F489475
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1070 | 534 | 998 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300053125|Ga0500618_002981|Ga0500618_002981_4591_5514 |
| Length | 307 |
| Sequence | MDTTMRLQDANDAAGVSANIKATGVVDVPNPIPESISGAGQHMTSGLGHIVKPDTIDVSHGPILYLEDVTVSFDGFRALNKLSLSIDDGELRCVIGPNGAGKTTMMDVITGKTRAQEGKVFLGQTLDLRRMDEPSIARAGIGRKFQKPTVFEQHPVWENLELAMKSDKRWFAALRAKLDPASQARIEEVLTTIRLEDAAYRTAGELSHGQKQRLEIGMLLMQQPQLLLLDEPAAGITDDETMELAGLLNSLRGRCSMMVVEHDMDFVAALAGETGRVTVMAEGSVLAEGTLDQVKRDERVIESYLGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 3 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 4 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 5 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 6 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 7 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 8 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 9 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 10 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 11 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 12 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 13 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 14 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 15 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 16 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 17 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 18 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 19 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 20 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 21 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 22 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 23 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 24 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 25 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 26 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 27 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 28 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 29 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 30 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 31 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 32 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 33 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 34 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 35 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 36 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 37 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 38 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 39 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 40 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 41 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 42 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 43 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 44 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 45 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 46 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 47 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 48 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 49 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 50 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 51 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 52 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 53 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 54 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 55 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 56 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 57 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 58 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 59 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 60 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 61 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 62 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 63 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 64 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 65 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 66 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 67 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 68 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 69 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 70 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 71 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 72 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 73 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 74 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 75 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 76 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 77 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 78 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 79 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 80 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 81 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 82 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 83 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 84 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 85 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 86 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 87 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 88 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 89 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 90 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 91 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 92 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 93 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 94 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 95 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 96 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 97 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 98 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 100 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 103 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 105 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 107 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 116 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 119 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 125 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 127 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 128 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 133 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 135 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 136 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 137 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 139 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 140 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 141 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 142 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 143 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 144 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 145 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 146 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 147 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 148 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 149 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 150 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 151 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 152 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 153 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 154 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 155 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 156 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 157 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 158 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 159 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 160 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 161 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 163 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 164 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 165 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 166 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 167 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 168 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 169 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 171 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 172 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 173 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 174 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 190 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 200 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 203 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 204 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 205 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 206 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 208 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 209 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 210 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 220 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 221 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 222 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 225 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 226 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 228 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 230 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 232 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 235 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 238 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 296 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 297 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 301 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 302 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 303 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 304 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 305 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 306 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 307 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 308 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 309 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 310 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 311 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 312 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 313 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 314 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 315 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 316 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 317 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 318 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 319 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 320 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 321 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 322 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 323 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 324 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 325 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 327 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 328 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 329 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 330 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 331 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 332 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 333 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 334 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 335 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 336 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 337 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 338 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 339 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 340 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 341 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 342 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 343 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 344 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 345 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 346 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 347 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 348 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 349 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 350 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 351 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 352 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 353 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 354 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 355 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 356 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 357 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 358 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 359 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 360 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 361 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 362 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 363 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 364 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 365 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 366 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 367 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 368 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 369 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 370 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 371 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 372 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 373 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 374 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 375 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 376 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 449 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 450 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 451 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 452 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 453 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 454 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 455 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 456 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 457 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 458 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 459 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 460 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 461 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 462 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 463 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 464 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 465 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 466 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 467 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 468 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 469 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 470 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 490 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 493 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 495 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 496 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 499 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 500 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 501 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 502 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 503 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 510 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 511 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 512 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 513 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 514 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 515 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 516 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 517 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 518 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 519 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 520 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 521 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 522 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 523 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 524 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 525 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 526 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 527 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 528 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 529 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 530 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 531 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 532 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 533 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 534 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.08 |
| Metatranscriptomes | 0.19 |
| Isolates | 6.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.57 |
| Nodule | 1.5 |
| Rhizoplane | 2.99 |
| Rhizosphere | 68.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10000096 | 3300002067 | Bacteria | 32409 |
| 2 | JGI25155J39150_1000813 | 3300002704 | Bacteria | 4887 |
| 3 | JGI25156J39149_1001146 | 3300002705 | Bacteria | 11872 |
| 4 | JGI25162J39368_1000036 | 3300002737 | Bacteria | 180433 |
| 5 | JGI25162J39368_1003311 | 3300002737 | Bacteria | 4835 |
| 6 | JGI25154J39366_1001229 | 3300002738 | Bacteria | 9652 |
| 7 | JGI25157J39369_1000796 | 3300002741 | Bacteria | 16066 |
| 8 | JGI25150J39212_1008568 | 3300002774 | Bacteria | 1994 |
| 9 | JGI25159J45721_1000166 | 3300002987 | Bacteria | 30609 |
| 10 | JGI25151J46595_10001128 | 3300003187 | Bacteria | 19432 |
| 11 | JGI25151J46595_10001423 | 3300003187 | Bacteria | 16347 |
| 12 | JGI25151J46595_10022278 | 3300003187 | Bacteria | 2633 |
| 13 | JGI25165J46597_1000022 | 3300003214 | Bacteria | 357959 |
| 14 | rootL2_10010907 | 3300003322 | Bacteria | 8662 |
| 15 | JGI25160J50197_1000352 | 3300003354 | Bacteria | 30609 |
| 16 | JGI25161J50226_1000268 | 3300003374 | Bacteria | 30609 |
| 17 | Ga0055538_1000011 | 3300003751 | Bacteria | 357959 |
| 18 | Ga0055538_1000024 | 3300003751 | Bacteria | 241526 |
| 19 | Ga0055539_1000016 | 3300003752 | Bacteria | 358248 |
| 20 | Ga0055539_1000031 | 3300003752 | Bacteria | 241526 |
| 21 | Ga0055533_1000019 | 3300003756 | Bacteria | 357959 |
| 22 | Ga0055533_1000041 | 3300003756 | Bacteria | 241526 |
| 23 | Ga0055532_1000074 | 3300003758 | Bacteria | 125513 |
| 24 | Ga0055532_1000801 | 3300003758 | Bacteria | 10873 |
| 25 | Ga0055532_1006666 | 3300003758 | Bacteria | 1529 |
| 26 | Ga0055525_1000042 | 3300003759 | Bacteria | 279804 |
| 27 | Ga0055525_1000049 | 3300003759 | Bacteria | 241526 |
| 28 | Ga0055527_1000332 | 3300003760 | Bacteria | 25122 |
| 29 | Ga0055527_1002750 | 3300003760 | Bacteria | 2845 |
| 30 | Ga0055535_1000760 | 3300003761 | Bacteria | 23926 |
| 31 | Ga0055535_1001462 | 3300003761 | Bacteria | 11901 |
| 32 | Ga0055542_1000127 | 3300003762 | Bacteria | 100078 |
| 33 | Ga0055542_1007926 | 3300003762 | Bacteria | 2112 |
| 34 | Ga0055529_1000015 | 3300003763 | Bacteria | 366950 |
| 35 | Ga0055529_1004858 | 3300003763 | Bacteria | 2008 |
| 36 | Ga0055526_1000411 | 3300003771 | Bacteria | 34678 |
| 37 | Ga0055537_1000209 | 3300003773 | Bacteria | 43625 |
| 38 | Ga0055537_1008280 | 3300003773 | Bacteria | 2415 |
| 39 | Ga0055537_1008698 | 3300003773 | Bacteria | 2318 |
| 40 | Ga0055536_1005808 | 3300003781 | Bacteria | 5937 |
| 41 | Ga0055536_1021092 | 3300003781 | Bacteria | 1989 |
| 42 | Ga0055534_1000204 | 3300003784 | Bacteria | 43602 |
| 43 | Ga0055528_1000531 | 3300003790 | Bacteria | 29380 |
| 44 | Ga0055528_1034292 | 3300003790 | Bacteria | 1254 |
| 45 | Ga0055530_10000929 | 3300003791 | Bacteria | 24035 |
| 46 | Ga0055530_10003395 | 3300003791 | Bacteria | 9087 |
| 47 | Ga0055530_10005486 | 3300003791 | Bacteria | 6008 |
| 48 | Ga0055530_10044041 | 3300003791 | Bacteria | 1073 |
| 49 | Ga0055540_1001184 | 3300003792 | Bacteria | 16088 |
| 50 | Ga0055540_1001797 | 3300003792 | Bacteria | 12200 |
| 51 | Ga0055540_1004397 | 3300003792 | Bacteria | 6378 |
| 52 | Ga0055531_10000566 | 3300003794 | Bacteria | 32450 |
| 53 | Ga0055531_10001763 | 3300003794 | Bacteria | 15421 |
| 54 | Ga0055541_1000017 | 3300003841 | Bacteria | 286811 |
| 55 | Ga0055541_1000022 | 3300003841 | Bacteria | 241526 |
| 56 | Ga0055543_1000361 | 3300004625 | Bacteria | 30407 |
| 57 | Ga0055543_1001214 | 3300004625 | Bacteria | 10824 |
| 58 | Ga0065165_1004330 | 3300005262 | Bacteria | 8913 |
| 59 | Ga0065165_1004677 | 3300005262 | Bacteria | 8264 |
| 60 | Ga0065165_1008599 | 3300005262 | Bacteria | 4743 |
| 61 | Ga0065165_1028618 | 3300005262 | Bacteria | 1796 |
| 62 | Ga0065714_10022629 | 3300005288 | Bacteria | 1648 |
| 63 | Ga0065704_10005654 | 3300005289 | Bacteria | 3379 |
| 64 | Ga0070683_100093142 | 3300005329 | Bacteria | 2830 |
| 65 | Ga0070683_100506879 | 3300005329 | Bacteria | 1153 |
| 66 | Ga0070690_100287651 | 3300005330 | Bacteria | 1175 |
| 67 | Ga0070670_100150757 | 3300005331 | Bacteria | 2012 |
| 68 | Ga0070677_10037616 | 3300005333 | Bacteria | 1889 |
| 69 | Ga0068869_100001022 | 3300005334 | Bacteria | 16269 |
| 70 | Ga0068869_100011250 | 3300005334 | Bacteria | 5862 |
| 71 | Ga0070666_10008187 | 3300005335 | Bacteria | 6478 |
| 72 | Ga0070680_100188240 | 3300005336 | Bacteria | 1739 |
| 73 | Ga0070682_100056181 | 3300005337 | Bacteria | 2475 |
| 74 | Ga0068868_100189855 | 3300005338 | Bacteria | 1708 |
| 75 | Ga0068868_100360833 | 3300005338 | Bacteria | 1246 |
| 76 | Ga0070660_100000008 | 3300005339 | Bacteria | 155650 |
| 77 | Ga0070660_100090113 | 3300005339 | Bacteria | 2417 |
| 78 | Ga0070661_100381930 | 3300005344 | Bacteria | 1110 |
| 79 | Ga0070668_100214473 | 3300005347 | Bacteria | 1585 |
| 80 | Ga0070668_100309274 | 3300005347 | Bacteria | 1327 |
| 81 | Ga0070668_100474225 | 3300005347 | Bacteria | 1080 |
| 82 | Ga0070669_100012521 | 3300005353 | Bacteria | 6018 |
| 83 | Ga0070675_100008605 | 3300005354 | Bacteria | 7924 |
| 84 | Ga0070671_100040429 | 3300005355 | Bacteria | 3873 |
| 85 | Ga0070671_100252295 | 3300005355 | Bacteria | 1499 |
| 86 | Ga0070671_100338804 | 3300005355 | Bacteria | 1282 |
| 87 | Ga0070671_100348900 | 3300005355 | Bacteria | 1263 |
| 88 | Ga0070674_100126848 | 3300005356 | Bacteria | 1897 |
| 89 | Ga0070673_100053368 | 3300005364 | Bacteria | 3175 |
| 90 | Ga0070673_100112110 | 3300005364 | Bacteria | 2263 |
| 91 | Ga0070673_100131740 | 3300005364 | Bacteria | 2099 |
| 92 | Ga0070688_100318799 | 3300005365 | Bacteria | 1129 |
| 93 | Ga0070659_100000014 | 3300005366 | Bacteria | 178272 |
| 94 | Ga0070659_100033084 | 3300005366 | Bacteria | 4014 |
| 95 | Ga0070659_100055093 | 3300005366 | Bacteria | 3133 |
| 96 | Ga0070659_100104663 | 3300005366 | Bacteria | 2280 |
| 97 | Ga0070667_100184810 | 3300005367 | Bacteria | 1844 |
| 98 | Ga0070667_100188207 | 3300005367 | Bacteria | 1828 |
| 99 | Ga0070667_100228928 | 3300005367 | Bacteria | 1657 |
| 100 | Ga0070709_10019138 | 3300005434 | Bacteria | 3952 |
| 101 | Ga0070713_100000039 | 3300005436 | Bacteria | 83384 |
| 102 | Ga0070713_100417020 | 3300005436 | Bacteria | 1256 |
| 103 | Ga0070713_100566618 | 3300005436 | Bacteria | 1077 |
| 104 | Ga0070710_10224337 | 3300005437 | Bacteria | 1197 |
| 105 | Ga0070711_100218548 | 3300005439 | Bacteria | 1480 |
| 106 | Ga0070678_100581294 | 3300005456 | Bacteria | 998 |
| 107 | Ga0070662_100021829 | 3300005457 | Bacteria | 4375 |
| 108 | Ga0070681_10118465 | 3300005458 | Bacteria | 2584 |
| 109 | Ga0070698_100025906 | 3300005471 | Bacteria | 6109 |
| 110 | Ga0070679_100040681 | 3300005530 | Bacteria | 4625 |
| 111 | Ga0068853_100025396 | 3300005539 | Bacteria | 4969 |
| 112 | Ga0068853_100354689 | 3300005539 | Bacteria | 1365 |
| 113 | Ga0070672_100011632 | 3300005543 | Bacteria | 6141 |
| 114 | Ga0070672_100096157 | 3300005543 | Bacteria | 2396 |
| 115 | Ga0070696_100554915 | 3300005546 | Bacteria | 921 |
| 116 | Ga0070693_100082994 | 3300005547 | Bacteria | 1914 |
| 117 | Ga0070665_100025091 | 3300005548 | Bacteria | 6008 |
| 118 | Ga0070665_100246022 | 3300005548 | Bacteria | 1789 |
| 119 | Ga0070665_100774911 | 3300005548 | Bacteria | 972 |
| 120 | Ga0068855_100042177 | 3300005563 | Bacteria | 5406 |
| 121 | Ga0068855_100137218 | 3300005563 | Bacteria | 2790 |
| 122 | Ga0068855_100249151 | 3300005563 | Bacteria | 1982 |
| 123 | Ga0068855_100354900 | 3300005563 | Bacteria | 1615 |
| 124 | Ga0070664_100078181 | 3300005564 | Bacteria | 2846 |
| 125 | Ga0068857_100022658 | 3300005577 | Bacteria | 5525 |
| 126 | Ga0068857_100034613 | 3300005577 | Bacteria | 4467 |
| 127 | Ga0068857_100194748 | 3300005577 | Bacteria | 1847 |
| 128 | Ga0068857_100591030 | 3300005577 | Bacteria | 1049 |
| 129 | Ga0068854_100622411 | 3300005578 | Bacteria | 924 |
| 130 | Ga0068856_100054154 | 3300005614 | Bacteria | 3957 |
| 131 | Ga0070702_100057523 | 3300005615 | Bacteria | 2250 |
| 132 | Ga0068852_100001737 | 3300005616 | Bacteria | 14834 |
| 133 | Ga0068852_100167306 | 3300005616 | Bacteria | 2058 |
| 134 | Ga0068859_100082222 | 3300005617 | Bacteria | 3263 |
| 135 | Ga0068859_100146800 | 3300005617 | Bacteria | 2434 |
| 136 | Ga0068864_100007739 | 3300005618 | Bacteria | 8853 |
| 137 | Ga0068866_10290534 | 3300005718 | Bacteria | 1017 |
| 138 | Ga0068861_100002859 | 3300005719 | Bacteria | 11364 |
| 139 | Ga0068861_100231314 | 3300005719 | Bacteria | 1568 |
| 140 | Ga0068851_10024197 | 3300005834 | Bacteria | 2972 |
| 141 | Ga0068851_10031045 | 3300005834 | Bacteria | 2652 |
| 142 | Ga0068870_10230271 | 3300005840 | Bacteria | 1139 |
| 143 | Ga0068863_100036693 | 3300005841 | Bacteria | 4669 |
| 144 | Ga0068863_100127257 | 3300005841 | Bacteria | 2431 |
| 145 | Ga0068863_100165244 | 3300005841 | Bacteria | 2122 |
| 146 | Ga0068863_100291278 | 3300005841 | Bacteria | 1582 |
| 147 | Ga0068858_100056949 | 3300005842 | Bacteria | 3612 |
| 148 | Ga0068858_100188139 | 3300005842 | Bacteria | 1951 |
| 149 | Ga0068860_100238517 | 3300005843 | Bacteria | 1768 |
| 150 | Ga0068862_100017882 | 3300005844 | Bacteria | 5902 |
| 151 | Ga0068862_100022469 | 3300005844 | Bacteria | 5276 |
| 152 | Ga0068862_100112543 | 3300005844 | Bacteria | 2391 |
| 153 | Ga0068862_100783512 | 3300005844 | Bacteria | 930 |
| 154 | Ga0081455_10153169 | 3300005937 | Bacteria | 1775 |
| 155 | Ga0081540_1000032 | 3300005983 | Bacteria | 144522 |
| 156 | Ga0075365_10048131 | 3300006038 | Bacteria | 2805 |
| 157 | Ga0075365_10062701 | 3300006038 | Bacteria | 2487 |
| 158 | Ga0075368_10034956 | 3300006042 | Bacteria | 1960 |
| 159 | Ga0075363_100049349 | 3300006048 | Bacteria | 2241 |
| 160 | Ga0075364_10003171 | 3300006051 | Bacteria | 9309 |
| 161 | Ga0075432_10077550 | 3300006058 | Bacteria | 1201 |
| 162 | Ga0070712_100260309 | 3300006175 | Bacteria | 1390 |
| 163 | Ga0075362_10002819 | 3300006177 | Bacteria | 5932 |
| 164 | Ga0075362_10012593 | 3300006177 | Bacteria | 3363 |
| 165 | Ga0075367_10019309 | 3300006178 | Bacteria | 3778 |
| 166 | Ga0075367_10196528 | 3300006178 | Bacteria | 1260 |
| 167 | Ga0075369_10024329 | 3300006186 | Bacteria | 2509 |
| 168 | Ga0075366_10030457 | 3300006195 | Bacteria | 3172 |
| 169 | Ga0075366_10060205 | 3300006195 | Bacteria | 2255 |
| 170 | Ga0075366_10310309 | 3300006195 | Bacteria | 965 |
| 171 | Ga0097621_100009938 | 3300006237 | Bacteria | 6933 |
| 172 | Ga0097621_100024893 | 3300006237 | Bacteria | 4679 |
| 173 | Ga0097621_100130963 | 3300006237 | Bacteria | 2135 |
| 174 | Ga0075370_10056153 | 3300006353 | Bacteria | 2237 |
| 175 | Ga0075370_10066117 | 3300006353 | Bacteria | 2062 |
| 176 | Ga0068871_100003785 | 3300006358 | Bacteria | 10418 |
| 177 | Ga0068871_100071670 | 3300006358 | Bacteria | 2851 |
| 178 | Ga0075428_100406871 | 3300006844 | Bacteria | 1458 |
| 179 | Ga0075430_100005392 | 3300006846 | Bacteria | 10800 |
| 180 | Ga0075430_100049829 | 3300006846 | Bacteria | 3533 |
| 181 | Ga0075431_100020149 | 3300006847 | Bacteria | 6811 |
| 182 | Ga0075434_100014084 | 3300006871 | Bacteria | 7637 |
| 183 | Ga0068865_100215397 | 3300006881 | Bacteria | 1499 |
| 184 | Ga0068865_100461839 | 3300006881 | Bacteria | 1052 |
| 185 | Ga0097620_100082225 | 3300006931 | Bacteria | 3263 |
| 186 | Ga0097620_100146805 | 3300006931 | Bacteria | 2434 |
| 187 | Ga0079104_1005965 | 3300006946 | Bacteria | 4724 |
| 188 | Ga0079104_1021330 | 3300006946 | Bacteria | 1766 |
| 189 | Ga0079104_1040558 | 3300006946 | Bacteria | 1089 |
| 190 | Ga0099826_10000004 | 3300006948 | Bacteria | 802669 |
| 191 | Ga0099826_10003943 | 3300006948 | Bacteria | 10263 |
| 192 | Ga0075435_100099622 | 3300007076 | Bacteria | 2407 |
| 193 | Ga0099795_10017173 | 3300007788 | Bacteria | 2303 |
| 194 | Ga0105251_10012206 | 3300009011 | Bacteria | 4874 |
| 195 | Ga0105251_10162159 | 3300009011 | Bacteria | 1008 |
| 196 | Ga0105244_10003810 | 3300009036 | Bacteria | 10640 |
| 197 | Ga0105244_10029659 | 3300009036 | Bacteria | 2920 |
| 198 | Ga0105244_10071206 | 3300009036 | Bacteria | 1734 |
| 199 | Ga0105244_10171220 | 3300009036 | Bacteria | 1033 |
| 200 | Ga0105240_10016169 | 3300009093 | Bacteria | 10112 |
| 201 | Ga0105240_10095751 | 3300009093 | Bacteria | 3619 |
| 202 | Ga0105240_10110333 | 3300009093 | Bacteria | 3330 |
| 203 | Ga0105240_10307314 | 3300009093 | Bacteria | 1812 |
| 204 | Ga0105240_10313783 | 3300009093 | Bacteria | 1789 |
| 205 | Ga0105240_10319900 | 3300009093 | Bacteria | 1769 |
| 206 | Ga0105240_10343084 | 3300009093 | Bacteria | 1696 |
| 207 | Ga0111539_10053706 | 3300009094 | Bacteria | 4796 |
| 208 | Ga0111539_10302127 | 3300009094 | Bacteria | 1863 |
| 209 | Ga0111539_10621460 | 3300009094 | Bacteria | 1258 |
| 210 | Ga0105245_10002213 | 3300009098 | Bacteria | 17601 |
| 211 | Ga0105245_10085324 | 3300009098 | Bacteria | 2894 |
| 212 | Ga0105245_10145723 | 3300009098 | Bacteria | 2234 |
| 213 | Ga0105245_10285321 | 3300009098 | Bacteria | 1615 |
| 214 | Ga0114129_10016867 | 3300009147 | Bacteria | 10398 |
| 215 | Ga0114129_10372132 | 3300009147 | Bacteria | 1888 |
| 216 | Ga0105243_10004131 | 3300009148 | Bacteria | 11546 |
| 217 | Ga0105243_10019383 | 3300009148 | Bacteria | 5158 |
| 218 | Ga0105241_10083754 | 3300009174 | Bacteria | 2502 |
| 219 | Ga0105242_10086337 | 3300009176 | Bacteria | 2633 |
| 220 | Ga0105242_10381003 | 3300009176 | Bacteria | 1311 |
| 221 | Ga0105248_10009668 | 3300009177 | Bacteria | 10623 |
| 222 | Ga0105248_10021120 | 3300009177 | Bacteria | 7215 |
| 223 | Ga0105248_10178802 | 3300009177 | Bacteria | 2391 |
| 224 | Ga0105248_10327176 | 3300009177 | Bacteria | 1726 |
| 225 | Ga0105248_10408393 | 3300009177 | Bacteria | 1529 |
| 226 | Ga0105237_10010158 | 3300009545 | Bacteria | 10032 |
| 227 | Ga0105237_10049330 | 3300009545 | Bacteria | 4232 |
| 228 | Ga0105237_10075212 | 3300009545 | Bacteria | 3369 |
| 229 | Ga0105237_10165516 | 3300009545 | Bacteria | 2210 |
| 230 | Ga0105237_10239013 | 3300009545 | Bacteria | 1817 |
| 231 | Ga0105237_10333826 | 3300009545 | Bacteria | 1520 |
| 232 | Ga0105238_10000107 | 3300009551 | Bacteria | 91765 |
| 233 | Ga0105238_10018714 | 3300009551 | Bacteria | 7054 |
| 234 | Ga0105238_10076514 | 3300009551 | Bacteria | 3338 |
| 235 | Ga0105238_10165334 | 3300009551 | Bacteria | 2188 |
| 236 | Ga0105249_10402713 | 3300009553 | Bacteria | 1399 |
| 237 | Ga0105249_10687517 | 3300009553 | Bacteria | 1082 |
| 238 | Ga0105239_10001202 | 3300010375 | Bacteria | 35405 |
| 239 | Ga0105239_10038533 | 3300010375 | Bacteria | 5238 |
| 240 | Ga0105239_10181094 | 3300010375 | Bacteria | 2358 |
| 241 | Ga0105239_10254137 | 3300010375 | Bacteria | 1974 |
| 242 | Ga0105239_10286758 | 3300010375 | Bacteria | 1854 |
| 243 | Ga0105239_10319843 | 3300010375 | Bacteria | 1750 |
| 244 | Ga0105239_10434352 | 3300010375 | Bacteria | 1488 |
| 245 | Ga0105246_10084927 | 3300011119 | Bacteria | 2266 |
| 246 | Ga0105246_10147303 | 3300011119 | Bacteria | 1778 |
| 247 | Ga0157347_1005273 | 3300012502 | Bacteria | 1231 |
| 248 | Ga0157373_10048268 | 3300013100 | Bacteria | 3035 |
| 249 | Ga0157371_10482293 | 3300013102 | Bacteria | 914 |
| 250 | Ga0157370_10001210 | 3300013104 | Bacteria | 32282 |
| 251 | Ga0157369_10105708 | 3300013105 | Bacteria | 2996 |
| 252 | Ga0157369_10136063 | 3300013105 | Bacteria | 2601 |
| 253 | Ga0157369_10231310 | 3300013105 | Bacteria | 1933 |
| 254 | Ga0157369_10331675 | 3300013105 | Bacteria | 1581 |
| 255 | Ga0157369_10420836 | 3300013105 | Bacteria | 1385 |
| 256 | Ga0157378_10400448 | 3300013297 | Bacteria | 1352 |
| 257 | Ga0163162_10003435 | 3300013306 | Bacteria | 15121 |
| 258 | Ga0163162_10098476 | 3300013306 | Bacteria | 3013 |
| 259 | Ga0163162_10489793 | 3300013306 | Bacteria | 1361 |
| 260 | Ga0157372_10120514 | 3300013307 | Bacteria | 3012 |
| 261 | Ga0157372_10409925 | 3300013307 | Bacteria | 1579 |
| 262 | Ga0157375_10044984 | 3300013308 | Bacteria | 4295 |
| 263 | Ga0157375_10127589 | 3300013308 | Bacteria | 2660 |
| 264 | Ga0157380_10033626 | 3300014326 | Bacteria | 3949 |
| 265 | Ga0182008_10003552 | 3300014497 | Bacteria | 9360 |
| 266 | Ga0182008_10016132 | 3300014497 | Bacteria | 3885 |
| 267 | Ga0182008_10038719 | 3300014497 | Bacteria | 2384 |
| 268 | Ga0182008_10049109 | 3300014497 | Bacteria | 2094 |
| 269 | Ga0182008_10121734 | 3300014497 | Bacteria | 1297 |
| 270 | Ga0157379_10063212 | 3300014968 | Bacteria | 3310 |
| 271 | Ga0157376_10008428 | 3300014969 | Bacteria | 7438 |
| 272 | Ga0157376_10017098 | 3300014969 | Bacteria | 5525 |
| 273 | Ga0157376_10032848 | 3300014969 | Bacteria | 4171 |
| 274 | Ga0182006_1000231 | 3300015261 | Bacteria | 52984 |
| 275 | Ga0182006_1013901 | 3300015261 | Bacteria | 3479 |
| 276 | Ga0182006_1041366 | 3300015261 | Bacteria | 1810 |
| 277 | Ga0182007_10008818 | 3300015262 | Bacteria | 4113 |
| 278 | Ga0182007_10046516 | 3300015262 | Bacteria | 1437 |
| 279 | Ga0182005_1000037 | 3300015265 | Bacteria | 166102 |
| 280 | Ga0182005_1005071 | 3300015265 | Bacteria | 4155 |
| 281 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 282 | Ga0163161_10000118 | 3300017792 | Bacteria | 75123 |
| 283 | Ga0163161_10026761 | 3300017792 | Bacteria | 4088 |
| 284 | Ga0163161_10449467 | 3300017792 | Bacteria | 1041 |
| 285 | Ga0213872_10095751 | 3300021361 | Bacteria | 1326 |
| 286 | Ga0213871_10011521 | 3300021441 | Bacteria | 2033 |
| 287 | Ga0209435_100094 | 3300025206 | Bacteria | 39577 |
| 288 | Ga0209784_100018 | 3300025224 | Bacteria | 456816 |
| 289 | Ga0209784_100019 | 3300025224 | Bacteria | 453558 |
| 290 | Ga0209566_100016 | 3300025225 | Bacteria | 456824 |
| 291 | Ga0209566_100017 | 3300025225 | Bacteria | 453558 |
| 292 | Ga0209674_100030 | 3300025226 | Bacteria | 456824 |
| 293 | Ga0209674_100031 | 3300025226 | Bacteria | 453558 |
| 294 | Ga0209672_100083 | 3300025228 | Bacteria | 135473 |
| 295 | Ga0209672_102400 | 3300025228 | Bacteria | 4643 |
| 296 | Ga0209147_100097 | 3300025229 | Bacteria | 164034 |
| 297 | Ga0209147_100244 | 3300025229 | Bacteria | 53002 |
| 298 | Ga0209147_101037 | 3300025229 | Bacteria | 11826 |
| 299 | Ga0209563_100034 | 3300025230 | Bacteria | 456824 |
| 300 | Ga0209563_100035 | 3300025230 | Bacteria | 453558 |
| 301 | Ga0207427_100315 | 3300025231 | Bacteria | 32969 |
| 302 | Ga0209437_100038 | 3300025233 | Bacteria | 453558 |
| 303 | Ga0209437_100372 | 3300025233 | Bacteria | 45954 |
| 304 | Ga0209437_108698 | 3300025233 | Bacteria | 1614 |
| 305 | Ga0209437_117772 | 3300025233 | Bacteria | 927 |
| 306 | Ga0209258_100078 | 3300025242 | Bacteria | 263996 |
| 307 | Ga0209258_100192 | 3300025242 | Bacteria | 125565 |
| 308 | Ga0209258_100405 | 3300025242 | Bacteria | 53002 |
| 309 | Ga0207425_1000455 | 3300025245 | Bacteria | 26503 |
| 310 | Ga0207425_1000952 | 3300025245 | Bacteria | 13673 |
| 311 | Ga0209646_1000051 | 3300025246 | Bacteria | 296525 |
| 312 | Ga0209646_1000103 | 3300025246 | Bacteria | 164034 |
| 313 | Ga0209646_1013337 | 3300025246 | Bacteria | 1251 |
| 314 | Ga0209026_1001208 | 3300025250 | Bacteria | 11962 |
| 315 | Ga0209677_100019 | 3300025253 | Bacteria | 456824 |
| 316 | Ga0209677_100020 | 3300025253 | Bacteria | 453558 |
| 317 | Ga0209148_1000086 | 3300025254 | Bacteria | 263996 |
| 318 | Ga0209148_1002102 | 3300025254 | Bacteria | 7539 |
| 319 | Ga0209759_1000091 | 3300025256 | Bacteria | 164034 |
| 320 | Ga0209759_1003935 | 3300025256 | Bacteria | 5717 |
| 321 | Ga0209129_1000116 | 3300025258 | Bacteria | 140716 |
| 322 | Ga0209129_1000830 | 3300025258 | Bacteria | 19469 |
| 323 | Ga0209129_1007819 | 3300025258 | Bacteria | 3093 |
| 324 | Ga0209129_1019257 | 3300025258 | Bacteria | 1293 |
| 325 | Ga0209233_1000049 | 3300025261 | Bacteria | 453558 |
| 326 | Ga0209565_1000067 | 3300025263 | Bacteria | 171247 |
| 327 | Ga0209565_1000133 | 3300025263 | Bacteria | 104054 |
| 328 | Ga0209565_1005683 | 3300025263 | Bacteria | 3599 |
| 329 | Ga0209565_1012255 | 3300025263 | Bacteria | 2053 |
| 330 | Ga0209455_1000031 | 3300025272 | Bacteria | 519952 |
| 331 | Ga0209455_1001485 | 3300025272 | Bacteria | 10503 |
| 332 | Ga0209455_1006271 | 3300025272 | Bacteria | 3537 |
| 333 | Ga0209673_1000190 | 3300025273 | Bacteria | 123411 |
| 334 | Ga0209673_1000813 | 3300025273 | Bacteria | 41247 |
| 335 | Ga0209673_1002954 | 3300025273 | Bacteria | 10655 |
| 336 | Ga0209673_1005012 | 3300025273 | Bacteria | 6843 |
| 337 | Ga0209673_1012551 | 3300025273 | Bacteria | 3406 |
| 338 | Ga0209673_1028546 | 3300025273 | Bacteria | 1793 |
| 339 | Ga0209673_1046401 | 3300025273 | Bacteria | 1186 |
| 340 | Ga0209130_1000202 | 3300025284 | Bacteria | 80333 |
| 341 | Ga0209130_1001910 | 3300025284 | Bacteria | 11746 |
| 342 | Ga0209130_1005820 | 3300025284 | Bacteria | 4165 |
| 343 | Ga0209130_1008843 | 3300025284 | Bacteria | 2930 |
| 344 | Ga0209675_1000038 | 3300025291 | Bacteria | 250481 |
| 345 | Ga0209675_1004428 | 3300025291 | Bacteria | 6245 |
| 346 | Ga0209675_1006283 | 3300025291 | Bacteria | 4798 |
| 347 | Ga0209675_1007038 | 3300025291 | Bacteria | 4386 |
| 348 | Ga0209675_1009003 | 3300025291 | Bacteria | 3582 |
| 349 | Ga0209675_1015821 | 3300025291 | Bacteria | 2223 |
| 350 | Ga0209675_1035674 | 3300025291 | Bacteria | 1132 |
| 351 | Ga0209676_1000125 | 3300025292 | Bacteria | 191565 |
| 352 | Ga0209676_1001114 | 3300025292 | Bacteria | 29761 |
| 353 | Ga0209676_1019055 | 3300025292 | Bacteria | 2372 |
| 354 | Ga0209025_1000769 | 3300025294 | Bacteria | 53174 |
| 355 | Ga0209025_1000811 | 3300025294 | Bacteria | 50182 |
| 356 | Ga0209025_1001608 | 3300025294 | Bacteria | 28307 |
| 357 | Ga0209025_1002825 | 3300025294 | Bacteria | 17474 |
| 358 | Ga0209025_1002969 | 3300025294 | Bacteria | 16837 |
| 359 | Ga0209025_1012056 | 3300025294 | Bacteria | 5599 |
| 360 | Ga0209025_1014639 | 3300025294 | Bacteria | 4802 |
| 361 | Ga0209025_1065058 | 3300025294 | Bacteria | 1334 |
| 362 | Ga0209564_1000011 | 3300025295 | Bacteria | 822327 |
| 363 | Ga0209564_1002219 | 3300025295 | Bacteria | 16157 |
| 364 | Ga0209564_1002684 | 3300025295 | Bacteria | 13489 |
| 365 | Ga0209564_1009762 | 3300025295 | Bacteria | 4515 |
| 366 | Ga0209758_1000034 | 3300025297 | Bacteria | 467637 |
| 367 | Ga0209758_1000286 | 3300025297 | Bacteria | 99636 |
| 368 | Ga0209758_1013003 | 3300025297 | Bacteria | 4591 |
| 369 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 370 | Ga0209050_1001325 | 3300025298 | Bacteria | 27578 |
| 371 | Ga0209050_1004979 | 3300025298 | Bacteria | 8645 |
| 372 | Ga0209050_1007763 | 3300025298 | Bacteria | 5914 |
| 373 | Ga0209256_1000066 | 3300025299 | Bacteria | 247534 |
| 374 | Ga0209256_1000270 | 3300025299 | Bacteria | 90996 |
| 375 | Ga0209256_1000726 | 3300025299 | Bacteria | 43520 |
| 376 | Ga0209256_1026104 | 3300025299 | Bacteria | 1689 |
| 377 | Ga0207426_1000067 | 3300025302 | Bacteria | 342108 |
| 378 | Ga0207426_1000145 | 3300025302 | Bacteria | 191065 |
| 379 | Ga0207426_1002489 | 3300025302 | Bacteria | 11681 |
| 380 | Ga0207426_1012223 | 3300025302 | Bacteria | 3234 |
| 381 | Ga0209051_1000134 | 3300025303 | Bacteria | 138380 |
| 382 | Ga0209051_1000388 | 3300025303 | Bacteria | 62011 |
| 383 | Ga0209051_1000991 | 3300025303 | Bacteria | 27413 |
| 384 | Ga0209051_1001829 | 3300025303 | Bacteria | 16828 |
| 385 | Ga0209051_1010900 | 3300025303 | Bacteria | 4539 |
| 386 | Ga0209051_1012848 | 3300025303 | Bacteria | 4026 |
| 387 | Ga0209257_1000022 | 3300025304 | Bacteria | 765258 |
| 388 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 389 | Ga0209257_1001367 | 3300025304 | Bacteria | 29437 |
| 390 | Ga0207656_10006731 | 3300025321 | Bacteria | 4153 |
| 391 | Ga0207656_10045081 | 3300025321 | Bacteria | 1886 |
| 392 | Ga0207656_10103733 | 3300025321 | Bacteria | 1306 |
| 393 | Ga0207655_1025647 | 3300025728 | Bacteria | 2855 |
| 394 | Ga0207655_1062846 | 3300025728 | Bacteria | 1426 |
| 395 | Ga0207713_1012892 | 3300025735 | Bacteria | 4437 |
| 396 | Ga0207682_10038204 | 3300025893 | Bacteria | 1947 |
| 397 | Ga0207692_10068585 | 3300025898 | Bacteria | 1860 |
| 398 | Ga0207642_10215147 | 3300025899 | Bacteria | 1070 |
| 399 | Ga0207680_10002625 | 3300025903 | Bacteria | 8394 |
| 400 | Ga0207647_10006741 | 3300025904 | Bacteria | 8340 |
| 401 | Ga0207647_10013565 | 3300025904 | Bacteria | 5642 |
| 402 | Ga0207699_10080349 | 3300025906 | Bacteria | 2020 |
| 403 | Ga0207645_10021161 | 3300025907 | Bacteria | 4245 |
| 404 | Ga0207705_10004503 | 3300025909 | Bacteria | 10528 |
| 405 | Ga0207705_10076640 | 3300025909 | Bacteria | 2431 |
| 406 | Ga0207684_10091257 | 3300025910 | Bacteria | 2596 |
| 407 | Ga0207654_10046374 | 3300025911 | Bacteria | 2478 |
| 408 | Ga0207654_10178580 | 3300025911 | Bacteria | 1384 |
| 409 | Ga0207707_10524161 | 3300025912 | Bacteria | 1009 |
| 410 | Ga0207695_10001362 | 3300025913 | Bacteria | 41437 |
| 411 | Ga0207695_10009442 | 3300025913 | Bacteria | 12064 |
| 412 | Ga0207695_10014244 | 3300025913 | Bacteria | 9432 |
| 413 | Ga0207695_10135148 | 3300025913 | Bacteria | 2420 |
| 414 | Ga0207695_10164918 | 3300025913 | Bacteria | 2144 |
| 415 | Ga0207695_10217866 | 3300025913 | Bacteria | 1817 |
| 416 | Ga0207695_10234924 | 3300025913 | Bacteria | 1736 |
| 417 | Ga0207671_10001336 | 3300025914 | Bacteria | 28835 |
| 418 | Ga0207671_10024297 | 3300025914 | Bacteria | 4559 |
| 419 | Ga0207671_10047846 | 3300025914 | Bacteria | 3165 |
| 420 | Ga0207671_10082299 | 3300025914 | Bacteria | 2415 |
| 421 | Ga0207671_10098691 | 3300025914 | Bacteria | 2209 |
| 422 | Ga0207671_10269697 | 3300025914 | Bacteria | 1341 |
| 423 | Ga0207693_10234326 | 3300025915 | Bacteria | 1442 |
| 424 | Ga0207657_10000018 | 3300025919 | Bacteria | 172140 |
| 425 | Ga0207657_10022908 | 3300025919 | Bacteria | 5828 |
| 426 | Ga0207649_10261078 | 3300025920 | Bacteria | 1251 |
| 427 | Ga0207652_10122862 | 3300025921 | Bacteria | 2311 |
| 428 | Ga0207652_10155238 | 3300025921 | Bacteria | 2050 |
| 429 | Ga0207646_10049764 | 3300025922 | Bacteria | 3752 |
| 430 | Ga0207681_10088404 | 3300025923 | Bacteria | 2207 |
| 431 | Ga0207694_10000130 | 3300025924 | Bacteria | 77624 |
| 432 | Ga0207694_10045075 | 3300025924 | Bacteria | 3406 |
| 433 | Ga0207694_10421926 | 3300025924 | Bacteria | 1111 |
| 434 | Ga0207659_10165511 | 3300025926 | Bacteria | 1740 |
| 435 | Ga0207659_10192180 | 3300025926 | Bacteria | 1625 |
| 436 | Ga0207659_10353556 | 3300025926 | Bacteria | 1220 |
| 437 | Ga0207687_10142411 | 3300025927 | Bacteria | 1820 |
| 438 | Ga0207700_10000082 | 3300025928 | Bacteria | 58939 |
| 439 | Ga0207700_10051865 | 3300025928 | Bacteria | 3064 |
| 440 | Ga0207644_10025628 | 3300025931 | Bacteria | 4056 |
| 441 | Ga0207690_10000006 | 3300025932 | Bacteria | 433880 |
| 442 | Ga0207690_10420557 | 3300025932 | Bacteria | 1069 |
| 443 | Ga0207706_10000892 | 3300025933 | Bacteria | 30643 |
| 444 | Ga0207706_10192847 | 3300025933 | Bacteria | 1788 |
| 445 | Ga0207709_10001889 | 3300025935 | Bacteria | 13830 |
| 446 | Ga0207709_10027454 | 3300025935 | Bacteria | 3280 |
| 447 | Ga0207670_10100241 | 3300025936 | Bacteria | 2067 |
| 448 | Ga0207669_10077219 | 3300025937 | Bacteria | 2117 |
| 449 | Ga0207704_10135171 | 3300025938 | Bacteria | 1715 |
| 450 | Ga0207691_10022198 | 3300025940 | Bacteria | 5987 |
| 451 | Ga0207691_10204250 | 3300025940 | Bacteria | 1718 |
| 452 | Ga0207711_10031413 | 3300025941 | Bacteria | 4482 |
| 453 | Ga0207711_10153394 | 3300025941 | Bacteria | 2080 |
| 454 | Ga0207711_10176446 | 3300025941 | Bacteria | 1941 |
| 455 | Ga0207689_10000393 | 3300025942 | Bacteria | 41140 |
| 456 | Ga0207689_10004760 | 3300025942 | Bacteria | 12243 |
| 457 | Ga0207661_10063210 | 3300025944 | Bacteria | 2997 |
| 458 | Ga0207679_10120278 | 3300025945 | Bacteria | 2089 |
| 459 | Ga0207679_10194028 | 3300025945 | Bacteria | 1691 |
| 460 | Ga0207667_10002863 | 3300025949 | Bacteria | 21405 |
| 461 | Ga0207667_10004521 | 3300025949 | Bacteria | 17039 |
| 462 | Ga0207667_10035111 | 3300025949 | Bacteria | 5380 |
| 463 | Ga0207667_10103988 | 3300025949 | Bacteria | 2929 |
| 464 | Ga0207667_10190569 | 3300025949 | Bacteria | 2104 |
| 465 | Ga0207651_10040769 | 3300025960 | Bacteria | 3076 |
| 466 | Ga0207651_10048141 | 3300025960 | Bacteria | 2880 |
| 467 | Ga0207651_10084821 | 3300025960 | Bacteria | 2296 |
| 468 | Ga0207651_10099224 | 3300025960 | Bacteria | 2156 |
| 469 | Ga0207712_10189254 | 3300025961 | Bacteria | 1623 |
| 470 | Ga0207668_10004274 | 3300025972 | Bacteria | 8376 |
| 471 | Ga0207668_10118695 | 3300025972 | Bacteria | 1999 |
| 472 | Ga0207668_10337266 | 3300025972 | Bacteria | 1256 |
| 473 | Ga0207668_10367426 | 3300025972 | Bacteria | 1207 |
| 474 | Ga0207640_10008616 | 3300025981 | Bacteria | 5668 |
| 475 | Ga0207640_10141902 | 3300025981 | Bacteria | 1752 |
| 476 | Ga0207658_10110774 | 3300025986 | Bacteria | 2170 |
| 477 | Ga0207677_10004381 | 3300026023 | Bacteria | 7564 |
| 478 | Ga0207677_10466367 | 3300026023 | Bacteria | 1085 |
| 479 | Ga0207703_10051154 | 3300026035 | Bacteria | 3347 |
| 480 | Ga0207703_10101296 | 3300026035 | Bacteria | 2442 |
| 481 | Ga0207703_10328392 | 3300026035 | Bacteria | 1402 |
| 482 | Ga0207639_10041283 | 3300026041 | Bacteria | 3450 |
| 483 | Ga0207639_10338404 | 3300026041 | Bacteria | 1341 |
| 484 | Ga0207678_10019804 | 3300026067 | Bacteria | 5917 |
| 485 | Ga0207678_10152990 | 3300026067 | Bacteria | 1970 |
| 486 | Ga0207702_10038205 | 3300026078 | Bacteria | 4021 |
| 487 | Ga0207702_10151144 | 3300026078 | Bacteria | 2112 |
| 488 | Ga0207641_10009992 | 3300026088 | Bacteria | 7810 |
| 489 | Ga0207641_10038171 | 3300026088 | Bacteria | 4014 |
| 490 | Ga0207641_10065097 | 3300026088 | Bacteria | 3117 |
| 491 | Ga0207641_10119125 | 3300026088 | Bacteria | 2353 |
| 492 | Ga0207641_10632051 | 3300026088 | Bacteria | 1050 |
| 493 | Ga0207674_10078055 | 3300026116 | Bacteria | 3317 |
| 494 | Ga0207674_10206403 | 3300026116 | Bacteria | 1914 |
| 495 | Ga0207674_10212886 | 3300026116 | Bacteria | 1881 |
| 496 | Ga0207675_100009503 | 3300026118 | Bacteria | 9100 |
| 497 | Ga0207675_100041541 | 3300026118 | Bacteria | 4295 |
| 498 | Ga0207675_100047608 | 3300026118 | Bacteria | 4002 |
| 499 | Ga0207683_10123968 | 3300026121 | Bacteria | 2321 |
| 500 | Ga0207683_10242392 | 3300026121 | Bacteria | 1644 |
| 501 | Ga0207683_10494145 | 3300026121 | Bacteria | 1130 |
| 502 | Ga0207698_10001988 | 3300026142 | Bacteria | 12027 |
| 503 | Ga0207698_10106897 | 3300026142 | Bacteria | 2335 |
| 504 | Ga0209281_1022964 | 3300027111 | Bacteria | 1189 |
| 505 | Ga0209282_1000015 | 3300027666 | Bacteria | 206531 |
| 506 | Ga0209282_1015645 | 3300027666 | Bacteria | 4828 |
| 507 | Ga0268266_10005293 | 3300028379 | Bacteria | 12110 |
| 508 | Ga0268266_10254787 | 3300028379 | Bacteria | 1624 |
| 509 | Ga0268266_10259595 | 3300028379 | Bacteria | 1610 |
| 510 | Ga0268266_10308091 | 3300028379 | Bacteria | 1479 |
| 511 | Ga0268265_10071330 | 3300028380 | Bacteria | 2705 |
| 512 | Ga0268265_10618361 | 3300028380 | Bacteria | 1037 |
| 513 | Ga0268264_10021658 | 3300028381 | Bacteria | 5248 |
| 514 | Ga0307515_10013446 | 3300028794 | Bacteria | 15298 |
| 515 | Ga0307515_10107895 | 3300028794 | Bacteria | 3286 |
| 516 | Ga0265338_10000057 | 3300028800 | Bacteria | 200477 |
| 517 | Ga0307511_10001004 | 3300030521 | Bacteria | 30016 |
| 518 | Ga0314311_1168092 | 3300030733 | Bacteria | 3560 |
| 519 | Ga0265340_10034005 | 3300031247 | Bacteria | 2536 |
| 520 | Ga0265327_10001504 | 3300031251 | Bacteria | 28880 |
| 521 | Ga0265327_10007858 | 3300031251 | Bacteria | 8112 |
| 522 | Ga0265327_10014466 | 3300031251 | Bacteria | 5159 |
| 523 | Ga0265327_10111907 | 3300031251 | Bacteria | 1303 |
| 524 | Ga0265316_10151084 | 3300031344 | Bacteria | 1740 |
| 525 | Ga0307513_10000004 | 3300031456 | Bacteria | 558931 |
| 526 | Ga0307513_10000549 | 3300031456 | Bacteria | 53746 |
| 527 | Ga0307408_100000425 | 3300031548 | Bacteria | 37508 |
| 528 | Ga0307408_100000521 | 3300031548 | Bacteria | 33246 |
| 529 | Ga0307408_100010654 | 3300031548 | Bacteria | 6063 |
| 530 | Ga0307408_100087374 | 3300031548 | Bacteria | 2345 |
| 531 | Ga0307514_10072345 | 3300031649 | Bacteria | 2582 |
| 532 | Ga0316575_10000019 | 3300031665 | Bacteria | 42637 |
| 533 | Ga0316575_10023424 | 3300031665 | Bacteria | 2387 |
| 534 | Ga0316579_10056447 | 3300031691 | Bacteria | 1843 |
| 535 | Ga0316579_10059174 | 3300031691 | Bacteria | 1801 |
| 536 | Ga0265314_10058736 | 3300031711 | Bacteria | 2635 |
| 537 | Ga0316576_10182334 | 3300031727 | Bacteria | 1583 |
| 538 | Ga0316578_10003864 | 3300031728 | Bacteria | 6956 |
| 539 | Ga0316578_10008771 | 3300031728 | Bacteria | 5165 |
| 540 | Ga0316578_10016759 | 3300031728 | Bacteria | 3973 |
| 541 | Ga0307405_10053326 | 3300031731 | Bacteria | 2518 |
| 542 | Ga0316577_10031426 | 3300031733 | Bacteria | 2966 |
| 543 | Ga0316577_10120463 | 3300031733 | Bacteria | 1474 |
| 544 | Ga0307410_10165527 | 3300031852 | Bacteria | 1661 |
| 545 | Ga0307406_10002492 | 3300031901 | Bacteria | 10032 |
| 546 | Ga0307406_10006980 | 3300031901 | Bacteria | 6253 |
| 547 | Ga0307412_10470811 | 3300031911 | Bacteria | 1039 |
| 548 | Ga0307414_10162842 | 3300032004 | Bacteria | 1774 |
| 549 | Ga0307414_10194131 | 3300032004 | Bacteria | 1645 |
| 550 | Ga0307411_10350680 | 3300032005 | Bacteria | 1203 |
| 551 | Ga0316583_10007052 | 3300032133 | Bacteria | 4043 |
| 552 | Ga0316583_10024330 | 3300032133 | Bacteria | 2163 |
| 553 | Ga0316585_10009490 | 3300032137 | Bacteria | 2841 |
| 554 | Ga0316585_10085674 | 3300032137 | Bacteria | 1028 |
| 555 | Ga0316580_10011290 | 3300032139 | Bacteria | 2709 |
| 556 | Ga0316580_10013716 | 3300032139 | Bacteria | 2469 |
| 557 | Ga0316593_10003759 | 3300032168 | Bacteria | 3814 |
| 558 | Ga0316593_10009070 | 3300032168 | Bacteria | 2796 |
| 559 | Ga0373939_0077781 | 3300035114 | Bacteria | 1095 |
| 560 | Ga0373962_0020529 | 3300035242 | Bacteria | 1736 |
| 561 | Ga0316574_0005050 | 3300035398 | Bacteria | 7008 |
| 562 | Ga0316574_0009706 | 3300035398 | Bacteria | 5405 |
| 563 | Ga0373931_0003777 | 3300035691 | Bacteria | 6851 |
| 564 | Ga0373935_0119168 | 3300035692 | Bacteria | 1761 |
| 565 | Ga0373935_0175318 | 3300035692 | Bacteria | 1469 |
| 566 | Ga0373927_0133664 | 3300035695 | Bacteria | 1621 |
| 567 | Ga0373937_0206448 | 3300036401 | Bacteria | 1848 |
| 568 | Ga0316582_0027041 | 3300036647 | Bacteria | 3460 |
| 569 | Ga0316584_0065584 | 3300036712 | Bacteria | 2720 |
| 570 | Ga0373925_0013472 | 3300037068 | Bacteria | 5918 |
| 571 | Ga0373925_0054709 | 3300037068 | Bacteria | 2986 |
| 572 | Ga0373925_0167723 | 3300037068 | Bacteria | 1732 |
| 573 | Ga0395899_0000008 | 3300037312 | Bacteria | 567572 |
| 574 | Ga0395899_0000637 | 3300037312 | Bacteria | 36229 |
| 575 | Ga0395899_0002108 | 3300037312 | Bacteria | 16341 |
| 576 | Ga0395899_0019864 | 3300037312 | Bacteria | 5098 |
| 577 | Ga0395899_0039931 | 3300037312 | Bacteria | 3511 |
| 578 | Ga0395899_0048495 | 3300037312 | Bacteria | 3160 |
| 579 | Ga0395899_0079830 | 3300037312 | Bacteria | 2382 |
| 580 | Ga0395900_0000252 | 3300037418 | Bacteria | 83358 |
| 581 | Ga0395900_0000273 | 3300037418 | Bacteria | 78527 |
| 582 | Ga0395900_0001610 | 3300037418 | Bacteria | 26610 |
| 583 | Ga0395900_0008082 | 3300037418 | Bacteria | 10830 |
| 584 | Ga0395900_0024372 | 3300037418 | Bacteria | 6196 |
| 585 | Ga0395900_0073562 | 3300037418 | Bacteria | 3514 |
| 586 | Ga0395900_0177755 | 3300037418 | Bacteria | 2164 |
| 587 | Ga0395900_0217281 | 3300037418 | Bacteria | 1928 |
| 588 | Ga0395900_0222095 | 3300037418 | Bacteria | 1904 |
| 589 | Ga0395900_0314768 | 3300037418 | Bacteria | 1547 |
| 590 | Ga0395898_0000072 | 3300037466 | Bacteria | 249505 |
| 591 | Ga0395898_0004624 | 3300037466 | Bacteria | 15023 |
| 592 | Ga0395898_0314771 | 3300037466 | Bacteria | 1493 |
| 593 | Ga0395898_0330480 | 3300037466 | Bacteria | 1453 |
| 594 | Ga0395905_0000600 | 3300037471 | Bacteria | 48145 |
| 595 | Ga0395905_0084816 | 3300037471 | Bacteria | 2968 |
| 596 | Ga0395905_0118838 | 3300037471 | Bacteria | 2484 |
| 597 | Ga0395905_0134292 | 3300037471 | Bacteria | 2327 |
| 598 | Ga0395905_0250215 | 3300037471 | Bacteria | 1655 |
| 599 | Ga0395905_0286976 | 3300037471 | Bacteria | 1532 |
| 600 | Ga0436364_0445393 | 3300037853 | Bacteria | 1837 |
| 601 | Ga0395901_0000963 | 3300038443 | Bacteria | 31334 |
| 602 | Ga0395901_0003504 | 3300038443 | Bacteria | 15808 |
| 603 | Ga0395901_0023068 | 3300038443 | Bacteria | 6378 |
| 604 | Ga0395901_0106032 | 3300038443 | Bacteria | 2949 |
| 605 | Ga0395901_0433124 | 3300038443 | Bacteria | 1347 |
| 606 | Ga0436365_0998154 | 3300039437 | Bacteria | 1221 |
| 607 | Ga0436360_0627319 | 3300039438 | Bacteria | 3961 |
| 608 | Ga0436361_0597437 | 3300039447 | Bacteria | 3065 |
| 609 | Ga0436363_1260698 | 3300039450 | Bacteria | 11308 |
| 610 | Ga0436362_0178065 | 3300039453 | Bacteria | 1992 |
| 611 | Ga0439466_0026806 | 3300041411 | Bacteria | 2000 |
| 612 | Ga0451797_0514870 | 3300041453 | Bacteria | 1082 |
| 613 | Ga0439431_0015246 | 3300041997 | Bacteria | 1787 |
| 614 | Ga0439442_011867 | 3300042002 | Bacteria | 1778 |
| 615 | Ga0439448_0014554 | 3300042005 | Bacteria | 2374 |
| 616 | Ga0439432_002972 | 3300042006 | Bacteria | 6315 |
| 617 | Ga0439449_0049113 | 3300042007 | Bacteria | 1561 |
| 618 | Ga0439450_019338 | 3300042008 | Bacteria | 1442 |
| 619 | Ga0439457_013461 | 3300042014 | Bacteria | 1839 |
| 620 | Ga0439462_0005441 | 3300042015 | Bacteria | 3139 |
| 621 | Ga0450921_000720 | 3300042123 | Bacteria | 1717 |
| 622 | Ga0450918_005739 | 3300042531 | Bacteria | 2220 |
| 623 | Ga0451577_0000142 | 3300042876 | Bacteria | 160598 |
| 624 | Ga0451577_0000479 | 3300042876 | Bacteria | 68148 |
| 625 | Ga0451577_0012374 | 3300042876 | Bacteria | 8012 |
| 626 | Ga0466969_0025226 | 3300044656 | Bacteria | 3058 |
| 627 | Ga0466969_0029612 | 3300044656 | Bacteria | 2795 |
| 628 | Ga0466972_0000070 | 3300044658 | Bacteria | 100242 |
| 629 | Ga0453683_0034446 | 3300044673 | Bacteria | 3192 |
| 630 | Ga0466965_0017310 | 3300044683 | Bacteria | 3443 |
| 631 | Ga0466965_0082097 | 3300044683 | Bacteria | 1630 |
| 632 | Ga0466966_0000008 | 3300044684 | Bacteria | 155597 |
| 633 | Ga0466966_0000712 | 3300044684 | Bacteria | 21100 |
| 634 | Ga0466966_0026979 | 3300044684 | Bacteria | 3746 |
| 635 | Ga0466966_0131208 | 3300044684 | Bacteria | 1534 |
| 636 | Ga0466961_0000845 | 3300044693 | Bacteria | 19158 |
| 637 | Ga0466961_0006638 | 3300044693 | Bacteria | 7359 |
| 638 | Ga0466964_0000224 | 3300044706 | Bacteria | 16209 |
| 639 | Ga0466964_0046016 | 3300044706 | Bacteria | 1777 |
| 640 | Ga0453684_0000126 | 3300044712 | Bacteria | 336395 |
| 641 | Ga0453684_0002411 | 3300044712 | Bacteria | 45566 |
| 642 | Ga0453684_0028832 | 3300044712 | Bacteria | 7902 |
| 643 | Ga0453684_0056585 | 3300044712 | Bacteria | 5086 |
| 644 | Ga0466971_0016897 | 3300044719 | Bacteria | 3224 |
| 645 | Ga0466968_0005916 | 3300044735 | Bacteria | 4589 |
| 646 | Ga0466970_0223719 | 3300044765 | Bacteria | 1051 |
| 647 | Ga0466957_0002849 | 3300044842 | Bacteria | 9355 |
| 648 | Ga0466957_0015317 | 3300044842 | Bacteria | 4479 |
| 649 | Ga0466957_0020426 | 3300044842 | Bacteria | 3897 |
| 650 | Ga0466957_0080072 | 3300044842 | Bacteria | 2033 |
| 651 | Ga0466960_0132986 | 3300044901 | Bacteria | 1315 |
| 652 | Ga0466959_0008703 | 3300045049 | Bacteria | 7186 |
| 653 | Ga0466959_0020254 | 3300045049 | Bacteria | 4898 |
| 654 | Ga0451576_0041903 | 3300045051 | Bacteria | 4837 |
| 655 | Ga0451576_0074358 | 3300045051 | Bacteria | 3536 |
| 656 | Ga0451576_0351790 | 3300045051 | Bacteria | 1542 |
| 657 | Ga0451576_0437782 | 3300045051 | Bacteria | 1372 |
| 658 | Ga0466958_0002090 | 3300045836 | Bacteria | 9888 |
| 659 | Ga0466958_0003846 | 3300045836 | Bacteria | 7850 |
| 660 | Ga0495617_000096 | 3300046452 | Bacteria | 62625 |
| 661 | Ga0495627_000059 | 3300046453 | Bacteria | 142466 |
| 662 | Ga0495603_0010749 | 3300046455 | Bacteria | 5552 |
| 663 | Ga0495590_0000002 | 3300046457 | Bacteria | 485720 |
| 664 | Ga0495590_0002012 | 3300046457 | Bacteria | 8549 |
| 665 | Ga0495590_0021765 | 3300046457 | Bacteria | 2271 |
| 666 | Ga0495590_0046800 | 3300046457 | Bacteria | 1509 |
| 667 | Ga0495629_0000692 | 3300046459 | Bacteria | 27301 |
| 668 | Ga0495629_0135803 | 3300046459 | Bacteria | 1712 |
| 669 | Ga0495629_0226796 | 3300046459 | Bacteria | 1288 |
| 670 | Ga0495638_0000367 | 3300046460 | Bacteria | 55964 |
| 671 | Ga0495638_0015361 | 3300046460 | Bacteria | 5144 |
| 672 | Ga0495651_0010800 | 3300046462 | Bacteria | 7020 |
| 673 | Ga0495651_0183498 | 3300046462 | Bacteria | 1479 |
| 674 | Ga0495650_0000019 | 3300046471 | Bacteria | 533849 |
| 675 | Ga0495650_0000276 | 3300046471 | Bacteria | 98048 |
| 676 | Ga0495650_0000530 | 3300046471 | Bacteria | 55501 |
| 677 | Ga0495650_0001558 | 3300046471 | Bacteria | 21622 |
| 678 | Ga0495650_0003997 | 3300046471 | Bacteria | 10352 |
| 679 | Ga0495650_0006041 | 3300046471 | Bacteria | 7651 |
| 680 | Ga0495650_0034111 | 3300046471 | Bacteria | 2257 |
| 681 | Ga0495650_0054316 | 3300046471 | Bacteria | 1635 |
| 682 | Ga0495650_0084299 | 3300046471 | Bacteria | 1220 |
| 683 | Ga0495580_0028776 | 3300046472 | Bacteria | 4037 |
| 684 | Ga0495582_0010500 | 3300046473 | Bacteria | 5094 |
| 685 | Ga0495582_0071794 | 3300046473 | Bacteria | 1915 |
| 686 | Ga0495605_0000023 | 3300046474 | Bacteria | 236732 |
| 687 | Ga0495605_0000063 | 3300046474 | Bacteria | 140789 |
| 688 | Ga0495605_0005172 | 3300046474 | Bacteria | 7600 |
| 689 | Ga0495605_0084818 | 3300046474 | Bacteria | 1476 |
| 690 | Ga0495639_0033278 | 3300046475 | Bacteria | 2302 |
| 691 | Ga0495639_0073336 | 3300046475 | Bacteria | 1584 |
| 692 | Ga0495584_0000788 | 3300046491 | Bacteria | 20907 |
| 693 | Ga0495584_0012628 | 3300046491 | Bacteria | 4312 |
| 694 | Ga0495585_0002085 | 3300046492 | Bacteria | 14641 |
| 695 | Ga0495596_0006610 | 3300046500 | Bacteria | 5320 |
| 696 | Ga0495596_0009131 | 3300046500 | Bacteria | 4374 |
| 697 | Ga0495607_0000300 | 3300046501 | Bacteria | 51872 |
| 698 | Ga0495607_0004194 | 3300046501 | Bacteria | 10702 |
| 699 | Ga0495607_0007716 | 3300046501 | Bacteria | 7408 |
| 700 | Ga0495607_0029177 | 3300046501 | Bacteria | 3397 |
| 701 | Ga0495607_0039243 | 3300046501 | Bacteria | 2828 |
| 702 | Ga0495607_0096620 | 3300046501 | Bacteria | 1590 |
| 703 | Ga0495583_0000404 | 3300046506 | Bacteria | 65523 |
| 704 | Ga0495583_0001717 | 3300046506 | Bacteria | 21041 |
| 705 | Ga0495583_0038678 | 3300046506 | Bacteria | 2253 |
| 706 | Ga0495606_0000001 | 3300046507 | Bacteria | 592123 |
| 707 | Ga0495606_0000089 | 3300046507 | Bacteria | 154743 |
| 708 | Ga0495606_0000526 | 3300046507 | Bacteria | 61953 |
| 709 | Ga0495606_0002377 | 3300046507 | Bacteria | 22071 |
| 710 | Ga0495606_0003493 | 3300046507 | Bacteria | 16645 |
| 711 | Ga0495606_0005324 | 3300046507 | Bacteria | 12372 |
| 712 | Ga0495606_0005973 | 3300046507 | Bacteria | 11420 |
| 713 | Ga0495606_0015771 | 3300046507 | Bacteria | 5801 |
| 714 | Ga0495606_0016928 | 3300046507 | Bacteria | 5534 |
| 715 | Ga0495606_0059145 | 3300046507 | Bacteria | 2459 |
| 716 | Ga0495606_0094533 | 3300046507 | Bacteria | 1832 |
| 717 | Ga0495606_0124712 | 3300046507 | Bacteria | 1537 |
| 718 | Ga0495608_0095698 | 3300046511 | Bacteria | 1918 |
| 719 | Ga0495610_0000106 | 3300046512 | Bacteria | 97582 |
| 720 | Ga0495610_0003895 | 3300046512 | Bacteria | 11325 |
| 721 | Ga0495610_0003952 | 3300046512 | Bacteria | 11224 |
| 722 | Ga0495610_0009910 | 3300046512 | Bacteria | 5963 |
| 723 | Ga0495610_0014892 | 3300046512 | Bacteria | 4547 |
| 724 | Ga0495610_0054009 | 3300046512 | Bacteria | 1942 |
| 725 | Ga0495616_0000111 | 3300046513 | Bacteria | 71395 |
| 726 | Ga0495616_0012896 | 3300046513 | Bacteria | 4728 |
| 727 | Ga0495616_0014794 | 3300046513 | Bacteria | 4357 |
| 728 | Ga0495616_0060210 | 3300046513 | Bacteria | 1866 |
| 729 | Ga0495628_0001262 | 3300046516 | Bacteria | 23180 |
| 730 | Ga0495628_0204342 | 3300046516 | Bacteria | 1487 |
| 731 | Ga0495632_0002784 | 3300046519 | Bacteria | 12967 |
| 732 | Ga0495637_0058832 | 3300046520 | Bacteria | 1583 |
| 733 | Ga0495643_0000312 | 3300046522 | Bacteria | 67022 |
| 734 | Ga0495643_0001280 | 3300046522 | Bacteria | 24099 |
| 735 | Ga0495643_0002513 | 3300046522 | Bacteria | 14389 |
| 736 | Ga0495643_0013623 | 3300046522 | Bacteria | 4860 |
| 737 | Ga0495643_0013971 | 3300046522 | Bacteria | 4786 |
| 738 | Ga0495644_0007048 | 3300046523 | Bacteria | 4349 |
| 739 | Ga0495644_0009384 | 3300046523 | Bacteria | 3773 |
| 740 | Ga0495648_0000037 | 3300046524 | Bacteria | 195401 |
| 741 | Ga0495648_0004385 | 3300046524 | Bacteria | 12074 |
| 742 | Ga0495648_0009791 | 3300046524 | Bacteria | 7374 |
| 743 | Ga0495648_0029713 | 3300046524 | Bacteria | 3623 |
| 744 | Ga0495642_0000535 | 3300046528 | Bacteria | 19288 |
| 745 | Ga0495654_0000015 | 3300046530 | Bacteria | 307873 |
| 746 | Ga0495654_0003446 | 3300046530 | Bacteria | 9679 |
| 747 | Ga0495654_0009030 | 3300046530 | Bacteria | 5472 |
| 748 | Ga0495665_0009106 | 3300046531 | Bacteria | 5380 |
| 749 | Ga0495609_0000002 | 3300046538 | Bacteria | 739816 |
| 750 | Ga0495609_0000334 | 3300046538 | Bacteria | 41567 |
| 751 | Ga0495609_0001009 | 3300046538 | Bacteria | 20017 |
| 752 | Ga0495609_0002742 | 3300046538 | Bacteria | 10603 |
| 753 | Ga0495621_0005728 | 3300046539 | Bacteria | 3588 |
| 754 | Ga0495597_0000024 | 3300046542 | Bacteria | 143948 |
| 755 | Ga0495597_0000874 | 3300046542 | Bacteria | 23420 |
| 756 | Ga0495597_0002290 | 3300046542 | Bacteria | 12434 |
| 757 | Ga0495645_0009956 | 3300046543 | Bacteria | 6655 |
| 758 | Ga0495645_0063919 | 3300046543 | Bacteria | 2663 |
| 759 | Ga0495622_0000969 | 3300046557 | Bacteria | 15397 |
| 760 | Ga0495633_0000244 | 3300046558 | Bacteria | 65398 |
| 761 | Ga0495633_0000433 | 3300046558 | Bacteria | 43302 |
| 762 | Ga0495633_0014264 | 3300046558 | Bacteria | 4161 |
| 763 | Ga0495633_0015529 | 3300046558 | Bacteria | 3948 |
| 764 | Ga0495633_0023233 | 3300046558 | Bacteria | 3073 |
| 765 | Ga0495633_0101553 | 3300046558 | Bacteria | 1335 |
| 766 | Ga0495667_0161275 | 3300046559 | Bacteria | 1442 |
| 767 | Ga0495656_0005116 | 3300046615 | Bacteria | 4519 |
| 768 | Ga0495668_0000241 | 3300046616 | Bacteria | 78040 |
| 769 | Ga0495668_0001675 | 3300046616 | Bacteria | 20557 |
| 770 | Ga0495668_0001687 | 3300046616 | Bacteria | 20430 |
| 771 | Ga0495611_0018206 | 3300046648 | Bacteria | 3010 |
| 772 | Ga0495625_0000317 | 3300046660 | Bacteria | 73568 |
| 773 | Ga0495625_0001881 | 3300046660 | Bacteria | 23817 |
| 774 | Ga0495625_0014029 | 3300046660 | Bacteria | 6414 |
| 775 | Ga0495625_0021505 | 3300046660 | Bacteria | 4967 |
| 776 | Ga0495625_0026803 | 3300046660 | Bacteria | 4348 |
| 777 | Ga0495625_0076863 | 3300046660 | Bacteria | 2333 |
| 778 | Ga0495661_0000183 | 3300046665 | Bacteria | 72020 |
| 779 | Ga0495661_0038946 | 3300046665 | Bacteria | 2956 |
| 780 | Ga0495661_0064705 | 3300046665 | Bacteria | 2157 |
| 781 | Ga0495661_0205407 | 3300046665 | Bacteria | 1029 |
| 782 | Ga0495588_0000127 | 3300046674 | Bacteria | 125854 |
| 783 | Ga0495588_0070690 | 3300046674 | Bacteria | 1814 |
| 784 | Ga0495623_0031408 | 3300046679 | Bacteria | 3414 |
| 785 | Ga0495646_0012603 | 3300046680 | Bacteria | 5373 |
| 786 | Ga0495646_0134589 | 3300046680 | Bacteria | 1388 |
| 787 | Ga0495647_0017512 | 3300046681 | Bacteria | 2536 |
| 788 | Ga0495658_0002829 | 3300046683 | Bacteria | 8717 |
| 789 | Ga0495669_0038374 | 3300046684 | Bacteria | 2121 |
| 790 | Ga0495669_0091817 | 3300046684 | Bacteria | 1402 |
| 791 | Ga0495624_0054694 | 3300046690 | Bacteria | 2516 |
| 792 | Ga0495624_0172427 | 3300046690 | Bacteria | 1320 |
| 793 | Ga0495670_0024761 | 3300046691 | Bacteria | 2967 |
| 794 | Ga0495671_0000006 | 3300046692 | Bacteria | 500471 |
| 795 | Ga0495671_0005302 | 3300046692 | Bacteria | 7564 |
| 796 | Ga0495671_0007566 | 3300046692 | Bacteria | 6180 |
| 797 | Ga0495649_0008178 | 3300046694 | Bacteria | 6307 |
| 798 | Ga0495649_0088312 | 3300046694 | Bacteria | 1654 |
| 799 | Ga0495649_0103208 | 3300046694 | Bacteria | 1514 |
| 800 | Ga0495649_0111947 | 3300046694 | Bacteria | 1447 |
| 801 | Ga0495589_0000083 | 3300046794 | Bacteria | 87058 |
| 802 | Ga0495589_0001488 | 3300046794 | Bacteria | 13479 |
| 803 | Ga0495660_0000365 | 3300046810 | Bacteria | 39810 |
| 804 | Ga0495660_0000625 | 3300046810 | Bacteria | 27722 |
| 805 | Ga0495660_0025700 | 3300046810 | Bacteria | 3343 |
| 806 | Ga0495660_0032884 | 3300046810 | Bacteria | 2911 |
| 807 | Ga0495660_0061619 | 3300046810 | Bacteria | 2012 |
| 808 | Ga0495581_0115185 | 3300047315 | Bacteria | 1563 |
| 809 | Ga0495604_0027537 | 3300047317 | Bacteria | 4519 |
| 810 | Ga0495636_0063802 | 3300047318 | Bacteria | 1562 |
| 811 | Ga0495674_0031179 | 3300047319 | Bacteria | 4844 |
| 812 | Ga0495672_0000021 | 3300047320 | Bacteria | 422795 |
| 813 | Ga0495672_0000707 | 3300047320 | Bacteria | 36700 |
| 814 | Ga0495672_0002916 | 3300047320 | Bacteria | 15128 |
| 815 | Ga0495672_0069170 | 3300047320 | Bacteria | 2005 |
| 816 | Ga0495672_0082684 | 3300047320 | Bacteria | 1785 |
| 817 | Ga0495680_0137293 | 3300047322 | Bacteria | 1792 |
| 818 | Ga0495683_0001181 | 3300047323 | Bacteria | 17821 |
| 819 | Ga0495683_0024470 | 3300047323 | Bacteria | 3098 |
| 820 | Ga0495683_0119960 | 3300047323 | Bacteria | 1249 |
| 821 | Ga0495687_000075 | 3300047443 | Bacteria | 152218 |
| 822 | Ga0495687_000104 | 3300047443 | Bacteria | 128704 |
| 823 | Ga0495687_000197 | 3300047443 | Bacteria | 86694 |
| 824 | Ga0495687_000701 | 3300047443 | Bacteria | 37406 |
| 825 | Ga0495687_001598 | 3300047443 | Bacteria | 20448 |
| 826 | Ga0495687_032607 | 3300047443 | Bacteria | 2375 |
| 827 | Ga0495677_0000030 | 3300047445 | Bacteria | 87817 |
| 828 | Ga0495679_001504 | 3300047446 | Bacteria | 13174 |
| 829 | Ga0495679_011288 | 3300047446 | Bacteria | 3457 |
| 830 | Ga0495679_036998 | 3300047446 | Bacteria | 1537 |
| 831 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 832 | Ga0495673_0000061 | 3300047469 | Bacteria | 230647 |
| 833 | Ga0495673_0000482 | 3300047469 | Bacteria | 42471 |
| 834 | Ga0495681_0027176 | 3300047470 | Bacteria | 2965 |
| 835 | Ga0495684_0228986 | 3300047471 | Bacteria | 1360 |
| 836 | Ga0495686_0000032 | 3300047472 | Bacteria | 345132 |
| 837 | Ga0495686_0000321 | 3300047472 | Bacteria | 79813 |
| 838 | Ga0495593_0087226 | 3300047673 | Bacteria | 1609 |
| 839 | Ga0495593_0090669 | 3300047673 | Bacteria | 1574 |
| 840 | Ga0495602_0009621 | 3300048088 | Bacteria | 10045 |
| 841 | Ga0495615_0013849 | 3300048090 | Bacteria | 1693 |
| 842 | Ga0495626_0000111 | 3300048091 | Bacteria | 105401 |
| 843 | Ga0495626_0001501 | 3300048091 | Bacteria | 18401 |
| 844 | Ga0495626_0005215 | 3300048091 | Bacteria | 7692 |
| 845 | Ga0495626_0008949 | 3300048091 | Bacteria | 5434 |
| 846 | Ga0495626_0024727 | 3300048091 | Bacteria | 2942 |
| 847 | Ga0495626_0137219 | 3300048091 | Bacteria | 1039 |
| 848 | Ga0496100_0329855 | 3300048903 | Bacteria | 1148 |
| 849 | Ga0496101_0013191 | 3300048904 | Bacteria | 5532 |
| 850 | Ga0496101_0154023 | 3300048904 | Bacteria | 1759 |
| 851 | Ga0496101_0184877 | 3300048904 | Bacteria | 1606 |
| 852 | Ga0496101_0205393 | 3300048904 | Bacteria | 1524 |
| 853 | Ga0496101_0365187 | 3300048904 | Bacteria | 1135 |
| 854 | Ga0496101_0375661 | 3300048904 | Bacteria | 1118 |
| 855 | Ga0496102_0002066 | 3300048905 | Bacteria | 17293 |
| 856 | Ga0496102_0017450 | 3300048905 | Bacteria | 6288 |
| 857 | Ga0496102_0118990 | 3300048905 | Bacteria | 2466 |
| 858 | Ga0496102_0138631 | 3300048905 | Bacteria | 2280 |
| 859 | Ga0496102_0210216 | 3300048905 | Bacteria | 1834 |
| 860 | Ga0496103_0005550 | 3300048906 | Bacteria | 7538 |
| 861 | Ga0496103_0124176 | 3300048906 | Bacteria | 1645 |
| 862 | Ga0496104_0037582 | 3300048907 | Bacteria | 4528 |
| 863 | Ga0496104_0156828 | 3300048907 | Bacteria | 2184 |
| 864 | Ga0496105_0123909 | 3300048908 | Bacteria | 2130 |
| 865 | Ga0496106_0000074 | 3300048909 | Bacteria | 80191 |
| 866 | Ga0496106_0002714 | 3300048909 | Bacteria | 13113 |
| 867 | Ga0496106_0012232 | 3300048909 | Bacteria | 6334 |
| 868 | Ga0496106_0013407 | 3300048909 | Bacteria | 6052 |
| 869 | Ga0496107_0006958 | 3300048910 | Bacteria | 7794 |
| 870 | Ga0496108_0171706 | 3300048911 | Bacteria | 1876 |
| 871 | Ga0496109_0057477 | 3300048912 | Bacteria | 3551 |
| 872 | Ga0496109_0114677 | 3300048912 | Bacteria | 2507 |
| 873 | Ga0496110_0152920 | 3300048913 | Bacteria | 2089 |
| 874 | Ga0496110_0187063 | 3300048913 | Bacteria | 1881 |
| 875 | Ga0496112_0444813 | 3300048915 | Bacteria | 1234 |
| 876 | Ga0496114_0088778 | 3300048917 | Bacteria | 2623 |
| 877 | Ga0496114_0190586 | 3300048917 | Bacteria | 1794 |
| 878 | Ga0496114_0500447 | 3300048917 | Bacteria | 1075 |
| 879 | Ga0496116_0026363 | 3300048919 | Bacteria | 4254 |
| 880 | Ga0496116_0034917 | 3300048919 | Bacteria | 3538 |
| 881 | Ga0496116_0053557 | 3300048919 | Bacteria | 2664 |
| 882 | Ga0496117_0006812 | 3300048920 | Bacteria | 11376 |
| 883 | Ga0496117_0049092 | 3300048920 | Bacteria | 3006 |
| 884 | Ga0496118_0003604 | 3300048921 | Bacteria | 19255 |
| 885 | Ga0496118_0023850 | 3300048921 | Bacteria | 5301 |
| 886 | Ga0496118_0082126 | 3300048921 | Bacteria | 2259 |
| 887 | Ga0496118_0210772 | 3300048921 | Bacteria | 1140 |
| 888 | Ga0496121_0000941 | 3300048924 | Bacteria | 52704 |
| 889 | Ga0496121_0004681 | 3300048924 | Bacteria | 18152 |
| 890 | Ga0496121_0021261 | 3300048924 | Bacteria | 6367 |
| 891 | Ga0496121_0034037 | 3300048924 | Bacteria | 4594 |
| 892 | Ga0496121_0096223 | 3300048924 | Bacteria | 2298 |
| 893 | Ga0496121_0135274 | 3300048924 | Bacteria | 1837 |
| 894 | Ga0496121_0158818 | 3300048924 | Bacteria | 1656 |
| 895 | Ga0496122_0005686 | 3300048925 | Bacteria | 14721 |
| 896 | Ga0496122_0009086 | 3300048925 | Bacteria | 10539 |
| 897 | Ga0496122_0014636 | 3300048925 | Bacteria | 7571 |
| 898 | Ga0496122_0022841 | 3300048925 | Bacteria | 5541 |
| 899 | Ga0496122_0161621 | 3300048925 | Bacteria | 1365 |
| 900 | Ga0496122_0166245 | 3300048925 | Bacteria | 1337 |
| 901 | Ga0496123_0007120 | 3300048926 | Bacteria | 10623 |
| 902 | Ga0496123_0011977 | 3300048926 | Bacteria | 7441 |
| 903 | Ga0496123_0102873 | 3300048926 | Bacteria | 1656 |
| 904 | Ga0496124_0000007 | 3300048927 | Bacteria | 883534 |
| 905 | Ga0496124_0020891 | 3300048927 | Bacteria | 6040 |
| 906 | Ga0496124_0044825 | 3300048927 | Bacteria | 3793 |
| 907 | Ga0496124_0106637 | 3300048927 | Bacteria | 2262 |
| 908 | Ga0496124_0136831 | 3300048927 | Bacteria | 1938 |
| 909 | Ga0496125_0009075 | 3300048928 | Bacteria | 10289 |
| 910 | Ga0496125_0022520 | 3300048928 | Bacteria | 5847 |
| 911 | Ga0496125_0049552 | 3300048928 | Bacteria | 3489 |
| 912 | Ga0496126_0000571 | 3300048929 | Bacteria | 70542 |
| 913 | Ga0496126_0012111 | 3300048929 | Bacteria | 8853 |
| 914 | Ga0496126_0069666 | 3300048929 | Bacteria | 3136 |
| 915 | Ga0496126_0159782 | 3300048929 | Bacteria | 1926 |
| 916 | Ga0496126_0246949 | 3300048929 | Bacteria | 1489 |
| 917 | Ga0495678_000030 | 3300049459 | Bacteria | 217986 |
| 918 | Ga0495678_001619 | 3300049459 | Bacteria | 17175 |
| 919 | Ga0495678_004565 | 3300049459 | Bacteria | 7965 |
| 920 | Ga0501031_0417905 | 3300049568 | Bacteria | 867 |
| 921 | Ga0501032_0127527 | 3300049569 | Bacteria | 1680 |
| 922 | Ga0501033_0200807 | 3300049570 | Bacteria | 1424 |
| 923 | Ga0501034_0000588 | 3300049571 | Bacteria | 57446 |
| 924 | Ga0501034_0002376 | 3300049571 | Bacteria | 22856 |
| 925 | Ga0501034_0070335 | 3300049571 | Bacteria | 3511 |
| 926 | Ga0501036_0011863 | 3300049572 | Bacteria | 7222 |
| 927 | Ga0501036_0137477 | 3300049572 | Bacteria | 2062 |
| 928 | Ga0501036_0401942 | 3300049572 | Bacteria | 1143 |
| 929 | Ga0501037_0010598 | 3300049573 | Bacteria | 6772 |
| 930 | Ga0501038_0001224 | 3300049574 | Bacteria | 23265 |
| 931 | Ga0501039_0013076 | 3300049575 | Bacteria | 6346 |
| 932 | Ga0501039_0106296 | 3300049575 | Bacteria | 2192 |
| 933 | Ga0501040_0016487 | 3300049576 | Bacteria | 4892 |
| 934 | Ga0501041_0005223 | 3300049577 | Bacteria | 7583 |
| 935 | Ga0501042_0029726 | 3300049578 | Bacteria | 3854 |
| 936 | Ga0501043_0010497 | 3300049579 | Bacteria | 7252 |
| 937 | Ga0501046_0034605 | 3300049580 | Bacteria | 4075 |
| 938 | Ga0501047_0001745 | 3300049581 | Bacteria | 21067 |
| 939 | Ga0501047_0021370 | 3300049581 | Bacteria | 6212 |
| 940 | Ga0501072_0006553 | 3300049588 | Bacteria | 8867 |
| 941 | Ga0501074_0152065 | 3300049590 | Bacteria | 1654 |
| 942 | Ga0501075_0003826 | 3300049591 | Bacteria | 10132 |
| 943 | Ga0501075_0087072 | 3300049591 | Bacteria | 2367 |
| 944 | Ga0501076_0000538 | 3300049592 | Bacteria | 24148 |
| 945 | Ga0501076_0146857 | 3300049592 | Bacteria | 1917 |
| 946 | Ga0501208_016508 | 3300049655 | Bacteria | 1150 |
| 947 | Ga0501079_0144454 | 3300049741 | Bacteria | 1854 |
| 948 | Ga0501080_0233382 | 3300049742 | Bacteria | 1681 |
| 949 | Ga0501080_0243333 | 3300049742 | Bacteria | 1641 |
| 950 | Ga0501081_0006631 | 3300049743 | Bacteria | 7525 |
| 951 | Ga0501083_0017537 | 3300049744 | Bacteria | 4991 |
| 952 | Ga0501262_000211 | 3300049759 | Bacteria | 7263 |
| 953 | Ga0501269_000655 | 3300049766 | Bacteria | 5945 |
| 954 | Ga0501035_0002263 | 3300049822 | Bacteria | 19027 |
| 955 | Ga0501035_0004536 | 3300049822 | Bacteria | 13179 |
| 956 | Ga0501035_0049247 | 3300049822 | Bacteria | 3776 |
| 957 | Ga0501044_0001571 | 3300049823 | Bacteria | 26728 |
| 958 | Ga0501044_0005080 | 3300049823 | Bacteria | 14681 |
| 959 | Ga0501045_0004030 | 3300049824 | Bacteria | 10122 |
| 960 | nmdc:mga03683_26853_c1 | 3300050489 | Bacteria | 2275 |
| 961 | nmdc:mga00v17_23749_c1 | 3300050491 | Bacteria | 3550 |
| 962 | nmdc:mga00v17_28740_c1 | 3300050491 | Bacteria | 3259 |
| 963 | nmdc:mga0k408_31611_c1 | 3300050493 | Bacteria | 3023 |
| 964 | nmdc:mga0k408_43461_c1 | 3300050493 | Bacteria | 2589 |
| 965 | nmdc:mga0k408_65032_c1 | 3300050493 | Bacteria | 2122 |
| 966 | nmdc:mga07m45_136330_c1 | 3300050496 | Bacteria | 1421 |
| 967 | nmdc:mga07m45_45703_c1 | 3300050496 | Bacteria | 2459 |
| 968 | nmdc:mga05p37_497045_c1 | 3300050507 | Bacteria | 1401 |
| 969 | nmdc:mga0qj67_218355_c1 | 3300050509 | Bacteria | 1548 |
| 970 | nmdc:mga06r32_15835_c1 | 3300050510 | Bacteria | 6858 |
| 971 | nmdc:mga08y16_168023_c1 | 3300050511 | Bacteria | 2279 |
| 972 | nmdc:mga08y16_520259_c1 | 3300050511 | Bacteria | 1207 |
| 973 | nmdc:mga0n895_23960_c1 | 3300050512 | Bacteria | 5745 |
| 974 | nmdc:mga0rr50_11953_c1 | 3300050513 | Bacteria | 5585 |
| 975 | nmdc:mga0rr50_513266_c1 | 3300050513 | Bacteria | 1019 |
| 976 | nmdc:mga0sz30_19901_c1 | 3300050516 | Bacteria | 2702 |
| 977 | Ga0500610_0001020 | 3300053079 | Bacteria | 9139 |
| 978 | Ga0500610_0001866 | 3300053079 | Bacteria | 7465 |
| 979 | Ga0500651_0001691 | 3300053093 | Bacteria | 11269 |
| 980 | Ga0500650_0000068 | 3300053098 | Bacteria | 31846 |
| 981 | Ga0500595_048810 | 3300053119 | Bacteria | 1321 |
| 982 | Ga0500618_000543 | 3300053125 | Bacteria | 23454 |
| 983 | Ga0500618_002981 | 3300053125 | Bacteria | 6040 |
| 984 | Ga0500655_003191 | 3300053133 | Bacteria | 2974 |
| 985 | Ga0500658_0000902 | 3300053134 | Bacteria | 12176 |
| 986 | Ga0500586_000310 | 3300053145 | Bacteria | 9716 |
| 987 | Ga0500622_0000011 | 3300053156 | Bacteria | 386096 |
| 988 | Ga0500634_0051201 | 3300053161 | Bacteria | 2222 |
| 989 | Ga0500645_000459 | 3300053730 | Bacteria | 27920 |
| 990 | Ga0501084_0033378 | 3300054114 | Bacteria | 4306 |
| 991 | Ga0501084_0219539 | 3300054114 | Bacteria | 1604 |
| 992 | Ga0501082_0001529 | 3300060353 | Bacteria | 20359 |
| 993 | Ga0501082_0125077 | 3300060353 | Bacteria | 2230 |
| 994 | Ga0466962_0000474 | 3300061719 | Bacteria | 17440 |
| 995 | Ga0466962_0022225 | 3300061719 | Bacteria | 3047 |
| 996 | Ga0466962_0121293 | 3300061719 | Bacteria | 1261 |
| 997 | Ga0466962_0130238 | 3300061719 | Bacteria | 1215 |
| 998 | Ga0530510_0001545 | 3300061734 | Bacteria | 15520 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005471 | Ga0070698_100025906 | Ga0070698_1000259062 | 211 |
| 2 | 3300025922 | Ga0207646_10049764 | Ga0207646_100497643 | 215 |
| 3 | 3300007076 | Ga0075435_100099622 | Ga0075435_1000996222 | 217 |
| 4 | 3300009098 | Ga0105245_10145723 | Ga0105245_101457232 | 219 |
| 5 | 3300009177 | Ga0105248_10178802 | Ga0105248_101788022 | 219 |
| 6 | 3300013307 | Ga0157372_10120514 | Ga0157372_101205144 | 219 |
| 7 | 3300014968 | Ga0157379_10063212 | Ga0157379_100632125 | 219 |
| 8 | 3300014969 | Ga0157376_10017098 | Ga0157376_100170986 | 219 |
| 9 | 3300035242 | Ga0373962_0020529 | Ga0373962_0020529_579_1454 | 219 |
| 10 | 3300035691 | Ga0373931_0003777 | Ga0373931_0003777_2196_3071 | 219 |
| 11 | 3300048904 | Ga0496101_0205393 | Ga0496101_0205393_289_1164 | 219 |
| 12 | 3300048909 | Ga0496106_0013407 | Ga0496106_0013407_3168_4043 | 219 |
| 13 | 3300048910 | Ga0496107_0006958 | Ga0496107_0006958_4892_5767 | 219 |
| 14 | 3300048912 | Ga0496109_0057477 | Ga0496109_0057477_2304_3179 | 219 |
| 15 | 3300048917 | Ga0496114_0190586 | Ga0496114_0190586_539_1414 | 219 |
| 16 | 3300050512 | nmdc:mga0n895_23960_c1 | nmdc:mga0n895_23960_c1_1202_2047 | 220 |
| 17 | 3300050513 | nmdc:mga0rr50_11953_c1 | nmdc:mga0rr50_11953_c1_2015_2860 | 220 |
| 18 | 3300005330 | Ga0070690_100287651 | Ga0070690_1002876511 | 222 |
| 19 | 3300005333 | Ga0070677_10037616 | Ga0070677_100376162 | 222 |
| 20 | 3300005334 | Ga0068869_100001022 | Ga0068869_10000102210 | 222 |
| 21 | 3300005338 | Ga0068868_100189855 | Ga0068868_1001898552 | 222 |
| 22 | 3300005354 | Ga0070675_100008605 | Ga0070675_1000086056 | 222 |
| 23 | 3300005355 | Ga0070671_100338804 | Ga0070671_1003388042 | 222 |
| 24 | 3300005366 | Ga0070659_100033084 | Ga0070659_1000330845 | 222 |
| 25 | 3300005457 | Ga0070662_100021829 | Ga0070662_1000218293 | 222 |
| 26 | 3300005539 | Ga0068853_100025396 | Ga0068853_1000253966 | 222 |
| 27 | 3300005547 | Ga0070693_100082994 | Ga0070693_1000829942 | 222 |
| 28 | 3300005563 | Ga0068855_100137218 | Ga0068855_1001372182 | 222 |
| 29 | 3300005614 | Ga0068856_100054154 | Ga0068856_1000541542 | 222 |
| 30 | 3300005615 | Ga0070702_100057523 | Ga0070702_1000575232 | 222 |
| 31 | 3300005618 | Ga0068864_100007739 | Ga0068864_1000077392 | 222 |
| 32 | 3300005719 | Ga0068861_100002859 | Ga0068861_1000028594 | 222 |
| 33 | 3300005834 | Ga0068851_10024197 | Ga0068851_100241972 | 222 |
| 34 | 3300005844 | Ga0068862_100112543 | Ga0068862_1001125432 | 222 |
| 35 | 3300006237 | Ga0097621_100009938 | Ga0097621_1000099382 | 222 |
| 36 | 3300006358 | Ga0068871_100003785 | Ga0068871_1000037853 | 222 |
| 37 | 3300013105 | Ga0157369_10331675 | Ga0157369_103316752 | 222 |
| 38 | 3300017792 | Ga0163161_10026761 | Ga0163161_100267615 | 222 |
| 39 | 3300025893 | Ga0207682_10038204 | Ga0207682_100382042 | 222 |
| 40 | 3300025907 | Ga0207645_10021161 | Ga0207645_100211612 | 222 |
| 41 | 3300025911 | Ga0207654_10046374 | Ga0207654_100463742 | 222 |
| 42 | 3300025914 | Ga0207671_10269697 | Ga0207671_102696972 | 222 |
| 43 | 3300025919 | Ga0207657_10022908 | Ga0207657_100229082 | 222 |
| 44 | 3300025924 | Ga0207694_10421926 | Ga0207694_104219262 | 222 |
| 45 | 3300025926 | Ga0207659_10165511 | Ga0207659_101655112 | 222 |
| 46 | 3300025927 | Ga0207687_10142411 | Ga0207687_101424111 | 222 |
| 47 | 3300025933 | Ga0207706_10000892 | Ga0207706_1000089229 | 222 |
| 48 | 3300025941 | Ga0207711_10153394 | Ga0207711_101533942 | 222 |
| 49 | 3300025942 | Ga0207689_10000393 | Ga0207689_100003932 | 222 |
| 50 | 3300025949 | Ga0207667_10103988 | Ga0207667_101039882 | 222 |
| 51 | 3300025981 | Ga0207640_10008616 | Ga0207640_100086162 | 222 |
| 52 | 3300026023 | Ga0207677_10004381 | Ga0207677_100043816 | 222 |
| 53 | 3300026035 | Ga0207703_10328392 | Ga0207703_103283922 | 222 |
| 54 | 3300026067 | Ga0207678_10019804 | Ga0207678_100198042 | 222 |
| 55 | 3300026078 | Ga0207702_10038205 | Ga0207702_100382054 | 222 |
| 56 | 3300026088 | Ga0207641_10038171 | Ga0207641_100381713 | 222 |
| 57 | 3300026118 | Ga0207675_100009503 | Ga0207675_1000095034 | 222 |
| 58 | 3300028380 | Ga0268265_10071330 | Ga0268265_100713302 | 222 |
| 59 | 3300031456 | Ga0307513_10000004 | Ga0307513_1000000435 | 225 |
| 60 | 3300005353 | Ga0070669_100012521 | Ga0070669_1000125213 | 226 |
| 61 | 3300009174 | Ga0105241_10083754 | Ga0105241_100837542 | 227 |
| 62 | 3300009545 | Ga0105237_10010158 | Ga0105237_100101589 | 227 |
| 63 | 3300013105 | Ga0157369_10420836 | Ga0157369_104208361 | 227 |
| 64 | 3300013100 | Ga0157373_10048268 | Ga0157373_100482682 | 228 |
| 65 | 3300014497 | Ga0182008_10038719 | Ga0182008_100387192 | 228 |
| 66 | 3300015262 | Ga0182007_10046516 | Ga0182007_100465162 | 228 |
| 67 | 3300031548 | Ga0307408_100010654 | Ga0307408_1000106543 | 228 |
| 68 | 3300031901 | Ga0307406_10002492 | Ga0307406_100024922 | 228 |
| 69 | 3300035692 | Ga0373935_0175318 | Ga0373935_0175318_392_1162 | 228 |
| 70 | 3300048904 | Ga0496101_0375661 | Ga0496101_0375661_105_893 | 228 |
| 71 | 3300005329 | Ga0070683_100093142 | Ga0070683_1000931422 | 231 |
| 72 | 3300005577 | Ga0068857_100022658 | Ga0068857_1000226585 | 231 |
| 73 | 3300025944 | Ga0207661_10063210 | Ga0207661_100632103 | 231 |
| 74 | 3300025945 | Ga0207679_10120278 | Ga0207679_101202783 | 231 |
| 75 | 3300003792 | Ga0055540_1001184 | Ga0055540_10011843 | 232 |
| 76 | 3300005289 | Ga0065704_10005654 | Ga0065704_100056543 | 232 |
| 77 | 3300005367 | Ga0070667_100228928 | Ga0070667_1002289282 | 232 |
| 78 | 3300006846 | Ga0075430_100005392 | Ga0075430_10000539211 | 232 |
| 79 | 3300006847 | Ga0075431_100020149 | Ga0075431_1000201493 | 232 |
| 80 | 3300009147 | Ga0114129_10372132 | Ga0114129_103721323 | 232 |
| 81 | 3300025303 | Ga0209051_1000991 | Ga0209051_100099126 | 232 |
| 82 | 3300050489 | nmdc:mga03683_26853_c1 | nmdc:mga03683_26853_c1_873_1751 | 232 |
| 83 | 3300050507 | nmdc:mga05p37_497045_c1 | nmdc:mga05p37_497045_c1_437_1177 | 232 |
| 84 | 3300050509 | nmdc:mga0qj67_218355_c1 | nmdc:mga0qj67_218355_c1_675_1415 | 232 |
| 85 | 3300050510 | nmdc:mga06r32_15835_c1 | nmdc:mga06r32_15835_c1_6079_6819 | 232 |
| 86 | 3300037068 | Ga0373925_0013472 | Ga0373925_0013472_79_858 | 233 |
| 87 | 3300005546 | Ga0070696_100554915 | Ga0070696_1005549151 | 234 |
| 88 | 3300006871 | Ga0075434_100014084 | Ga0075434_1000140843 | 234 |
| 89 | 3300025910 | Ga0207684_10091257 | Ga0207684_100912572 | 234 |
| 90 | 3300037853 | Ga0436364_0445393 | Ga0436364_0445393_321_1160 | 234 |
| 91 | 3300037312 | Ga0395899_0019864 | Ga0395899_0019864_152_940 | 236 |
| 92 | 3300037418 | Ga0395900_0001610 | Ga0395900_0001610_25732_26520 | 236 |
| 93 | 3300037418 | Ga0395900_0314768 | Ga0395900_0314768_185_973 | 236 |
| 94 | 3300037466 | Ga0395898_0330480 | Ga0395898_0330480_118_906 | 236 |
| 95 | 3300038443 | Ga0395901_0000963 | Ga0395901_0000963_22316_23104 | 236 |
| 96 | 3300039437 | Ga0436365_0998154 | Ga0436365_0998154_115_954 | 236 |
| 97 | 3300039450 | Ga0436363_1260698 | Ga0436363_1260698_6329_7168 | 236 |
| 98 | 3300042007 | Ga0439449_0049113 | Ga0439449_0049113_128_916 | 236 |
| 99 | 3300044706 | Ga0466964_0000224 | Ga0466964_0000224_8437_9225 | 236 |
| 100 | 3300044842 | Ga0466957_0015317 | Ga0466957_0015317_897_1685 | 236 |
| 101 | 3300005347 | Ga0070668_100474225 | Ga0070668_1004742251 | 237 |
| 102 | 3300005367 | Ga0070667_100184810 | Ga0070667_1001848102 | 237 |
| 103 | 3300005937 | Ga0081455_10153169 | Ga0081455_101531692 | 237 |
| 104 | 3300013306 | Ga0163162_10489793 | Ga0163162_104897932 | 237 |
| 105 | 3300014497 | Ga0182008_10003552 | Ga0182008_100035524 | 237 |
| 106 | 3300025972 | Ga0207668_10118695 | Ga0207668_101186951 | 237 |
| 107 | 3300026121 | Ga0207683_10123968 | Ga0207683_101239683 | 237 |
| 108 | 3300031251 | Ga0265327_10111907 | Ga0265327_101119072 | 237 |
| 109 | 3300037068 | Ga0373925_0167723 | Ga0373925_0167723_175_999 | 237 |
| 110 | 3300037471 | Ga0395905_0250215 | Ga0395905_0250215_664_1452 | 237 |
| 111 | 3300041453 | Ga0451797_0514870 | Ga0451797_0514870_255_1031 | 237 |
| 112 | 3300048911 | Ga0496108_0171706 | Ga0496108_0171706_496_1368 | 237 |
| 113 | 3300049572 | Ga0501036_0401942 | Ga0501036_0401942_24_866 | 237 |
| 114 | 3300003792 | Ga0055540_1004397 | Ga0055540_10043973 | 238 |
| 115 | 3300003794 | Ga0055531_10000566 | Ga0055531_100005665 | 238 |
| 116 | 3300005336 | Ga0070680_100188240 | Ga0070680_1001882402 | 238 |
| 117 | 3300005347 | Ga0070668_100309274 | Ga0070668_1003092742 | 238 |
| 118 | 3300005366 | Ga0070659_100104663 | Ga0070659_1001046633 | 238 |
| 119 | 3300005436 | Ga0070713_100417020 | Ga0070713_1004170202 | 238 |
| 120 | 3300005437 | Ga0070710_10224337 | Ga0070710_102243371 | 238 |
| 121 | 3300005458 | Ga0070681_10118465 | Ga0070681_101184653 | 238 |
| 122 | 3300005530 | Ga0070679_100040681 | Ga0070679_1000406814 | 238 |
| 123 | 3300005539 | Ga0068853_100354689 | Ga0068853_1003546891 | 238 |
| 124 | 3300005577 | Ga0068857_100034613 | Ga0068857_1000346133 | 238 |
| 125 | 3300005577 | Ga0068857_100591030 | Ga0068857_1005910302 | 238 |
| 126 | 3300005983 | Ga0081540_1000032 | Ga0081540_10000324 | 238 |
| 127 | 3300006038 | Ga0075365_10062701 | Ga0075365_100627014 | 238 |
| 128 | 3300006042 | Ga0075368_10034956 | Ga0075368_100349562 | 238 |
| 129 | 3300006177 | Ga0075362_10012593 | Ga0075362_100125935 | 238 |
| 130 | 3300006178 | Ga0075367_10019309 | Ga0075367_100193094 | 238 |
| 131 | 3300006178 | Ga0075367_10196528 | Ga0075367_101965282 | 238 |
| 132 | 3300006195 | Ga0075366_10060205 | Ga0075366_100602052 | 238 |
| 133 | 3300006195 | Ga0075366_10310309 | Ga0075366_103103091 | 238 |
| 134 | 3300006353 | Ga0075370_10056153 | Ga0075370_100561533 | 238 |
| 135 | 3300009094 | Ga0111539_10053706 | Ga0111539_100537063 | 238 |
| 136 | 3300009176 | Ga0105242_10381003 | Ga0105242_103810032 | 238 |
| 137 | 3300013102 | Ga0157371_10482293 | Ga0157371_104822931 | 238 |
| 138 | 3300013306 | Ga0163162_10098476 | Ga0163162_100984763 | 238 |
| 139 | 3300015683 | Ga0183362_10003 | Ga0183362_10003476 | 238 |
| 140 | 3300025273 | Ga0209673_1046401 | Ga0209673_10464012 | 238 |
| 141 | 3300025303 | Ga0209051_1000388 | Ga0209051_10003883 | 238 |
| 142 | 3300025304 | Ga0209257_1000022 | Ga0209257_1000022640 | 238 |
| 143 | 3300025914 | Ga0207671_10047846 | Ga0207671_100478461 | 238 |
| 144 | 3300025921 | Ga0207652_10155238 | Ga0207652_101552382 | 238 |
| 145 | 3300025923 | Ga0207681_10088404 | Ga0207681_100884041 | 238 |
| 146 | 3300026041 | Ga0207639_10338404 | Ga0207639_103384042 | 238 |
| 147 | 3300026116 | Ga0207674_10206403 | Ga0207674_102064032 | 238 |
| 148 | 3300026118 | Ga0207675_100041541 | Ga0207675_1000415413 | 238 |
| 149 | 3300031251 | Ga0265327_10014466 | Ga0265327_100144665 | 238 |
| 150 | 3300041411 | Ga0439466_0026806 | Ga0439466_0026806_727_1602 | 238 |
| 151 | 3300041997 | Ga0439431_0015246 | Ga0439431_0015246_738_1613 | 238 |
| 152 | 3300042002 | Ga0439442_011867 | Ga0439442_011867_167_1042 | 238 |
| 153 | 3300042006 | Ga0439432_002972 | Ga0439432_002972_663_1538 | 238 |
| 154 | 3300042014 | Ga0439457_013461 | Ga0439457_013461_473_1348 | 238 |
| 155 | 3300042015 | Ga0439462_0005441 | Ga0439462_0005441_1561_2436 | 238 |
| 156 | 3300050493 | nmdc:mga0k408_43461_c1 | nmdc:mga0k408_43461_c1_1642_2517 | 238 |
| 157 | 3300050493 | nmdc:mga0k408_65032_c1 | nmdc:mga0k408_65032_c1_612_1490 | 238 |
| 158 | 3300050511 | nmdc:mga08y16_168023_c1 | nmdc:mga08y16_168023_c1_786_1556 | 238 |
| 159 | 3300053730 | Ga0500645_000459 | Ga0500645_000459_14756_15640 | 238 |
| 160 | iso_pu_bacteria | 2739367655 | 2739612289 | 238 |
| 161 | 3300002987 | JGI25159J45721_1000166 | JGI25159J45721_100016620 | 239 |
| 162 | 3300003354 | JGI25160J50197_1000352 | JGI25160J50197_100035220 | 239 |
| 163 | 3300003374 | JGI25161J50226_1000268 | JGI25161J50226_100026820 | 239 |
| 164 | 3300003758 | Ga0055532_1006666 | Ga0055532_10066662 | 239 |
| 165 | 3300003760 | Ga0055527_1002750 | Ga0055527_10027503 | 239 |
| 166 | 3300003761 | Ga0055535_1000760 | Ga0055535_10007608 | 239 |
| 167 | 3300003762 | Ga0055542_1000127 | Ga0055542_10001278 | 239 |
| 168 | 3300003773 | Ga0055537_1008280 | Ga0055537_10082802 | 239 |
| 169 | 3300003773 | Ga0055537_1008698 | Ga0055537_10086982 | 239 |
| 170 | 3300003781 | Ga0055536_1021092 | Ga0055536_10210922 | 239 |
| 171 | 3300003790 | Ga0055528_1034292 | Ga0055528_10342922 | 239 |
| 172 | 3300003791 | Ga0055530_10000929 | Ga0055530_1000092918 | 239 |
| 173 | 3300003791 | Ga0055530_10003395 | Ga0055530_100033954 | 239 |
| 174 | 3300003791 | Ga0055530_10044041 | Ga0055530_100440411 | 239 |
| 175 | 3300004625 | Ga0055543_1000361 | Ga0055543_100036120 | 239 |
| 176 | 3300004625 | Ga0055543_1001214 | Ga0055543_10012148 | 239 |
| 177 | 3300005262 | Ga0065165_1004330 | Ga0065165_10043303 | 239 |
| 178 | 3300005262 | Ga0065165_1004677 | Ga0065165_10046773 | 239 |
| 179 | 3300005262 | Ga0065165_1008599 | Ga0065165_10085995 | 239 |
| 180 | 3300005262 | Ga0065165_1028618 | Ga0065165_10286181 | 239 |
| 181 | 3300005339 | Ga0070660_100090113 | Ga0070660_1000901132 | 239 |
| 182 | 3300005548 | Ga0070665_100025091 | Ga0070665_1000250913 | 239 |
| 183 | 3300005834 | Ga0068851_10031045 | Ga0068851_100310453 | 239 |
| 184 | 3300005841 | Ga0068863_100127257 | Ga0068863_1001272572 | 239 |
| 185 | 3300006177 | Ga0075362_10002819 | Ga0075362_100028195 | 239 |
| 186 | 3300006881 | Ga0068865_100215397 | Ga0068865_1002153972 | 239 |
| 187 | 3300009093 | Ga0105240_10343084 | Ga0105240_103430842 | 239 |
| 188 | 3300010375 | Ga0105239_10254137 | Ga0105239_102541372 | 239 |
| 189 | 3300025228 | Ga0209672_102400 | Ga0209672_1024003 | 239 |
| 190 | 3300025229 | Ga0209147_101037 | Ga0209147_1010376 | 239 |
| 191 | 3300025242 | Ga0209258_100078 | Ga0209258_100078154 | 239 |
| 192 | 3300025245 | Ga0207425_1000952 | Ga0207425_10009523 | 239 |
| 193 | 3300025254 | Ga0209148_1000086 | Ga0209148_1000086154 | 239 |
| 194 | 3300025258 | Ga0209129_1000116 | Ga0209129_100011610 | 239 |
| 195 | 3300025258 | Ga0209129_1007819 | Ga0209129_10078193 | 239 |
| 196 | 3300025258 | Ga0209129_1019257 | Ga0209129_10192572 | 239 |
| 197 | 3300025263 | Ga0209565_1000133 | Ga0209565_10001333 | 239 |
| 198 | 3300025263 | Ga0209565_1005683 | Ga0209565_10056832 | 239 |
| 199 | 3300025273 | Ga0209673_1000190 | Ga0209673_1000190116 | 239 |
| 200 | 3300025273 | Ga0209673_1002954 | Ga0209673_10029549 | 239 |
| 201 | 3300025284 | Ga0209130_1000202 | Ga0209130_100020227 | 239 |
| 202 | 3300025284 | Ga0209130_1001910 | Ga0209130_10019109 | 239 |
| 203 | 3300025284 | Ga0209130_1008843 | Ga0209130_10088432 | 239 |
| 204 | 3300025291 | Ga0209675_1006283 | Ga0209675_10062834 | 239 |
| 205 | 3300025291 | Ga0209675_1007038 | Ga0209675_10070382 | 239 |
| 206 | 3300025291 | Ga0209675_1009003 | Ga0209675_10090032 | 239 |
| 207 | 3300025292 | Ga0209676_1000125 | Ga0209676_1000125153 | 239 |
| 208 | 3300025294 | Ga0209025_1002825 | Ga0209025_100282512 | 239 |
| 209 | 3300025294 | Ga0209025_1014639 | Ga0209025_10146391 | 239 |
| 210 | 3300025295 | Ga0209564_1002219 | Ga0209564_10022194 | 239 |
| 211 | 3300025295 | Ga0209564_1002684 | Ga0209564_10026844 | 239 |
| 212 | 3300025295 | Ga0209564_1009762 | Ga0209564_10097625 | 239 |
| 213 | 3300025297 | Ga0209758_1000034 | Ga0209758_1000034130 | 239 |
| 214 | 3300025297 | Ga0209758_1013003 | Ga0209758_10130033 | 239 |
| 215 | 3300025298 | Ga0209050_1000012 | Ga0209050_1000012631 | 239 |
| 216 | 3300025298 | Ga0209050_1004979 | Ga0209050_10049799 | 239 |
| 217 | 3300025299 | Ga0209256_1000066 | Ga0209256_100006694 | 239 |
| 218 | 3300025299 | Ga0209256_1000270 | Ga0209256_10002704 | 239 |
| 219 | 3300025302 | Ga0207426_1000067 | Ga0207426_100006732 | 239 |
| 220 | 3300025302 | Ga0207426_1000145 | Ga0207426_1000145134 | 239 |
| 221 | 3300025302 | Ga0207426_1002489 | Ga0207426_10024894 | 239 |
| 222 | 3300025303 | Ga0209051_1000134 | Ga0209051_100013491 | 239 |
| 223 | 3300025303 | Ga0209051_1012848 | Ga0209051_10128482 | 239 |
| 224 | 3300025304 | Ga0209257_1000024 | Ga0209257_1000024577 | 239 |
| 225 | 3300025321 | Ga0207656_10045081 | Ga0207656_100450812 | 239 |
| 226 | 3300025909 | Ga0207705_10004503 | Ga0207705_100045032 | 239 |
| 227 | 3300025913 | Ga0207695_10164918 | Ga0207695_101649182 | 239 |
| 228 | 3300026078 | Ga0207702_10151144 | Ga0207702_101511442 | 239 |
| 229 | 3300026088 | Ga0207641_10065097 | Ga0207641_100650972 | 239 |
| 230 | 3300026116 | Ga0207674_10212886 | Ga0207674_102128862 | 239 |
| 231 | 3300028379 | Ga0268266_10005293 | Ga0268266_100052935 | 239 |
| 232 | 3300031251 | Ga0265327_10007858 | Ga0265327_100078585 | 239 |
| 233 | 3300031456 | Ga0307513_10000549 | Ga0307513_1000054927 | 239 |
| 234 | 3300031548 | Ga0307408_100000425 | Ga0307408_10000042518 | 239 |
| 235 | 3300031901 | Ga0307406_10006980 | Ga0307406_100069803 | 239 |
| 236 | 3300037312 | Ga0395899_0048495 | Ga0395899_0048495_37_825 | 239 |
| 237 | 3300037418 | Ga0395900_0024372 | Ga0395900_0024372_3234_4022 | 239 |
| 238 | 3300038443 | Ga0395901_0433124 | Ga0395901_0433124_11_871 | 239 |
| 239 | 3300046491 | Ga0495584_0012628 | Ga0495584_0012628_2565_3353 | 239 |
| 240 | 3300046500 | Ga0495596_0006610 | Ga0495596_0006610_2125_2913 | 239 |
| 241 | 3300046501 | Ga0495607_0007716 | Ga0495607_0007716_3410_4198 | 239 |
| 242 | 3300046507 | Ga0495606_0124712 | Ga0495606_0124712_484_1272 | 239 |
| 243 | 3300046513 | Ga0495616_0000111 | Ga0495616_0000111_55144_55932 | 239 |
| 244 | 3300046530 | Ga0495654_0003446 | Ga0495654_0003446_3200_4108 | 239 |
| 245 | 3300046538 | Ga0495609_0000002 | Ga0495609_0000002_263669_264457 | 239 |
| 246 | 3300046542 | Ga0495597_0000024 | Ga0495597_0000024_11494_12372 | 239 |
| 247 | 3300046615 | Ga0495656_0005116 | Ga0495656_0005116_661_1536 | 239 |
| 248 | 3300046648 | Ga0495611_0018206 | Ga0495611_0018206_1367_2155 | 239 |
| 249 | 3300046665 | Ga0495661_0000183 | Ga0495661_0000183_68151_68939 | 239 |
| 250 | 3300046794 | Ga0495589_0000083 | Ga0495589_0000083_3082_3870 | 239 |
| 251 | 3300047320 | Ga0495672_0069170 | Ga0495672_0069170_858_1646 | 239 |
| 252 | 3300047443 | Ga0495687_000197 | Ga0495687_000197_82825_83613 | 239 |
| 253 | 3300047445 | Ga0495677_0000030 | Ga0495677_0000030_3082_3870 | 239 |
| 254 | 3300048090 | Ga0495615_0013849 | Ga0495615_0013849_77_865 | 239 |
| 255 | 3300048091 | Ga0495626_0001501 | Ga0495626_0001501_3572_4360 | 239 |
| 256 | 3300048926 | Ga0496123_0102873 | Ga0496123_0102873_161_949 | 239 |
| 257 | 3300005331 | Ga0070670_100150757 | Ga0070670_1001507572 | 240 |
| 258 | 3300005334 | Ga0068869_100011250 | Ga0068869_1000112502 | 240 |
| 259 | 3300005338 | Ga0068868_100360833 | Ga0068868_1003608332 | 240 |
| 260 | 3300005355 | Ga0070671_100040429 | Ga0070671_1000404293 | 240 |
| 261 | 3300005364 | Ga0070673_100131740 | Ga0070673_1001317402 | 240 |
| 262 | 3300005365 | Ga0070688_100318799 | Ga0070688_1003187992 | 240 |
| 263 | 3300005543 | Ga0070672_100011632 | Ga0070672_1000116325 | 240 |
| 264 | 3300005548 | Ga0070665_100774911 | Ga0070665_1007749111 | 240 |
| 265 | 3300005617 | Ga0068859_100146800 | Ga0068859_1001468002 | 240 |
| 266 | 3300005718 | Ga0068866_10290534 | Ga0068866_102905341 | 240 |
| 267 | 3300005719 | Ga0068861_100231314 | Ga0068861_1002313142 | 240 |
| 268 | 3300005841 | Ga0068863_100036693 | Ga0068863_1000366933 | 240 |
| 269 | 3300005841 | Ga0068863_100165244 | Ga0068863_1001652442 | 240 |
| 270 | 3300005842 | Ga0068858_100056949 | Ga0068858_1000569494 | 240 |
| 271 | 3300005844 | Ga0068862_100022469 | Ga0068862_1000224691 | 240 |
| 272 | 3300006237 | Ga0097621_100130963 | Ga0097621_1001309633 | 240 |
| 273 | 3300006358 | Ga0068871_100071670 | Ga0068871_1000716702 | 240 |
| 274 | 3300006881 | Ga0068865_100461839 | Ga0068865_1004618391 | 240 |
| 275 | 3300006931 | Ga0097620_100146805 | Ga0097620_1001468052 | 240 |
| 276 | 3300009094 | Ga0111539_10621460 | Ga0111539_106214602 | 240 |
| 277 | 3300009098 | Ga0105245_10285321 | Ga0105245_102853212 | 240 |
| 278 | 3300009177 | Ga0105248_10009668 | Ga0105248_1000966811 | 240 |
| 279 | 3300009177 | Ga0105248_10021120 | Ga0105248_100211206 | 240 |
| 280 | 3300009553 | Ga0105249_10402713 | Ga0105249_104027132 | 240 |
| 281 | 3300010375 | Ga0105239_10434352 | Ga0105239_104343522 | 240 |
| 282 | 3300013297 | Ga0157378_10400448 | Ga0157378_104004482 | 240 |
| 283 | 3300013308 | Ga0157375_10044984 | Ga0157375_100449843 | 240 |
| 284 | 3300014969 | Ga0157376_10032848 | Ga0157376_100328483 | 240 |
| 285 | 3300017792 | Ga0163161_10449467 | Ga0163161_104494672 | 240 |
| 286 | 3300025899 | Ga0207642_10215147 | Ga0207642_102151472 | 240 |
| 287 | 3300025926 | Ga0207659_10192180 | Ga0207659_101921802 | 240 |
| 288 | 3300025940 | Ga0207691_10022198 | Ga0207691_100221985 | 240 |
| 289 | 3300025941 | Ga0207711_10031413 | Ga0207711_100314134 | 240 |
| 290 | 3300025942 | Ga0207689_10004760 | Ga0207689_100047604 | 240 |
| 291 | 3300025960 | Ga0207651_10040769 | Ga0207651_100407692 | 240 |
| 292 | 3300025960 | Ga0207651_10048141 | Ga0207651_100481413 | 240 |
| 293 | 3300025972 | Ga0207668_10337266 | Ga0207668_103372662 | 240 |
| 294 | 3300026023 | Ga0207677_10466367 | Ga0207677_104663671 | 240 |
| 295 | 3300026035 | Ga0207703_10101296 | Ga0207703_101012962 | 240 |
| 296 | 3300026088 | Ga0207641_10119125 | Ga0207641_101191252 | 240 |
| 297 | 3300026088 | Ga0207641_10632051 | Ga0207641_106320511 | 240 |
| 298 | 3300028380 | Ga0268265_10618361 | Ga0268265_106183611 | 240 |
| 299 | 3300038443 | Ga0395901_0106032 | Ga0395901_0106032_1266_2054 | 240 |
| 300 | 3300042005 | Ga0439448_0014554 | Ga0439448_0014554_1194_1994 | 240 |
| 301 | 3300042008 | Ga0439450_019338 | Ga0439450_019338_382_1182 | 240 |
| 302 | 3300044765 | Ga0466970_0223719 | Ga0466970_0223719_210_1010 | 240 |
| 303 | 3300046810 | Ga0495660_0061619 | Ga0495660_0061619_899_1687 | 240 |
| 304 | 3300048925 | Ga0496122_0022841 | Ga0496122_0022841_1994_2782 | 240 |
| 305 | 3300049569 | Ga0501032_0127527 | Ga0501032_0127527_76_903 | 240 |
| 306 | 3300049571 | Ga0501034_0002376 | Ga0501034_0002376_16635_17462 | 240 |
| 307 | 3300049572 | Ga0501036_0137477 | Ga0501036_0137477_519_1346 | 240 |
| 308 | 3300049573 | Ga0501037_0010598 | Ga0501037_0010598_5524_6351 | 240 |
| 309 | 3300049574 | Ga0501038_0001224 | Ga0501038_0001224_4752_5579 | 240 |
| 310 | 3300049575 | Ga0501039_0106296 | Ga0501039_0106296_697_1524 | 240 |
| 311 | 3300049579 | Ga0501043_0010497 | Ga0501043_0010497_2441_3268 | 240 |
| 312 | 3300049581 | Ga0501047_0021370 | Ga0501047_0021370_5179_6006 | 240 |
| 313 | 3300049742 | Ga0501080_0243333 | Ga0501080_0243333_769_1596 | 240 |
| 314 | 3300049744 | Ga0501083_0017537 | Ga0501083_0017537_452_1279 | 240 |
| 315 | 3300049822 | Ga0501035_0049247 | Ga0501035_0049247_334_1161 | 240 |
| 316 | 3300049823 | Ga0501044_0001571 | Ga0501044_0001571_14653_15480 | 240 |
| 317 | 3300054114 | Ga0501084_0219539 | Ga0501084_0219539_412_1239 | 240 |
| 318 | 3300060353 | Ga0501082_0125077 | Ga0501082_0125077_694_1521 | 240 |
| 319 | 3300003187 | JGI25151J46595_10001423 | JGI25151J46595_1000142312 | 241 |
| 320 | 3300003187 | JGI25151J46595_10022278 | JGI25151J46595_100222782 | 241 |
| 321 | 3300003773 | Ga0055537_1000209 | Ga0055537_10002094 | 241 |
| 322 | 3300003781 | Ga0055536_1005808 | Ga0055536_10058081 | 241 |
| 323 | 3300003784 | Ga0055534_1000204 | Ga0055534_10002044 | 241 |
| 324 | 3300003790 | Ga0055528_1000531 | Ga0055528_10005319 | 241 |
| 325 | 3300003791 | Ga0055530_10005486 | Ga0055530_100054864 | 241 |
| 326 | 3300003792 | Ga0055540_1001797 | Ga0055540_100179711 | 241 |
| 327 | 3300003794 | Ga0055531_10001763 | Ga0055531_100017634 | 241 |
| 328 | 3300005344 | Ga0070661_100381930 | Ga0070661_1003819301 | 241 |
| 329 | 3300005563 | Ga0068855_100249151 | Ga0068855_1002491511 | 241 |
| 330 | 3300005844 | Ga0068862_100017882 | Ga0068862_1000178822 | 241 |
| 331 | 3300006048 | Ga0075363_100049349 | Ga0075363_1000493493 | 241 |
| 332 | 3300006195 | Ga0075366_10030457 | Ga0075366_100304573 | 241 |
| 333 | 3300006353 | Ga0075370_10066117 | Ga0075370_100661172 | 241 |
| 334 | 3300006946 | Ga0079104_1040558 | Ga0079104_10405582 | 241 |
| 335 | 3300006948 | Ga0099826_10003943 | Ga0099826_100039432 | 241 |
| 336 | 3300009036 | Ga0105244_10029659 | Ga0105244_100296593 | 241 |
| 337 | 3300009036 | Ga0105244_10071206 | Ga0105244_100712062 | 241 |
| 338 | 3300009093 | Ga0105240_10313783 | Ga0105240_103137832 | 241 |
| 339 | 3300009148 | Ga0105243_10019383 | Ga0105243_100193834 | 241 |
| 340 | 3300009545 | Ga0105237_10239013 | Ga0105237_102390132 | 241 |
| 341 | 3300011119 | Ga0105246_10084927 | Ga0105246_100849272 | 241 |
| 342 | 3300012502 | Ga0157347_1005273 | Ga0157347_10052731 | 241 |
| 343 | 3300013104 | Ga0157370_10001210 | Ga0157370_1000121028 | 241 |
| 344 | 3300013105 | Ga0157369_10231310 | Ga0157369_102313102 | 241 |
| 345 | 3300014497 | Ga0182008_10049109 | Ga0182008_100491092 | 241 |
| 346 | 3300014497 | Ga0182008_10121734 | Ga0182008_101217342 | 241 |
| 347 | 3300015261 | Ga0182006_1041366 | Ga0182006_10413662 | 241 |
| 348 | 3300017792 | Ga0163161_10000118 | Ga0163161_100001183 | 241 |
| 349 | 3300025258 | Ga0209129_1000830 | Ga0209129_10008304 | 241 |
| 350 | 3300025263 | Ga0209565_1000067 | Ga0209565_100006745 | 241 |
| 351 | 3300025273 | Ga0209673_1000813 | Ga0209673_100081345 | 241 |
| 352 | 3300025273 | Ga0209673_1005012 | Ga0209673_10050123 | 241 |
| 353 | 3300025291 | Ga0209675_1000038 | Ga0209675_1000038199 | 241 |
| 354 | 3300025291 | Ga0209675_1004428 | Ga0209675_10044286 | 241 |
| 355 | 3300025291 | Ga0209675_1015821 | Ga0209675_10158212 | 241 |
| 356 | 3300025292 | Ga0209676_1001114 | Ga0209676_100111414 | 241 |
| 357 | 3300025292 | Ga0209676_1019055 | Ga0209676_10190552 | 241 |
| 358 | 3300025294 | Ga0209025_1001608 | Ga0209025_10016082 | 241 |
| 359 | 3300025294 | Ga0209025_1002969 | Ga0209025_10029692 | 241 |
| 360 | 3300025294 | Ga0209025_1065058 | Ga0209025_10650582 | 241 |
| 361 | 3300025298 | Ga0209050_1001325 | Ga0209050_100132517 | 241 |
| 362 | 3300025298 | Ga0209050_1007763 | Ga0209050_10077634 | 241 |
| 363 | 3300025299 | Ga0209256_1026104 | Ga0209256_10261042 | 241 |
| 364 | 3300025303 | Ga0209051_1001829 | Ga0209051_100182914 | 241 |
| 365 | 3300025304 | Ga0209257_1001367 | Ga0209257_100136714 | 241 |
| 366 | 3300025728 | Ga0207655_1062846 | Ga0207655_10628462 | 241 |
| 367 | 3300025911 | Ga0207654_10178580 | Ga0207654_101785801 | 241 |
| 368 | 3300025913 | Ga0207695_10217866 | Ga0207695_102178662 | 241 |
| 369 | 3300025932 | Ga0207690_10420557 | Ga0207690_104205572 | 241 |
| 370 | 3300025935 | Ga0207709_10001889 | Ga0207709_100018893 | 241 |
| 371 | 3300025949 | Ga0207667_10190569 | Ga0207667_101905691 | 241 |
| 372 | 3300026041 | Ga0207639_10041283 | Ga0207639_100412833 | 241 |
| 373 | 3300027666 | Ga0209282_1015645 | Ga0209282_10156453 | 241 |
| 374 | 3300028379 | Ga0268266_10259595 | Ga0268266_102595952 | 241 |
| 375 | 3300028794 | Ga0307515_10013446 | Ga0307515_100134465 | 241 |
| 376 | 3300030733 | Ga0314311_1168092 | Ga0314311_11680923 | 241 |
| 377 | 3300031548 | Ga0307408_100087374 | Ga0307408_1000873742 | 241 |
| 378 | 3300031649 | Ga0307514_10072345 | Ga0307514_100723452 | 241 |
| 379 | 3300031731 | Ga0307405_10053326 | Ga0307405_100533263 | 241 |
| 380 | 3300031852 | Ga0307410_10165527 | Ga0307410_101655272 | 241 |
| 381 | 3300031911 | Ga0307412_10470811 | Ga0307412_104708112 | 241 |
| 382 | 3300036401 | Ga0373937_0206448 | Ga0373937_0206448_753_1616 | 241 |
| 383 | 3300042123 | Ga0450921_000720 | Ga0450921_000720_411_1289 | 241 |
| 384 | 3300042531 | Ga0450918_005739 | Ga0450918_005739_371_1249 | 241 |
| 385 | 3300046512 | Ga0495610_0014892 | Ga0495610_0014892_504_1382 | 241 |
| 386 | 3300046513 | Ga0495616_0014794 | Ga0495616_0014794_507_1385 | 241 |
| 387 | 3300046523 | Ga0495644_0009384 | Ga0495644_0009384_198_959 | 241 |
| 388 | 3300046660 | Ga0495625_0000317 | Ga0495625_0000317_3933_4811 | 241 |
| 389 | 3300046660 | Ga0495625_0076863 | Ga0495625_0076863_736_1614 | 241 |
| 390 | 3300046674 | Ga0495588_0070690 | Ga0495588_0070690_311_1189 | 241 |
| 391 | 3300047323 | Ga0495683_0024470 | Ga0495683_0024470_485_1246 | 241 |
| 392 | 3300047446 | Ga0495679_001504 | Ga0495679_001504_5446_6207 | 241 |
| 393 | 3300048921 | Ga0496118_0082126 | Ga0496118_0082126_244_1122 | 241 |
| 394 | 3300048924 | Ga0496121_0096223 | Ga0496121_0096223_296_1174 | 241 |
| 395 | 3300048924 | Ga0496121_0135274 | Ga0496121_0135274_823_1701 | 241 |
| 396 | 3300048928 | Ga0496125_0049552 | Ga0496125_0049552_87_965 | 241 |
| 397 | 3300049759 | Ga0501262_000211 | Ga0501262_000211_3475_4353 | 241 |
| 398 | 3300050491 | nmdc:mga00v17_23749_c1 | nmdc:mga00v17_23749_c1_2260_3138 | 241 |
| 399 | 3300050493 | nmdc:mga0k408_31611_c1 | nmdc:mga0k408_31611_c1_232_1110 | 241 |
| 400 | 3300050496 | nmdc:mga07m45_136330_c1 | nmdc:mga07m45_136330_c1_481_1359 | 241 |
| 401 | 3300050496 | nmdc:mga07m45_45703_c1 | nmdc:mga07m45_45703_c1_1005_1883 | 241 |
| 402 | 3300053079 | Ga0500610_0001020 | Ga0500610_0001020_7402_8280 | 241 |
| 403 | 3300053079 | Ga0500610_0001866 | Ga0500610_0001866_5165_6043 | 241 |
| 404 | 3300053093 | Ga0500651_0001691 | Ga0500651_0001691_7478_8356 | 241 |
| 405 | 3300053133 | Ga0500655_003191 | Ga0500655_003191_788_1666 | 241 |
| 406 | 3300053134 | Ga0500658_0000902 | Ga0500658_0000902_10204_11082 | 241 |
| 407 | iso_pu_bacteria | 2643221645 | 2644249708 | 241 |
| 408 | iso_pu_bacteria | 2894510363 | 2894510616 | 241 |
| 409 | iso_pu_bacteria | 2989392574 | 2989394256 | 241 |
| 410 | 3300005288 | Ga0065714_10022629 | Ga0065714_100226292 | 242 |
| 411 | 3300005366 | Ga0070659_100055093 | Ga0070659_1000550934 | 242 |
| 412 | 3300025273 | Ga0209673_1028546 | Ga0209673_10285462 | 242 |
| 413 | 3300025284 | Ga0209130_1005820 | Ga0209130_10058201 | 242 |
| 414 | 3300025921 | Ga0207652_10122862 | Ga0207652_101228621 | 242 |
| 415 | 3300025926 | Ga0207659_10353556 | Ga0207659_103535561 | 242 |
| 416 | 3300037418 | Ga0395900_0222095 | Ga0395900_0222095_579_1448 | 242 |
| 417 | 3300037471 | Ga0395905_0000600 | Ga0395905_0000600_35209_36078 | 242 |
| 418 | 3300037471 | Ga0395905_0118838 | Ga0395905_0118838_939_1814 | 242 |
| 419 | 3300042876 | Ga0451577_0012374 | Ga0451577_0012374_5299_6180 | 242 |
| 420 | 3300044712 | Ga0453684_0028832 | Ga0453684_0028832_1830_2711 | 242 |
| 421 | 3300045051 | Ga0451576_0351790 | Ga0451576_0351790_185_1066 | 242 |
| 422 | 3300049655 | Ga0501208_016508 | Ga0501208_016508_224_1099 | 242 |
| 423 | 3300005355 | Ga0070671_100252295 | Ga0070671_1002522952 | 243 |
| 424 | 3300005434 | Ga0070709_10019138 | Ga0070709_100191382 | 243 |
| 425 | 3300005436 | Ga0070713_100566618 | Ga0070713_1005666181 | 243 |
| 426 | 3300005439 | Ga0070711_100218548 | Ga0070711_1002185482 | 243 |
| 427 | 3300005563 | Ga0068855_100042177 | Ga0068855_1000421775 | 243 |
| 428 | 3300006175 | Ga0070712_100260309 | Ga0070712_1002603092 | 243 |
| 429 | 3300009098 | Ga0105245_10085324 | Ga0105245_100853243 | 243 |
| 430 | 3300009148 | Ga0105243_10004131 | Ga0105243_100041318 | 243 |
| 431 | 3300009176 | Ga0105242_10086337 | Ga0105242_100863373 | 243 |
| 432 | 3300013307 | Ga0157372_10409925 | Ga0157372_104099252 | 243 |
| 433 | 3300025906 | Ga0207699_10080349 | Ga0207699_100803492 | 243 |
| 434 | 3300025915 | Ga0207693_10234326 | Ga0207693_102343262 | 243 |
| 435 | 3300025920 | Ga0207649_10261078 | Ga0207649_102610782 | 243 |
| 436 | 3300025928 | Ga0207700_10051865 | Ga0207700_100518652 | 243 |
| 437 | 3300025931 | Ga0207644_10025628 | Ga0207644_100256285 | 243 |
| 438 | 3300025935 | Ga0207709_10027454 | Ga0207709_100274543 | 243 |
| 439 | 3300031251 | Ga0265327_10001504 | Ga0265327_1000150419 | 243 |
| 440 | 3300037418 | Ga0395900_0177755 | Ga0395900_0177755_1179_1979 | 243 |
| 441 | 3300037466 | Ga0395898_0314771 | Ga0395898_0314771_116_916 | 243 |
| 442 | 3300037471 | Ga0395905_0286976 | Ga0395905_0286976_504_1304 | 243 |
| 443 | 3300048091 | Ga0495626_0024727 | Ga0495626_0024727_1317_2105 | 243 |
| 444 | 3300048909 | Ga0496106_0002714 | Ga0496106_0002714_9085_9873 | 243 |
| 445 | 3300048915 | Ga0496112_0444813 | Ga0496112_0444813_363_1151 | 243 |
| 446 | 3300053156 | Ga0500622_0000011 | Ga0500622_0000011_97684_98502 | 243 |
| 447 | iso_pu_bacteria | 2547132103 | 2547374511 | 243 |
| 448 | 3300005364 | Ga0070673_100053368 | Ga0070673_1000533682 | 244 |
| 449 | 3300007788 | Ga0099795_10017173 | Ga0099795_100171733 | 244 |
| 450 | 3300009147 | Ga0114129_10016867 | Ga0114129_100168678 | 244 |
| 451 | 3300009553 | Ga0105249_10687517 | Ga0105249_106875171 | 244 |
| 452 | 3300025933 | Ga0207706_10192847 | Ga0207706_101928472 | 244 |
| 453 | 3300025938 | Ga0207704_10135171 | Ga0207704_101351712 | 244 |
| 454 | 3300025960 | Ga0207651_10099224 | Ga0207651_100992242 | 244 |
| 455 | 3300025961 | Ga0207712_10189254 | Ga0207712_101892541 | 244 |
| 456 | 3300025986 | Ga0207658_10110774 | Ga0207658_101107742 | 244 |
| 457 | 3300031344 | Ga0265316_10151084 | Ga0265316_101510842 | 244 |
| 458 | 3300031728 | Ga0316578_10003864 | Ga0316578_100038644 | 244 |
| 459 | 3300037471 | Ga0395905_0084816 | Ga0395905_0084816_1613_2401 | 244 |
| 460 | 3300042876 | Ga0451577_0000479 | Ga0451577_0000479_3402_4208 | 244 |
| 461 | 3300044712 | Ga0453684_0002411 | Ga0453684_0002411_20784_21590 | 244 |
| 462 | 3300044712 | Ga0453684_0056585 | Ga0453684_0056585_3093_3902 | 244 |
| 463 | 3300045051 | Ga0451576_0041903 | Ga0451576_0041903_3600_4406 | 244 |
| 464 | 3300046522 | Ga0495643_0013971 | Ga0495643_0013971_3370_4143 | 244 |
| 465 | 3300053125 | Ga0500618_000543 | Ga0500618_000543_17211_18002 | 244 |
| 466 | iso_pu_bacteria | 2857558681 | 2857561018 | 244 |
| 467 | 3300009011 | Ga0105251_10162159 | Ga0105251_101621591 | 245 |
| 468 | 3300025898 | Ga0207692_10068585 | Ga0207692_100685852 | 245 |
| 469 | 3300031665 | Ga0316575_10023424 | Ga0316575_100234244 | 245 |
| 470 | 3300031691 | Ga0316579_10059174 | Ga0316579_100591742 | 245 |
| 471 | 3300031728 | Ga0316578_10008771 | Ga0316578_100087714 | 245 |
| 472 | 3300032139 | Ga0316580_10013716 | Ga0316580_100137162 | 245 |
| 473 | 3300035398 | Ga0316574_0005050 | Ga0316574_0005050_3597_4427 | 245 |
| 474 | 3300049568 | Ga0501031_0417905 | Ga0501031_0417905_64_852 | 245 |
| 475 | 3300049570 | Ga0501033_0200807 | Ga0501033_0200807_334_1158 | 245 |
| 476 | 3300049571 | Ga0501034_0070335 | Ga0501034_0070335_2151_2939 | 245 |
| 477 | 3300049572 | Ga0501036_0011863 | Ga0501036_0011863_1684_2508 | 245 |
| 478 | 3300049575 | Ga0501039_0013076 | Ga0501039_0013076_4752_5576 | 245 |
| 479 | 3300049576 | Ga0501040_0016487 | Ga0501040_0016487_2160_2984 | 245 |
| 480 | 3300049577 | Ga0501041_0005223 | Ga0501041_0005223_1895_2719 | 245 |
| 481 | 3300049578 | Ga0501042_0029726 | Ga0501042_0029726_109_933 | 245 |
| 482 | 3300049580 | Ga0501046_0034605 | Ga0501046_0034605_2967_3791 | 245 |
| 483 | 3300049581 | Ga0501047_0001745 | Ga0501047_0001745_3431_4219 | 245 |
| 484 | 3300049588 | Ga0501072_0006553 | Ga0501072_0006553_3484_4308 | 245 |
| 485 | 3300049590 | Ga0501074_0152065 | Ga0501074_0152065_792_1616 | 245 |
| 486 | 3300049591 | Ga0501075_0003826 | Ga0501075_0003826_6673_7497 | 245 |
| 487 | 3300049591 | Ga0501075_0087072 | Ga0501075_0087072_915_1739 | 245 |
| 488 | 3300049592 | Ga0501076_0000538 | Ga0501076_0000538_23014_23838 | 245 |
| 489 | 3300049592 | Ga0501076_0146857 | Ga0501076_0146857_377_1201 | 245 |
| 490 | 3300049741 | Ga0501079_0144454 | Ga0501079_0144454_778_1602 | 245 |
| 491 | 3300049742 | Ga0501080_0233382 | Ga0501080_0233382_546_1370 | 245 |
| 492 | 3300049743 | Ga0501081_0006631 | Ga0501081_0006631_3273_4097 | 245 |
| 493 | 3300049822 | Ga0501035_0004536 | Ga0501035_0004536_3538_4326 | 245 |
| 494 | 3300049823 | Ga0501044_0005080 | Ga0501044_0005080_2818_3606 | 245 |
| 495 | 3300049824 | Ga0501045_0004030 | Ga0501045_0004030_3207_4031 | 245 |
| 496 | 3300050513 | nmdc:mga0rr50_513266_c1 | nmdc:mga0rr50_513266_c1_160_972 | 245 |
| 497 | 3300054114 | Ga0501084_0033378 | Ga0501084_0033378_756_1580 | 245 |
| 498 | 3300060353 | Ga0501082_0001529 | Ga0501082_0001529_3478_4302 | 245 |
| 499 | 3300061734 | Ga0530510_0001545 | Ga0530510_0001545_13715_14539 | 245 |
| 500 | iso_pu_bacteria | 8001522603 | 8001525924 | 245 |
| 501 | iso_pu_bacteria | 8047673197 | 8047677987 | 245 |
| 502 | 3300005840 | Ga0068870_10230271 | Ga0068870_102302712 | 246 |
| 503 | 3300031691 | Ga0316579_10056447 | Ga0316579_100564472 | 246 |
| 504 | 3300031733 | Ga0316577_10120463 | Ga0316577_101204632 | 246 |
| 505 | 3300032137 | Ga0316585_10085674 | Ga0316585_100856742 | 246 |
| 506 | 3300032168 | Ga0316593_10009070 | Ga0316593_100090703 | 246 |
| 507 | 3300036647 | Ga0316582_0027041 | Ga0316582_0027041_628_1443 | 246 |
| 508 | 3300036712 | Ga0316584_0065584 | Ga0316584_0065584_1486_2301 | 246 |
| 509 | 3300046520 | Ga0495637_0058832 | Ga0495637_0058832_221_1000 | 246 |
| 510 | 3300046522 | Ga0495643_0001280 | Ga0495643_0001280_1846_2625 | 246 |
| 511 | 3300048091 | Ga0495626_0005215 | Ga0495626_0005215_3412_4191 | 246 |
| 512 | 3300048091 | Ga0495626_0008949 | Ga0495626_0008949_1344_2123 | 246 |
| 513 | 3300048924 | Ga0496121_0158818 | Ga0496121_0158818_53_904 | 246 |
| 514 | 3300048927 | Ga0496124_0000007 | Ga0496124_0000007_648683_649534 | 246 |
| 515 | 3300053119 | Ga0500595_048810 | Ga0500595_048810_340_1161 | 246 |
| 516 | iso_pu_bacteria | 2738541297 | 2738830185 | 246 |
| 517 | iso_pu_bacteria | 2738541357 | 2739153981 | 246 |
| 518 | iso_pu_bacteria | 2738543003 | 2739195901 | 246 |
| 519 | iso_pu_bacteria | 2738543026 | 2739322377 | 246 |
| 520 | iso_pu_bacteria | 2738543029 | 2739340618 | 246 |
| 521 | 3300006844 | Ga0075428_100406871 | Ga0075428_1004068712 | 247 |
| 522 | 3300031548 | Ga0307408_100000521 | Ga0307408_10000052120 | 247 |
| 523 | 3300037418 | Ga0395900_0000252 | Ga0395900_0000252_13615_14400 | 247 |
| 524 | 3300044656 | Ga0466969_0025226 | Ga0466969_0025226_1842_2702 | 247 |
| 525 | 3300045049 | Ga0466959_0008703 | Ga0466959_0008703_489_1349 | 247 |
| 526 | 3300049822 | Ga0501035_0002263 | Ga0501035_0002263_7015_7800 | 247 |
| 527 | iso_pu_bacteria | 2857564685 | 2857568458 | 247 |
| 528 | 3300005436 | Ga0070713_100000039 | Ga0070713_10000003916 | 248 |
| 529 | 3300005841 | Ga0068863_100291278 | Ga0068863_1002912782 | 248 |
| 530 | 3300005844 | Ga0068862_100783512 | Ga0068862_1007835122 | 248 |
| 531 | 3300006058 | Ga0075432_10077550 | Ga0075432_100775502 | 248 |
| 532 | 3300006237 | Ga0097621_100024893 | Ga0097621_1000248934 | 248 |
| 533 | 3300009093 | Ga0105240_10307314 | Ga0105240_103073142 | 248 |
| 534 | 3300014969 | Ga0157376_10008428 | Ga0157376_100084286 | 248 |
| 535 | 3300025321 | Ga0207656_10006731 | Ga0207656_100067315 | 248 |
| 536 | 3300025928 | Ga0207700_10000082 | Ga0207700_1000008236 | 248 |
| 537 | 3300026088 | Ga0207641_10009992 | Ga0207641_100099922 | 248 |
| 538 | 3300026121 | Ga0207683_10494145 | Ga0207683_104941451 | 248 |
| 539 | 3300026142 | Ga0207698_10001988 | Ga0207698_100019884 | 248 |
| 540 | 3300031665 | Ga0316575_10000019 | Ga0316575_1000001924 | 248 |
| 541 | 3300031711 | Ga0265314_10058736 | Ga0265314_100587362 | 248 |
| 542 | 3300035398 | Ga0316574_0009706 | Ga0316574_0009706_2843_3667 | 248 |
| 543 | 3300035692 | Ga0373935_0119168 | Ga0373935_0119168_672_1511 | 248 |
| 544 | 3300044684 | Ga0466966_0000712 | Ga0466966_0000712_7257_8102 | 248 |
| 545 | 3300044719 | Ga0466971_0016897 | Ga0466971_0016897_620_1465 | 248 |
| 546 | 3300044842 | Ga0466957_0002849 | Ga0466957_0002849_2183_3028 | 248 |
| 547 | 3300046471 | Ga0495650_0034111 | Ga0495650_0034111_838_1623 | 248 |
| 548 | 3300046474 | Ga0495605_0000023 | Ga0495605_0000023_232343_233128 | 248 |
| 549 | 3300046507 | Ga0495606_0005324 | Ga0495606_0005324_2702_3493 | 248 |
| 550 | 3300046530 | Ga0495654_0000015 | Ga0495654_0000015_133355_134140 | 248 |
| 551 | 3300046539 | Ga0495621_0005728 | Ga0495621_0005728_813_1700 | 248 |
| 552 | 3300048907 | Ga0496104_0037582 | Ga0496104_0037582_855_1787 | 248 |
| 553 | 3300061719 | Ga0466962_0000474 | Ga0466962_0000474_2304_3149 | 248 |
| 554 | iso_pu_bacteria | 2891633521 | 2891634376 | 248 |
| 555 | iso_pu_bacteria | 2904424332 | 2904425450 | 248 |
| 556 | 3300005617 | Ga0068859_100082222 | Ga0068859_1000822223 | 249 |
| 557 | 3300006186 | Ga0075369_10024329 | Ga0075369_100243292 | 249 |
| 558 | 3300006931 | Ga0097620_100082225 | Ga0097620_1000822253 | 249 |
| 559 | 3300009094 | Ga0111539_10302127 | Ga0111539_103021272 | 249 |
| 560 | 3300010375 | Ga0105239_10319843 | Ga0105239_103198432 | 249 |
| 561 | 3300021361 | Ga0213872_10095751 | Ga0213872_100957512 | 249 |
| 562 | 3300021441 | Ga0213871_10011521 | Ga0213871_100115212 | 249 |
| 563 | 3300025936 | Ga0207670_10100241 | Ga0207670_101002412 | 249 |
| 564 | 3300030521 | Ga0307511_10001004 | Ga0307511_1000100414 | 249 |
| 565 | 3300032004 | Ga0307414_10162842 | Ga0307414_101628421 | 249 |
| 566 | 3300035114 | Ga0373939_0077781 | Ga0373939_0077781_215_1072 | 249 |
| 567 | 3300037312 | Ga0395899_0079830 | Ga0395899_0079830_458_1246 | 249 |
| 568 | 3300039438 | Ga0436360_0627319 | Ga0436360_0627319_1777_2562 | 249 |
| 569 | 3300039447 | Ga0436361_0597437 | Ga0436361_0597437_788_1573 | 249 |
| 570 | 3300039453 | Ga0436362_0178065 | Ga0436362_0178065_826_1611 | 249 |
| 571 | 3300044683 | Ga0466965_0017310 | Ga0466965_0017310_760_1548 | 249 |
| 572 | 3300044684 | Ga0466966_0131208 | Ga0466966_0131208_35_886 | 249 |
| 573 | 3300044706 | Ga0466964_0046016 | Ga0466964_0046016_514_1302 | 249 |
| 574 | 3300044735 | Ga0466968_0005916 | Ga0466968_0005916_1854_2642 | 249 |
| 575 | 3300044842 | Ga0466957_0080072 | Ga0466957_0080072_965_1753 | 249 |
| 576 | 3300044901 | Ga0466960_0132986 | Ga0466960_0132986_83_871 | 249 |
| 577 | 3300045049 | Ga0466959_0020254 | Ga0466959_0020254_1218_2006 | 249 |
| 578 | 3300045051 | Ga0451576_0074358 | Ga0451576_0074358_568_1425 | 249 |
| 579 | 3300045836 | Ga0466958_0003846 | Ga0466958_0003846_6042_6893 | 249 |
| 580 | 3300046457 | Ga0495590_0046800 | Ga0495590_0046800_409_1197 | 249 |
| 581 | 3300046474 | Ga0495605_0000063 | Ga0495605_0000063_75174_75962 | 249 |
| 582 | 3300046474 | Ga0495605_0084818 | Ga0495605_0084818_155_943 | 249 |
| 583 | 3300046491 | Ga0495584_0000788 | Ga0495584_0000788_16810_17598 | 249 |
| 584 | 3300046501 | Ga0495607_0029177 | Ga0495607_0029177_2393_3181 | 249 |
| 585 | 3300046506 | Ga0495583_0000404 | Ga0495583_0000404_10447_11235 | 249 |
| 586 | 3300046507 | Ga0495606_0000089 | Ga0495606_0000089_78933_79727 | 249 |
| 587 | 3300046507 | Ga0495606_0002377 | Ga0495606_0002377_1901_2689 | 249 |
| 588 | 3300046513 | Ga0495616_0060210 | Ga0495616_0060210_714_1502 | 249 |
| 589 | 3300046519 | Ga0495632_0002784 | Ga0495632_0002784_5343_6131 | 249 |
| 590 | 3300046522 | Ga0495643_0013623 | Ga0495643_0013623_1038_1826 | 249 |
| 591 | 3300046523 | Ga0495644_0007048 | Ga0495644_0007048_1135_1938 | 249 |
| 592 | 3300046528 | Ga0495642_0000535 | Ga0495642_0000535_18225_19013 | 249 |
| 593 | 3300046558 | Ga0495633_0101553 | Ga0495633_0101553_118_906 | 249 |
| 594 | 3300046665 | Ga0495661_0038946 | Ga0495661_0038946_1975_2763 | 249 |
| 595 | 3300046665 | Ga0495661_0064705 | Ga0495661_0064705_399_1187 | 249 |
| 596 | 3300046674 | Ga0495588_0000127 | Ga0495588_0000127_22103_22891 | 249 |
| 597 | 3300046794 | Ga0495589_0001488 | Ga0495589_0001488_3050_3838 | 249 |
| 598 | 3300046810 | Ga0495660_0000625 | Ga0495660_0000625_22059_22847 | 249 |
| 599 | 3300047320 | Ga0495672_0002916 | Ga0495672_0002916_12528_13316 | 249 |
| 600 | 3300047443 | Ga0495687_000075 | Ga0495687_000075_55058_55846 | 249 |
| 601 | 3300047443 | Ga0495687_000701 | Ga0495687_000701_33584_34372 | 249 |
| 602 | 3300048091 | Ga0495626_0000111 | Ga0495626_0000111_40631_41419 | 249 |
| 603 | 3300048925 | Ga0496122_0161621 | Ga0496122_0161621_176_964 | 249 |
| 604 | 3300048927 | Ga0496124_0020891 | Ga0496124_0020891_3103_3891 | 249 |
| 605 | 3300048927 | Ga0496124_0136831 | Ga0496124_0136831_998_1786 | 249 |
| 606 | 3300050511 | nmdc:mga08y16_520259_c1 | nmdc:mga08y16_520259_c1_18_875 | 249 |
| 607 | 3300050516 | nmdc:mga0sz30_19901_c1 | nmdc:mga0sz30_19901_c1_1071_1883 | 249 |
| 608 | 3300061719 | Ga0466962_0130238 | Ga0466962_0130238_165_953 | 249 |
| 609 | iso_pu_bacteria | 2511231026 | 2511387924 | 249 |
| 610 | iso_pu_bacteria | 2521172590 | 2521560651 | 249 |
| 611 | iso_pu_bacteria | 2551306416 | 2553008015 | 249 |
| 612 | iso_pu_bacteria | 2904439833 | 2904442969 | 249 |
| 613 | iso_pu_bacteria | 2904530477 | 2904534823 | 249 |
| 614 | iso_pu_bacteria | 2904584206 | 2904588848 | 249 |
| 615 | iso_pu_bacteria | 2904589729 | 2904594079 | 249 |
| 616 | iso_pu_bacteria | 2904601388 | 2904605077 | 249 |
| 617 | iso_pu_bacteria | 2919079590 | 2919083309 | 249 |
| 618 | iso_pu_bacteria | 2923510766 | 2923514458 | 249 |
| 619 | iso_pu_bacteria | 2928130867 | 2928133166 | 249 |
| 620 | 3300006038 | Ga0075365_10048131 | Ga0075365_100481313 | 250 |
| 621 | 3300006846 | Ga0075430_100049829 | Ga0075430_1000498293 | 250 |
| 622 | 3300025273 | Ga0209673_1012551 | Ga0209673_10125512 | 250 |
| 623 | 3300031727 | Ga0316576_10182334 | Ga0316576_101823342 | 250 |
| 624 | 3300031728 | Ga0316578_10016759 | Ga0316578_100167593 | 250 |
| 625 | 3300031733 | Ga0316577_10031426 | Ga0316577_100314262 | 250 |
| 626 | 3300032133 | Ga0316583_10007052 | Ga0316583_100070523 | 250 |
| 627 | 3300032137 | Ga0316585_10009490 | Ga0316585_100094902 | 250 |
| 628 | 3300032139 | Ga0316580_10011290 | Ga0316580_100112903 | 250 |
| 629 | 3300032168 | Ga0316593_10003759 | Ga0316593_100037592 | 250 |
| 630 | 3300037312 | Ga0395899_0000008 | Ga0395899_0000008_76733_77587 | 250 |
| 631 | 3300037312 | Ga0395899_0039931 | Ga0395899_0039931_898_1749 | 250 |
| 632 | 3300037418 | Ga0395900_0000273 | Ga0395900_0000273_76608_77462 | 250 |
| 633 | 3300037418 | Ga0395900_0073562 | Ga0395900_0073562_1931_2806 | 250 |
| 634 | 3300037466 | Ga0395898_0000072 | Ga0395898_0000072_114030_114884 | 250 |
| 635 | 3300037471 | Ga0395905_0134292 | Ga0395905_0134292_1441_2316 | 250 |
| 636 | 3300042876 | Ga0451577_0000142 | Ga0451577_0000142_145662_146537 | 250 |
| 637 | 3300044656 | Ga0466969_0029612 | Ga0466969_0029612_12_863 | 250 |
| 638 | 3300044693 | Ga0466961_0000845 | Ga0466961_0000845_73_924 | 250 |
| 639 | 3300044712 | Ga0453684_0000126 | Ga0453684_0000126_321459_322334 | 250 |
| 640 | 3300044842 | Ga0466957_0020426 | Ga0466957_0020426_44_898 | 250 |
| 641 | 3300045836 | Ga0466958_0002090 | Ga0466958_0002090_7236_8087 | 250 |
| 642 | 3300046452 | Ga0495617_000096 | Ga0495617_000096_39326_40117 | 250 |
| 643 | 3300046471 | Ga0495650_0000530 | Ga0495650_0000530_26199_26990 | 250 |
| 644 | 3300046492 | Ga0495585_0002085 | Ga0495585_0002085_262_1053 | 250 |
| 645 | 3300046512 | Ga0495610_0000106 | Ga0495610_0000106_19909_20700 | 250 |
| 646 | 3300046512 | Ga0495610_0009910 | Ga0495610_0009910_4919_5710 | 250 |
| 647 | 3300046524 | Ga0495648_0004385 | Ga0495648_0004385_629_1420 | 250 |
| 648 | 3300046524 | Ga0495648_0029713 | Ga0495648_0029713_2217_3008 | 250 |
| 649 | 3300046530 | Ga0495654_0009030 | Ga0495654_0009030_3409_4200 | 250 |
| 650 | 3300046558 | Ga0495633_0015529 | Ga0495633_0015529_2842_3633 | 250 |
| 651 | 3300046558 | Ga0495633_0023233 | Ga0495633_0023233_653_1444 | 250 |
| 652 | 3300046616 | Ga0495668_0001675 | Ga0495668_0001675_19480_20271 | 250 |
| 653 | 3300046665 | Ga0495661_0205407 | Ga0495661_0205407_85_876 | 250 |
| 654 | 3300046692 | Ga0495671_0000006 | Ga0495671_0000006_425219_426010 | 250 |
| 655 | 3300046692 | Ga0495671_0007566 | Ga0495671_0007566_4879_5670 | 250 |
| 656 | 3300046810 | Ga0495660_0025700 | Ga0495660_0025700_2040_2831 | 250 |
| 657 | 3300047323 | Ga0495683_0119960 | Ga0495683_0119960_174_965 | 250 |
| 658 | 3300047446 | Ga0495679_011288 | Ga0495679_011288_1489_2280 | 250 |
| 659 | 3300047446 | Ga0495679_036998 | Ga0495679_036998_352_1143 | 250 |
| 660 | 3300047469 | Ga0495673_0000003 | Ga0495673_0000003_700934_701725 | 250 |
| 661 | 3300047469 | Ga0495673_0000061 | Ga0495673_0000061_33911_34702 | 250 |
| 662 | 3300047469 | Ga0495673_0000482 | Ga0495673_0000482_41223_42014 | 250 |
| 663 | 3300048925 | Ga0496122_0166245 | Ga0496122_0166245_24_815 | 250 |
| 664 | 3300048929 | Ga0496126_0012111 | Ga0496126_0012111_909_1700 | 250 |
| 665 | 3300053145 | Ga0500586_000310 | Ga0500586_000310_2830_3621 | 250 |
| 666 | iso_pu_bacteria | 2511231002 | 2511247284 | 250 |
| 667 | iso_pu_bacteria | 2738543013 | 2739248904 | 250 |
| 668 | iso_pu_bacteria | 2842733646 | 2842736268 | 250 |
| 669 | iso_pu_bacteria | 639633007 | 639785789 | 250 |
| 670 | 3300002774 | JGI25150J39212_1008568 | JGI25150J39212_10085682 | 251 |
| 671 | 3300003763 | Ga0055529_1000015 | Ga0055529_1000015313 | 251 |
| 672 | 3300005347 | Ga0070668_100214473 | Ga0070668_1002144731 | 251 |
| 673 | 3300005456 | Ga0070678_100581294 | Ga0070678_1005812941 | 251 |
| 674 | 3300005842 | Ga0068858_100188139 | Ga0068858_1001881392 | 251 |
| 675 | 3300005843 | Ga0068860_100238517 | Ga0068860_1002385172 | 251 |
| 676 | 3300009098 | Ga0105245_10002213 | Ga0105245_100022137 | 251 |
| 677 | 3300025233 | Ga0209437_117772 | Ga0209437_1177721 | 251 |
| 678 | 3300025245 | Ga0207425_1000455 | Ga0207425_100045510 | 251 |
| 679 | 3300025272 | Ga0209455_1000031 | Ga0209455_1000031315 | 251 |
| 680 | 3300025297 | Ga0209758_1000286 | Ga0209758_100028665 | 251 |
| 681 | 3300025912 | Ga0207707_10524161 | Ga0207707_105241611 | 251 |
| 682 | 3300025972 | Ga0207668_10367426 | Ga0207668_103674261 | 251 |
| 683 | 3300026035 | Ga0207703_10051154 | Ga0207703_100511543 | 251 |
| 684 | 3300028381 | Ga0268264_10021658 | Ga0268264_100216585 | 251 |
| 685 | 3300032133 | Ga0316583_10024330 | Ga0316583_100243302 | 251 |
| 686 | 3300035695 | Ga0373927_0133664 | Ga0373927_0133664_515_1354 | 251 |
| 687 | 3300037068 | Ga0373925_0054709 | Ga0373925_0054709_1689_2528 | 251 |
| 688 | 3300037312 | Ga0395899_0000637 | Ga0395899_0000637_13487_14311 | 251 |
| 689 | 3300037312 | Ga0395899_0002108 | Ga0395899_0002108_4227_5051 | 251 |
| 690 | 3300037418 | Ga0395900_0008082 | Ga0395900_0008082_929_1753 | 251 |
| 691 | 3300037418 | Ga0395900_0217281 | Ga0395900_0217281_319_1143 | 251 |
| 692 | 3300037466 | Ga0395898_0004624 | Ga0395898_0004624_2751_3575 | 251 |
| 693 | 3300038443 | Ga0395901_0003504 | Ga0395901_0003504_2540_3364 | 251 |
| 694 | 3300038443 | Ga0395901_0023068 | Ga0395901_0023068_5123_5947 | 251 |
| 695 | 3300044683 | Ga0466965_0082097 | Ga0466965_0082097_304_1149 | 251 |
| 696 | 3300044684 | Ga0466966_0000008 | Ga0466966_0000008_38144_38995 | 251 |
| 697 | 3300044684 | Ga0466966_0026979 | Ga0466966_0026979_407_1252 | 251 |
| 698 | 3300046459 | Ga0495629_0135803 | Ga0495629_0135803_521_1360 | 251 |
| 699 | 3300046471 | Ga0495650_0000276 | Ga0495650_0000276_94148_94942 | 251 |
| 700 | 3300046472 | Ga0495580_0028776 | Ga0495580_0028776_1005_1844 | 251 |
| 701 | 3300046473 | Ga0495582_0010500 | Ga0495582_0010500_3384_4223 | 251 |
| 702 | 3300046475 | Ga0495639_0073336 | Ga0495639_0073336_351_1190 | 251 |
| 703 | 3300046531 | Ga0495665_0009106 | Ga0495665_0009106_1127_1966 | 251 |
| 704 | 3300046660 | Ga0495625_0001881 | Ga0495625_0001881_1227_2021 | 251 |
| 705 | 3300046681 | Ga0495647_0017512 | Ga0495647_0017512_875_1714 | 251 |
| 706 | 3300046683 | Ga0495658_0002829 | Ga0495658_0002829_4943_5782 | 251 |
| 707 | 3300047471 | Ga0495684_0228986 | Ga0495684_0228986_41_880 | 251 |
| 708 | 3300053098 | Ga0500650_0000068 | Ga0500650_0000068_12974_13795 | 251 |
| 709 | 3300061719 | Ga0466962_0121293 | Ga0466962_0121293_243_1088 | 251 |
| 710 | iso_pu_bacteria | 2574179768 | 2574431238 | 251 |
| 711 | iso_pu_bacteria | 2919476304 | 2919477298 | 251 |
| 712 | 3300003322 | rootL2_10010907 | rootL2_100109077 | 252 |
| 713 | 3300005548 | Ga0070665_100246022 | Ga0070665_1002460222 | 252 |
| 714 | 3300009551 | Ga0105238_10076514 | Ga0105238_100765142 | 252 |
| 715 | 3300010375 | Ga0105239_10286758 | Ga0105239_102867582 | 252 |
| 716 | 3300025263 | Ga0209565_1012255 | Ga0209565_10122551 | 252 |
| 717 | 3300025291 | Ga0209675_1035674 | Ga0209675_10356742 | 252 |
| 718 | 3300028379 | Ga0268266_10254787 | Ga0268266_102547872 | 252 |
| 719 | 3300046507 | Ga0495606_0003493 | Ga0495606_0003493_3298_4095 | 252 |
| 720 | 3300047472 | Ga0495686_0000321 | Ga0495686_0000321_35798_36628 | 252 |
| 721 | 3300049766 | Ga0501269_000655 | Ga0501269_000655_2105_2902 | 252 |
| 722 | iso_pu_bacteria | 2857542790 | 2857544340 | 252 |
| 723 | iso_pu_bacteria | 2857553236 | 2857557646 | 252 |
| 724 | 3300003751 | Ga0055538_1000024 | Ga0055538_100002419 | 253 |
| 725 | 3300003752 | Ga0055539_1000031 | Ga0055539_100003119 | 253 |
| 726 | 3300003756 | Ga0055533_1000041 | Ga0055533_100004119 | 253 |
| 727 | 3300003759 | Ga0055525_1000049 | Ga0055525_100004919 | 253 |
| 728 | 3300003841 | Ga0055541_1000022 | Ga0055541_100002219 | 253 |
| 729 | 3300006946 | Ga0079104_1005965 | Ga0079104_10059653 | 253 |
| 730 | 3300009093 | Ga0105240_10095751 | Ga0105240_100957513 | 253 |
| 731 | 3300009545 | Ga0105237_10075212 | Ga0105237_100752122 | 253 |
| 732 | 3300009551 | Ga0105238_10000107 | Ga0105238_1000010770 | 253 |
| 733 | 3300010375 | Ga0105239_10001202 | Ga0105239_100012029 | 253 |
| 734 | 3300025224 | Ga0209784_100018 | Ga0209784_10001819 | 253 |
| 735 | 3300025225 | Ga0209566_100016 | Ga0209566_10001619 | 253 |
| 736 | 3300025226 | Ga0209674_100030 | Ga0209674_10003019 | 253 |
| 737 | 3300025230 | Ga0209563_100034 | Ga0209563_10003419 | 253 |
| 738 | 3300025253 | Ga0209677_100019 | Ga0209677_10001919 | 253 |
| 739 | 3300025321 | Ga0207656_10103733 | Ga0207656_101037332 | 253 |
| 740 | 3300025913 | Ga0207695_10009442 | Ga0207695_100094424 | 253 |
| 741 | 3300025914 | Ga0207671_10001336 | Ga0207671_1000133621 | 253 |
| 742 | 3300025924 | Ga0207694_10000130 | Ga0207694_1000013018 | 253 |
| 743 | 3300025949 | Ga0207667_10002863 | Ga0207667_1000286310 | 253 |
| 744 | 3300025981 | Ga0207640_10141902 | Ga0207640_101419022 | 253 |
| 745 | 3300044673 | Ga0453683_0034446 | Ga0453683_0034446_1193_2083 | 253 |
| 746 | 3300045051 | Ga0451576_0437782 | Ga0451576_0437782_405_1280 | 253 |
| 747 | 3300046453 | Ga0495627_000059 | Ga0495627_000059_69637_70467 | 253 |
| 748 | 3300046538 | Ga0495609_0000334 | Ga0495609_0000334_4392_5222 | 253 |
| 749 | 3300046810 | Ga0495660_0000365 | Ga0495660_0000365_35618_36448 | 253 |
| 750 | 3300047470 | Ga0495681_0027176 | Ga0495681_0027176_1016_1846 | 253 |
| 751 | 3300048928 | Ga0496125_0022520 | Ga0496125_0022520_4586_5431 | 253 |
| 752 | 3300049459 | Ga0495678_000030 | Ga0495678_000030_48442_49272 | 253 |
| 753 | iso_pu_bacteria | 2511231003 | 2511250587 | 253 |
| 754 | iso_pu_bacteria | 2818991445 | 2819595331 | 253 |
| 755 | iso_pu_bacteria | 2884811622 | 2884814346 | 253 |
| 756 | iso_pu_bacteria | 2884836552 | 2884839281 | 253 |
| 757 | iso_pu_bacteria | 2884852848 | 2884856909 | 253 |
| 758 | iso_pu_bacteria | 2896154374 | 2896158255 | 253 |
| 759 | iso_pu_bacteria | 2904434214 | 2904436009 | 253 |
| 760 | 3300032004 | Ga0307414_10194131 | Ga0307414_101941312 | 254 |
| 761 | iso_pu_bacteria | 2513237150 | 2513953008 | 254 |
| 762 | iso_pu_bacteria | 2513237165 | 2514043889 | 254 |
| 763 | iso_pu_bacteria | 2643221603 | 2644026682 | 254 |
| 764 | iso_pu_bacteria | 644736347 | 644747378 | 254 |
| 765 | 3300006946 | Ga0079104_1021330 | Ga0079104_10213302 | 255 |
| 766 | 3300006948 | Ga0099826_10000004 | Ga0099826_10000004557 | 255 |
| 767 | 3300015261 | Ga0182006_1000231 | Ga0182006_100023122 | 255 |
| 768 | 3300015265 | Ga0182005_1000037 | Ga0182005_100003776 | 255 |
| 769 | 3300027111 | Ga0209281_1022964 | Ga0209281_10229642 | 255 |
| 770 | 3300027666 | Ga0209282_1000015 | Ga0209282_100001563 | 255 |
| 771 | 3300046474 | Ga0495605_0005172 | Ga0495605_0005172_3575_4444 | 255 |
| 772 | 3300046500 | Ga0495596_0009131 | Ga0495596_0009131_638_1507 | 255 |
| 773 | 3300046501 | Ga0495607_0096620 | Ga0495607_0096620_395_1264 | 255 |
| 774 | 3300046512 | Ga0495610_0003895 | Ga0495610_0003895_9827_10696 | 255 |
| 775 | 3300046513 | Ga0495616_0012896 | Ga0495616_0012896_3142_4011 | 255 |
| 776 | 3300046538 | Ga0495609_0002742 | Ga0495609_0002742_6628_7497 | 255 |
| 777 | 3300046692 | Ga0495671_0005302 | Ga0495671_0005302_3539_4408 | 255 |
| 778 | 3300047320 | Ga0495672_0082684 | Ga0495672_0082684_686_1555 | 255 |
| 779 | 3300048919 | Ga0496116_0034917 | Ga0496116_0034917_1812_2681 | 255 |
| 780 | 3300048924 | Ga0496121_0034037 | Ga0496121_0034037_732_1601 | 255 |
| 781 | 3300048925 | Ga0496122_0014636 | Ga0496122_0014636_3118_3987 | 255 |
| 782 | 3300048926 | Ga0496123_0011977 | Ga0496123_0011977_3407_4276 | 255 |
| 783 | 3300053161 | Ga0500634_0051201 | Ga0500634_0051201_1211_2050 | 255 |
| 784 | iso_pu_bacteria | 2721755763 | 2723875898 | 255 |
| 785 | 3300002704 | JGI25155J39150_1000813 | JGI25155J39150_10008132 | 256 |
| 786 | 3300002705 | JGI25156J39149_1001146 | JGI25156J39149_100114610 | 256 |
| 787 | 3300002737 | JGI25162J39368_1000036 | JGI25162J39368_1000036141 | 256 |
| 788 | 3300002737 | JGI25162J39368_1003311 | JGI25162J39368_10033113 | 256 |
| 789 | 3300002738 | JGI25154J39366_1001229 | JGI25154J39366_100122910 | 256 |
| 790 | 3300002741 | JGI25157J39369_1000796 | JGI25157J39369_100079610 | 256 |
| 791 | 3300003214 | JGI25165J46597_1000022 | JGI25165J46597_1000022218 | 256 |
| 792 | 3300003751 | Ga0055538_1000011 | Ga0055538_1000011139 | 256 |
| 793 | 3300003752 | Ga0055539_1000016 | Ga0055539_1000016218 | 256 |
| 794 | 3300003756 | Ga0055533_1000019 | Ga0055533_1000019218 | 256 |
| 795 | 3300003758 | Ga0055532_1000074 | Ga0055532_1000074109 | 256 |
| 796 | 3300003759 | Ga0055525_1000042 | Ga0055525_1000042141 | 256 |
| 797 | 3300003841 | Ga0055541_1000017 | Ga0055541_1000017153 | 256 |
| 798 | 3300005337 | Ga0070682_100056181 | Ga0070682_1000561812 | 256 |
| 799 | 3300005563 | Ga0068855_100354900 | Ga0068855_1003549002 | 256 |
| 800 | 3300005616 | Ga0068852_100001737 | Ga0068852_1000017378 | 256 |
| 801 | 3300009011 | Ga0105251_10012206 | Ga0105251_100122066 | 256 |
| 802 | 3300009093 | Ga0105240_10016169 | Ga0105240_1001616911 | 256 |
| 803 | 3300009093 | Ga0105240_10110333 | Ga0105240_101103332 | 256 |
| 804 | 3300009545 | Ga0105237_10333826 | Ga0105237_103338262 | 256 |
| 805 | 3300010375 | Ga0105239_10181094 | Ga0105239_101810943 | 256 |
| 806 | 3300014497 | Ga0182008_10016132 | Ga0182008_100161321 | 256 |
| 807 | 3300015261 | Ga0182006_1013901 | Ga0182006_10139014 | 256 |
| 808 | 3300015262 | Ga0182007_10008818 | Ga0182007_100088183 | 256 |
| 809 | 3300015265 | Ga0182005_1005071 | Ga0182005_10050713 | 256 |
| 810 | 3300025206 | Ga0209435_100094 | Ga0209435_10009411 | 256 |
| 811 | 3300025224 | Ga0209784_100019 | Ga0209784_100019296 | 256 |
| 812 | 3300025225 | Ga0209566_100017 | Ga0209566_100017296 | 256 |
| 813 | 3300025226 | Ga0209674_100031 | Ga0209674_100031296 | 256 |
| 814 | 3300025229 | Ga0209147_100097 | Ga0209147_100097142 | 256 |
| 815 | 3300025230 | Ga0209563_100035 | Ga0209563_100035296 | 256 |
| 816 | 3300025231 | Ga0207427_100315 | Ga0207427_10031516 | 256 |
| 817 | 3300025233 | Ga0209437_100038 | Ga0209437_100038296 | 256 |
| 818 | 3300025233 | Ga0209437_100372 | Ga0209437_10037234 | 256 |
| 819 | 3300025242 | Ga0209258_100192 | Ga0209258_100192108 | 256 |
| 820 | 3300025246 | Ga0209646_1000103 | Ga0209646_1000103142 | 256 |
| 821 | 3300025250 | Ga0209026_1001208 | Ga0209026_10012084 | 256 |
| 822 | 3300025253 | Ga0209677_100020 | Ga0209677_100020296 | 256 |
| 823 | 3300025256 | Ga0209759_1000091 | Ga0209759_1000091142 | 256 |
| 824 | 3300025261 | Ga0209233_1000049 | Ga0209233_1000049296 | 256 |
| 825 | 3300025272 | Ga0209455_1006271 | Ga0209455_10062712 | 256 |
| 826 | 3300025913 | Ga0207695_10001362 | Ga0207695_1000136211 | 256 |
| 827 | 3300025913 | Ga0207695_10014244 | Ga0207695_100142446 | 256 |
| 828 | 3300025914 | Ga0207671_10098691 | Ga0207671_100986913 | 256 |
| 829 | 3300025924 | Ga0207694_10045075 | Ga0207694_100450752 | 256 |
| 830 | 3300025949 | Ga0207667_10004521 | Ga0207667_100045217 | 256 |
| 831 | 3300044658 | Ga0466972_0000070 | Ga0466972_0000070_95764_96609 | 256 |
| 832 | 3300046457 | Ga0495590_0000002 | Ga0495590_0000002_66441_67250 | 256 |
| 833 | 3300046460 | Ga0495638_0000367 | Ga0495638_0000367_9419_10228 | 256 |
| 834 | 3300046462 | Ga0495651_0010800 | Ga0495651_0010800_5836_6702 | 256 |
| 835 | 3300046471 | Ga0495650_0003997 | Ga0495650_0003997_404_1213 | 256 |
| 836 | 3300046501 | Ga0495607_0000300 | Ga0495607_0000300_3454_4308 | 256 |
| 837 | 3300046501 | Ga0495607_0004194 | Ga0495607_0004194_2915_3724 | 256 |
| 838 | 3300046506 | Ga0495583_0001717 | Ga0495583_0001717_3199_4008 | 256 |
| 839 | 3300046507 | Ga0495606_0005973 | Ga0495606_0005973_3027_3836 | 256 |
| 840 | 3300046507 | Ga0495606_0016928 | Ga0495606_0016928_3294_4139 | 256 |
| 841 | 3300046511 | Ga0495608_0095698 | Ga0495608_0095698_324_1190 | 256 |
| 842 | 3300046516 | Ga0495628_0001262 | Ga0495628_0001262_3723_4589 | 256 |
| 843 | 3300046524 | Ga0495648_0000037 | Ga0495648_0000037_13214_14023 | 256 |
| 844 | 3300046538 | Ga0495609_0001009 | Ga0495609_0001009_6040_6849 | 256 |
| 845 | 3300046543 | Ga0495645_0009956 | Ga0495645_0009956_3021_3875 | 256 |
| 846 | 3300046557 | Ga0495622_0000969 | Ga0495622_0000969_13979_14788 | 256 |
| 847 | 3300046558 | Ga0495633_0000433 | Ga0495633_0000433_28730_29539 | 256 |
| 848 | 3300046616 | Ga0495668_0001687 | Ga0495668_0001687_16144_16953 | 256 |
| 849 | 3300046660 | Ga0495625_0014029 | Ga0495625_0014029_5351_6160 | 256 |
| 850 | 3300046660 | Ga0495625_0021505 | Ga0495625_0021505_581_1435 | 256 |
| 851 | 3300046680 | Ga0495646_0012603 | Ga0495646_0012603_1594_2448 | 256 |
| 852 | 3300046810 | Ga0495660_0032884 | Ga0495660_0032884_1732_2562 | 256 |
| 853 | 3300047320 | Ga0495672_0000021 | Ga0495672_0000021_28430_29260 | 256 |
| 854 | 3300047443 | Ga0495687_001598 | Ga0495687_001598_9336_10145 | 256 |
| 855 | 3300048925 | Ga0496122_0009086 | Ga0496122_0009086_8196_9050 | 256 |
| 856 | 3300048926 | Ga0496123_0007120 | Ga0496123_0007120_651_1505 | 256 |
| 857 | 3300049459 | Ga0495678_004565 | Ga0495678_004565_3202_4011 | 256 |
| 858 | iso_pu_bacteria | 2842711865 | 2842712648 | 256 |
| 859 | 3300009177 | Ga0105248_10327176 | Ga0105248_103271762 | 257 |
| 860 | 3300009177 | Ga0105248_10408393 | Ga0105248_104083932 | 257 |
| 861 | 3300025941 | Ga0207711_10176446 | Ga0207711_101764462 | 257 |
| 862 | 3300048904 | Ga0496101_0365187 | Ga0496101_0365187_92_943 | 257 |
| 863 | 3300048909 | Ga0496106_0000074 | Ga0496106_0000074_20552_21400 | 257 |
| 864 | 3300048921 | Ga0496118_0210772 | Ga0496118_0210772_267_1118 | 257 |
| 865 | 3300048924 | Ga0496121_0000941 | Ga0496121_0000941_20475_21323 | 257 |
| 866 | 3300048924 | Ga0496121_0021261 | Ga0496121_0021261_1645_2496 | 257 |
| 867 | 3300048929 | Ga0496126_0000571 | Ga0496126_0000571_50325_51167 | 257 |
| 868 | 3300003187 | JGI25151J46595_10001128 | JGI25151J46595_100011285 | 258 |
| 869 | 3300006051 | Ga0075364_10003171 | Ga0075364_100031716 | 258 |
| 870 | 3300025294 | Ga0209025_1000769 | Ga0209025_100076930 | 258 |
| 871 | 3300025294 | Ga0209025_1000811 | Ga0209025_10008117 | 258 |
| 872 | 3300025294 | Ga0209025_1012056 | Ga0209025_10120562 | 258 |
| 873 | 3300025299 | Ga0209256_1000726 | Ga0209256_10007267 | 258 |
| 874 | 3300025303 | Ga0209051_1010900 | Ga0209051_10109002 | 258 |
| 875 | 3300047317 | Ga0495604_0027537 | Ga0495604_0027537_411_1259 | 258 |
| 876 | 3300047318 | Ga0495636_0063802 | Ga0495636_0063802_395_1243 | 258 |
| 877 | 3300048905 | Ga0496102_0118990 | Ga0496102_0118990_188_1072 | 258 |
| 878 | 3300049571 | Ga0501034_0000588 | Ga0501034_0000588_35598_36446 | 258 |
| 879 | 3300050491 | nmdc:mga00v17_28740_c1 | nmdc:mga00v17_28740_c1_623_1462 | 258 |
| 880 | 3300048920 | Ga0496117_0006812 | Ga0496117_0006812_7755_8603 | 259 |
| 881 | 3300048921 | Ga0496118_0003604 | Ga0496118_0003604_7764_8612 | 259 |
| 882 | iso_pu_bacteria | 2501025502 | 2501078623 | 259 |
| 883 | iso_pu_bacteria | 2501025504 | 2501414262 | 259 |
| 884 | iso_pu_bacteria | 2510917013 | 2511089273 | 259 |
| 885 | iso_pu_bacteria | 2510917014 | 2511094483 | 259 |
| 886 | iso_pu_bacteria | 2510917015 | 2511104253 | 259 |
| 887 | iso_pu_bacteria | 2513237082 | 2513552863 | 259 |
| 888 | iso_pu_bacteria | 2513237083 | 2513561654 | 259 |
| 889 | iso_pu_bacteria | 2519103095 | 2519458036 | 259 |
| 890 | iso_pu_bacteria | 2582581311 | 2585294333 | 259 |
| 891 | iso_pu_bacteria | 2816332253 | 2817260201 | 259 |
| 892 | iso_pu_bacteria | 2816332256 | 2817277868 | 259 |
| 893 | iso_pu_bacteria | 2816332286 | 2817451054 | 259 |
| 894 | iso_pu_bacteria | 2856287931 | 2856291572 | 259 |
| 895 | iso_pu_bacteria | 2857357740 | 2857364630 | 259 |
| 896 | iso_pu_bacteria | 2883087390 | 2883093884 | 259 |
| 897 | iso_pu_bacteria | 2928157003 | 2928159693 | 259 |
| 898 | iso_pu_bacteria | 2928163908 | 2928164253 | 259 |
| 899 | iso_pu_bacteria | 2981990288 | 2981994128 | 259 |
| 900 | iso_pu_bacteria | 641736154 | 642416824 | 259 |
| 901 | iso_pu_bacteria | 8003955200 | 8003958510 | 259 |
| 902 | iso_pu_bacteria | 8020807995 | 8020813851 | 259 |
| 903 | iso_pu_bacteria | 8039098773 | 8039099342 | 259 |
| 904 | iso_pu_bacteria | 8040167225 | 8040170491 | 259 |
| 905 | iso_pu_bacteria | 8040173305 | 8040178862 | 259 |
| 906 | 3300003771 | Ga0055526_1000411 | Ga0055526_100041115 | 260 |
| 907 | 3300005356 | Ga0070674_100126848 | Ga0070674_1001268482 | 260 |
| 908 | 3300005543 | Ga0070672_100096157 | Ga0070672_1000961573 | 260 |
| 909 | 3300009036 | Ga0105244_10003810 | Ga0105244_100038102 | 260 |
| 910 | 3300014326 | Ga0157380_10033626 | Ga0157380_100336263 | 260 |
| 911 | 3300025233 | Ga0209437_108698 | Ga0209437_1086982 | 260 |
| 912 | 3300025246 | Ga0209646_1000051 | Ga0209646_1000051267 | 260 |
| 913 | 3300025295 | Ga0209564_1000011 | Ga0209564_1000011324 | 260 |
| 914 | 3300025728 | Ga0207655_1025647 | Ga0207655_10256472 | 260 |
| 915 | 3300025937 | Ga0207669_10077219 | Ga0207669_100772192 | 260 |
| 916 | 3300025940 | Ga0207691_10204250 | Ga0207691_102042502 | 260 |
| 917 | 3300025972 | Ga0207668_10004274 | Ga0207668_100042746 | 260 |
| 918 | 3300026118 | Ga0207675_100047608 | Ga0207675_1000476083 | 260 |
| 919 | 3300028794 | Ga0307515_10107895 | Ga0307515_101078952 | 260 |
| 920 | 3300028800 | Ga0265338_10000057 | Ga0265338_10000057179 | 260 |
| 921 | 3300031247 | Ga0265340_10034005 | Ga0265340_100340052 | 260 |
| 922 | 3300032005 | Ga0307411_10350680 | Ga0307411_103506802 | 260 |
| 923 | 3300046471 | Ga0495650_0000019 | Ga0495650_0000019_355148_356008 | 260 |
| 924 | 3300046471 | Ga0495650_0001558 | Ga0495650_0001558_3320_4177 | 260 |
| 925 | 3300046501 | Ga0495607_0039243 | Ga0495607_0039243_1474_2331 | 260 |
| 926 | 3300046507 | Ga0495606_0000001 | Ga0495606_0000001_580256_581113 | 260 |
| 927 | 3300046507 | Ga0495606_0000526 | Ga0495606_0000526_15746_16606 | 260 |
| 928 | 3300046507 | Ga0495606_0015771 | Ga0495606_0015771_4318_5175 | 260 |
| 929 | 3300046512 | Ga0495610_0003952 | Ga0495610_0003952_591_1448 | 260 |
| 930 | 3300046512 | Ga0495610_0054009 | Ga0495610_0054009_133_990 | 260 |
| 931 | 3300046522 | Ga0495643_0000312 | Ga0495643_0000312_62616_63473 | 260 |
| 932 | 3300046522 | Ga0495643_0002513 | Ga0495643_0002513_529_1386 | 260 |
| 933 | 3300046524 | Ga0495648_0009791 | Ga0495648_0009791_3500_4357 | 260 |
| 934 | 3300046542 | Ga0495597_0000874 | Ga0495597_0000874_9360_10217 | 260 |
| 935 | 3300046542 | Ga0495597_0002290 | Ga0495597_0002290_609_1466 | 260 |
| 936 | 3300046558 | Ga0495633_0000244 | Ga0495633_0000244_22306_23163 | 260 |
| 937 | 3300046558 | Ga0495633_0014264 | Ga0495633_0014264_2783_3640 | 260 |
| 938 | 3300046616 | Ga0495668_0000241 | Ga0495668_0000241_15028_15885 | 260 |
| 939 | 3300046660 | Ga0495625_0026803 | Ga0495625_0026803_2990_3847 | 260 |
| 940 | 3300046694 | Ga0495649_0088312 | Ga0495649_0088312_665_1522 | 260 |
| 941 | 3300046694 | Ga0495649_0111947 | Ga0495649_0111947_441_1298 | 260 |
| 942 | 3300047320 | Ga0495672_0000707 | Ga0495672_0000707_35270_36127 | 260 |
| 943 | 3300048905 | Ga0496102_0138631 | Ga0496102_0138631_1253_2116 | 260 |
| 944 | 3300048919 | Ga0496116_0053557 | Ga0496116_0053557_229_1086 | 260 |
| 945 | 3300048927 | Ga0496124_0106637 | Ga0496124_0106637_155_1012 | 260 |
| 946 | 3300049459 | Ga0495678_001619 | Ga0495678_001619_3387_4244 | 260 |
| 947 | 3300046462 | Ga0495651_0183498 | Ga0495651_0183498_21_884 | 261 |
| 948 | 3300046679 | Ga0495623_0031408 | Ga0495623_0031408_852_1715 | 261 |
| 949 | 3300048088 | Ga0495602_0009621 | Ga0495602_0009621_2508_3371 | 261 |
| 950 | 3300047443 | Ga0495687_032607 | Ga0495687_032607_1458_2324 | 262 |
| 951 | 3300003758 | Ga0055532_1000801 | Ga0055532_100080111 | 263 |
| 952 | 3300003760 | Ga0055527_1000332 | Ga0055527_10003326 | 263 |
| 953 | 3300003761 | Ga0055535_1001462 | Ga0055535_10014623 | 263 |
| 954 | 3300003762 | Ga0055542_1007926 | Ga0055542_10079262 | 263 |
| 955 | 3300003763 | Ga0055529_1004858 | Ga0055529_10048582 | 263 |
| 956 | 3300005329 | Ga0070683_100506879 | Ga0070683_1005068792 | 263 |
| 957 | 3300005339 | Ga0070660_100000008 | Ga0070660_100000008102 | 263 |
| 958 | 3300005366 | Ga0070659_100000014 | Ga0070659_100000014179 | 263 |
| 959 | 3300005564 | Ga0070664_100078181 | Ga0070664_1000781812 | 263 |
| 960 | 3300005577 | Ga0068857_100194748 | Ga0068857_1001947482 | 263 |
| 961 | 3300005578 | Ga0068854_100622411 | Ga0068854_1006224111 | 263 |
| 962 | 3300005616 | Ga0068852_100167306 | Ga0068852_1001673062 | 263 |
| 963 | 3300009545 | Ga0105237_10049330 | Ga0105237_100493302 | 263 |
| 964 | 3300009551 | Ga0105238_10018714 | Ga0105238_100187144 | 263 |
| 965 | 3300010375 | Ga0105239_10038533 | Ga0105239_100385334 | 263 |
| 966 | 3300013105 | Ga0157369_10105708 | Ga0157369_101057083 | 263 |
| 967 | 3300025228 | Ga0209672_100083 | Ga0209672_10008313 | 263 |
| 968 | 3300025229 | Ga0209147_100244 | Ga0209147_10024449 | 263 |
| 969 | 3300025242 | Ga0209258_100405 | Ga0209258_10040549 | 263 |
| 970 | 3300025254 | Ga0209148_1002102 | Ga0209148_10021024 | 263 |
| 971 | 3300025256 | Ga0209759_1003935 | Ga0209759_10039353 | 263 |
| 972 | 3300025272 | Ga0209455_1001485 | Ga0209455_10014853 | 263 |
| 973 | 3300025904 | Ga0207647_10006741 | Ga0207647_100067418 | 263 |
| 974 | 3300025909 | Ga0207705_10076640 | Ga0207705_100766402 | 263 |
| 975 | 3300025913 | Ga0207695_10135148 | Ga0207695_101351482 | 263 |
| 976 | 3300025914 | Ga0207671_10024297 | Ga0207671_100242973 | 263 |
| 977 | 3300025919 | Ga0207657_10000018 | Ga0207657_1000001850 | 263 |
| 978 | 3300025932 | Ga0207690_10000006 | Ga0207690_10000006102 | 263 |
| 979 | 3300025945 | Ga0207679_10194028 | Ga0207679_101940282 | 263 |
| 980 | 3300025949 | Ga0207667_10035111 | Ga0207667_100351114 | 263 |
| 981 | 3300026116 | Ga0207674_10078055 | Ga0207674_100780553 | 263 |
| 982 | 3300026142 | Ga0207698_10106897 | Ga0207698_101068972 | 263 |
| 983 | 3300047472 | Ga0495686_0000032 | Ga0495686_0000032_14734_15612 | 263 |
| 984 | 3300061719 | Ga0466962_0022225 | Ga0466962_0022225_1559_2416 | 263 |
| 985 | 3300002067 | JGI24735J21928_10000096 | JGI24735J21928_100000963 | 265 |
| 986 | 3300005335 | Ga0070666_10008187 | Ga0070666_100081875 | 265 |
| 987 | 3300005355 | Ga0070671_100348900 | Ga0070671_1003489001 | 265 |
| 988 | 3300005364 | Ga0070673_100112110 | Ga0070673_1001121102 | 265 |
| 989 | 3300005367 | Ga0070667_100188207 | Ga0070667_1001882071 | 265 |
| 990 | 3300009036 | Ga0105244_10171220 | Ga0105244_101712201 | 265 |
| 991 | 3300009093 | Ga0105240_10319900 | Ga0105240_103199002 | 265 |
| 992 | 3300009545 | Ga0105237_10165516 | Ga0105237_101655162 | 265 |
| 993 | 3300009551 | Ga0105238_10165334 | Ga0105238_101653342 | 265 |
| 994 | 3300011119 | Ga0105246_10147303 | Ga0105246_101473031 | 265 |
| 995 | 3300013105 | Ga0157369_10136063 | Ga0157369_101360631 | 265 |
| 996 | 3300013306 | Ga0163162_10003435 | Ga0163162_1000343513 | 265 |
| 997 | 3300013308 | Ga0157375_10127589 | Ga0157375_101275893 | 265 |
| 998 | 3300025246 | Ga0209646_1013337 | Ga0209646_10133372 | 265 |
| 999 | 3300025302 | Ga0207426_1012223 | Ga0207426_10122233 | 265 |
| 1000 | 3300025735 | Ga0207713_1012892 | Ga0207713_10128923 | 265 |
| 1001 | 3300025903 | Ga0207680_10002625 | Ga0207680_100026257 | 265 |
| 1002 | 3300025904 | Ga0207647_10013565 | Ga0207647_100135653 | 265 |
| 1003 | 3300025913 | Ga0207695_10234924 | Ga0207695_102349241 | 265 |
| 1004 | 3300025914 | Ga0207671_10082299 | Ga0207671_100822993 | 265 |
| 1005 | 3300025960 | Ga0207651_10084821 | Ga0207651_100848211 | 265 |
| 1006 | 3300026067 | Ga0207678_10152990 | Ga0207678_101529902 | 265 |
| 1007 | 3300026121 | Ga0207683_10242392 | Ga0207683_102423922 | 265 |
| 1008 | 3300028379 | Ga0268266_10308091 | Ga0268266_103080912 | 265 |
| 1009 | 3300044693 | Ga0466961_0006638 | Ga0466961_0006638_5040_5924 | 265 |
| 1010 | 3300046455 | Ga0495603_0010749 | Ga0495603_0010749_4571_5437 | 265 |
| 1011 | 3300046457 | Ga0495590_0002012 | Ga0495590_0002012_4551_5435 | 265 |
| 1012 | 3300046457 | Ga0495590_0021765 | Ga0495590_0021765_702_1568 | 265 |
| 1013 | 3300046459 | Ga0495629_0000692 | Ga0495629_0000692_155_1021 | 265 |
| 1014 | 3300046459 | Ga0495629_0226796 | Ga0495629_0226796_278_1144 | 265 |
| 1015 | 3300046460 | Ga0495638_0015361 | Ga0495638_0015361_814_1680 | 265 |
| 1016 | 3300046471 | Ga0495650_0006041 | Ga0495650_0006041_5995_6861 | 265 |
| 1017 | 3300046471 | Ga0495650_0054316 | Ga0495650_0054316_345_1211 | 265 |
| 1018 | 3300046471 | Ga0495650_0084299 | Ga0495650_0084299_122_988 | 265 |
| 1019 | 3300046473 | Ga0495582_0071794 | Ga0495582_0071794_286_1152 | 265 |
| 1020 | 3300046475 | Ga0495639_0033278 | Ga0495639_0033278_1339_2205 | 265 |
| 1021 | 3300046506 | Ga0495583_0038678 | Ga0495583_0038678_1363_2229 | 265 |
| 1022 | 3300046507 | Ga0495606_0059145 | Ga0495606_0059145_66_932 | 265 |
| 1023 | 3300046507 | Ga0495606_0094533 | Ga0495606_0094533_611_1477 | 265 |
| 1024 | 3300046516 | Ga0495628_0204342 | Ga0495628_0204342_40_924 | 265 |
| 1025 | 3300046543 | Ga0495645_0063919 | Ga0495645_0063919_1429_2295 | 265 |
| 1026 | 3300046559 | Ga0495667_0161275 | Ga0495667_0161275_414_1280 | 265 |
| 1027 | 3300046680 | Ga0495646_0134589 | Ga0495646_0134589_122_1006 | 265 |
| 1028 | 3300046684 | Ga0495669_0038374 | Ga0495669_0038374_653_1519 | 265 |
| 1029 | 3300046684 | Ga0495669_0091817 | Ga0495669_0091817_280_1146 | 265 |
| 1030 | 3300046690 | Ga0495624_0054694 | Ga0495624_0054694_25_909 | 265 |
| 1031 | 3300046690 | Ga0495624_0172427 | Ga0495624_0172427_287_1171 | 265 |
| 1032 | 3300046691 | Ga0495670_0024761 | Ga0495670_0024761_1560_2426 | 265 |
| 1033 | 3300046694 | Ga0495649_0008178 | Ga0495649_0008178_2006_2872 | 265 |
| 1034 | 3300046694 | Ga0495649_0103208 | Ga0495649_0103208_50_919 | 265 |
| 1035 | 3300047315 | Ga0495581_0115185 | Ga0495581_0115185_587_1453 | 265 |
| 1036 | 3300047319 | Ga0495674_0031179 | Ga0495674_0031179_3258_4145 | 265 |
| 1037 | 3300047322 | Ga0495680_0137293 | Ga0495680_0137293_774_1640 | 265 |
| 1038 | 3300047323 | Ga0495683_0001181 | Ga0495683_0001181_6715_7599 | 265 |
| 1039 | 3300047443 | Ga0495687_000104 | Ga0495687_000104_53001_53870 | 265 |
| 1040 | 3300047673 | Ga0495593_0087226 | Ga0495593_0087226_149_1015 | 265 |
| 1041 | 3300047673 | Ga0495593_0090669 | Ga0495593_0090669_519_1403 | 265 |
| 1042 | 3300048091 | Ga0495626_0137219 | Ga0495626_0137219_141_1007 | 265 |
| 1043 | 3300048903 | Ga0496100_0329855 | Ga0496100_0329855_148_1014 | 265 |
| 1044 | 3300048904 | Ga0496101_0013191 | Ga0496101_0013191_4579_5463 | 265 |
| 1045 | 3300048904 | Ga0496101_0154023 | Ga0496101_0154023_720_1604 | 265 |
| 1046 | 3300048904 | Ga0496101_0184877 | Ga0496101_0184877_483_1349 | 265 |
| 1047 | 3300048905 | Ga0496102_0002066 | Ga0496102_0002066_9348_10232 | 265 |
| 1048 | 3300048905 | Ga0496102_0017450 | Ga0496102_0017450_1276_2142 | 265 |
| 1049 | 3300048905 | Ga0496102_0210216 | Ga0496102_0210216_448_1314 | 265 |
| 1050 | 3300048906 | Ga0496103_0005550 | Ga0496103_0005550_5201_6085 | 265 |
| 1051 | 3300048906 | Ga0496103_0124176 | Ga0496103_0124176_623_1507 | 265 |
| 1052 | 3300048907 | Ga0496104_0156828 | Ga0496104_0156828_160_1044 | 265 |
| 1053 | 3300048908 | Ga0496105_0123909 | Ga0496105_0123909_184_1068 | 265 |
| 1054 | 3300048909 | Ga0496106_0012232 | Ga0496106_0012232_5247_6131 | 265 |
| 1055 | 3300048912 | Ga0496109_0114677 | Ga0496109_0114677_562_1446 | 265 |
| 1056 | 3300048913 | Ga0496110_0152920 | Ga0496110_0152920_413_1297 | 265 |
| 1057 | 3300048913 | Ga0496110_0187063 | Ga0496110_0187063_202_1068 | 265 |
| 1058 | 3300048917 | Ga0496114_0088778 | Ga0496114_0088778_1515_2381 | 265 |
| 1059 | 3300048917 | Ga0496114_0500447 | Ga0496114_0500447_55_921 | 265 |
| 1060 | 3300048919 | Ga0496116_0026363 | Ga0496116_0026363_2188_3072 | 265 |
| 1061 | 3300048920 | Ga0496117_0049092 | Ga0496117_0049092_2053_2937 | 265 |
| 1062 | 3300048921 | Ga0496118_0023850 | Ga0496118_0023850_1379_2263 | 265 |
| 1063 | 3300048924 | Ga0496121_0004681 | Ga0496121_0004681_10141_11025 | 265 |
| 1064 | 3300048925 | Ga0496122_0005686 | Ga0496122_0005686_10731_11615 | 265 |
| 1065 | 3300048927 | Ga0496124_0044825 | Ga0496124_0044825_2584_3468 | 265 |
| 1066 | 3300048928 | Ga0496125_0009075 | Ga0496125_0009075_2950_3834 | 265 |
| 1067 | 3300048929 | Ga0496126_0069666 | Ga0496126_0069666_939_1823 | 265 |
| 1068 | 3300048929 | Ga0496126_0159782 | Ga0496126_0159782_774_1658 | 265 |
| 1069 | 3300048929 | Ga0496126_0246949 | Ga0496126_0246949_409_1293 | 265 |
| 1070 | 3300053125 | Ga0500618_002981 | Ga0500618_002981_4591_5514 | 265 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.7812 | 34 | 252 |
| 2awn-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) | 0.7124 | 33 | 252 |
| 8fw5-assembly1.cif.gz_D | chimeric hsgator1-spgtr-splam complex | 0.6832 | 60 | 84 |
| 2awn-assembly1.cif.gz_A | crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) | 0.6808 | 34 | 252 |
| 6wnr-assembly1.cif.gz_C | e. coli atp synthase state 3b | 0.6482 | 54 | 76 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6Q2V7_231_304_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9199 | 31 | 92 | 3.40.50.300 |
| af_A0A1D6P1I8_181_285_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8188 | 34 | 116 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7754 | 34 | 247 | 3.40.50.300 |
| af_A0A1D6Q2V7_231_304_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7673 | 31 | 92 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7602 | 34 | 247 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-V8NDR4-F1-model_v4 | Antigen peptide transporter 2 | 0.7511 | 21 | 252 |
GO:0005524
GO:0015421 GO:0016020 GO:0016887 |
| AF-A0A536ETP5-F1-model_v4 | ABC transporter ATP-binding protein | 0.7471 | 32 | 261 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A0A2S3U666-F1-model_v4 | Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD | 0.7379 | 31 | 254 |
GO:0005524
GO:0016887 |
| AF-A0A127QVM3-F1-model_v4 | Urea ABC transporter, ATP-binding protein UrtD | 0.6818 | 26 | 265 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A839HF54-F1-model_v4 | Urea ABC transporter ATP-binding protein UrtD | 0.6718 | 14 | 265 |
GO:0005524
GO:0005886 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar