208_50_919 265
1035 3300047315 Ga0495581_0115185 Ga0495581_0115185_587_1453 265
1036 3300047319 Ga0495674_0031179 Ga0495674_0031179_3258_4145 265
1037 3300047322 Ga0495680_0137293 Ga0495680_0137293_774_1640 265
1038 3300047323 Ga0495683_0001181 Ga0495683_0001181_6715_7599 265
1039 3300047443 Ga0495687_000104 Ga0495687_000104_53001_53870 265
1040 3300047673 Ga0495593_0087226 Ga0495593_0087226_149_1015 265
1041 3300047673 Ga0495593_0090669 Ga0495593_0090669_519_1403 265
1042 3300048091 Ga0495626_0137219 Ga0495626_0137219_141_1007 265
1043 3300048903 Ga0496100_0329855 Ga0496100_0329855_148_1014 265
1044 3300048904 Ga0496101_0013191 Ga0496101_0013191_4579_5463 265
1045 3300048904 Ga0496101_0154023 Ga0496101_0154023_720_1604 265
1046 3300048904 Ga0496101_0184877 Ga0496101_0184877_483_1349 265
1047 3300048905 Ga0496102_0002066 Ga0496102_0002066_9348_10232 265
1048 3300048905 Ga0496102_0017450 Ga0496102_0017450_1276_2142 265
1049 3300048905 Ga0496102_0210216 Ga0496102_0210216_448_1314 265
1050 3300048906 Ga0496103_0005550 Ga0496103_0005550_5201_6085 265
1051 3300048906 Ga0496103_0124176 Ga0496103_0124176_623_1507 265
1052 3300048907 Ga0496104_0156828 Ga0496104_0156828_160_1044 265
1053 3300048908 Ga0496105_0123909 Ga0496105_0123909_184_1068 265
1054 3300048909 Ga0496106_0012232 Ga0496106_0012232_5247_6131 265
1055 3300048912 Ga0496109_0114677 Ga0496109_0114677_562_1446 265
1056 3300048913 Ga0496110_0152920 Ga0496110_0152920_413_1297 265
1057 3300048913 Ga0496110_0187063 Ga0496110_0187063_202_1068 265
1058 3300048917 Ga0496114_0088778 Ga0496114_0088778_1515_2381 265
1059 3300048917 Ga0496114_0500447 Ga0496114_0500447_55_921 265
1060 3300048919 Ga0496116_0026363 Ga0496116_0026363_2188_3072 265
1061 3300048920 Ga0496117_0049092 Ga0496117_0049092_2053_2937 265
1062 3300048921 Ga0496118_0023850 Ga0496118_0023850_1379_2263 265
1063 3300048924 Ga0496121_0004681 Ga0496121_0004681_10141_11025 265
1064 3300048925 Ga0496122_0005686 Ga0496122_0005686_10731_11615 265
1065 3300048927 Ga0496124_0044825 Ga0496124_0044825_2584_3468 265
1066 3300048928 Ga0496125_0009075 Ga0496125_0009075_2950_3834 265
1067 3300048929 Ga0496126_0069666 Ga0496126_0069666_939_1823 265
1068 3300048929 Ga0496126_0159782 Ga0496126_0159782_774_1658 265
1069 3300048929 Ga0496126_0246949 Ga0496126_0246949_409_1293 265
1070 3300053125 Ga0500618_002981 Ga0500618_002981_4591_5514 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

79

234

0.96

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

284

307

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.7812 34 252
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.7124 33 252
8fw5-assembly1.cif.gz_D chimeric hsgator1-spgtr-splam complex 0.6832 60 84
2awn-assembly1.cif.gz_A crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.6808 34 252
6wnr-assembly1.cif.gz_C e. coli atp synthase state 3b 0.6482 54 76
ID Description Score Start End Superfamily
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9199 31 92 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8188 34 116 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7754 34 247 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7673 31 92 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7602 34 247 3.40.50.300
ID Description Score Start End GO Terms
AF-V8NDR4-F1-model_v4 Antigen peptide transporter 2 0.7511 21 252 GO:0005524
GO:0015421
GO:0016020
GO:0016887
AF-A0A536ETP5-F1-model_v4 ABC transporter ATP-binding protein 0.7471 32 261 GO:0005524
GO:0016887
GO:0055052
AF-A0A2S3U666-F1-model_v4 Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD 0.7379 31 254 GO:0005524
GO:0016887
AF-A0A127QVM3-F1-model_v4 Urea ABC transporter, ATP-binding protein UrtD 0.6818 26 265 GO:0005524
GO:0005886
GO:0016887
AF-A0A839HF54-F1-model_v4 Urea ABC transporter ATP-binding protein UrtD 0.6718 14 265 GO:0005524
GO:0005886
GO:0016887

Feature Viewer

pLDDT pTM Quality
77.3 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map