F489406

General Info

Members Datasets Scaffolds Average Seq Length
1066 473 1043 210

Family's Representative Sequence

Representative Sequence 3300033527|Ga0316586_1000008|Ga0316586_100000820
Length 239
Sequence MKGILGKKLGMTQVFTEDGVQIPVTVVEVTPNVVTQIKTEDKDGYNAVQVAVSDKRVKNTSKSLQGHFDKANTAPKRFVKEFRDFEGADELSVGQELPNIFEVGEIIDVQGISKGKGFQGAIKRHNQRRGPMSHGSRFHRAPGAMGNVQDRRVRKGKLLPGHMGDALTTIQNSQIVAFDAEKSLVLVKGNVPGSNNTFVTLKKSVKTPGKIQEIKVLNFNDAALVGSKNESAEEAGNEE

Samples

Sample ID Description Type Environment
1 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
2 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
3 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
4 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
5 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
6 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
7 2739367700 Dyella sp. YR388 Isolate Unclassified
8 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
9 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
10 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
11 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
12 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
13 2884411467 Dyella sp. AD56 Isolate Rhizosphere
14 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
15 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
16 2928963466 Dyella japonica 1073 Isolate Unclassified
17 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
18 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
19 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
20 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
21 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
22 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
25 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
26 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
29 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
30 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
31 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
32 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
33 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
34 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
40 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
41 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
44 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
47 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
50 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
51 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
52 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
53 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
56 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
57 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
60 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
63 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
64 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
65 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
68 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
69 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
73 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
74 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
75 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
76 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
77 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
78 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
85 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
86 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
87 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
90 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
91 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
92 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
93 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
94 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
107 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
108 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
109 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
110 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
111 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
112 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
113 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
114 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
115 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
122 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
123 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
134 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
143 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
147 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
148 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
149 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
150 3300019177 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
155 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
162 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
164 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
169 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
170 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
172 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
173 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
175 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
176 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
246 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300031011 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
252 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
253 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
254 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
255 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
256 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
257 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
258 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
259 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
260 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
261 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
262 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
263 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
267 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
268 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
269 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
270 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
271 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
272 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
273 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
274 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
275 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
276 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
277 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
278 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
279 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
280 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
282 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
283 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
284 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
285 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
286 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
287 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
288 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
289 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
290 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
291 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
292 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
293 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
294 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
295 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
296 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
297 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
298 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
299 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
300 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
301 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
302 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
303 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
304 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
305 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
306 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
307 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
308 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
309 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
310 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
311 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
312 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
313 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
314 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
315 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
316 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
317 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
318 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
319 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
320 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
321 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
322 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
323 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
324 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
325 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
326 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
327 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
328 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
329 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
330 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
331 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
332 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
333 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
334 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
335 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
336 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
337 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
338 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
339 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
340 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
341 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
342 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
343 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
344 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
345 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
346 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
347 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
348 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
349 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
350 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
351 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
352 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
353 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
354 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
355 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
356 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
357 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
358 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
359 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
360 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
361 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
362 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
363 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
364 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
365 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
366 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
367 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
368 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
369 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
370 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
371 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
372 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
373 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
374 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
375 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
376 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
377 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
378 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
379 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
380 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
381 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
382 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
383 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
384 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
385 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
386 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
387 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
395 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
396 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
422 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
432 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
433 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
434 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
435 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
436 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
437 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
438 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
439 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
440 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
441 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
442 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
443 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
446 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
447 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
448 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
449 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
450 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
451 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
452 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
453 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
454 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
455 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
456 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
457 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
458 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
459 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
460 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
461 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
462 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
471 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
472 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
473 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.65
Metatranscriptomes 9.19
Isolates 2.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.66
Nodule 0.09
Rhizoplane 2.25
Rhizosphere 83.77
Stem 0
Stem Tuber 0
Unclassified 7.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002754 3300001904 Bacteria 3079
2 JGI24736J21556_1003768 3300001904 Bacteria 2612
3 JGI24736J21556_1023445 3300001904 Bacteria 964
4 JGI24741J21665_1004451 3300001915 Bacteria 3103
5 JGI24741J21665_1004493 3300001915 Bacteria 3078
6 JGI24741J21665_1004799 3300001915 Bacteria 2933
7 JGI24741J21665_1008247 3300001915 Bacteria 1973
8 JGI24741J21665_1018685 3300001915 Bacteria 1106
9 JGI24740J21852_10003737 3300001979 Bacteria 6625
10 JGI24740J21852_10006264 3300001979 Bacteria 4944
11 JGI24740J21852_10012232 3300001979 Bacteria 3240
12 JGI25156J39149_1002085 3300002705 Bacteria 7577
13 JGI25156J39149_1003296 3300002705 Bacteria 5346
14 JGI25162J39368_1003895 3300002737 Bacteria 3875
15 JGI25162J39368_1007773 3300002737 Bacteria 1620
16 JGI25157J39369_1001153 3300002741 Bacteria 11428
17 JGI25157J39369_1001750 3300002741 Bacteria 7146
18 JGI25157J39369_1002044 3300002741 Bacteria 5780
19 JGI25151J46595_10007643 3300003187 Bacteria 5275
20 JGI25151J46595_10013580 3300003187 Bacteria 3661
21 Ga0055538_1000196 3300003751 Bacteria 36369
22 Ga0055533_1002319 3300003756 Bacteria 4392
23 Ga0055525_1000111 3300003759 Bacteria 127836
24 Ga0055527_1001334 3300003760 Bacteria 5331
25 Ga0055527_1004862 3300003760 Bacteria 1803
26 Ga0055535_1004862 3300003761 Bacteria 3121
27 Ga0055542_1003848 3300003762 Bacteria 3875
28 Ga0055542_1004903 3300003762 Bacteria 3121
29 Ga0055529_1003204 3300003763 Bacteria 2799
30 Ga0055526_1008536 3300003771 Bacteria 5088
31 Ga0055526_1008987 3300003771 Bacteria 4886
32 Ga0055537_1001096 3300003773 Bacteria 11761
33 Ga0055524_1013602 3300003775 Bacteria 3064
34 Ga0055524_1015666 3300003775 Bacteria 2753
35 Ga0055536_1024081 3300003781 Bacteria 1773
36 Ga0055534_1003331 3300003784 Bacteria 5088
37 Ga0055534_1006907 3300003784 Bacteria 2790
38 Ga0055528_1013611 3300003790 Bacteria 3070
39 Ga0055528_1016393 3300003790 Bacteria 2622
40 Ga0055530_10004966 3300003791 Bacteria 6579
41 Ga0055531_10017875 3300003794 Bacteria 2963
42 Ga0058859_11760642 3300004798 Bacteria 1466
43 Ga0058863_10021952 3300004799 Bacteria 1762
44 Ga0058863_10051910 3300004799 Bacteria 920
45 Ga0058861_10029892 3300004800 Bacteria 2654
46 Ga0058860_10137024 3300004801 Bacteria 3744
47 Ga0058862_10121056 3300004803 Bacteria 1383
48 Ga0065165_1033037 3300005262 Bacteria 1615
49 Ga0065707_10183525 3300005295 Bacteria 1394
50 Ga0070658_10062591 3300005327 Bacteria 3032
51 Ga0070658_10253456 3300005327 Bacteria 1493
52 Ga0070658_10424499 3300005327 Bacteria 1144
53 Ga0070676_10011569 3300005328 Bacteria 4799
54 Ga0070683_100091777 3300005329 Bacteria 2852
55 Ga0070683_100337298 3300005329 Bacteria 1435
56 Ga0070690_100108195 3300005330 Bacteria 1851
57 Ga0070670_100213118 3300005331 Bacteria 1679
58 Ga0070666_10062032 3300005335 Bacteria 2531
59 Ga0070666_10267214 3300005335 Bacteria 1213
60 Ga0070680_100024646 3300005336 Bacteria 4808
61 Ga0070680_100126748 3300005336 Bacteria 2133
62 Ga0070680_100131473 3300005336 Bacteria 2094
63 Ga0070680_100135391 3300005336 Bacteria 2063
64 Ga0070680_100450980 3300005336 Bacteria 1099
65 Ga0070682_100031926 3300005337 Bacteria 3189
66 Ga0070682_100040504 3300005337 Bacteria 2867
67 Ga0070682_100141710 3300005337 Bacteria 1639
68 Ga0070682_100155304 3300005337 Bacteria 1574
69 Ga0070682_100374660 3300005337 Bacteria 1068
70 Ga0070660_100123626 3300005339 Bacteria 2066
71 Ga0070660_100244093 3300005339 Bacteria 1463
72 Ga0070660_100398730 3300005339 Bacteria 1137
73 Ga0070660_100541817 3300005339 Bacteria 970
74 Ga0070689_100041431 3300005340 Bacteria 3535
75 Ga0070691_10019986 3300005341 Bacteria 3091
76 Ga0070691_10048275 3300005341 Bacteria 2025
77 Ga0070661_100015281 3300005344 Bacteria 5418
78 Ga0070661_100042481 3300005344 Bacteria 3318
79 Ga0070661_100097541 3300005344 Bacteria 2182
80 Ga0070661_100138082 3300005344 Bacteria 1835
81 Ga0070661_100169084 3300005344 Bacteria 1659
82 Ga0070661_100187257 3300005344 Bacteria 1577
83 Ga0070661_100369076 3300005344 Bacteria 1129
84 Ga0070661_100699554 3300005344 Bacteria 826
85 Ga0070661_100749257 3300005344 Bacteria 798
86 Ga0070692_10007700 3300005345 Bacteria 4763
87 Ga0070692_10056065 3300005345 Bacteria 2062
88 Ga0070692_10087946 3300005345 Bacteria 1684
89 Ga0070692_10124727 3300005345 Bacteria 1440
90 Ga0070668_100014103 3300005347 Bacteria 5973
91 Ga0070668_100348368 3300005347 Bacteria 1253
92 Ga0070669_100006246 3300005353 Bacteria 8599
93 Ga0070669_100222301 3300005353 Bacteria 1493
94 Ga0070669_100564161 3300005353 Bacteria 950
95 Ga0070675_100638971 3300005354 Bacteria 967
96 Ga0070671_100288936 3300005355 Bacteria 1395
97 Ga0070671_100322516 3300005355 Bacteria 1316
98 Ga0070674_100279417 3300005356 Bacteria 1323
99 Ga0070674_100287754 3300005356 Bacteria 1305
100 Ga0070673_100109100 3300005364 Bacteria 2292
101 Ga0070688_100171238 3300005365 Bacteria 1499
102 Ga0070659_100138001 3300005366 Bacteria 1984
103 Ga0070659_100160932 3300005366 Bacteria 1835
104 Ga0070659_100173711 3300005366 Bacteria 1766
105 Ga0070659_100191871 3300005366 Bacteria 1679
106 Ga0070659_100219319 3300005366 Bacteria 1569
107 Ga0070659_100750336 3300005366 Bacteria 846
108 Ga0070667_100074637 3300005367 Bacteria 2893
109 Ga0070667_100124452 3300005367 Bacteria 2246
110 Ga0070667_100577578 3300005367 Bacteria 1034
111 Ga0070709_10000076 3300005434 Bacteria 74077
112 Ga0070709_10034187 3300005434 Bacteria 3080
113 Ga0070709_10160955 3300005434 Bacteria 1561
114 Ga0070713_100008401 3300005436 Bacteria 7319
115 Ga0070713_100020295 3300005436 Bacteria 5092
116 Ga0070713_100037982 3300005436 Bacteria 3897
117 Ga0070713_100103997 3300005436 Bacteria 2465
118 Ga0070710_10040859 3300005437 Bacteria 2558
119 Ga0070710_10071767 3300005437 Bacteria 1998
120 Ga0070710_10268926 3300005437 Bacteria 1102
121 Ga0070711_100001449 3300005439 Bacteria 13051
122 Ga0070711_100007565 3300005439 Bacteria 6611
123 Ga0070711_100225282 3300005439 Bacteria 1459
124 Ga0070711_100397777 3300005439 Bacteria 1118
125 Ga0070705_100127227 3300005440 Bacteria 1656
126 Ga0070694_100058419 3300005444 Bacteria 2624
127 Ga0070708_100035523 3300005445 Bacteria 4342
128 Ga0070708_100311587 3300005445 Bacteria 1482
129 Ga0070708_100318751 3300005445 Bacteria 1464
130 Ga0070663_100036599 3300005455 Bacteria 3410
131 Ga0070663_100112513 3300005455 Bacteria 2047
132 Ga0070663_100155767 3300005455 Bacteria 1755
133 Ga0070663_100199061 3300005455 Bacteria 1562
134 Ga0070663_100220345 3300005455 Bacteria 1489
135 Ga0070678_100007039 3300005456 Bacteria 6648
136 Ga0070662_100045686 3300005457 Bacteria 3144
137 Ga0070662_100109776 3300005457 Bacteria 2100
138 Ga0070662_100390820 3300005457 Bacteria 1146
139 Ga0070681_10038165 3300005458 Bacteria 4817
140 Ga0070681_10072551 3300005458 Bacteria 3405
141 Ga0070681_10107230 3300005458 Bacteria 2734
142 Ga0070681_10150874 3300005458 Bacteria 2250
143 Ga0070681_10164806 3300005458 Bacteria 2139
144 Ga0068867_100135873 3300005459 Bacteria 1916
145 Ga0068867_100200101 3300005459 Bacteria 1599
146 Ga0070706_100119495 3300005467 Bacteria 2456
147 Ga0070707_100192686 3300005468 Bacteria 1987
148 Ga0070698_100361005 3300005471 Bacteria 1384
149 Ga0070698_100363463 3300005471 Bacteria 1379
150 Ga0070699_100023687 3300005518 Bacteria 5289
151 Ga0070679_100019420 3300005530 Bacteria 6608
152 Ga0070679_100040938 3300005530 Bacteria 4611
153 Ga0070679_100178793 3300005530 Bacteria 2094
154 Ga0070679_100184276 3300005530 Bacteria 2059
155 Ga0070679_100881218 3300005530 Bacteria 838
156 Ga0070684_100050987 3300005535 Bacteria 3595
157 Ga0070684_100083757 3300005535 Bacteria 2826
158 Ga0070684_100088026 3300005535 Bacteria 2758
159 Ga0070697_100006091 3300005536 Bacteria 9330
160 Ga0070697_100049282 3300005536 Bacteria 3418
161 Ga0068853_100029334 3300005539 Bacteria 4636
162 Ga0068853_100035785 3300005539 Bacteria 4219
163 Ga0068853_100146241 3300005539 Bacteria 2124
164 Ga0068853_100155319 3300005539 Bacteria 2061
165 Ga0068853_100167153 3300005539 Bacteria 1988
166 Ga0070695_100005390 3300005545 Bacteria 7529
167 Ga0070695_100077726 3300005545 Bacteria 2187
168 Ga0070696_100004505 3300005546 Bacteria 9299
169 Ga0070696_100124730 3300005546 Bacteria 1867
170 Ga0070696_100128219 3300005546 Bacteria 1843
171 Ga0070696_100141842 3300005546 Bacteria 1757
172 Ga0070696_100153761 3300005546 Bacteria 1690
173 Ga0070693_100000494 3300005547 Bacteria 17601
174 Ga0070693_100091903 3300005547 Bacteria 1831
175 Ga0070665_100000175 3300005548 Bacteria 113874
176 Ga0070665_100000700 3300005548 Bacteria 44692
177 Ga0070665_100105834 3300005548 Bacteria 2815
178 Ga0070704_100013476 3300005549 Bacteria 5075
179 Ga0068855_100231949 3300005563 Bacteria 2066
180 Ga0068855_100258994 3300005563 Bacteria 1938
181 Ga0068855_101050573 3300005563 Bacteria 854
182 Ga0070664_100100832 3300005564 Bacteria 2510
183 Ga0070664_100443888 3300005564 Bacteria 1190
184 Ga0068857_100003667 3300005577 Bacteria 12865
185 Ga0068857_100087151 3300005577 Bacteria 2792
186 Ga0068857_100175464 3300005577 Bacteria 1950
187 Ga0068854_100054151 3300005578 Bacteria 2884
188 Ga0068854_100099085 3300005578 Bacteria 2182
189 Ga0068854_100104882 3300005578 Bacteria 2124
190 Ga0068854_100161998 3300005578 Bacteria 1733
191 Ga0068854_100221682 3300005578 Bacteria 1496
192 Ga0068854_100265326 3300005578 Bacteria 1376
193 Ga0068854_100415343 3300005578 Bacteria 1116
194 Ga0068856_100004797 3300005614 Bacteria 13405
195 Ga0068856_100184419 3300005614 Bacteria 2100
196 Ga0068856_100192491 3300005614 Bacteria 2053
197 Ga0068856_100211399 3300005614 Bacteria 1955
198 Ga0068856_100354244 3300005614 Bacteria 1486
199 Ga0068856_100459289 3300005614 Bacteria 1294
200 Ga0070702_100051791 3300005615 Bacteria 2352
201 Ga0068852_100031217 3300005616 Bacteria 4393
202 Ga0068852_100134375 3300005616 Bacteria 2282
203 Ga0068852_100151291 3300005616 Bacteria 2158
204 Ga0068852_100156348 3300005616 Bacteria 2124
205 Ga0068852_100370010 3300005616 Bacteria 1404
206 Ga0068852_100991777 3300005616 Bacteria 859
207 Ga0068859_100122263 3300005617 Bacteria 2670
208 Ga0068859_100678814 3300005617 Bacteria 1121
209 Ga0068864_100168714 3300005618 Bacteria 1994
210 Ga0068864_100479567 3300005618 Bacteria 1194
211 Ga0068861_100050727 3300005719 Bacteria 3147
212 Ga0068861_100503022 3300005719 Bacteria 1096
213 Ga0068851_10014017 3300005834 Bacteria 3800
214 Ga0068851_10118794 3300005834 Bacteria 1419
215 Ga0068851_10129468 3300005834 Bacteria 1364
216 Ga0068863_100012596 3300005841 Bacteria 8156
217 Ga0068863_100100973 3300005841 Bacteria 2742
218 Ga0068858_100068753 3300005842 Bacteria 3282
219 Ga0068858_100075141 3300005842 Bacteria 3138
220 Ga0068860_100426956 3300005843 Bacteria 1314
221 Ga0068862_100164162 3300005844 Bacteria 1984
222 Ga0081540_1000720 3300005983 Bacteria 30494
223 Ga0070717_10659450 3300006028 Bacteria 950
224 Ga0070716_100092179 3300006173 Bacteria 1836
225 Ga0070716_100198374 3300006173 Bacteria 1332
226 Ga0070716_100380441 3300006173 Bacteria 1009
227 Ga0070712_100055854 3300006175 Bacteria 2767
228 Ga0070712_100057688 3300006175 Bacteria 2729
229 Ga0068871_100100892 3300006358 Bacteria 2418
230 Ga0068871_100436173 3300006358 Bacteria 1172
231 Ga0075434_100195641 3300006871 Bacteria 2042
232 Ga0075434_100278025 3300006871 Bacteria 1694
233 Ga0068865_100440219 3300006881 Bacteria 1075
234 Ga0075436_100051741 3300006914 Bacteria 2834
235 Ga0075436_100125917 3300006914 Bacteria 1795
236 Ga0097620_100122253 3300006931 Bacteria 2670
237 Ga0097620_100678845 3300006931 Bacteria 1121
238 Ga0075435_100021456 3300007076 Bacteria 4968
239 Ga0075435_100176685 3300007076 Bacteria 1803
240 Ga0099794_10033018 3300007265 Bacteria 2432
241 Ga0099794_10132618 3300007265 Bacteria 1259
242 Ga0099794_10216173 3300007265 Bacteria 984
243 Ga0099794_10222807 3300007265 Unclassified 969
244 Ga0099794_10227996 3300007265 Bacteria 958
245 Ga0099795_10030595 3300007788 Bacteria 1849
246 Ga0105240_10054178 3300009093 Bacteria 5028
247 Ga0105240_10113841 3300009093 Bacteria 3269
248 Ga0105240_10261623 3300009093 Bacteria 1996
249 Ga0105240_10270922 3300009093 Bacteria 1955
250 Ga0105240_10274138 3300009093 Bacteria 1941
251 Ga0105240_10282025 3300009093 Bacteria 1908
252 Ga0111539_10344664 3300009094 Bacteria 1734
253 Ga0105247_10014280 3300009101 Bacteria 4767
254 Ga0105242_10341696 3300009176 Bacteria 1380
255 Ga0105248_10241422 3300009177 Bacteria 2034
256 Ga0105248_10280233 3300009177 Bacteria 1877
257 Ga0105248_10886345 3300009177 Bacteria 1007
258 Ga0105237_10051347 3300009545 Bacteria 4141
259 Ga0105237_10073900 3300009545 Bacteria 3401
260 Ga0105237_10161032 3300009545 Unclassified 2242
261 Ga0105237_10167989 3300009545 Bacteria 2193
262 Ga0105237_10239616 3300009545 Bacteria 1815
263 Ga0105238_10022011 3300009551 Bacteria 6496
264 Ga0105238_10067600 3300009551 Bacteria 3574
265 Ga0105238_10145294 3300009551 Bacteria 2348
266 Ga0105238_10214402 3300009551 Bacteria 1902
267 Ga0105238_10361347 3300009551 Bacteria 1441
268 Ga0105238_10494909 3300009551 Bacteria 1223
269 Ga0099796_10027098 3300010159 Bacteria 1827
270 Ga0105239_10006660 3300010375 Bacteria 13359
271 Ga0105239_10053763 3300010375 Bacteria 4416
272 Ga0105239_10141288 3300010375 Bacteria 2683
273 Ga0105239_10244795 3300010375 Bacteria 2013
274 Ga0105239_10280538 3300010375 Bacteria 1875
275 Ga0105246_10140293 3300011119 Bacteria 1816
276 Ga0157323_1003136 3300012495 Bacteria 976
277 Ga0157373_10037570 3300013100 Bacteria 3471
278 Ga0157373_10087027 3300013100 Bacteria 2202
279 Ga0157373_10133595 3300013100 Bacteria 1744
280 Ga0157373_10244996 3300013100 Bacteria 1267
281 Ga0157371_10042032 3300013102 Bacteria 3259
282 Ga0157371_10045126 3300013102 Bacteria 3137
283 Ga0157371_10118940 3300013102 Bacteria 1878
284 Ga0157371_10146760 3300013102 Bacteria 1681
285 Ga0157371_10153337 3300013102 Bacteria 1644
286 Ga0157371_10500069 3300013102 Bacteria 898
287 Ga0157370_10069149 3300013104 Bacteria 3335
288 Ga0157370_10073111 3300013104 Bacteria 3235
289 Ga0157370_10163772 3300013104 Bacteria 2069
290 Ga0157370_10320909 3300013104 Bacteria 1429
291 Ga0157370_10450952 3300013104 Bacteria 1183
292 Ga0157369_10036937 3300013105 Bacteria 5351
293 Ga0157369_10107916 3300013105 Bacteria 2961
294 Ga0157369_10179013 3300013105 Bacteria 2231
295 Ga0157369_10185505 3300013105 Bacteria 2188
296 Ga0157369_10269476 3300013105 Bacteria 1775
297 Ga0157369_10506063 3300013105 Bacteria 1249
298 Ga0157378_10765208 3300013297 Bacteria 989
299 Ga0163162_10070045 3300013306 Bacteria 3559
300 Ga0163162_10574042 3300013306 Bacteria 1255
301 Ga0157372_10045136 3300013307 Bacteria 4887
302 Ga0157372_10082823 3300013307 Bacteria 3633
303 Ga0157372_10157288 3300013307 Bacteria 2625
304 Ga0157372_10257410 3300013307 Bacteria 2026
305 Ga0157372_10310831 3300013307 Bacteria 1834
306 Ga0157372_10411246 3300013307 Bacteria 1576
307 Ga0157372_10484226 3300013307 Bacteria 1442
308 Ga0157372_11119375 3300013307 Bacteria 911
309 Ga0157372_11559379 3300013307 Bacteria 761
310 Ga0163163_10643802 3300014325 Bacteria 1123
311 Ga0182008_10077601 3300014497 Bacteria 1634
312 Ga0182008_10185021 3300014497 Bacteria 1055
313 Ga0157379_10168013 3300014968 Bacteria 1980
314 Ga0157376_10000077 3300014969 Bacteria 74189
315 Ga0157376_10001519 3300014969 Bacteria 15329
316 Ga0157376_10219585 3300014969 Bacteria 1760
317 Ga0157376_10254964 3300014969 Bacteria 1640
318 Ga0182007_10134052 3300015262 Bacteria 835
319 Ga0183368_1002 3300015687 Bacteria 1865598
320 Ga0183360_10001 3300015689 Bacteria 3943671
321 Ga0163161_10539761 3300017792 Bacteria 954
322 Ga0184592_126085 3300019177 Bacteria 1464
323 Ga0197907_10574318 3300020069 Bacteria 1433
324 Ga0197907_10947378 3300020069 Bacteria 3159
325 Ga0197907_11264123 3300020069 Bacteria 778
326 Ga0206356_10069576 3300020070 Bacteria 3317
327 Ga0206356_10171056 3300020070 Bacteria 2333
328 Ga0206356_10966620 3300020070 Bacteria 4089
329 Ga0206356_11482326 3300020070 Bacteria 1521
330 Ga0206349_1346577 3300020075 Bacteria 1686
331 Ga0206355_1347985 3300020076 Bacteria 4206
332 Ga0206355_1657004 3300020076 Bacteria 2465
333 Ga0206351_10247550 3300020077 Bacteria 8297
334 Ga0206352_11092907 3300020078 Bacteria 7966
335 Ga0206352_11356790 3300020078 Bacteria 2706
336 Ga0206350_10601137 3300020080 Bacteria 3515
337 Ga0206354_10337548 3300020081 Bacteria 1915
338 Ga0206354_10771806 3300020081 Bacteria 1286
339 Ga0206354_10919723 3300020081 Bacteria 3008
340 Ga0206353_10129542 3300020082 Bacteria 10452
341 Ga0206353_10294942 3300020082 Bacteria 4933
342 Ga0206353_11029087 3300020082 Bacteria 1412
343 Ga0154015_1010654 3300020610 Bacteria 5497
344 Ga0154015_1416341 3300020610 Bacteria 1104
345 Ga0213876_10017049 3300021384 Bacteria 3837
346 Ga0224712_10013385 3300022467 Bacteria 2610
347 Ga0224712_10021892 3300022467 Bacteria 2195
348 Ga0224712_10027027 3300022467 Bacteria 2037
349 Ga0209435_101200 3300025206 Bacteria 3488
350 Ga0209435_106506 3300025206 Bacteria 1299
351 Ga0209784_100310 3300025224 Bacteria 25654
352 Ga0209674_100043 3300025226 Bacteria 369728
353 Ga0209674_102881 3300025226 Bacteria 3418
354 Ga0209672_100004 3300025228 Bacteria 1467504
355 Ga0209672_102109 3300025228 Bacteria 5311
356 Ga0209563_100103 3300025230 Bacteria 151835
357 Ga0207427_100209 3300025231 Bacteria 53322
358 Ga0207427_104741 3300025231 Bacteria 2153
359 Ga0209437_100020 3300025233 Bacteria 656374
360 Ga0209437_100193 3300025233 Bacteria 122027
361 Ga0209258_100003 3300025242 Bacteria 1467504
362 Ga0209258_104604 3300025242 Bacteria 2564
363 Ga0207425_1039535 3300025245 Bacteria 903
364 Ga0209026_1000060 3300025250 Bacteria 220052
365 Ga0209026_1000274 3300025250 Bacteria 61312
366 Ga0209026_1001271 3300025250 Bacteria 11502
367 Ga0209026_1006743 3300025250 Bacteria 2739
368 Ga0209148_1000002 3300025254 Bacteria 2399500
369 Ga0209148_1000025 3300025254 Bacteria 663262
370 Ga0209759_1001919 3300025256 Bacteria 10178
371 Ga0209759_1010126 3300025256 Bacteria 2786
372 Ga0209759_1016259 3300025256 Bacteria 1887
373 Ga0209233_1000020 3300025261 Bacteria 798224
374 Ga0209233_1000920 3300025261 Bacteria 12852
375 Ga0209233_1033207 3300025261 Bacteria 1186
376 Ga0209565_1000001 3300025263 Bacteria 2950419
377 Ga0209565_1037789 3300025263 Bacteria 912
378 Ga0209455_1000004 3300025272 Bacteria 1467504
379 Ga0209455_1000095 3300025272 Bacteria 217487
380 Ga0209673_1000001 3300025273 Bacteria 3176258
381 Ga0209673_1002116 3300025273 Bacteria 14881
382 Ga0209675_1000001 3300025291 Bacteria 2950293
383 Ga0209675_1006904 3300025291 Bacteria 4460
384 Ga0209676_1001608 3300025292 Bacteria 20029
385 Ga0209676_1004892 3300025292 Bacteria 7229
386 Ga0209025_1044140 3300025294 Bacteria 1868
387 Ga0209025_1122127 3300025294 Bacteria 775
388 Ga0209564_1000001 3300025295 Bacteria 3176258
389 Ga0209564_1007141 3300025295 Bacteria 5828
390 Ga0209050_1001128 3300025298 Bacteria 32216
391 Ga0209256_1000002 3300025299 Bacteria 1906740
392 Ga0209256_1003821 3300025299 Bacteria 10090
393 Ga0209051_1037982 3300025303 Bacteria 1758
394 Ga0209257_1006382 3300025304 Bacteria 7632
395 Ga0207697_10042053 3300025315 Bacteria 1877
396 Ga0207656_10098242 3300025321 Bacteria 1339
397 Ga0207656_10105805 3300025321 Bacteria 1295
398 Ga0207692_10016367 3300025898 Bacteria 3283
399 Ga0207692_10056387 3300025898 Bacteria 2015
400 Ga0207692_10230442 3300025898 Bacteria 1102
401 Ga0207710_10034664 3300025900 Bacteria 2219
402 Ga0207647_10011795 3300025904 Bacteria 6108
403 Ga0207647_10012806 3300025904 Bacteria 5826
404 Ga0207647_10013393 3300025904 Bacteria 5686
405 Ga0207647_10041903 3300025904 Bacteria 2875
406 Ga0207647_10047348 3300025904 Bacteria 2675
407 Ga0207647_10071130 3300025904 Bacteria 2099
408 Ga0207647_10094179 3300025904 Bacteria 1784
409 Ga0207685_10031330 3300025905 Bacteria 1903
410 Ga0207699_10018682 3300025906 Bacteria 3679
411 Ga0207699_10170900 3300025906 Bacteria 1454
412 Ga0207699_10191605 3300025906 Bacteria 1380
413 Ga0207699_10208563 3300025906 Bacteria 1328
414 Ga0207699_10228437 3300025906 Bacteria 1274
415 Ga0207645_10006593 3300025907 Bacteria 8303
416 Ga0207705_10004273 3300025909 Bacteria 10819
417 Ga0207705_10008046 3300025909 Bacteria 7728
418 Ga0207705_10031780 3300025909 Bacteria 3770
419 Ga0207705_10034450 3300025909 Bacteria 3620
420 Ga0207705_10118746 3300025909 Bacteria 1960
421 Ga0207705_10173090 3300025909 Bacteria 1626
422 Ga0207705_10189107 3300025909 Bacteria 1556
423 Ga0207684_10230671 3300025910 Bacteria 1597
424 Ga0207684_10244280 3300025910 Bacteria 1549
425 Ga0207684_10251617 3300025910 Bacteria 1524
426 Ga0207684_10332351 3300025910 Bacteria 1309
427 Ga0207684_10383432 3300025910 Bacteria 1209
428 Ga0207654_10061667 3300025911 Bacteria 2195
429 Ga0207654_10144552 3300025911 Bacteria 1521
430 Ga0207707_10000210 3300025912 Bacteria 62292
431 Ga0207707_10001339 3300025912 Bacteria 22957
432 Ga0207707_10018111 3300025912 Bacteria 6137
433 Ga0207707_10025201 3300025912 Bacteria 5202
434 Ga0207707_10051492 3300025912 Bacteria 3585
435 Ga0207707_10052498 3300025912 Bacteria 3549
436 Ga0207707_10152834 3300025912 Bacteria 2018
437 Ga0207707_10237996 3300025912 Bacteria 1583
438 Ga0207695_10000818 3300025913 Bacteria 57675
439 Ga0207695_10006299 3300025913 Bacteria 15447
440 Ga0207695_10008130 3300025913 Bacteria 13192
441 Ga0207695_10068969 3300025913 Bacteria 3621
442 Ga0207695_10073537 3300025913 Bacteria 3483
443 Ga0207695_10148552 3300025913 Bacteria 2285
444 Ga0207695_10217754 3300025913 Bacteria 1818
445 Ga0207695_10312640 3300025913 Bacteria 1461
446 Ga0207671_10028839 3300025914 Bacteria 4146
447 Ga0207671_10054495 3300025914 Bacteria 2963
448 Ga0207671_10085943 3300025914 Bacteria 2364
449 Ga0207671_10269984 3300025914 Bacteria 1340
450 Ga0207693_10038470 3300025915 Bacteria 3768
451 Ga0207693_10096232 3300025915 Bacteria 2321
452 Ga0207693_10134099 3300025915 Bacteria 1947
453 Ga0207693_10277593 3300025915 Bacteria 1313
454 Ga0207693_10280409 3300025915 Bacteria 1306
455 Ga0207663_10004162 3300025916 Bacteria 7164
456 Ga0207663_10017954 3300025916 Bacteria 3951
457 Ga0207663_10275735 3300025916 Bacteria 1247
458 Ga0207660_10014060 3300025917 Bacteria 5253
459 Ga0207660_10034597 3300025917 Bacteria 3503
460 Ga0207660_10036194 3300025917 Bacteria 3431
461 Ga0207660_10105351 3300025917 Bacteria 2113
462 Ga0207660_10119378 3300025917 Bacteria 1995
463 Ga0207660_10368253 3300025917 Bacteria 1154
464 Ga0207657_10055348 3300025919 Bacteria 3427
465 Ga0207657_10070713 3300025919 Bacteria 2956
466 Ga0207657_10122412 3300025919 Bacteria 2140
467 Ga0207657_10124909 3300025919 Bacteria 2114
468 Ga0207657_10128163 3300025919 Bacteria 2082
469 Ga0207657_10200956 3300025919 Bacteria 1603
470 Ga0207649_10002213 3300025920 Bacteria 10987
471 Ga0207649_10014504 3300025920 Bacteria 4414
472 Ga0207649_10015259 3300025920 Bacteria 4316
473 Ga0207649_10024587 3300025920 Bacteria 3503
474 Ga0207649_10047910 3300025920 Bacteria 2633
475 Ga0207649_10065071 3300025920 Bacteria 2307
476 Ga0207652_10033428 3300025921 Bacteria 4330
477 Ga0207652_10048121 3300025921 Bacteria 3644
478 Ga0207652_10053020 3300025921 Bacteria 3483
479 Ga0207652_10147343 3300025921 Bacteria 2107
480 Ga0207652_10156736 3300025921 Bacteria 2040
481 Ga0207652_10669003 3300025921 Bacteria 928
482 Ga0207646_10000754 3300025922 Bacteria 42028
483 Ga0207646_10303931 3300025922 Bacteria 1441
484 Ga0207646_10356904 3300025922 Bacteria 1321
485 Ga0207646_10730209 3300025922 Bacteria 885
486 Ga0207681_10105252 3300025923 Bacteria 2042
487 Ga0207694_10028197 3300025924 Bacteria 4280
488 Ga0207694_10088183 3300025924 Bacteria 2445
489 Ga0207694_10119803 3300025924 Bacteria 2100
490 Ga0207694_10160368 3300025924 Bacteria 1816
491 Ga0207694_10714487 3300025924 Bacteria 845
492 Ga0207650_10286074 3300025925 Bacteria 1343
493 Ga0207687_10234006 3300025927 Bacteria 1452
494 Ga0207687_10481145 3300025927 Bacteria 1034
495 Ga0207700_10116306 3300025928 Bacteria 2161
496 Ga0207700_10180340 3300025928 Bacteria 1768
497 Ga0207700_10285416 3300025928 Bacteria 1421
498 Ga0207700_10737458 3300025928 Bacteria 880
499 Ga0207664_10001884 3300025929 Bacteria 13792
500 Ga0207644_10089389 3300025931 Bacteria 2292
501 Ga0207644_10090873 3300025931 Bacteria 2275
502 Ga0207690_10000291 3300025932 Bacteria 35587
503 Ga0207690_10003289 3300025932 Bacteria 9676
504 Ga0207690_10034320 3300025932 Bacteria 3268
505 Ga0207690_10222034 3300025932 Bacteria 1446
506 Ga0207690_10227720 3300025932 Bacteria 1429
507 Ga0207690_10670980 3300025932 Bacteria 851
508 Ga0207690_10809951 3300025932 Bacteria 774
509 Ga0207706_10015708 3300025933 Bacteria 6844
510 Ga0207706_10100114 3300025933 Bacteria 2550
511 Ga0207706_10107956 3300025933 Bacteria 2449
512 Ga0207706_10319011 3300025933 Bacteria 1352
513 Ga0207686_10023003 3300025934 Bacteria 3595
514 Ga0207686_10333629 3300025934 Bacteria 1137
515 Ga0207704_10216261 3300025938 Bacteria 1414
516 Ga0207665_10000959 3300025939 Bacteria 19542
517 Ga0207665_10006155 3300025939 Bacteria 7969
518 Ga0207665_10006268 3300025939 Bacteria 7894
519 Ga0207665_10010543 3300025939 Bacteria 6070
520 Ga0207665_10035786 3300025939 Bacteria 3297
521 Ga0207665_10052220 3300025939 Bacteria 2754
522 Ga0207665_10101234 3300025939 Bacteria 2011
523 Ga0207665_10215796 3300025939 Bacteria 1404
524 Ga0207665_10409253 3300025939 Bacteria 1034
525 Ga0207689_10020406 3300025942 Bacteria 5577
526 Ga0207689_10136777 3300025942 Bacteria 2018
527 Ga0207661_10004252 3300025944 Bacteria 10024
528 Ga0207661_10058973 3300025944 Bacteria 3091
529 Ga0207661_10273592 3300025944 Bacteria 1507
530 Ga0207661_10648918 3300025944 Bacteria 970
531 Ga0207679_10025524 3300025945 Bacteria 4065
532 Ga0207679_10425174 3300025945 Bacteria 1173
533 Ga0207667_10008758 3300025949 Bacteria 11990
534 Ga0207667_10009904 3300025949 Bacteria 11181
535 Ga0207667_10010803 3300025949 Bacteria 10649
536 Ga0207667_10053962 3300025949 Bacteria 4228
537 Ga0207667_10072769 3300025949 Bacteria 3572
538 Ga0207667_10095216 3300025949 Bacteria 3074
539 Ga0207667_10119954 3300025949 Bacteria 2710
540 Ga0207667_10193768 3300025949 Bacteria 2085
541 Ga0207667_10259410 3300025949 Bacteria 1777
542 Ga0207651_10066649 3300025960 Bacteria 2531
543 Ga0207668_10075782 3300025972 Bacteria 2419
544 Ga0207668_10187878 3300025972 Bacteria 1635
545 Ga0207668_10423728 3300025972 Bacteria 1130
546 Ga0207640_10002025 3300025981 Bacteria 10946
547 Ga0207640_10003058 3300025981 Bacteria 9010
548 Ga0207640_10025408 3300025981 Bacteria 3585
549 Ga0207640_10026008 3300025981 Bacteria 3549
550 Ga0207640_10059031 3300025981 Bacteria 2530
551 Ga0207640_10513033 3300025981 Bacteria 1000
552 Ga0207640_10559495 3300025981 Bacteria 962
553 Ga0207658_10028034 3300025986 Bacteria 3963
554 Ga0207658_10106388 3300025986 Bacteria 2208
555 Ga0207677_10157745 3300026023 Bacteria 1759
556 Ga0207677_10345942 3300026023 Bacteria 1244
557 Ga0207703_10163415 3300026035 Bacteria 1952
558 Ga0207703_10205239 3300026035 Bacteria 1753
559 Ga0207639_10000231 3300026041 Bacteria 41634
560 Ga0207639_10016511 3300026041 Bacteria 5226
561 Ga0207639_10029641 3300026041 Bacteria 4008
562 Ga0207639_10047428 3300026041 Bacteria 3247
563 Ga0207639_10125486 3300026041 Bacteria 2116
564 Ga0207639_10452119 3300026041 Bacteria 1166
565 Ga0207678_10016758 3300026067 Bacteria 6435
566 Ga0207678_10049236 3300026067 Bacteria 3642
567 Ga0207678_10055028 3300026067 Bacteria 3427
568 Ga0207678_10130950 3300026067 Bacteria 2140
569 Ga0207678_10137839 3300026067 Bacteria 2082
570 Ga0207678_10220963 3300026067 Bacteria 1621
571 Ga0207678_10271783 3300026067 Bacteria 1453
572 Ga0207678_10729632 3300026067 Bacteria 873
573 Ga0207678_10924653 3300026067 Bacteria 771
574 Ga0207708_10509884 3300026075 Bacteria 1009
575 Ga0207702_10000852 3300026078 Bacteria 31897
576 Ga0207702_10011901 3300026078 Bacteria 7239
577 Ga0207702_10012283 3300026078 Bacteria 7129
578 Ga0207702_10074823 3300026078 Bacteria 2924
579 Ga0207702_10091382 3300026078 Bacteria 2665
580 Ga0207702_10161689 3300026078 Bacteria 2045
581 Ga0207702_10375412 3300026078 Bacteria 1366
582 Ga0207702_10744510 3300026078 Bacteria 967
583 Ga0207641_10183031 3300026088 Bacteria 1920
584 Ga0207641_10546239 3300026088 Bacteria 1129
585 Ga0207648_10168415 3300026089 Bacteria 1936
586 Ga0207648_10310721 3300026089 Bacteria 1415
587 Ga0207676_10162686 3300026095 Bacteria 1935
588 Ga0207676_10285849 3300026095 Bacteria 1499
589 Ga0207674_10001554 3300026116 Bacteria 29587
590 Ga0207674_10017287 3300026116 Bacteria 7869
591 Ga0207674_10059241 3300026116 Bacteria 3875
592 Ga0207674_10111246 3300026116 Bacteria 2713
593 Ga0207674_10142271 3300026116 Bacteria 2358
594 Ga0207675_100106837 3300026118 Bacteria 2639
595 Ga0207675_100774282 3300026118 Bacteria 972
596 Ga0207675_101176735 3300026118 Bacteria 787
597 Ga0207683_10023634 3300026121 Bacteria 5287
598 Ga0207698_10004871 3300026142 Bacteria 8228
599 Ga0207698_10007267 3300026142 Bacteria 6940
600 Ga0207698_10038635 3300026142 Bacteria 3528
601 Ga0207698_10052641 3300026142 Bacteria 3120
602 Ga0207698_10301744 3300026142 Bacteria 1491
603 Ga0207698_10705601 3300026142 Bacteria 1004
604 Ga0209588_1051560 3300027671 Bacteria 1331
605 Ga0209588_1081586 3300027671 Bacteria 1044
606 Ga0268266_10000001 3300028379 Bacteria 4040580
607 Ga0268266_10000259 3300028379 Bacteria 88660
608 Ga0268266_10100303 3300028379 Bacteria 2550
609 Ga0268265_10115242 3300028380 Bacteria 2202
610 Ga0268264_10023204 3300028381 Bacteria 5063
611 Ga0268264_10121193 3300028381 Bacteria 2305
612 Ga0268264_10515755 3300028381 Bacteria 1168
613 Ga0307517_10241588 3300028786 Bacteria 1071
614 Ga0265766_1002482 3300030863 Bacteria 1024
615 Ga0265770_1020074 3300030878 Bacteria 1053
616 Ga0265764_100381 3300030882 Bacteria 1637
617 Ga0265774_100076 3300031011 Bacteria 2339
618 Ga0265760_10004278 3300031090 Bacteria 4102
619 Ga0265760_10074156 3300031090 Bacteria 1047
620 Ga0265760_10114369 3300031090 Unclassified 862
621 Ga0265325_10048727 3300031241 Bacteria 2188
622 Ga0265339_10265934 3300031249 Bacteria 826
623 Ga0307408_100110780 3300031548 Bacteria 2108
624 Ga0316575_10141054 3300031665 Bacteria 992
625 Ga0316576_10006052 3300031727 Bacteria 7481
626 Ga0316576_10187240 3300031727 Bacteria 1561
627 Ga0316578_10032616 3300031728 Bacteria 2978
628 Ga0307413_10146858 3300031824 Bacteria 1638
629 Ga0307413_10837432 3300031824 Bacteria 776
630 Ga0307406_10093487 3300031901 Bacteria 2030
631 Ga0307406_10105057 3300031901 Bacteria 1932
632 Ga0307412_10028293 3300031911 Bacteria 3505
633 Ga0307409_100474526 3300031995 Bacteria 1212
634 Ga0307416_100079046 3300032002 Bacteria 2770
635 Ga0307507_10270077 3300033179 Bacteria 1075
636 Ga0316586_1000008 3300033527 Bacteria 10390
637 Ga0316588_1000021 3300033528 Bacteria 11292
638 Ga0316596_1000103 3300033541 Bacteria 10744
639 Ga0373959_0043986 3300034820 Bacteria 946
640 Ga0373926_0002726 3300035083 Bacteria 5632
641 Ga0373934_0001004 3300035086 Bacteria 10198
642 Ga0373934_0114056 3300035086 Bacteria 1097
643 Ga0373923_0001256 3300035111 Bacteria 7130
644 Ga0373945_0098404 3300035116 Bacteria 1142
645 Ga0373945_0240426 3300035116 Bacteria 762
646 Ga0373953_0066494 3300035117 Bacteria 1481
647 Ga0373954_0005540 3300035118 Bacteria 5466
648 Ga0373954_0015764 3300035118 Bacteria 3380
649 Ga0373954_0042676 3300035118 Bacteria 2115
650 Ga0373956_0019487 3300035119 Bacteria 2877
651 Ga0373957_0000289 3300035120 Bacteria 12644
652 Ga0373957_0034419 3300035120 Bacteria 1876
653 Ga0373943_0117096 3300035170 Bacteria 1412
654 Ga0373946_0023454 3300035171 Bacteria 2411
655 Ga0373955_0161703 3300035172 Bacteria 1322
656 Ga0316574_0051750 3300035398 Bacteria 2560
657 Ga0373931_0021266 3300035691 Bacteria 3254
658 Ga0373935_0010652 3300035692 Bacteria 5520
659 Ga0373927_0000934 3300035695 Bacteria 22198
660 Ga0373927_0004438 3300035695 Bacteria 9831
661 Ga0373933_0000551 3300035724 Bacteria 23376
662 Ga0373933_0002799 3300035724 Bacteria 9741
663 Ga0373933_0188487 3300035724 Bacteria 1317
664 Ga0373947_0000905 3300035725 Bacteria 17957
665 Ga0373947_0008831 3300035725 Bacteria 5795
666 Ga0373937_0000238 3300036401 Bacteria 53880
667 Ga0373937_0005026 3300036401 Bacteria 11254
668 Ga0373937_0016547 3300036401 Bacteria 6549
669 Ga0373937_0049055 3300036401 Bacteria 3866
670 Ga0373937_0377618 3300036401 Bacteria 1344
671 Ga0310112_000276 3300036458 Bacteria 4093
672 Ga0310109_011090 3300036534 Bacteria 1215
673 Ga0310110_004759 3300036535 Bacteria 1922
674 Ga0373925_0001788 3300037068 Bacteria 17923
675 Ga0373925_0009068 3300037068 Bacteria 7241
676 Ga0395899_0001959 3300037312 Bacteria 16927
677 Ga0395899_0042216 3300037312 Bacteria 3405
678 Ga0395899_0432225 3300037312 Bacteria 865
679 Ga0395900_0125348 3300037418 Bacteria 2634
680 Ga0395900_0135347 3300037418 Bacteria 2524
681 Ga0395900_0172278 3300037418 Bacteria 2202
682 Ga0395898_0000558 3300037466 Bacteria 69802
683 Ga0395898_0135016 3300037466 Bacteria 2362
684 Ga0395898_0138563 3300037466 Bacteria 2329
685 Ga0395901_0002939 3300038443 Bacteria 17197
686 Ga0395901_0218962 3300038443 Bacteria 1990
687 Ga0400483_047654 3300039062 Bacteria 9246
688 Ga0400483_168849 3300039062 Bacteria 24271
689 Ga0436365_1034683 3300039437 Bacteria 2594
690 Ga0436361_1002022 3300039447 Bacteria 749
691 Ga0451787_149821 3300041441 Bacteria 2666
692 Ga0451794_28977 3300041446 Bacteria 1588
693 Ga0451793_0393032 3300041452 Bacteria 3643
694 Ga0451805_117344 3300041461 Bacteria 748
695 Ga0451837_0589056 3300041494 Bacteria 1792
696 Ga0451853_1157729 3300041512 Bacteria 894
697 Ga0439437_001431 3300042000 Bacteria 2515
698 Ga0439455_0060019 3300042012 Bacteria 1007
699 Ga0439459_0002369 3300042438 Bacteria 2898
700 Ga0451577_0127243 3300042876 Bacteria 2283
701 Ga0466969_0001060 3300044656 Bacteria 14842
702 Ga0466969_0008941 3300044656 Bacteria 5311
703 Ga0466972_0000416 3300044658 Bacteria 22317
704 Ga0466965_0049044 3300044683 Bacteria 2093
705 Ga0466966_0002549 3300044684 Bacteria 11933
706 Ga0466961_0025162 3300044693 Bacteria 3830
707 Ga0466961_0085616 3300044693 Bacteria 1992
708 Ga0466971_0033841 3300044719 Bacteria 2290
709 Ga0466968_0016253 3300044735 Bacteria 2961
710 Ga0466968_0222672 3300044735 Bacteria 889
711 Ga0466970_0000139 3300044765 Bacteria 33601
712 Ga0466970_0088960 3300044765 Bacteria 1674
713 Ga0466959_0003175 3300045049 Bacteria 10666
714 Ga0466959_0072597 3300045049 Bacteria 2490
715 Ga0466958_0045436 3300045836 Bacteria 2649
716 Ga0466967_0729083 3300045976 Bacteria 982
717 Ga0466967_0743177 3300045976 Bacteria 973
718 Ga0495592_0116471 3300046454 Bacteria 1885
719 Ga0495592_0129288 3300046454 Bacteria 1768
720 Ga0495603_0065572 3300046455 Bacteria 2140
721 Ga0495629_0065391 3300046459 Bacteria 2538
722 Ga0495638_0000007 3300046460 Bacteria 602783
723 Ga0495651_0003059 3300046462 Bacteria 12909
724 Ga0495651_0012754 3300046462 Bacteria 6488
725 Ga0495651_0144083 3300046462 Bacteria 1724
726 Ga0495651_0369488 3300046462 Bacteria 943
727 Ga0495653_0004713 3300046463 Bacteria 11039
728 Ga0495653_0005252 3300046463 Bacteria 10534
729 Ga0495653_0188001 3300046463 Bacteria 1411
730 Ga0495653_0430957 3300046463 Unclassified 833
731 Ga0495653_0668187 3300046463 Bacteria 633
732 Ga0495650_0000202 3300046471 Bacteria 129910
733 Ga0495580_0002827 3300046472 Bacteria 14922
734 Ga0495580_0016376 3300046472 Bacteria 5564
735 Ga0495580_0071634 3300046472 Bacteria 2421
736 Ga0495580_0132657 3300046472 Bacteria 1727
737 Ga0495582_0004462 3300046473 Bacteria 7870
738 Ga0495582_0130173 3300046473 Unclassified 1421
739 Ga0495662_0014892 3300046476 Bacteria 3779
740 Ga0495664_0000007 3300046477 Bacteria 386710
741 Ga0495664_0158325 3300046477 Bacteria 1374
742 Ga0495594_0077145 3300046499 Bacteria 1858
743 Ga0495606_0001329 3300046507 Bacteria 33751
744 Ga0495608_0004716 3300046511 Bacteria 9758
745 Ga0495608_0014220 3300046511 Bacteria 5523
746 Ga0495608_0024720 3300046511 Bacteria 4105
747 Ga0495608_0083762 3300046511 Bacteria 2070
748 Ga0495618_0000035 3300046514 Bacteria 102739
749 Ga0495618_0102156 3300046514 Bacteria 1835
750 Ga0495628_0011006 3300046516 Bacteria 7660
751 Ga0495628_0017722 3300046516 Bacteria 5917
752 Ga0495630_0000610 3300046517 Bacteria 25880
753 Ga0495630_0015980 3300046517 Bacteria 5484
754 Ga0495630_0088337 3300046517 Bacteria 2341
755 Ga0495630_0145341 3300046517 Bacteria 1803
756 Ga0495630_0221500 3300046517 Unclassified 1444
757 Ga0495666_0029996 3300046526 Bacteria 2672
758 Ga0495666_0107669 3300046526 Bacteria 1310
759 Ga0495652_0023062 3300046529 Bacteria 5519
760 Ga0495652_0026177 3300046529 Bacteria 5155
761 Ga0495665_0017344 3300046531 Bacteria 3873
762 Ga0495665_0159246 3300046531 Bacteria 1177
763 Ga0495640_0031243 3300046533 Bacteria 3802
764 Ga0495586_0001676 3300046535 Bacteria 12153
765 Ga0495587_0000383 3300046536 Bacteria 31535
766 Ga0495587_0023543 3300046536 Bacteria 3784
767 Ga0495587_0024675 3300046536 Bacteria 3682
768 Ga0495645_0000033 3300046543 Bacteria 105930
769 Ga0495645_0076839 3300046543 Bacteria 2401
770 Ga0495622_0040458 3300046557 Bacteria 2169
771 Ga0495667_0071691 3300046559 Bacteria 2259
772 Ga0495625_0016676 3300046660 Bacteria 5771
773 Ga0495635_0011568 3300046663 Bacteria 6186
774 Ga0495657_0000027 3300046675 Bacteria 131421
775 Ga0495657_0049456 3300046675 Bacteria 2831
776 Ga0495657_0058966 3300046675 Bacteria 2547
777 Ga0495657_0201940 3300046675 Unclassified 1211
778 Ga0495599_0044494 3300046678 Bacteria 2784
779 Ga0495623_0001135 3300046679 Bacteria 18014
780 Ga0495646_0013837 3300046680 Bacteria 5129
781 Ga0495646_0118500 3300046680 Bacteria 1500
782 Ga0495646_0249493 3300046680 Bacteria 951
783 Ga0495613_0062134 3300046689 Bacteria 2734
784 Ga0495613_0214634 3300046689 Unclassified 1352
785 Ga0495624_0026801 3300046690 Bacteria 3776
786 Ga0495624_0038887 3300046690 Bacteria 3053
787 Ga0495670_0056198 3300046691 Bacteria 1974
788 Ga0495649_0000383 3300046694 Bacteria 38398
789 Ga0495600_0041791 3300046809 Bacteria 2988
790 Ga0495600_0200930 3300046809 Bacteria 1280
791 Ga0495581_0011173 3300047315 Bacteria 5190
792 Ga0495604_0000785 3300047317 Bacteria 26749
793 Ga0495604_0017471 3300047317 Bacteria 5742
794 Ga0495604_0209128 3300047317 Bacteria 1349
795 Ga0495604_0541963 3300047317 Bacteria 751
796 Ga0495674_0022169 3300047319 Bacteria 5859
797 Ga0495674_0184395 3300047319 Bacteria 1736
798 Ga0495674_0245455 3300047319 Bacteria 1474
799 Ga0495680_0081547 3300047322 Bacteria 2442
800 Ga0495680_0223650 3300047322 Unclassified 1342
801 Ga0495675_0002324 3300047444 Bacteria 11363
802 Ga0495684_0006019 3300047471 Bacteria 9428
803 Ga0495684_0010523 3300047471 Bacteria 7154
804 Ga0495684_0093585 3300047471 Bacteria 2276
805 Ga0495684_0208428 3300047471 Bacteria 1438
806 Ga0495593_0000774 3300047673 Bacteria 18607
807 Ga0495593_0083344 3300047673 Bacteria 1652
808 Ga0495602_0000595 3300048088 Bacteria 33887
809 Ga0495602_0019524 3300048088 Bacteria 6723
810 Ga0495602_0111755 3300048088 Bacteria 2218
811 Ga0495614_0038783 3300048089 Bacteria 2044
812 Ga0495614_0081326 3300048089 Unclassified 1403
813 Ga0496100_0473313 3300048903 Bacteria 963
814 Ga0496101_0243688 3300048904 Bacteria 1399
815 Ga0496102_0000002 3300048905 Bacteria 814588
816 Ga0496103_0000017 3300048906 Bacteria 244768
817 Ga0496104_0159892 3300048907 Bacteria 2161
818 Ga0496105_0041905 3300048908 Bacteria 3773
819 Ga0496107_0074215 3300048910 Bacteria 2475
820 Ga0496108_0647932 3300048911 Bacteria 918
821 Ga0496109_0004801 3300048912 Bacteria 11284
822 Ga0496110_0517704 3300048913 Bacteria 1085
823 Ga0496113_0237825 3300048916 Bacteria 1453
824 Ga0496114_0001141 3300048917 Bacteria 20073
825 Ga0496114_0055393 3300048917 Bacteria 3307
826 Ga0496114_0146312 3300048917 Bacteria 2048
827 Ga0496115_0002269 3300048918 Bacteria 13760
828 Ga0496115_0002867 3300048918 Bacteria 12421
829 Ga0496115_0082599 3300048918 Bacteria 2618
830 Ga0496115_0137021 3300048918 Bacteria 2018
831 Ga0496115_0145132 3300048918 Bacteria 1958
832 Ga0496115_0316099 3300048918 Bacteria 1278
833 Ga0496116_0021441 3300048919 Bacteria 4874
834 Ga0496116_0076103 3300048919 Bacteria 2103
835 Ga0496117_0000124 3300048920 Bacteria 169701
836 Ga0496117_0032904 3300048920 Bacteria 3931
837 Ga0496117_0063248 3300048920 Bacteria 2530
838 Ga0496118_0001647 3300048921 Bacteria 32855
839 Ga0496118_0012321 3300048921 Bacteria 8227
840 Ga0496118_0092393 3300048921 Bacteria 2077
841 Ga0496119_0000020 3300048922 Bacteria 285602
842 Ga0496119_0016519 3300048922 Bacteria 5611
843 Ga0496119_0089994 3300048922 Bacteria 1747
844 Ga0496120_0000006 3300048923 Bacteria 445068
845 Ga0496120_0002172 3300048923 Bacteria 20837
846 Ga0496120_0035080 3300048923 Bacteria 2999
847 Ga0496121_0002121 3300048924 Bacteria 31165
848 Ga0496121_0005001 3300048924 Bacteria 17352
849 Ga0496121_0016314 3300048924 Bacteria 7676
850 Ga0496121_0060216 3300048924 Bacteria 3124
851 Ga0496122_0000040 3300048925 Bacteria 285095
852 Ga0496122_0000140 3300048925 Bacteria 169037
853 Ga0496122_0000802 3300048925 Bacteria 60277
854 Ga0496122_0007916 3300048925 Bacteria 11642
855 Ga0496122_0043480 3300048925 Bacteria 3519
856 Ga0496122_0124335 3300048925 Bacteria 1655
857 Ga0496123_0000572 3300048926 Bacteria 62779
858 Ga0496123_0004284 3300048926 Bacteria 15176
859 Ga0496123_0022627 3300048926 Bacteria 4838
860 Ga0496124_0010706 3300048927 Bacteria 9252
861 Ga0496124_0101554 3300048927 Bacteria 2330
862 Ga0496125_0000010 3300048928 Bacteria 671167
863 Ga0496126_0000060 3300048929 Bacteria 264944
864 Ga0496126_0002082 3300048929 Bacteria 28029
865 Ga0496126_0028743 3300048929 Bacteria 5292
866 Ga0496126_0119779 3300048929 Bacteria 2284
867 Ga0496126_0225492 3300048929 Bacteria 1572
868 Ga0501306_009115 3300049127 Bacteria 1225
869 Ga0501308_013235 3300049128 Bacteria 951
870 Ga0501309_016200 3300049129 Bacteria 1014
871 Ga0501341_05108 3300049131 Bacteria 780
872 Ga0501343_003268 3300049132 Bacteria 1186
873 Ga0501305_000306 3300049161 Bacteria 3821
874 Ga0501305_007127 3300049161 Bacteria 1409
875 Ga0501305_013396 3300049161 Bacteria 1134
876 Ga0501307_004411 3300049162 Bacteria 1434
877 Ga0501307_008447 3300049162 Bacteria 1157
878 Ga0501307_015629 3300049162 Bacteria 939
879 Ga0501307_030725 3300049162 Bacteria 743
880 Ga0495678_016742 3300049459 Bacteria 3341
881 Ga0495682_0095818 3300049460 Bacteria 1065
882 Ga0501311_000061 3300049527 Bacteria 4751
883 Ga0501311_000124 3300049527 Bacteria 3927
884 Ga0501312_000051 3300049528 Bacteria 7173
885 Ga0501312_000171 3300049528 Bacteria 4337
886 Ga0501313_000884 3300049529 Bacteria 2334
887 Ga0501314_001682 3300049530 Bacteria 1634
888 Ga0501315_000777 3300049531 Bacteria 2403
889 Ga0501315_032343 3300049531 Bacteria 759
890 Ga0501316_032252 3300049532 Bacteria 705
891 Ga0501317_000397 3300049533 Bacteria 2969
892 Ga0501318_017451 3300049534 Bacteria 877
893 Ga0501319_003952 3300049535 Bacteria 1014
894 Ga0501320_000012 3300049536 Bacteria 8841
895 Ga0501320_001616 3300049536 Bacteria 1689
896 Ga0501321_004655 3300049537 Bacteria 1321
897 Ga0501321_005495 3300049537 Bacteria 1256
898 Ga0501321_006267 3300049537 Bacteria 1204
899 Ga0501323_000549 3300049539 Bacteria 2838
900 Ga0501323_000727 3300049539 Bacteria 2601
901 Ga0501324_016790 3300049540 Bacteria 721
902 Ga0501326_00100 3300049542 Bacteria 2712
903 Ga0501327_01403 3300049543 Bacteria 1150
904 Ga0501328_00508 3300049544 Bacteria 1328
905 Ga0501331_05830 3300049547 Bacteria 711
906 Ga0501332_03127 3300049548 Bacteria 948
907 Ga0501332_03708 3300049548 Bacteria 891
908 Ga0501334_01717 3300049550 Bacteria 1243
909 Ga0501335_004678 3300049551 Bacteria 1204
910 Ga0501335_009713 3300049551 Bacteria 920
911 Ga0501336_001466 3300049552 Bacteria 1408
912 Ga0501338_01561 3300049554 Bacteria 1241
913 Ga0501031_0011709 3300049568 Bacteria 5721
914 Ga0501031_0249142 3300049568 Bacteria 1154
915 Ga0501031_0388182 3300049568 Bacteria 903
916 Ga0501032_0002355 3300049569 Bacteria 14808
917 Ga0501032_0020602 3300049569 Bacteria 4590
918 Ga0501032_0025237 3300049569 Bacteria 4098
919 Ga0501032_0253464 3300049569 Bacteria 1142
920 Ga0501032_0294043 3300049569 Bacteria 1050
921 Ga0501033_0003263 3300049570 Bacteria 13428
922 Ga0501033_0012162 3300049570 Bacteria 6569
923 Ga0501034_0005654 3300049571 Bacteria 13601
924 Ga0501034_0025504 3300049571 Bacteria 6019
925 Ga0501034_0056333 3300049571 Bacteria 3955
926 Ga0501034_0214299 3300049571 Bacteria 1880
927 Ga0501034_0396200 3300049571 Unclassified 1304
928 Ga0501034_0826266 3300049571 Bacteria 818
929 Ga0501036_0332906 3300049572 Bacteria 1268
930 Ga0501036_0603738 3300049572 Bacteria 910
931 Ga0501037_0001372 3300049573 Bacteria 17876
932 Ga0501037_0127086 3300049573 Bacteria 1829
933 Ga0501038_0000314 3300049574 Bacteria 41462
934 Ga0501038_0013134 3300049574 Bacteria 7553
935 Ga0501038_0059410 3300049574 Bacteria 3275
936 Ga0501038_0199794 3300049574 Bacteria 1605
937 Ga0501039_0020620 3300049575 Bacteria 5050
938 Ga0501039_0036074 3300049575 Bacteria 3814
939 Ga0501042_0056670 3300049578 Bacteria 2796
940 Ga0501042_0144574 3300049578 Bacteria 1715
941 Ga0501042_0343336 3300049578 Bacteria 1079
942 Ga0501043_0001324 3300049579 Bacteria 21677
943 Ga0501043_0030616 3300049579 Bacteria 4230
944 Ga0501043_0269409 3300049579 Bacteria 1307
945 Ga0501046_0001012 3300049580 Bacteria 27395
946 Ga0501046_0034206 3300049580 Bacteria 4102
947 Ga0501046_0100330 3300049580 Bacteria 2221
948 Ga0501046_0113833 3300049580 Bacteria 2064
949 Ga0501046_0334541 3300049580 Bacteria 1101
950 Ga0501047_0000250 3300049581 Bacteria 63699
951 Ga0501047_0004195 3300049581 Bacteria 13568
952 Ga0501047_0103652 3300049581 Bacteria 2725
953 Ga0501047_0103968 3300049581 Bacteria 2720
954 Ga0501047_0188557 3300049581 Bacteria 1926
955 Ga0501047_0232735 3300049581 Bacteria 1695
956 Ga0501048_0017992 3300049582 Bacteria 5200
957 Ga0501048_0021518 3300049582 Bacteria 4723
958 Ga0501048_0029557 3300049582 Bacteria 3972
959 Ga0501067_0015294 3300049583 Bacteria 4246
960 Ga0501068_0246210 3300049584 Bacteria 1138
961 Ga0501069_0060151 3300049585 Bacteria 2120
962 Ga0501069_0089872 3300049585 Bacteria 1736
963 Ga0501069_0109992 3300049585 Bacteria 1568
964 Ga0501069_0522550 3300049585 Bacteria 709
965 Ga0501070_0006574 3300049586 Bacteria 9894
966 Ga0501070_0033585 3300049586 Bacteria 4293
967 Ga0501070_0036917 3300049586 Bacteria 4080
968 Ga0501070_0063643 3300049586 Bacteria 3055
969 Ga0501070_0138119 3300049586 Bacteria 2012
970 Ga0501070_0144521 3300049586 Bacteria 1963
971 Ga0501070_0162900 3300049586 Bacteria 1838
972 Ga0501070_0247835 3300049586 Bacteria 1457
973 Ga0501071_0015438 3300049587 Bacteria 5243
974 Ga0501071_0088182 3300049587 Bacteria 2276
975 Ga0501073_0001831 3300049589 Bacteria 15830
976 Ga0501073_0059390 3300049589 Bacteria 2671
977 Ga0501073_0077593 3300049589 Bacteria 2311
978 Ga0501073_0588853 3300049589 Bacteria 768
979 Ga0501074_0000980 3300049590 Bacteria 18498
980 Ga0501074_0060097 3300049590 Bacteria 2737
981 Ga0501074_0069493 3300049590 Bacteria 2532
982 Ga0501074_0148950 3300049590 Bacteria 1673
983 Ga0501074_0154724 3300049590 Bacteria 1638
984 Ga0501076_0515508 3300049592 Bacteria 986
985 Ga0501079_0213512 3300049741 Bacteria 1507
986 Ga0501079_0285027 3300049741 Bacteria 1291
987 Ga0501079_0374970 3300049741 Bacteria 1115
988 Ga0501080_0002282 3300049742 Bacteria 16696
989 Ga0501080_0021405 3300049742 Bacteria 5985
990 Ga0501080_0049719 3300049742 Bacteria 3902
991 Ga0501080_0062331 3300049742 Bacteria 3470
992 Ga0501080_0089179 3300049742 Bacteria 2865
993 Ga0501080_0107130 3300049742 Bacteria 2590
994 Ga0501081_0073960 3300049743 Bacteria 2377
995 Ga0501083_0057300 3300049744 Bacteria 2608
996 Ga0501083_0154216 3300049744 Bacteria 1504
997 Ga0501035_0000666 3300049822 Bacteria 37861
998 Ga0501035_0043368 3300049822 Bacteria 4053
999 Ga0501035_0069939 3300049822 Bacteria 3110
1000 Ga0501035_0307897 3300049822 Bacteria 1333
1001 Ga0501035_0508787 3300049822 Bacteria 991
1002 Ga0501035_0742204 3300049822 Bacteria 788
1003 Ga0501035_0769091 3300049822 Bacteria 771
1004 Ga0501044_0004802 3300049823 Bacteria 15112
1005 Ga0501044_0017351 3300049823 Bacteria 7721
1006 Ga0501044_0154438 3300049823 Bacteria 2275
1007 Ga0501044_0199878 3300049823 Bacteria 1957
1008 Ga0501044_0406799 3300049823 Bacteria 1272
1009 Ga0501044_0590676 3300049823 Bacteria 1004
1010 Ga0501045_0273922 3300049824 Bacteria 1256
1011 nmdc:mga0n895_277153_c1 3300050512 Bacteria 1701
1012 nmdc:mga0rr50_215952_c1 3300050513 Bacteria 1582
1013 nmdc:mga0rr50_437874_c1 3300050513 Bacteria 1107
1014 nmdc:mga0rr50_517934_c1 3300050513 Unclassified 1015
1015 nmdc:mga0rr50_73583_c1 3300050513 Bacteria 2613
1016 nmdc:mga08x19_365_c1 3300050514 Bacteria 32003
1017 nmdc:mga08x19_57597_c1 3300050514 Bacteria 2512
1018 nmdc:mga0a205_903698_c1 3300050515 Bacteria 730
1019 Ga0495601_0003409 3300053077 Bacteria 9110
1020 Ga0495601_0015194 3300053077 Bacteria 4651
1021 Ga0495612_0000369 3300053078 Bacteria 18070
1022 Ga0495612_0000772 3300053078 Bacteria 13040
1023 Ga0495619_0130096 3300053085 Bacteria 1729
1024 Ga0500647_0000104 3300053091 Bacteria 16366
1025 Ga0500648_000010 3300053097 Bacteria 53408
1026 Ga0500556_0000303 3300053104 Bacteria 37613
1027 Ga0500585_099340 3300053144 Bacteria 1049
1028 Ga0500586_095330 3300053145 Bacteria 1044
1029 Ga0500620_109363 3300053155 Bacteria 968
1030 Ga0500633_0015716 3300053160 Bacteria 2178
1031 Ga0500599_000007 3300053736 Bacteria 77262
1032 Ga0501084_0245529 3300054114 Bacteria 1511
1033 Ga0501084_0576817 3300054114 Bacteria 950
1034 Ga0587073_0001891 3300059492 Bacteria 2575
1035 Ga0587088_001539 3300059508 Bacteria 2415
1036 Ga0587106_000089 3300059605 Bacteria 4305
1037 Ga0587101_006283 3300059623 Bacteria 1356
1038 Ga0587075_006913 3300059644 Bacteria 1408
1039 Ga0587076_017558 3300059645 Bacteria 1142
1040 Ga0587079_003247 3300059647 Bacteria 2100
1041 Ga0587111_0101286 3300060346 Bacteria 718
1042 Ga0501082_0146414 3300060353 Bacteria 2050
1043 Ga0501082_0507194 3300060353 Bacteria 1054

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046463 Ga0495653_0668187 Ga0495653_0668187_22_540 172
2 3300035117 Ga0373953_0066494 Ga0373953_0066494_355_1092 174
3 3300035118 Ga0373954_0015764 Ga0373954_0015764_373_1110 174
4 3300003759 Ga0055525_1000111 Ga0055525_100011138 177
5 3300003760 Ga0055527_1001334 Ga0055527_10013342 177
6 3300003761 Ga0055535_1004862 Ga0055535_10048626 177
7 3300003762 Ga0055542_1004903 Ga0055542_10049031 177
8 3300025228 Ga0209672_100004 Ga0209672_1000041295 177
9 3300025230 Ga0209563_100103 Ga0209563_10010338 177
10 3300025242 Ga0209258_100003 Ga0209258_1000031295 177
11 3300025254 Ga0209148_1000025 Ga0209148_1000025599 177
12 3300025272 Ga0209455_1000004 Ga0209455_10000041295 177
13 3300053104 Ga0500556_0000303 Ga0500556_0000303_5450_6109 177
14 3300053160 Ga0500633_0015716 Ga0500633_0015716_1430_2089 177
15 3300053736 Ga0500599_000007 Ga0500599_000007_55052_55711 177
16 3300002705 JGI25156J39149_1003296 JGI25156J39149_10032964 178
17 3300002741 JGI25157J39369_1001750 JGI25157J39369_100175013 178
18 3300025250 Ga0209026_1000060 Ga0209026_10000603 178
19 3300025256 Ga0209759_1001919 Ga0209759_10019193 178
20 3300037312 Ga0395899_0001959 Ga0395899_0001959_15206_15847 178
21 3300037466 Ga0395898_0000558 Ga0395898_0000558_1060_1701 178
22 3300044656 Ga0466969_0008941 Ga0466969_0008941_3920_4561 178
23 3300044684 Ga0466966_0002549 Ga0466966_0002549_851_1492 178
24 3300044693 Ga0466961_0085616 Ga0466961_0085616_999_1640 178
25 3300044719 Ga0466971_0033841 Ga0466971_0033841_1504_2145 178
26 3300044765 Ga0466970_0088960 Ga0466970_0088960_211_852 178
27 3300045049 Ga0466959_0072597 Ga0466959_0072597_999_1640 178
28 3300045836 Ga0466958_0045436 Ga0466958_0045436_1323_1964 178
29 3300001915 JGI24741J21665_1004799 JGI24741J21665_10047994 186
30 3300005336 Ga0070680_100126748 Ga0070680_1001267482 186
31 3300005344 Ga0070661_100097541 Ga0070661_1000975413 186
32 3300005345 Ga0070692_10124727 Ga0070692_101247273 186
33 3300005455 Ga0070663_100199061 Ga0070663_1001990612 186
34 3300005539 Ga0068853_100167153 Ga0068853_1001671532 186
35 3300005578 Ga0068854_100099085 Ga0068854_1000990853 186
36 3300005616 Ga0068852_100134375 Ga0068852_1001343753 186
37 3300009093 Ga0105240_10261623 Ga0105240_102616233 186
38 3300013102 Ga0157371_10153337 Ga0157371_101533372 186
39 3300013105 Ga0157369_10185505 Ga0157369_101855053 186
40 3300025909 Ga0207705_10118746 Ga0207705_101187463 186
41 3300025913 Ga0207695_10217754 Ga0207695_102177543 186
42 3300025919 Ga0207657_10122412 Ga0207657_101224123 186
43 3300025920 Ga0207649_10014504 Ga0207649_100145044 186
44 3300025932 Ga0207690_10034320 Ga0207690_100343203 186
45 3300025949 Ga0207667_10009904 Ga0207667_1000990422 186
46 3300025981 Ga0207640_10059031 Ga0207640_100590313 186
47 3300026041 Ga0207639_10000231 Ga0207639_100002317 186
48 3300026067 Ga0207678_10130950 Ga0207678_101309503 186
49 3300026142 Ga0207698_10004871 Ga0207698_100048713 186
50 3300005617 Ga0068859_100678814 Ga0068859_1006788142 188
51 3300006931 Ga0097620_100678845 Ga0097620_1006788452 188
52 3300025294 Ga0209025_1044140 Ga0209025_10441402 189
53 3300041461 Ga0451805_117344 Ga0451805_117344_159_734 191
54 3300049127 Ga0501306_009115 Ga0501306_009115_352_981 191
55 3300049128 Ga0501308_013235 Ga0501308_013235_202_831 191
56 3300049129 Ga0501309_016200 Ga0501309_016200_372_1001 191
57 3300049131 Ga0501341_05108 Ga0501341_05108_114_740 191
58 3300049529 Ga0501313_000884 Ga0501313_000884_511_1140 191
59 3300049532 Ga0501316_032252 Ga0501316_032252_36_665 191
60 3300049547 Ga0501331_05830 Ga0501331_05830_31_660 191
61 3300007265 Ga0099794_10227996 Ga0099794_102279962 192
62 3300041512 Ga0451853_1157729 Ga0451853_1157729_188_829 192
63 3300049132 Ga0501343_003268 Ga0501343_003268_112_741 192
64 3300049161 Ga0501305_013396 Ga0501305_013396_490_1119 192
65 3300049527 Ga0501311_000124 Ga0501311_000124_3087_3716 192
66 3300049528 Ga0501312_000171 Ga0501312_000171_3177_3806 192
67 3300049531 Ga0501315_032343 Ga0501315_032343_19_648 192
68 3300049535 Ga0501319_003952 Ga0501319_003952_309_938 192
69 3300049537 Ga0501321_004655 Ga0501321_004655_581_1210 192
70 3300049539 Ga0501323_000549 Ga0501323_000549_562_1191 192
71 3300049540 Ga0501324_016790 Ga0501324_016790_71_700 192
72 3300049542 Ga0501326_00100 Ga0501326_00100_533_1162 192
73 3300049543 Ga0501327_01403 Ga0501327_01403_410_1039 192
74 3300049544 Ga0501328_00508 Ga0501328_00508_433_1062 192
75 3300049548 Ga0501332_03127 Ga0501332_03127_302_931 192
76 3300049550 Ga0501334_01717 Ga0501334_01717_264_893 192
77 3300049551 Ga0501335_004678 Ga0501335_004678_117_746 192
78 3300049552 Ga0501336_001466 Ga0501336_001466_261_890 192
79 3300049554 Ga0501338_01561 Ga0501338_01561_501_1130 192
80 3300003763 Ga0055529_1003204 Ga0055529_10032042 193
81 3300005327 Ga0070658_10424499 Ga0070658_104244992 193
82 3300005336 Ga0070680_100024646 Ga0070680_1000246468 193
83 3300005366 Ga0070659_100138001 Ga0070659_1001380012 193
84 3300005455 Ga0070663_100155767 Ga0070663_1001557672 193
85 3300005458 Ga0070681_10038165 Ga0070681_100381658 193
86 3300005530 Ga0070679_100040938 Ga0070679_1000409382 193
87 3300005578 Ga0068854_100054151 Ga0068854_1000541512 193
88 3300009093 Ga0105240_10282025 Ga0105240_102820253 193
89 3300013104 Ga0157370_10320909 Ga0157370_103209092 193
90 3300013307 Ga0157372_10411246 Ga0157372_104112462 193
91 3300025909 Ga0207705_10173090 Ga0207705_101730903 193
92 3300025912 Ga0207707_10237996 Ga0207707_102379963 193
93 3300025917 Ga0207660_10034597 Ga0207660_100345976 193
94 3300025921 Ga0207652_10033428 Ga0207652_100334283 193
95 3300025949 Ga0207667_10259410 Ga0207667_102594102 193
96 3300026067 Ga0207678_10220963 Ga0207678_102209632 193
97 3300049162 Ga0501307_015629 Ga0501307_015629_277_906 193
98 3300049533 Ga0501317_000397 Ga0501317_000397_564_1193 193
99 3300049537 Ga0501321_005495 Ga0501321_005495_516_1145 193
100 3300049569 Ga0501032_0253464 Ga0501032_0253464_229_870 193
101 3300049572 Ga0501036_0332906 Ga0501036_0332906_263_904 193
102 3300049581 Ga0501047_0103652 Ga0501047_0103652_1743_2384 193
103 3300049585 Ga0501069_0089872 Ga0501069_0089872_296_937 193
104 3300049586 Ga0501070_0006574 Ga0501070_0006574_473_1114 193
105 3300049586 Ga0501070_0063643 Ga0501070_0063643_1155_1796 193
106 3300049587 Ga0501071_0015438 Ga0501071_0015438_4129_4770 193
107 3300049589 Ga0501073_0001831 Ga0501073_0001831_14793_15434 193
108 3300049590 Ga0501074_0000980 Ga0501074_0000980_17627_18268 193
109 3300049741 Ga0501079_0213512 Ga0501079_0213512_504_1145 193
110 3300049742 Ga0501080_0002282 Ga0501080_0002282_542_1183 193
111 3300049822 Ga0501035_0307897 Ga0501035_0307897_384_1025 193
112 3300049823 Ga0501044_0017351 Ga0501044_0017351_4916_5557 193
113 3300046680 Ga0495646_0249493 Ga0495646_0249493_31_648 194
114 3300049574 Ga0501038_0059410 Ga0501038_0059410_288_929 195
115 3300049586 Ga0501070_0247835 Ga0501070_0247835_380_1021 195
116 3300049590 Ga0501074_0069493 Ga0501074_0069493_1070_1711 195
117 3300049742 Ga0501080_0021405 Ga0501080_0021405_4765_5406 195
118 3300049822 Ga0501035_0742204 Ga0501035_0742204_32_673 195
119 3300049823 Ga0501044_0199878 Ga0501044_0199878_999_1640 195
120 3300025921 Ga0207652_10669003 Ga0207652_106690032 196
121 3300048927 Ga0496124_0010706 Ga0496124_0010706_5275_5916 196
122 3300049537 Ga0501321_006267 Ga0501321_006267_582_1181 196
123 3300049548 Ga0501332_03708 Ga0501332_03708_277_876 196
124 3300049551 Ga0501335_009713 Ga0501335_009713_14_613 196
125 3300044735 Ga0466968_0222672 Ga0466968_0222672_100_717 198
126 3300046472 Ga0495580_0132657 Ga0495580_0132657_1106_1711 198
127 3300049571 Ga0501034_0396200 Ga0501034_0396200_259_861 198
128 iso_pu_bacteria 2895395659 2895397474 198
129 3300046689 Ga0495613_0214634 Ga0495613_0214634_18_638 199
130 iso_pu_bacteria 2881644220 2881649638 199
131 3300046463 Ga0495653_0004713 Ga0495653_0004713_3653_4270 200
132 3300046514 Ga0495618_0000035 Ga0495618_0000035_81346_81963 200
133 3300046543 Ga0495645_0000033 Ga0495645_0000033_21376_21993 200
134 3300049162 Ga0501307_004411 Ga0501307_004411_537_1166 200
135 3300049536 Ga0501320_000012 Ga0501320_000012_7924_8553 200
136 3300053077 Ga0495601_0003409 Ga0495601_0003409_1181_1798 200
137 3300053078 Ga0495612_0000369 Ga0495612_0000369_11551_12168 200
138 iso_pu_bacteria 8055531788 8055533618 200
139 3300009551 Ga0105238_10214402 Ga0105238_102144022 202
140 3300010375 Ga0105239_10006660 Ga0105239_100066603 202
141 3300010375 Ga0105239_10053763 Ga0105239_100537633 202
142 3300013102 Ga0157371_10500069 Ga0157371_105000692 202
143 3300013306 Ga0163162_10070045 Ga0163162_100700453 202
144 3300014969 Ga0157376_10219585 Ga0157376_102195853 202
145 3300020069 Ga0197907_10574318 Ga0197907_105743182 202
146 3300031727 Ga0316576_10006052 Ga0316576_100060524 202
147 3300031727 Ga0316576_10187240 Ga0316576_101872402 202
148 3300034820 Ga0373959_0043986 Ga0373959_0043986_129_743 202
149 3300035398 Ga0316574_0051750 Ga0316574_0051750_1443_2051 202
150 3300041441 Ga0451787_149821 Ga0451787_149821_940_1551 202
151 3300041446 Ga0451794_28977 Ga0451794_28977_682_1290 202
152 3300041452 Ga0451793_0393032 Ga0451793_0393032_861_1469 202
153 3300041494 Ga0451837_0589056 Ga0451837_0589056_365_976 202
154 3300042438 Ga0439459_0002369 Ga0439459_0002369_263_871 202
155 3300044658 Ga0466972_0000416 Ga0466972_0000416_2071_2682 202
156 3300044765 Ga0466970_0000139 Ga0466970_0000139_1149_1760 202
157 3300046460 Ga0495638_0000007 Ga0495638_0000007_600180_600788 202
158 3300046471 Ga0495650_0000202 Ga0495650_0000202_11856_12464 202
159 3300046507 Ga0495606_0001329 Ga0495606_0001329_32015_32623 202
160 3300046557 Ga0495622_0040458 Ga0495622_0040458_1476_2084 202
161 3300046660 Ga0495625_0016676 Ga0495625_0016676_1411_2019 202
162 3300046694 Ga0495649_0000383 Ga0495649_0000383_1327_1935 202
163 3300048903 Ga0496100_0473313 Ga0496100_0473313_325_933 202
164 3300048904 Ga0496101_0243688 Ga0496101_0243688_775_1383 202
165 3300048907 Ga0496104_0159892 Ga0496104_0159892_1274_1882 202
166 3300048908 Ga0496105_0041905 Ga0496105_0041905_793_1401 202
167 3300048917 Ga0496114_0055393 Ga0496114_0055393_733_1341 202
168 3300048918 Ga0496115_0145132 Ga0496115_0145132_1328_1936 202
169 3300048920 Ga0496117_0032904 Ga0496117_0032904_2860_3471 202
170 3300048920 Ga0496117_0063248 Ga0496117_0063248_1653_2261 202
171 3300048921 Ga0496118_0001647 Ga0496118_0001647_1031_1642 202
172 3300048921 Ga0496118_0092393 Ga0496118_0092393_905_1513 202
173 3300048922 Ga0496119_0016519 Ga0496119_0016519_1260_1868 202
174 3300048923 Ga0496120_0035080 Ga0496120_0035080_2171_2779 202
175 3300048924 Ga0496121_0016314 Ga0496121_0016314_2093_2701 202
176 3300048924 Ga0496121_0060216 Ga0496121_0060216_465_1073 202
177 3300048929 Ga0496126_0028743 Ga0496126_0028743_1564_2172 202
178 3300048929 Ga0496126_0225492 Ga0496126_0225492_515_1126 202
179 3300049459 Ga0495678_016742 Ga0495678_016742_2273_2881 202
180 3300049460 Ga0495682_0095818 Ga0495682_0095818_229_837 202
181 3300049568 Ga0501031_0011709 Ga0501031_0011709_4249_4860 202
182 3300049569 Ga0501032_0002355 Ga0501032_0002355_878_1489 202
183 3300049569 Ga0501032_0020602 Ga0501032_0020602_3191_3805 202
184 3300049570 Ga0501033_0003263 Ga0501033_0003263_869_1480 202
185 3300049571 Ga0501034_0005654 Ga0501034_0005654_211_822 202
186 3300049571 Ga0501034_0025504 Ga0501034_0025504_786_1400 202
187 3300049573 Ga0501037_0001372 Ga0501037_0001372_15527_16138 202
188 3300049574 Ga0501038_0000314 Ga0501038_0000314_582_1193 202
189 3300049575 Ga0501039_0020620 Ga0501039_0020620_686_1297 202
190 3300049575 Ga0501039_0036074 Ga0501039_0036074_2093_2707 202
191 3300049579 Ga0501043_0001324 Ga0501043_0001324_20195_20806 202
192 3300049580 Ga0501046_0001012 Ga0501046_0001012_853_1464 202
193 3300049581 Ga0501047_0004195 Ga0501047_0004195_12077_12688 202
194 3300049582 Ga0501048_0017992 Ga0501048_0017992_64_675 202
195 3300049585 Ga0501069_0522550 Ga0501069_0522550_15_626 202
196 3300049589 Ga0501073_0077593 Ga0501073_0077593_224_835 202
197 3300049742 Ga0501080_0089179 Ga0501080_0089179_2131_2742 202
198 3300049822 Ga0501035_0000666 Ga0501035_0000666_18692_19303 202
199 3300049823 Ga0501044_0004802 Ga0501044_0004802_13625_14236 202
200 3300049823 Ga0501044_0590676 Ga0501044_0590676_31_639 202
201 3300054114 Ga0501084_0576817 Ga0501084_0576817_15_629 202
202 iso_pu_bacteria 2857604169 2857608873 203
203 iso_pu_bacteria 2857609550 2857613416 203
204 3300003751 Ga0055538_1000196 Ga0055538_10001964 204
205 3300025224 Ga0209784_100310 Ga0209784_1003103 204
206 iso_pu_bacteria 2512564013 2512635739 204
207 iso_pu_bacteria 2857465823 2857472351 204
208 iso_pu_bacteria 2857591370 2857597784 204
209 iso_pu_bacteria 2915597211 2915598703 204
210 iso_pu_bacteria 2929183550 2929183849 204
211 3300005563 Ga0068855_101050573 Ga0068855_1010505732 205
212 3300005615 Ga0070702_100051791 Ga0070702_1000517912 205
213 3300005616 Ga0068852_100991777 Ga0068852_1009917772 205
214 3300017792 Ga0163161_10539761 Ga0163161_105397612 205
215 3300025927 Ga0207687_10234006 Ga0207687_102340062 205
216 3300026023 Ga0207677_10157745 Ga0207677_101577452 205
217 3300026075 Ga0207708_10509884 Ga0207708_105098842 205
218 3300026078 Ga0207702_10744510 Ga0207702_107445102 205
219 3300026118 Ga0207675_101176735 Ga0207675_1011767351 205
220 3300031665 Ga0316575_10141054 Ga0316575_101410541 205
221 3300031728 Ga0316578_10032616 Ga0316578_100326162 205
222 3300031901 Ga0307406_10105057 Ga0307406_101050572 205
223 3300045976 Ga0466967_0729083 Ga0466967_0729083_279_896 205
224 3300046462 Ga0495651_0369488 Ga0495651_0369488_256_873 205
225 3300046477 Ga0495664_0000007 Ga0495664_0000007_122974_123591 205
226 3300046517 Ga0495630_0000610 Ga0495630_0000610_23334_23951 205
227 3300046675 Ga0495657_0000027 Ga0495657_0000027_108456_109073 205
228 3300046809 Ga0495600_0041791 Ga0495600_0041791_272_889 205
229 3300047471 Ga0495684_0093585 Ga0495684_0093585_1083_1700 205
230 3300048905 Ga0496102_0000002 Ga0496102_0000002_648095_648712 205
231 3300048906 Ga0496103_0000017 Ga0496103_0000017_241312_241929 205
232 3300048911 Ga0496108_0647932 Ga0496108_0647932_96_713 205
233 3300048912 Ga0496109_0004801 Ga0496109_0004801_3989_4606 205
234 3300048913 Ga0496110_0517704 Ga0496110_0517704_283_900 205
235 3300053077 Ga0495601_0015194 Ga0495601_0015194_1316_1933 205
236 iso_pu_bacteria 8007371054 8007374602 205
237 3300026067 Ga0207678_10924653 Ga0207678_109246531 206
238 3300033527 Ga0316586_1000008 Ga0316586_100000820 206
239 3300048925 Ga0496122_0124335 Ga0496122_0124335_534_1154 206
240 3300005434 Ga0070709_10000076 Ga0070709_1000007626 207
241 3300006173 Ga0070716_100380441 Ga0070716_1003804411 207
242 3300025939 Ga0207665_10409253 Ga0207665_104092531 207
243 3300049161 Ga0501305_000306 Ga0501305_000306_2438_3070 207
244 3300049528 Ga0501312_000051 Ga0501312_000051_430_1062 207
245 3300049531 Ga0501315_000777 Ga0501315_000777_1418_2050 207
246 3300049534 Ga0501318_017451 Ga0501318_017451_52_684 207
247 3300053091 Ga0500647_0000104 Ga0500647_0000104_1525_2190 207
248 3300053097 Ga0500648_000010 Ga0500648_000010_13948_14613 207
249 3300053144 Ga0500585_099340 Ga0500585_099340_127_792 207
250 3300053145 Ga0500586_095330 Ga0500586_095330_107_772 207
251 3300006871 Ga0075434_100195641 Ga0075434_1001956412 208
252 3300037312 Ga0395899_0432225 Ga0395899_0432225_138_764 208
253 3300044656 Ga0466969_0001060 Ga0466969_0001060_13684_14310 208
254 3300044683 Ga0466965_0049044 Ga0466965_0049044_818_1444 208
255 3300044693 Ga0466961_0025162 Ga0466961_0025162_2309_2935 208
256 3300044735 Ga0466968_0016253 Ga0466968_0016253_1523_2149 208
257 3300045049 Ga0466959_0003175 Ga0466959_0003175_8219_8845 208
258 3300048924 Ga0496121_0002121 Ga0496121_0002121_492_1151 208
259 3300049527 Ga0501311_000061 Ga0501311_000061_3682_4311 208
260 3300049530 Ga0501314_001682 Ga0501314_001682_509_1138 208
261 3300049536 Ga0501320_001616 Ga0501320_001616_10_639 208
262 3300049539 Ga0501323_000727 Ga0501323_000727_1437_2066 208
263 3300005295 Ga0065707_10183525 Ga0065707_101835252 209
264 3300005356 Ga0070674_100287754 Ga0070674_1002877541 209
265 3300005434 Ga0070709_10034187 Ga0070709_100341873 209
266 3300005436 Ga0070713_100020295 Ga0070713_1000202952 209
267 3300005436 Ga0070713_100037982 Ga0070713_1000379822 209
268 3300005439 Ga0070711_100001449 Ga0070711_1000014499 209
269 3300005439 Ga0070711_100007565 Ga0070711_1000075656 209
270 3300005440 Ga0070705_100127227 Ga0070705_1001272271 209
271 3300005444 Ga0070694_100058419 Ga0070694_1000584193 209
272 3300005445 Ga0070708_100035523 Ga0070708_1000355237 209
273 3300005445 Ga0070708_100311587 Ga0070708_1003115872 209
274 3300005445 Ga0070708_100318751 Ga0070708_1003187512 209
275 3300005458 Ga0070681_10164806 Ga0070681_101648062 209
276 3300005459 Ga0068867_100200101 Ga0068867_1002001012 209
277 3300005467 Ga0070706_100119495 Ga0070706_1001194953 209
278 3300005468 Ga0070707_100192686 Ga0070707_1001926863 209
279 3300005471 Ga0070698_100361005 Ga0070698_1003610052 209
280 3300005518 Ga0070699_100023687 Ga0070699_1000236874 209
281 3300005530 Ga0070679_100019420 Ga0070679_1000194203 209
282 3300005536 Ga0070697_100006091 Ga0070697_1000060913 209
283 3300005536 Ga0070697_100049282 Ga0070697_1000492826 209
284 3300005545 Ga0070695_100005390 Ga0070695_1000053903 209
285 3300005545 Ga0070695_100077726 Ga0070695_1000777262 209
286 3300005546 Ga0070696_100004505 Ga0070696_1000045053 209
287 3300005547 Ga0070693_100000494 Ga0070693_1000004943 209
288 3300005548 Ga0070665_100000700 Ga0070665_10000070028 209
289 3300005549 Ga0070704_100013476 Ga0070704_1000134768 209
290 3300005841 Ga0068863_100012596 Ga0068863_1000125964 209
291 3300006028 Ga0070717_10659450 Ga0070717_106594501 209
292 3300006173 Ga0070716_100092179 Ga0070716_1000921793 209
293 3300006175 Ga0070712_100057688 Ga0070712_1000576882 209
294 3300006871 Ga0075434_100278025 Ga0075434_1002780252 209
295 3300006881 Ga0068865_100440219 Ga0068865_1004402192 209
296 3300006914 Ga0075436_100051741 Ga0075436_1000517413 209
297 3300006914 Ga0075436_100125917 Ga0075436_1001259172 209
298 3300007076 Ga0075435_100021456 Ga0075435_1000214562 209
299 3300007076 Ga0075435_100176685 Ga0075435_1001766852 209
300 3300007265 Ga0099794_10033018 Ga0099794_100330183 209
301 3300007265 Ga0099794_10216173 Ga0099794_102161731 209
302 3300007265 Ga0099794_10222807 Ga0099794_102228071 209
303 3300009176 Ga0105242_10341696 Ga0105242_103416962 209
304 3300009177 Ga0105248_10886345 Ga0105248_108863452 209
305 3300009545 Ga0105237_10161032 Ga0105237_101610321 209
306 3300013297 Ga0157378_10765208 Ga0157378_107652082 209
307 3300013306 Ga0163162_10574042 Ga0163162_105740422 209
308 3300013307 Ga0157372_10310831 Ga0157372_103108312 209
309 3300014969 Ga0157376_10000077 Ga0157376_1000007779 209
310 3300014969 Ga0157376_10001519 Ga0157376_1000151929 209
311 3300021384 Ga0213876_10017049 Ga0213876_100170494 209
312 3300025898 Ga0207692_10230442 Ga0207692_102304422 209
313 3300025905 Ga0207685_10031330 Ga0207685_100313303 209
314 3300025906 Ga0207699_10018682 Ga0207699_100186823 209
315 3300025906 Ga0207699_10191605 Ga0207699_101916051 209
316 3300025906 Ga0207699_10208563 Ga0207699_102085632 209
317 3300025906 Ga0207699_10228437 Ga0207699_102284373 209
318 3300025910 Ga0207684_10230671 Ga0207684_102306712 209
319 3300025910 Ga0207684_10244280 Ga0207684_102442803 209
320 3300025910 Ga0207684_10251617 Ga0207684_102516173 209
321 3300025910 Ga0207684_10332351 Ga0207684_103323512 209
322 3300025910 Ga0207684_10383432 Ga0207684_103834322 209
323 3300025912 Ga0207707_10152834 Ga0207707_101528343 209
324 3300025914 Ga0207671_10085943 Ga0207671_100859432 209
325 3300025915 Ga0207693_10038470 Ga0207693_100384706 209
326 3300025915 Ga0207693_10096232 Ga0207693_100962322 209
327 3300025915 Ga0207693_10277593 Ga0207693_102775932 209
328 3300025916 Ga0207663_10004162 Ga0207663_100041625 209
329 3300025916 Ga0207663_10017954 Ga0207663_100179547 209
330 3300025922 Ga0207646_10000754 Ga0207646_100007543 209
331 3300025922 Ga0207646_10303931 Ga0207646_103039312 209
332 3300025922 Ga0207646_10356904 Ga0207646_103569042 209
333 3300025928 Ga0207700_10285416 Ga0207700_102854163 209
334 3300025934 Ga0207686_10023003 Ga0207686_100230032 209
335 3300025938 Ga0207704_10216261 Ga0207704_102162612 209
336 3300025939 Ga0207665_10000959 Ga0207665_100009593 209
337 3300025939 Ga0207665_10006155 Ga0207665_1000615515 209
338 3300025939 Ga0207665_10006268 Ga0207665_100062683 209
339 3300025939 Ga0207665_10010543 Ga0207665_100105434 209
340 3300025939 Ga0207665_10035786 Ga0207665_100357866 209
341 3300026035 Ga0207703_10163415 Ga0207703_101634152 209
342 3300026088 Ga0207641_10546239 Ga0207641_105462392 209
343 3300026089 Ga0207648_10310721 Ga0207648_103107212 209
344 3300027671 Ga0209588_1051560 Ga0209588_10515602 209
345 3300027671 Ga0209588_1081586 Ga0209588_10815861 209
346 3300028379 Ga0268266_10000259 Ga0268266_1000025956 209
347 3300028381 Ga0268264_10515755 Ga0268264_105157552 209
348 3300030878 Ga0265770_1020074 Ga0265770_10200742 209
349 3300031090 Ga0265760_10074156 Ga0265760_100741562 209
350 3300031090 Ga0265760_10114369 Ga0265760_101143691 209
351 3300031241 Ga0265325_10048727 Ga0265325_100487273 209
352 3300031249 Ga0265339_10265934 Ga0265339_102659341 209
353 3300033541 Ga0316596_1000103 Ga0316596_100010321 209
354 3300035083 Ga0373926_0002726 Ga0373926_0002726_4876_5544 209
355 3300035086 Ga0373934_0001004 Ga0373934_0001004_635_1288 209
356 3300035086 Ga0373934_0114056 Ga0373934_0114056_402_1043 209
357 3300035111 Ga0373923_0001256 Ga0373923_0001256_486_1127 209
358 3300035116 Ga0373945_0098404 Ga0373945_0098404_401_1069 209
359 3300035116 Ga0373945_0240426 Ga0373945_0240426_44_685 209
360 3300035118 Ga0373954_0005540 Ga0373954_0005540_1326_1967 209
361 3300035118 Ga0373954_0042676 Ga0373954_0042676_817_1458 209
362 3300035119 Ga0373956_0019487 Ga0373956_0019487_1563_2204 209
363 3300035120 Ga0373957_0000289 Ga0373957_0000289_816_1469 209
364 3300035120 Ga0373957_0034419 Ga0373957_0034419_357_998 209
365 3300035170 Ga0373943_0117096 Ga0373943_0117096_660_1328 209
366 3300035171 Ga0373946_0023454 Ga0373946_0023454_528_1196 209
367 3300035172 Ga0373955_0161703 Ga0373955_0161703_68_709 209
368 3300035691 Ga0373931_0021266 Ga0373931_0021266_234_875 209
369 3300035692 Ga0373935_0010652 Ga0373935_0010652_4337_4978 209
370 3300035695 Ga0373927_0000934 Ga0373927_0000934_20018_20659 209
371 3300035695 Ga0373927_0004438 Ga0373927_0004438_8606_9274 209
372 3300035724 Ga0373933_0000551 Ga0373933_0000551_2196_2849 209
373 3300035724 Ga0373933_0002799 Ga0373933_0002799_1022_1663 209
374 3300035724 Ga0373933_0188487 Ga0373933_0188487_518_1174 209
375 3300035725 Ga0373947_0000905 Ga0373947_0000905_5372_6013 209
376 3300035725 Ga0373947_0008831 Ga0373947_0008831_4332_5000 209
377 3300036401 Ga0373937_0000238 Ga0373937_0000238_52738_53379 209
378 3300036401 Ga0373937_0005026 Ga0373937_0005026_1472_2113 209
379 3300036401 Ga0373937_0016547 Ga0373937_0016547_5262_5915 209
380 3300036401 Ga0373937_0049055 Ga0373937_0049055_2126_2782 209
381 3300036401 Ga0373937_0377618 Ga0373937_0377618_524_1165 209
382 3300037068 Ga0373925_0001788 Ga0373925_0001788_16691_17359 209
383 3300037068 Ga0373925_0009068 Ga0373925_0009068_2639_3280 209
384 3300039437 Ga0436365_1034683 Ga0436365_1034683_813_1469 209
385 3300046454 Ga0495592_0116471 Ga0495592_0116471_571_1212 209
386 3300046454 Ga0495592_0129288 Ga0495592_0129288_571_1224 209
387 3300046455 Ga0495603_0065572 Ga0495603_0065572_457_1098 209
388 3300046459 Ga0495629_0065391 Ga0495629_0065391_241_882 209
389 3300046462 Ga0495651_0003059 Ga0495651_0003059_11517_12158 209
390 3300046462 Ga0495651_0012754 Ga0495651_0012754_431_1072 209
391 3300046462 Ga0495651_0144083 Ga0495651_0144083_710_1363 209
392 3300046463 Ga0495653_0005252 Ga0495653_0005252_752_1393 209
393 3300046463 Ga0495653_0188001 Ga0495653_0188001_314_955 209
394 3300046463 Ga0495653_0430957 Ga0495653_0430957_84_737 209
395 3300046472 Ga0495580_0002827 Ga0495580_0002827_563_1204 209
396 3300046472 Ga0495580_0016376 Ga0495580_0016376_4381_5022 209
397 3300046472 Ga0495580_0071634 Ga0495580_0071634_1508_2149 209
398 3300046473 Ga0495582_0004462 Ga0495582_0004462_6228_6869 209
399 3300046473 Ga0495582_0130173 Ga0495582_0130173_25_666 209
400 3300046476 Ga0495662_0014892 Ga0495662_0014892_933_1574 209
401 3300046477 Ga0495664_0158325 Ga0495664_0158325_274_915 209
402 3300046499 Ga0495594_0077145 Ga0495594_0077145_489_1130 209
403 3300046511 Ga0495608_0004716 Ga0495608_0004716_7983_8624 209
404 3300046511 Ga0495608_0014220 Ga0495608_0014220_4286_4939 209
405 3300046511 Ga0495608_0083762 Ga0495608_0083762_1312_1953 209
406 3300046514 Ga0495618_0102156 Ga0495618_0102156_538_1179 209
407 3300046516 Ga0495628_0011006 Ga0495628_0011006_556_1197 209
408 3300046517 Ga0495630_0015980 Ga0495630_0015980_4273_4914 209
409 3300046517 Ga0495630_0145341 Ga0495630_0145341_634_1302 209
410 3300046517 Ga0495630_0221500 Ga0495630_0221500_724_1365 209
411 3300046526 Ga0495666_0029996 Ga0495666_0029996_1495_2136 209
412 3300046526 Ga0495666_0107669 Ga0495666_0107669_360_1001 209
413 3300046529 Ga0495652_0023062 Ga0495652_0023062_4399_5040 209
414 3300046529 Ga0495652_0026177 Ga0495652_0026177_3520_4161 209
415 3300046531 Ga0495665_0017344 Ga0495665_0017344_2662_3303 209
416 3300046531 Ga0495665_0159246 Ga0495665_0159246_489_1130 209
417 3300046533 Ga0495640_0031243 Ga0495640_0031243_1405_2046 209
418 3300046535 Ga0495586_0001676 Ga0495586_0001676_10942_11583 209
419 3300046536 Ga0495587_0000383 Ga0495587_0000383_7796_8437 209
420 3300046536 Ga0495587_0023543 Ga0495587_0023543_2226_2879 209
421 3300046536 Ga0495587_0024675 Ga0495587_0024675_1175_1816 209
422 3300046543 Ga0495645_0076839 Ga0495645_0076839_1190_1831 209
423 3300046559 Ga0495667_0071691 Ga0495667_0071691_1142_1783 209
424 3300046663 Ga0495635_0011568 Ga0495635_0011568_626_1267 209
425 3300046675 Ga0495657_0049456 Ga0495657_0049456_623_1264 209
426 3300046675 Ga0495657_0201940 Ga0495657_0201940_107_760 209
427 3300046678 Ga0495599_0044494 Ga0495599_0044494_1944_2585 209
428 3300046679 Ga0495623_0001135 Ga0495623_0001135_16823_17464 209
429 3300046680 Ga0495646_0013837 Ga0495646_0013837_344_985 209
430 3300046689 Ga0495613_0062134 Ga0495613_0062134_622_1263 209
431 3300046690 Ga0495624_0026801 Ga0495624_0026801_2930_3598 209
432 3300046690 Ga0495624_0038887 Ga0495624_0038887_556_1197 209
433 3300046691 Ga0495670_0056198 Ga0495670_0056198_733_1362 209
434 3300046809 Ga0495600_0200930 Ga0495600_0200930_583_1236 209
435 3300047315 Ga0495581_0011173 Ga0495581_0011173_377_1018 209
436 3300047317 Ga0495604_0000785 Ga0495604_0000785_618_1271 209
437 3300047317 Ga0495604_0017471 Ga0495604_0017471_957_1598 209
438 3300047317 Ga0495604_0209128 Ga0495604_0209128_78_719 209
439 3300047317 Ga0495604_0541963 Ga0495604_0541963_65_706 209
440 3300047319 Ga0495674_0022169 Ga0495674_0022169_1074_1715 209
441 3300047319 Ga0495674_0245455 Ga0495674_0245455_588_1229 209
442 3300047322 Ga0495680_0081547 Ga0495680_0081547_981_1634 209
443 3300047322 Ga0495680_0223650 Ga0495680_0223650_564_1205 209
444 3300047444 Ga0495675_0002324 Ga0495675_0002324_9347_9988 209
445 3300047471 Ga0495684_0006019 Ga0495684_0006019_7967_8608 209
446 3300047471 Ga0495684_0208428 Ga0495684_0208428_548_1189 209
447 3300047673 Ga0495593_0000774 Ga0495593_0000774_17353_17994 209
448 3300047673 Ga0495593_0083344 Ga0495593_0083344_987_1628 209
449 3300048088 Ga0495602_0000595 Ga0495602_0000595_2382_3023 209
450 3300048088 Ga0495602_0019524 Ga0495602_0019524_571_1212 209
451 3300048088 Ga0495602_0111755 Ga0495602_0111755_1445_2098 209
452 3300048089 Ga0495614_0038783 Ga0495614_0038783_652_1293 209
453 3300048089 Ga0495614_0081326 Ga0495614_0081326_614_1255 209
454 3300048917 Ga0496114_0001141 Ga0496114_0001141_18902_19543 209
455 3300048918 Ga0496115_0002867 Ga0496115_0002867_3210_3851 209
456 3300048918 Ga0496115_0082599 Ga0496115_0082599_1322_1978 209
457 3300048918 Ga0496115_0316099 Ga0496115_0316099_291_932 209
458 3300048919 Ga0496116_0021441 Ga0496116_0021441_471_1103 209
459 3300048919 Ga0496116_0076103 Ga0496116_0076103_733_1368 209
460 3300048920 Ga0496117_0000124 Ga0496117_0000124_91130_91765 209
461 3300048921 Ga0496118_0012321 Ga0496118_0012321_2688_3323 209
462 3300048922 Ga0496119_0000020 Ga0496119_0000020_110219_110854 209
463 3300048922 Ga0496119_0089994 Ga0496119_0089994_958_1590 209
464 3300048923 Ga0496120_0000006 Ga0496120_0000006_250944_251579 209
465 3300048923 Ga0496120_0002172 Ga0496120_0002172_18352_18987 209
466 3300048925 Ga0496122_0000040 Ga0496122_0000040_145132_145767 209
467 3300048925 Ga0496122_0000140 Ga0496122_0000140_100441_101073 209
468 3300048925 Ga0496122_0000802 Ga0496122_0000802_42566_43201 209
469 3300048925 Ga0496122_0007916 Ga0496122_0007916_5298_5927 209
470 3300048925 Ga0496122_0043480 Ga0496122_0043480_2682_3314 209
471 3300048926 Ga0496123_0000572 Ga0496123_0000572_16670_17305 209
472 3300048926 Ga0496123_0004284 Ga0496123_0004284_1565_2200 209
473 3300048926 Ga0496123_0022627 Ga0496123_0022627_2561_3193 209
474 3300048927 Ga0496124_0101554 Ga0496124_0101554_1649_2284 209
475 3300048928 Ga0496125_0000010 Ga0496125_0000010_149228_149863 209
476 3300048929 Ga0496126_0000060 Ga0496126_0000060_250303_250938 209
477 3300048929 Ga0496126_0002082 Ga0496126_0002082_5777_6409 209
478 3300050512 nmdc:mga0n895_277153_c1 nmdc:mga0n895_277153_c1_508_1164 209
479 3300050513 nmdc:mga0rr50_215952_c1 nmdc:mga0rr50_215952_c1_51_719 209
480 3300050513 nmdc:mga0rr50_437874_c1 nmdc:mga0rr50_437874_c1_384_1025 209
481 3300050513 nmdc:mga0rr50_517934_c1 nmdc:mga0rr50_517934_c1_60_701 209
482 3300050513 nmdc:mga0rr50_73583_c1 nmdc:mga0rr50_73583_c1_357_1013 209
483 3300050514 nmdc:mga08x19_365_c1 nmdc:mga08x19_365_c1_30786_31454 209
484 3300050514 nmdc:mga08x19_57597_c1 nmdc:mga08x19_57597_c1_637_1296 209
485 3300050515 nmdc:mga0a205_903698_c1 nmdc:mga0a205_903698_c1_27_668 209
486 3300053078 Ga0495612_0000772 Ga0495612_0000772_11843_12484 209
487 3300053085 Ga0495619_0130096 Ga0495619_0130096_514_1167 209
488 3300059645 Ga0587076_017558 Ga0587076_017558_52_681 209
489 iso_pu_bacteria 2537561836 2538834132 209
490 iso_pu_bacteria 2643221562 2643829524 209
491 iso_pu_bacteria 2643221577 2643895221 209
492 iso_pu_bacteria 2643221685 2644477380 209
493 iso_pu_bacteria 2687453130 2687584041 209
494 iso_pu_bacteria 2739367700 2739732124 209
495 iso_pu_bacteria 2884411467 2884413728 209
496 iso_pu_bacteria 2928963466 2928964822 209
497 3300005434 Ga0070709_10160955 Ga0070709_101609552 210
498 3300005436 Ga0070713_100103997 Ga0070713_1001039973 210
499 3300005437 Ga0070710_10071767 Ga0070710_100717672 210
500 3300005439 Ga0070711_100397777 Ga0070711_1003977772 210
501 3300005471 Ga0070698_100363463 Ga0070698_1003634632 210
502 3300006173 Ga0070716_100198374 Ga0070716_1001983742 210
503 3300007265 Ga0099794_10132618 Ga0099794_101326181 210
504 3300007788 Ga0099795_10030595 Ga0099795_100305953 210
505 3300009094 Ga0111539_10344664 Ga0111539_103446642 210
506 3300010159 Ga0099796_10027098 Ga0099796_100270982 210
507 3300014968 Ga0157379_10168013 Ga0157379_101680133 210
508 3300025906 Ga0207699_10170900 Ga0207699_101709002 210
509 3300025915 Ga0207693_10280409 Ga0207693_102804092 210
510 3300025916 Ga0207663_10275735 Ga0207663_102757352 210
511 3300025922 Ga0207646_10730209 Ga0207646_107302091 210
512 3300025928 Ga0207700_10180340 Ga0207700_101803402 210
513 3300025939 Ga0207665_10052220 Ga0207665_100522204 210
514 3300025939 Ga0207665_10215796 Ga0207665_102157961 210
515 3300031090 Ga0265760_10004278 Ga0265760_100042783 210
516 3300033528 Ga0316588_1000021 Ga0316588_100002121 210
517 3300039062 Ga0400483_047654 Ga0400483_047654_7081_7716 210
518 3300039062 Ga0400483_168849 Ga0400483_168849_22968_23603 210
519 3300046511 Ga0495608_0024720 Ga0495608_0024720_1794_2450 210
520 3300046516 Ga0495628_0017722 Ga0495628_0017722_5247_5903 210
521 3300046517 Ga0495630_0088337 Ga0495630_0088337_271_927 210
522 3300046675 Ga0495657_0058966 Ga0495657_0058966_451_1107 210
523 3300046680 Ga0495646_0118500 Ga0495646_0118500_121_777 210
524 3300047319 Ga0495674_0184395 Ga0495674_0184395_540_1196 210
525 3300047471 Ga0495684_0010523 Ga0495684_0010523_5973_6629 210
526 3300060346 Ga0587111_0101286 Ga0587111_0101286_31_669 210
527 3300003187 JGI25151J46595_10007643 JGI25151J46595_100076434 212
528 3300003187 JGI25151J46595_10013580 JGI25151J46595_100135804 212
529 3300003771 Ga0055526_1008536 Ga0055526_10085362 212
530 3300003771 Ga0055526_1008987 Ga0055526_10089872 212
531 3300003773 Ga0055537_1001096 Ga0055537_10010962 212
532 3300003775 Ga0055524_1013602 Ga0055524_10136022 212
533 3300003775 Ga0055524_1015666 Ga0055524_10156664 212
534 3300003781 Ga0055536_1024081 Ga0055536_10240812 212
535 3300003784 Ga0055534_1003331 Ga0055534_10033318 212
536 3300003784 Ga0055534_1006907 Ga0055534_10069074 212
537 3300003790 Ga0055528_1013611 Ga0055528_10136114 212
538 3300003790 Ga0055528_1016393 Ga0055528_10163932 212
539 3300003791 Ga0055530_10004966 Ga0055530_100049664 212
540 3300003794 Ga0055531_10017875 Ga0055531_100178754 212
541 3300005353 Ga0070669_100222301 Ga0070669_1002223012 212
542 3300009093 Ga0105240_10054178 Ga0105240_100541785 212
543 3300009177 Ga0105248_10280233 Ga0105248_102802332 212
544 3300012495 Ga0157323_1003136 Ga0157323_10031362 212
545 3300015689 Ga0183360_10001 Ga0183360_100012728 212
546 3300025245 Ga0207425_1039535 Ga0207425_10395352 212
547 3300025263 Ga0209565_1000001 Ga0209565_10000011145 212
548 3300025263 Ga0209565_1037789 Ga0209565_10377892 212
549 3300025273 Ga0209673_1000001 Ga0209673_10000011145 212
550 3300025273 Ga0209673_1002116 Ga0209673_100211625 212
551 3300025291 Ga0209675_1000001 Ga0209675_10000011388 212
552 3300025291 Ga0209675_1006904 Ga0209675_10069047 212
553 3300025292 Ga0209676_1001608 Ga0209676_100160831 212
554 3300025292 Ga0209676_1004892 Ga0209676_10048922 212
555 3300025294 Ga0209025_1122127 Ga0209025_11221271 212
556 3300025295 Ga0209564_1000001 Ga0209564_10000011550 212
557 3300025295 Ga0209564_1007141 Ga0209564_100714111 212
558 3300025298 Ga0209050_1001128 Ga0209050_100112840 212
559 3300025299 Ga0209256_1000002 Ga0209256_10000023 212
560 3300025299 Ga0209256_1003821 Ga0209256_10038213 212
561 3300025304 Ga0209257_1006382 Ga0209257_100638217 212
562 3300031548 Ga0307408_100110780 Ga0307408_1001107802 212
563 3300031824 Ga0307413_10837432 Ga0307413_108374321 212
564 3300031901 Ga0307406_10093487 Ga0307406_100934872 212
565 3300031911 Ga0307412_10028293 Ga0307412_100282937 212
566 3300032002 Ga0307416_100079046 Ga0307416_1000790464 212
567 3300042876 Ga0451577_0127243 Ga0451577_0127243_326_979 212
568 3300048924 Ga0496121_0005001 Ga0496121_0005001_15934_16587 212
569 3300049161 Ga0501305_007127 Ga0501305_007127_173_826 212
570 3300049162 Ga0501307_008447 Ga0501307_008447_175_828 212
571 3300049162 Ga0501307_030725 Ga0501307_030725_31_708 212
572 3300049579 Ga0501043_0030616 Ga0501043_0030616_2752_3405 212
573 iso_pu_bacteria 2941489479 2941490077 212
574 iso_pu_bacteria 2995948881 2995950363 212
575 iso_pu_bacteria 8003014200 8003015003 212
576 3300001904 JGI24736J21556_1002754 JGI24736J21556_10027546 213
577 3300001904 JGI24736J21556_1003768 JGI24736J21556_10037684 213
578 3300001904 JGI24736J21556_1023445 JGI24736J21556_10234451 213
579 3300001915 JGI24741J21665_1004451 JGI24741J21665_10044512 213
580 3300001915 JGI24741J21665_1004493 JGI24741J21665_10044933 213
581 3300001915 JGI24741J21665_1008247 JGI24741J21665_10082473 213
582 3300001915 JGI24741J21665_1018685 JGI24741J21665_10186852 213
583 3300001979 JGI24740J21852_10003737 JGI24740J21852_1000373713 213
584 3300001979 JGI24740J21852_10006264 JGI24740J21852_100062643 213
585 3300001979 JGI24740J21852_10012232 JGI24740J21852_100122322 213
586 3300002705 JGI25156J39149_1002085 JGI25156J39149_100208513 213
587 3300002737 JGI25162J39368_1003895 JGI25162J39368_10038952 213
588 3300002737 JGI25162J39368_1007773 JGI25162J39368_10077732 213
589 3300002741 JGI25157J39369_1001153 JGI25157J39369_10011533 213
590 3300002741 JGI25157J39369_1002044 JGI25157J39369_10020443 213
591 3300003756 Ga0055533_1002319 Ga0055533_10023192 213
592 3300003760 Ga0055527_1004862 Ga0055527_10048623 213
593 3300003762 Ga0055542_1003848 Ga0055542_10038486 213
594 3300004798 Ga0058859_11760642 Ga0058859_117606422 213
595 3300004799 Ga0058863_10021952 Ga0058863_100219522 213
596 3300004799 Ga0058863_10051910 Ga0058863_100519102 213
597 3300004800 Ga0058861_10029892 Ga0058861_100298922 213
598 3300004801 Ga0058860_10137024 Ga0058860_101370246 213
599 3300004803 Ga0058862_10121056 Ga0058862_101210562 213
600 3300005262 Ga0065165_1033037 Ga0065165_10330373 213
601 3300005327 Ga0070658_10062591 Ga0070658_100625912 213
602 3300005327 Ga0070658_10253456 Ga0070658_102534562 213
603 3300005328 Ga0070676_10011569 Ga0070676_100115692 213
604 3300005329 Ga0070683_100091777 Ga0070683_1000917773 213
605 3300005329 Ga0070683_100337298 Ga0070683_1003372982 213
606 3300005330 Ga0070690_100108195 Ga0070690_1001081952 213
607 3300005331 Ga0070670_100213118 Ga0070670_1002131182 213
608 3300005335 Ga0070666_10062032 Ga0070666_100620322 213
609 3300005335 Ga0070666_10267214 Ga0070666_102672141 213
610 3300005336 Ga0070680_100131473 Ga0070680_1001314733 213
611 3300005336 Ga0070680_100135391 Ga0070680_1001353913 213
612 3300005336 Ga0070680_100450980 Ga0070680_1004509802 213
613 3300005337 Ga0070682_100031926 Ga0070682_1000319262 213
614 3300005337 Ga0070682_100040504 Ga0070682_1000405041 213
615 3300005337 Ga0070682_100141710 Ga0070682_1001417103 213
616 3300005337 Ga0070682_100155304 Ga0070682_1001553043 213
617 3300005337 Ga0070682_100374660 Ga0070682_1003746602 213
618 3300005339 Ga0070660_100123626 Ga0070660_1001236263 213
619 3300005339 Ga0070660_100244093 Ga0070660_1002440932 213
620 3300005339 Ga0070660_100398730 Ga0070660_1003987301 213
621 3300005339 Ga0070660_100541817 Ga0070660_1005418172 213
622 3300005340 Ga0070689_100041431 Ga0070689_1000414315 213
623 3300005341 Ga0070691_10019986 Ga0070691_100199864 213
624 3300005341 Ga0070691_10048275 Ga0070691_100482753 213
625 3300005344 Ga0070661_100015281 Ga0070661_1000152819 213
626 3300005344 Ga0070661_100042481 Ga0070661_1000424813 213
627 3300005344 Ga0070661_100138082 Ga0070661_1001380823 213
628 3300005344 Ga0070661_100169084 Ga0070661_1001690842 213
629 3300005344 Ga0070661_100187257 Ga0070661_1001872571 213
630 3300005344 Ga0070661_100369076 Ga0070661_1003690762 213
631 3300005344 Ga0070661_100699554 Ga0070661_1006995541 213
632 3300005344 Ga0070661_100749257 Ga0070661_1007492571 213
633 3300005345 Ga0070692_10007700 Ga0070692_100077008 213
634 3300005345 Ga0070692_10056065 Ga0070692_100560652 213
635 3300005345 Ga0070692_10087946 Ga0070692_100879463 213
636 3300005347 Ga0070668_100014103 Ga0070668_1000141034 213
637 3300005347 Ga0070668_100348368 Ga0070668_1003483682 213
638 3300005353 Ga0070669_100006246 Ga0070669_1000062464 213
639 3300005353 Ga0070669_100564161 Ga0070669_1005641611 213
640 3300005354 Ga0070675_100638971 Ga0070675_1006389712 213
641 3300005355 Ga0070671_100288936 Ga0070671_1002889362 213
642 3300005355 Ga0070671_100322516 Ga0070671_1003225162 213
643 3300005356 Ga0070674_100279417 Ga0070674_1002794172 213
644 3300005364 Ga0070673_100109100 Ga0070673_1001091004 213
645 3300005365 Ga0070688_100171238 Ga0070688_1001712382 213
646 3300005366 Ga0070659_100160932 Ga0070659_1001609323 213
647 3300005366 Ga0070659_100173711 Ga0070659_1001737113 213
648 3300005366 Ga0070659_100191871 Ga0070659_1001918712 213
649 3300005366 Ga0070659_100219319 Ga0070659_1002193193 213
650 3300005366 Ga0070659_100750336 Ga0070659_1007503362 213
651 3300005367 Ga0070667_100074637 Ga0070667_1000746372 213
652 3300005367 Ga0070667_100124452 Ga0070667_1001244524 213
653 3300005367 Ga0070667_100577578 Ga0070667_1005775781 213
654 3300005436 Ga0070713_100008401 Ga0070713_1000084013 213
655 3300005437 Ga0070710_10040859 Ga0070710_100408593 213
656 3300005437 Ga0070710_10268926 Ga0070710_102689262 213
657 3300005439 Ga0070711_100225282 Ga0070711_1002252823 213
658 3300005455 Ga0070663_100036599 Ga0070663_1000365992 213
659 3300005455 Ga0070663_100112513 Ga0070663_1001125132 213
660 3300005455 Ga0070663_100220345 Ga0070663_1002203452 213
661 3300005456 Ga0070678_100007039 Ga0070678_10000703910 213
662 3300005457 Ga0070662_100045686 Ga0070662_1000456866 213
663 3300005457 Ga0070662_100109776 Ga0070662_1001097761 213
664 3300005457 Ga0070662_100390820 Ga0070662_1003908202 213
665 3300005458 Ga0070681_10072551 Ga0070681_100725516 213
666 3300005458 Ga0070681_10107230 Ga0070681_101072304 213
667 3300005458 Ga0070681_10150874 Ga0070681_101508743 213
668 3300005459 Ga0068867_100135873 Ga0068867_1001358732 213
669 3300005530 Ga0070679_100178793 Ga0070679_1001787933 213
670 3300005530 Ga0070679_100184276 Ga0070679_1001842763 213
671 3300005530 Ga0070679_100881218 Ga0070679_1008812181 213
672 3300005535 Ga0070684_100050987 Ga0070684_1000509875 213
673 3300005535 Ga0070684_100083757 Ga0070684_1000837572 213
674 3300005535 Ga0070684_100088026 Ga0070684_1000880264 213
675 3300005539 Ga0068853_100029334 Ga0068853_1000293347 213
676 3300005539 Ga0068853_100035785 Ga0068853_1000357857 213
677 3300005539 Ga0068853_100146241 Ga0068853_1001462412 213
678 3300005539 Ga0068853_100155319 Ga0068853_1001553192 213
679 3300005546 Ga0070696_100124730 Ga0070696_1001247303 213
680 3300005546 Ga0070696_100128219 Ga0070696_1001282191 213
681 3300005546 Ga0070696_100141842 Ga0070696_1001418423 213
682 3300005546 Ga0070696_100153761 Ga0070696_1001537612 213
683 3300005547 Ga0070693_100091903 Ga0070693_1000919032 213
684 3300005548 Ga0070665_100000175 Ga0070665_100000175112 213
685 3300005548 Ga0070665_100105834 Ga0070665_1001058343 213
686 3300005563 Ga0068855_100231949 Ga0068855_1002319492 213
687 3300005563 Ga0068855_100258994 Ga0068855_1002589944 213
688 3300005564 Ga0070664_100100832 Ga0070664_1001008322 213
689 3300005564 Ga0070664_100443888 Ga0070664_1004438882 213
690 3300005577 Ga0068857_100003667 Ga0068857_1000036673 213
691 3300005577 Ga0068857_100087151 Ga0068857_1000871514 213
692 3300005577 Ga0068857_100175464 Ga0068857_1001754643 213
693 3300005578 Ga0068854_100104882 Ga0068854_1001048823 213
694 3300005578 Ga0068854_100161998 Ga0068854_1001619982 213
695 3300005578 Ga0068854_100221682 Ga0068854_1002216822 213
696 3300005578 Ga0068854_100265326 Ga0068854_1002653262 213
697 3300005578 Ga0068854_100415343 Ga0068854_1004153432 213
698 3300005614 Ga0068856_100004797 Ga0068856_1000047973 213
699 3300005614 Ga0068856_100184419 Ga0068856_1001844192 213
700 3300005614 Ga0068856_100192491 Ga0068856_1001924913 213
701 3300005614 Ga0068856_100211399 Ga0068856_1002113992 213
702 3300005614 Ga0068856_100354244 Ga0068856_1003542442 213
703 3300005614 Ga0068856_100459289 Ga0068856_1004592892 213
704 3300005616 Ga0068852_100031217 Ga0068852_1000312177 213
705 3300005616 Ga0068852_100151291 Ga0068852_1001512913 213
706 3300005616 Ga0068852_100156348 Ga0068852_1001563483 213
707 3300005616 Ga0068852_100370010 Ga0068852_1003700101 213
708 3300005617 Ga0068859_100122263 Ga0068859_1001222633 213
709 3300005618 Ga0068864_100168714 Ga0068864_1001687143 213
710 3300005618 Ga0068864_100479567 Ga0068864_1004795672 213
711 3300005719 Ga0068861_100050727 Ga0068861_1000507274 213
712 3300005719 Ga0068861_100503022 Ga0068861_1005030222 213
713 3300005834 Ga0068851_10014017 Ga0068851_100140177 213
714 3300005834 Ga0068851_10118794 Ga0068851_101187942 213
715 3300005834 Ga0068851_10129468 Ga0068851_101294682 213
716 3300005841 Ga0068863_100100973 Ga0068863_1001009734 213
717 3300005842 Ga0068858_100068753 Ga0068858_1000687534 213
718 3300005842 Ga0068858_100075141 Ga0068858_1000751415 213
719 3300005843 Ga0068860_100426956 Ga0068860_1004269563 213
720 3300005844 Ga0068862_100164162 Ga0068862_1001641623 213
721 3300005983 Ga0081540_1000720 Ga0081540_100072010 213
722 3300006175 Ga0070712_100055854 Ga0070712_1000558544 213
723 3300006358 Ga0068871_100100892 Ga0068871_1001008924 213
724 3300006358 Ga0068871_100436173 Ga0068871_1004361732 213
725 3300006931 Ga0097620_100122253 Ga0097620_1001222533 213
726 3300009093 Ga0105240_10113841 Ga0105240_101138416 213
727 3300009093 Ga0105240_10270922 Ga0105240_102709222 213
728 3300009093 Ga0105240_10274138 Ga0105240_102741382 213
729 3300009101 Ga0105247_10014280 Ga0105247_100142802 213
730 3300009177 Ga0105248_10241422 Ga0105248_102414223 213
731 3300009545 Ga0105237_10051347 Ga0105237_100513473 213
732 3300009545 Ga0105237_10073900 Ga0105237_100739005 213
733 3300009545 Ga0105237_10167989 Ga0105237_101679892 213
734 3300009545 Ga0105237_10239616 Ga0105237_102396162 213
735 3300009551 Ga0105238_10022011 Ga0105238_1002201113 213
736 3300009551 Ga0105238_10067600 Ga0105238_100676004 213
737 3300009551 Ga0105238_10145294 Ga0105238_101452943 213
738 3300009551 Ga0105238_10361347 Ga0105238_103613472 213
739 3300009551 Ga0105238_10494909 Ga0105238_104949092 213
740 3300010375 Ga0105239_10141288 Ga0105239_101412883 213
741 3300010375 Ga0105239_10244795 Ga0105239_102447953 213
742 3300010375 Ga0105239_10280538 Ga0105239_102805383 213
743 3300011119 Ga0105246_10140293 Ga0105246_101402933 213
744 3300013100 Ga0157373_10037570 Ga0157373_100375706 213
745 3300013100 Ga0157373_10087027 Ga0157373_100870274 213
746 3300013100 Ga0157373_10133595 Ga0157373_101335952 213
747 3300013100 Ga0157373_10244996 Ga0157373_102449962 213
748 3300013102 Ga0157371_10042032 Ga0157371_100420325 213
749 3300013102 Ga0157371_10045126 Ga0157371_100451263 213
750 3300013102 Ga0157371_10118940 Ga0157371_101189403 213
751 3300013102 Ga0157371_10146760 Ga0157371_101467603 213
752 3300013104 Ga0157370_10069149 Ga0157370_100691493 213
753 3300013104 Ga0157370_10073111 Ga0157370_100731112 213
754 3300013104 Ga0157370_10163772 Ga0157370_101637723 213
755 3300013104 Ga0157370_10450952 Ga0157370_104509522 213
756 3300013105 Ga0157369_10036937 Ga0157369_100369373 213
757 3300013105 Ga0157369_10107916 Ga0157369_101079164 213
758 3300013105 Ga0157369_10179013 Ga0157369_101790133 213
759 3300013105 Ga0157369_10269476 Ga0157369_102694763 213
760 3300013105 Ga0157369_10506063 Ga0157369_105060632 213
761 3300013307 Ga0157372_10045136 Ga0157372_100451363 213
762 3300013307 Ga0157372_10082823 Ga0157372_100828233 213
763 3300013307 Ga0157372_10157288 Ga0157372_101572883 213
764 3300013307 Ga0157372_10257410 Ga0157372_102574103 213
765 3300013307 Ga0157372_10484226 Ga0157372_104842262 213
766 3300013307 Ga0157372_11119375 Ga0157372_111193752 213
767 3300013307 Ga0157372_11559379 Ga0157372_115593791 213
768 3300014325 Ga0163163_10643802 Ga0163163_106438022 213
769 3300014497 Ga0182008_10077601 Ga0182008_100776013 213
770 3300014497 Ga0182008_10185021 Ga0182008_101850212 213
771 3300014969 Ga0157376_10254964 Ga0157376_102549643 213
772 3300015262 Ga0182007_10134052 Ga0182007_101340522 213
773 3300015687 Ga0183368_1002 Ga0183368_1002396 213
774 3300019177 Ga0184592_126085 Ga0184592_1260852 213
775 3300020069 Ga0197907_10947378 Ga0197907_109473783 213
776 3300020069 Ga0197907_11264123 Ga0197907_112641231 213
777 3300020070 Ga0206356_10069576 Ga0206356_100695762 213
778 3300020070 Ga0206356_10171056 Ga0206356_101710563 213
779 3300020070 Ga0206356_10966620 Ga0206356_109666203 213
780 3300020070 Ga0206356_11482326 Ga0206356_114823262 213
781 3300020075 Ga0206349_1346577 Ga0206349_13465772 213
782 3300020076 Ga0206355_1347985 Ga0206355_13479853 213
783 3300020076 Ga0206355_1657004 Ga0206355_16570042 213
784 3300020077 Ga0206351_10247550 Ga0206351_102475503 213
785 3300020078 Ga0206352_11092907 Ga0206352_110929072 213
786 3300020078 Ga0206352_11356790 Ga0206352_113567902 213
787 3300020080 Ga0206350_10601137 Ga0206350_106011373 213
788 3300020081 Ga0206354_10337548 Ga0206354_103375483 213
789 3300020081 Ga0206354_10771806 Ga0206354_107718062 213
790 3300020081 Ga0206354_10919723 Ga0206354_109197235 213
791 3300020082 Ga0206353_10129542 Ga0206353_1012954221 213
792 3300020082 Ga0206353_10294942 Ga0206353_102949428 213
793 3300020082 Ga0206353_11029087 Ga0206353_110290872 213
794 3300020610 Ga0154015_1010654 Ga0154015_10106543 213
795 3300020610 Ga0154015_1416341 Ga0154015_14163412 213
796 3300022467 Ga0224712_10013385 Ga0224712_100133852 213
797 3300022467 Ga0224712_10021892 Ga0224712_100218922 213
798 3300022467 Ga0224712_10027027 Ga0224712_100270274 213
799 3300025206 Ga0209435_101200 Ga0209435_1012003 213
800 3300025206 Ga0209435_106506 Ga0209435_1065062 213
801 3300025226 Ga0209674_100043 Ga0209674_100043364 213
802 3300025226 Ga0209674_102881 Ga0209674_1028815 213
803 3300025228 Ga0209672_102109 Ga0209672_1021097 213
804 3300025231 Ga0207427_100209 Ga0207427_1002093 213
805 3300025231 Ga0207427_104741 Ga0207427_1047411 213
806 3300025233 Ga0209437_100020 Ga0209437_100020623 213
807 3300025233 Ga0209437_100193 Ga0209437_100193108 213
808 3300025242 Ga0209258_104604 Ga0209258_1046042 213
809 3300025250 Ga0209026_1000274 Ga0209026_100027450 213
810 3300025250 Ga0209026_1001271 Ga0209026_10012713 213
811 3300025250 Ga0209026_1006743 Ga0209026_10067434 213
812 3300025254 Ga0209148_1000002 Ga0209148_10000021281 213
813 3300025256 Ga0209759_1010126 Ga0209759_10101263 213
814 3300025256 Ga0209759_1016259 Ga0209759_10162591 213
815 3300025261 Ga0209233_1000020 Ga0209233_10000203 213
816 3300025261 Ga0209233_1000920 Ga0209233_100092025 213
817 3300025261 Ga0209233_1033207 Ga0209233_10332072 213
818 3300025272 Ga0209455_1000095 Ga0209455_100009569 213
819 3300025303 Ga0209051_1037982 Ga0209051_10379822 213
820 3300025315 Ga0207697_10042053 Ga0207697_100420533 213
821 3300025321 Ga0207656_10098242 Ga0207656_100982422 213
822 3300025321 Ga0207656_10105805 Ga0207656_101058052 213
823 3300025898 Ga0207692_10016367 Ga0207692_100163673 213
824 3300025898 Ga0207692_10056387 Ga0207692_100563872 213
825 3300025900 Ga0207710_10034664 Ga0207710_100346644 213
826 3300025904 Ga0207647_10011795 Ga0207647_1001179512 213
827 3300025904 Ga0207647_10012806 Ga0207647_100128068 213
828 3300025904 Ga0207647_10013393 Ga0207647_1001339311 213
829 3300025904 Ga0207647_10041903 Ga0207647_100419032 213
830 3300025904 Ga0207647_10047348 Ga0207647_100473484 213
831 3300025904 Ga0207647_10071130 Ga0207647_100711303 213
832 3300025904 Ga0207647_10094179 Ga0207647_100941793 213
833 3300025907 Ga0207645_10006593 Ga0207645_100065934 213
834 3300025909 Ga0207705_10004273 Ga0207705_100042733 213
835 3300025909 Ga0207705_10008046 Ga0207705_100080463 213
836 3300025909 Ga0207705_10031780 Ga0207705_100317804 213
837 3300025909 Ga0207705_10034450 Ga0207705_100344503 213
838 3300025909 Ga0207705_10189107 Ga0207705_101891072 213
839 3300025911 Ga0207654_10061667 Ga0207654_100616672 213
840 3300025911 Ga0207654_10144552 Ga0207654_101445523 213
841 3300025912 Ga0207707_10000210 Ga0207707_100002103 213
842 3300025912 Ga0207707_10001339 Ga0207707_100013393 213
843 3300025912 Ga0207707_10018111 Ga0207707_100181112 213
844 3300025912 Ga0207707_10025201 Ga0207707_100252013 213
845 3300025912 Ga0207707_10051492 Ga0207707_100514924 213
846 3300025912 Ga0207707_10052498 Ga0207707_100524986 213
847 3300025913 Ga0207695_10000818 Ga0207695_1000081847 213
848 3300025913 Ga0207695_10006299 Ga0207695_100062993 213
849 3300025913 Ga0207695_10008130 Ga0207695_100081308 213
850 3300025913 Ga0207695_10068969 Ga0207695_100689696 213
851 3300025913 Ga0207695_10073537 Ga0207695_100735373 213
852 3300025913 Ga0207695_10148552 Ga0207695_101485522 213
853 3300025913 Ga0207695_10312640 Ga0207695_103126402 213
854 3300025914 Ga0207671_10028839 Ga0207671_100288393 213
855 3300025914 Ga0207671_10054495 Ga0207671_100544952 213
856 3300025914 Ga0207671_10269984 Ga0207671_102699843 213
857 3300025915 Ga0207693_10134099 Ga0207693_101340992 213
858 3300025917 Ga0207660_10014060 Ga0207660_100140603 213
859 3300025917 Ga0207660_10036194 Ga0207660_100361943 213
860 3300025917 Ga0207660_10105351 Ga0207660_101053513 213
861 3300025917 Ga0207660_10119378 Ga0207660_101193783 213
862 3300025917 Ga0207660_10368253 Ga0207660_103682532 213
863 3300025919 Ga0207657_10055348 Ga0207657_100553483 213
864 3300025919 Ga0207657_10070713 Ga0207657_100707133 213
865 3300025919 Ga0207657_10124909 Ga0207657_101249093 213
866 3300025919 Ga0207657_10128163 Ga0207657_101281633 213
867 3300025919 Ga0207657_10200956 Ga0207657_102009561 213
868 3300025920 Ga0207649_10002213 Ga0207649_100022133 213
869 3300025920 Ga0207649_10015259 Ga0207649_100152593 213
870 3300025920 Ga0207649_10024587 Ga0207649_100245872 213
871 3300025920 Ga0207649_10047910 Ga0207649_100479104 213
872 3300025920 Ga0207649_10065071 Ga0207649_100650712 213
873 3300025921 Ga0207652_10048121 Ga0207652_100481216 213
874 3300025921 Ga0207652_10053020 Ga0207652_100530203 213
875 3300025921 Ga0207652_10147343 Ga0207652_101473433 213
876 3300025921 Ga0207652_10156736 Ga0207652_101567363 213
877 3300025923 Ga0207681_10105252 Ga0207681_101052522 213
878 3300025924 Ga0207694_10028197 Ga0207694_100281973 213
879 3300025924 Ga0207694_10088183 Ga0207694_100881834 213
880 3300025924 Ga0207694_10119803 Ga0207694_101198033 213
881 3300025924 Ga0207694_10160368 Ga0207694_101603682 213
882 3300025924 Ga0207694_10714487 Ga0207694_107144872 213
883 3300025925 Ga0207650_10286074 Ga0207650_102860743 213
884 3300025927 Ga0207687_10481145 Ga0207687_104811452 213
885 3300025928 Ga0207700_10116306 Ga0207700_101163063 213
886 3300025928 Ga0207700_10737458 Ga0207700_107374582 213
887 3300025929 Ga0207664_10001884 Ga0207664_100018843 213
888 3300025931 Ga0207644_10089389 Ga0207644_100893892 213
889 3300025931 Ga0207644_10090873 Ga0207644_100908734 213
890 3300025932 Ga0207690_10000291 Ga0207690_1000029129 213
891 3300025932 Ga0207690_10003289 Ga0207690_100032893 213
892 3300025932 Ga0207690_10222034 Ga0207690_102220342 213
893 3300025932 Ga0207690_10227720 Ga0207690_102277202 213
894 3300025932 Ga0207690_10670980 Ga0207690_106709801 213
895 3300025932 Ga0207690_10809951 Ga0207690_108099511 213
896 3300025933 Ga0207706_10015708 Ga0207706_100157081 213
897 3300025933 Ga0207706_10100114 Ga0207706_101001143 213
898 3300025933 Ga0207706_10107956 Ga0207706_101079564 213
899 3300025933 Ga0207706_10319011 Ga0207706_103190112 213
900 3300025934 Ga0207686_10333629 Ga0207686_103336292 213
901 3300025939 Ga0207665_10101234 Ga0207665_101012343 213
902 3300025942 Ga0207689_10020406 Ga0207689_100204064 213
903 3300025942 Ga0207689_10136777 Ga0207689_101367773 213
904 3300025944 Ga0207661_10004252 Ga0207661_100042523 213
905 3300025944 Ga0207661_10058973 Ga0207661_100589733 213
906 3300025944 Ga0207661_10273592 Ga0207661_102735922 213
907 3300025944 Ga0207661_10648918 Ga0207661_106489181 213
908 3300025945 Ga0207679_10025524 Ga0207679_100255247 213
909 3300025945 Ga0207679_10425174 Ga0207679_104251742 213
910 3300025949 Ga0207667_10008758 Ga0207667_1000875823 213
911 3300025949 Ga0207667_10010803 Ga0207667_100108033 213
912 3300025949 Ga0207667_10053962 Ga0207667_100539623 213
913 3300025949 Ga0207667_10072769 Ga0207667_100727693 213
914 3300025949 Ga0207667_10095216 Ga0207667_100952164 213
915 3300025949 Ga0207667_10119954 Ga0207667_101199542 213
916 3300025949 Ga0207667_10193768 Ga0207667_101937682 213
917 3300025960 Ga0207651_10066649 Ga0207651_100666492 213
918 3300025972 Ga0207668_10075782 Ga0207668_100757823 213
919 3300025972 Ga0207668_10187878 Ga0207668_101878782 213
920 3300025972 Ga0207668_10423728 Ga0207668_104237282 213
921 3300025981 Ga0207640_10002025 Ga0207640_1000202521 213
922 3300025981 Ga0207640_10003058 Ga0207640_100030583 213
923 3300025981 Ga0207640_10025408 Ga0207640_100254083 213
924 3300025981 Ga0207640_10026008 Ga0207640_100260083 213
925 3300025981 Ga0207640_10513033 Ga0207640_105130332 213
926 3300025981 Ga0207640_10559495 Ga0207640_105594952 213
927 3300025986 Ga0207658_10028034 Ga0207658_100280347 213
928 3300025986 Ga0207658_10106388 Ga0207658_101063882 213
929 3300026023 Ga0207677_10345942 Ga0207677_103459422 213
930 3300026035 Ga0207703_10205239 Ga0207703_102052393 213
931 3300026041 Ga0207639_10016511 Ga0207639_100165119 213
932 3300026041 Ga0207639_10029641 Ga0207639_100296413 213
933 3300026041 Ga0207639_10047428 Ga0207639_100474286 213
934 3300026041 Ga0207639_10125486 Ga0207639_101254863 213
935 3300026041 Ga0207639_10452119 Ga0207639_104521192 213
936 3300026067 Ga0207678_10016758 Ga0207678_100167582 213
937 3300026067 Ga0207678_10049236 Ga0207678_100492366 213
938 3300026067 Ga0207678_10055028 Ga0207678_100550283 213
939 3300026067 Ga0207678_10137839 Ga0207678_101378393 213
940 3300026067 Ga0207678_10271783 Ga0207678_102717832 213
941 3300026067 Ga0207678_10729632 Ga0207678_107296322 213
942 3300026078 Ga0207702_10000852 Ga0207702_1000085218 213
943 3300026078 Ga0207702_10011901 Ga0207702_1001190114 213
944 3300026078 Ga0207702_10012283 Ga0207702_1001228314 213
945 3300026078 Ga0207702_10074823 Ga0207702_100748233 213
946 3300026078 Ga0207702_10091382 Ga0207702_100913823 213
947 3300026078 Ga0207702_10161689 Ga0207702_101616892 213
948 3300026078 Ga0207702_10375412 Ga0207702_103754122 213
949 3300026088 Ga0207641_10183031 Ga0207641_101830313 213
950 3300026089 Ga0207648_10168415 Ga0207648_101684153 213
951 3300026095 Ga0207676_10162686 Ga0207676_101626862 213
952 3300026095 Ga0207676_10285849 Ga0207676_102858493 213
953 3300026116 Ga0207674_10001554 Ga0207674_100015542 213
954 3300026116 Ga0207674_10017287 Ga0207674_100172873 213
955 3300026116 Ga0207674_10059241 Ga0207674_100592414 213
956 3300026116 Ga0207674_10111246 Ga0207674_101112463 213
957 3300026116 Ga0207674_10142271 Ga0207674_101422714 213
958 3300026118 Ga0207675_100106837 Ga0207675_1001068372 213
959 3300026118 Ga0207675_100774282 Ga0207675_1007742822 213
960 3300026121 Ga0207683_10023634 Ga0207683_1002363410 213
961 3300026142 Ga0207698_10007267 Ga0207698_100072673 213
962 3300026142 Ga0207698_10038635 Ga0207698_100386356 213
963 3300026142 Ga0207698_10052641 Ga0207698_100526413 213
964 3300026142 Ga0207698_10301744 Ga0207698_103017442 213
965 3300026142 Ga0207698_10705601 Ga0207698_107056011 213
966 3300028379 Ga0268266_10000001 Ga0268266_100000013285 213
967 3300028379 Ga0268266_10100303 Ga0268266_101003033 213
968 3300028380 Ga0268265_10115242 Ga0268265_101152424 213
969 3300028381 Ga0268264_10023204 Ga0268264_100232042 213
970 3300028381 Ga0268264_10121193 Ga0268264_101211933 213
971 3300028786 Ga0307517_10241588 Ga0307517_102415882 213
972 3300030863 Ga0265766_1002482 Ga0265766_10024822 213
973 3300030882 Ga0265764_100381 Ga0265764_1003812 213
974 3300031011 Ga0265774_100076 Ga0265774_1000764 213
975 3300031824 Ga0307413_10146858 Ga0307413_101468582 213
976 3300031995 Ga0307409_100474526 Ga0307409_1004745262 213
977 3300033179 Ga0307507_10270077 Ga0307507_102700772 213
978 3300036458 Ga0310112_000276 Ga0310112_000276_2700_3341 213
979 3300036534 Ga0310109_011090 Ga0310109_011090_387_1028 213
980 3300036535 Ga0310110_004759 Ga0310110_004759_584_1225 213
981 3300037312 Ga0395899_0042216 Ga0395899_0042216_498_1139 213
982 3300037418 Ga0395900_0125348 Ga0395900_0125348_12_653 213
983 3300037418 Ga0395900_0135347 Ga0395900_0135347_1111_1752 213
984 3300037418 Ga0395900_0172278 Ga0395900_0172278_598_1239 213
985 3300037466 Ga0395898_0135016 Ga0395898_0135016_930_1571 213
986 3300037466 Ga0395898_0138563 Ga0395898_0138563_594_1235 213
987 3300038443 Ga0395901_0002939 Ga0395901_0002939_1001_1642 213
988 3300038443 Ga0395901_0218962 Ga0395901_0218962_782_1423 213
989 3300039447 Ga0436361_1002022 Ga0436361_1002022_85_726 213
990 3300042000 Ga0439437_001431 Ga0439437_001431_1319_1960 213
991 3300042012 Ga0439455_0060019 Ga0439455_0060019_218_859 213
992 3300045976 Ga0466967_0743177 Ga0466967_0743177_84_731 213
993 3300048910 Ga0496107_0074215 Ga0496107_0074215_209_856 213
994 3300048916 Ga0496113_0237825 Ga0496113_0237825_593_1234 213
995 3300048917 Ga0496114_0146312 Ga0496114_0146312_378_1025 213
996 3300048918 Ga0496115_0002269 Ga0496115_0002269_12210_12851 213
997 3300048918 Ga0496115_0137021 Ga0496115_0137021_466_1113 213
998 3300048929 Ga0496126_0119779 Ga0496126_0119779_971_1618 213
999 3300049568 Ga0501031_0249142 Ga0501031_0249142_16_657 213
1000 3300049568 Ga0501031_0388182 Ga0501031_0388182_158_799 213
1001 3300049569 Ga0501032_0025237 Ga0501032_0025237_2589_3230 213
1002 3300049569 Ga0501032_0294043 Ga0501032_0294043_78_719 213
1003 3300049570 Ga0501033_0012162 Ga0501033_0012162_5779_6420 213
1004 3300049571 Ga0501034_0056333 Ga0501034_0056333_2804_3445 213
1005 3300049571 Ga0501034_0214299 Ga0501034_0214299_1166_1807 213
1006 3300049571 Ga0501034_0826266 Ga0501034_0826266_62_703 213
1007 3300049572 Ga0501036_0603738 Ga0501036_0603738_171_812 213
1008 3300049573 Ga0501037_0127086 Ga0501037_0127086_938_1585 213
1009 3300049574 Ga0501038_0013134 Ga0501038_0013134_1530_2171 213
1010 3300049574 Ga0501038_0199794 Ga0501038_0199794_571_1212 213
1011 3300049578 Ga0501042_0056670 Ga0501042_0056670_1162_1803 213
1012 3300049578 Ga0501042_0144574 Ga0501042_0144574_803_1450 213
1013 3300049578 Ga0501042_0343336 Ga0501042_0343336_398_1039 213
1014 3300049579 Ga0501043_0269409 Ga0501043_0269409_17_658 213
1015 3300049580 Ga0501046_0034206 Ga0501046_0034206_2334_2975 213
1016 3300049580 Ga0501046_0100330 Ga0501046_0100330_697_1344 213
1017 3300049580 Ga0501046_0113833 Ga0501046_0113833_562_1203 213
1018 3300049580 Ga0501046_0334541 Ga0501046_0334541_425_1066 213
1019 3300049581 Ga0501047_0000250 Ga0501047_0000250_493_1134 213
1020 3300049581 Ga0501047_0103968 Ga0501047_0103968_89_736 213
1021 3300049581 Ga0501047_0188557 Ga0501047_0188557_759_1400 213
1022 3300049581 Ga0501047_0232735 Ga0501047_0232735_563_1204 213
1023 3300049582 Ga0501048_0021518 Ga0501048_0021518_3370_4011 213
1024 3300049582 Ga0501048_0029557 Ga0501048_0029557_2958_3605 213
1025 3300049583 Ga0501067_0015294 Ga0501067_0015294_3118_3765 213
1026 3300049584 Ga0501068_0246210 Ga0501068_0246210_184_831 213
1027 3300049585 Ga0501069_0060151 Ga0501069_0060151_864_1505 213
1028 3300049585 Ga0501069_0109992 Ga0501069_0109992_431_1072 213
1029 3300049586 Ga0501070_0033585 Ga0501070_0033585_3173_3820 213
1030 3300049586 Ga0501070_0036917 Ga0501070_0036917_568_1209 213
1031 3300049586 Ga0501070_0138119 Ga0501070_0138119_575_1216 213
1032 3300049586 Ga0501070_0144521 Ga0501070_0144521_389_1030 213
1033 3300049586 Ga0501070_0162900 Ga0501070_0162900_687_1328 213
1034 3300049587 Ga0501071_0088182 Ga0501071_0088182_906_1553 213
1035 3300049589 Ga0501073_0059390 Ga0501073_0059390_1273_1914 213
1036 3300049589 Ga0501073_0588853 Ga0501073_0588853_42_683 213
1037 3300049590 Ga0501074_0060097 Ga0501074_0060097_1107_1748 213
1038 3300049590 Ga0501074_0148950 Ga0501074_0148950_938_1585 213
1039 3300049590 Ga0501074_0154724 Ga0501074_0154724_42_683 213
1040 3300049592 Ga0501076_0515508 Ga0501076_0515508_82_723 213
1041 3300049741 Ga0501079_0285027 Ga0501079_0285027_400_1047 213
1042 3300049741 Ga0501079_0374970 Ga0501079_0374970_19_660 213
1043 3300049742 Ga0501080_0049719 Ga0501080_0049719_665_1312 213
1044 3300049742 Ga0501080_0062331 Ga0501080_0062331_826_1467 213
1045 3300049742 Ga0501080_0107130 Ga0501080_0107130_1555_2196 213
1046 3300049743 Ga0501081_0073960 Ga0501081_0073960_158_805 213
1047 3300049744 Ga0501083_0057300 Ga0501083_0057300_1717_2364 213
1048 3300049744 Ga0501083_0154216 Ga0501083_0154216_234_875 213
1049 3300049822 Ga0501035_0043368 Ga0501035_0043368_2958_3599 213
1050 3300049822 Ga0501035_0069939 Ga0501035_0069939_535_1176 213
1051 3300049822 Ga0501035_0508787 Ga0501035_0508787_78_719 213
1052 3300049822 Ga0501035_0769091 Ga0501035_0769091_15_656 213
1053 3300049823 Ga0501044_0154438 Ga0501044_0154438_55_696 213
1054 3300049823 Ga0501044_0406799 Ga0501044_0406799_245_892 213
1055 3300049824 Ga0501045_0273922 Ga0501045_0273922_23_664 213
1056 3300053155 Ga0500620_109363 Ga0500620_109363_230_877 213
1057 3300054114 Ga0501084_0245529 Ga0501084_0245529_633_1274 213
1058 3300059492 Ga0587073_0001891 Ga0587073_0001891_582_1223 213
1059 3300059508 Ga0587088_001539 Ga0587088_001539_1155_1796 213
1060 3300059605 Ga0587106_000089 Ga0587106_000089_826_1467 213
1061 3300059623 Ga0587101_006283 Ga0587101_006283_557_1198 213
1062 3300059644 Ga0587075_006913 Ga0587075_006913_207_848 213
1063 3300059647 Ga0587079_003247 Ga0587079_003247_788_1429 213
1064 3300060353 Ga0501082_0146414 Ga0501082_0146414_697_1344 213
1065 3300060353 Ga0501082_0507194 Ga0501082_0507194_367_1008 213
1066 iso_pu_bacteria 2939611941 2939612733 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00297

Ribosomal_L3

Ribosomal protein L3

88

183

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9543 3 212
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9529 3 213
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.943 3 212
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9415 3 213
6pvk-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class a 0.9317 3 212
ID Description Score Start End Superfamily
af_P9WH87_35_101_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9766 35 99 3.30.160.810
af_Q9SKX4_88_148_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.973 35 85 3.30.160.810
af_Q9LIT4_106_169_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9582 35 99 3.30.160.810
af_P60438_33_95_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9485 34 97 3.30.160.810
af_Q54I61_95_160_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9399 33 97 3.30.160.810
ID Description Score Start End GO Terms
AF-A0A812F856-F1-model_v4 It binds directly near the 3'-end of the 23S rRNA 0.9711 3 86 GO:0003735
GO:0006412
GO:0022625
AF-A0A2V6DPT5-F1-model_v4 50S ribosomal protein L3 0.9675 1 86 GO:0003735
GO:0006412
GO:0022625
AF-A0A3B9LAN4-F1-model_v4 50S ribosomal protein L3 0.9623 4 124 GO:0003735
GO:0006412
GO:0022625
AF-A0A447N332-F1-model_v4 50S ribosomal protein L3 0.9597 3 86 GO:0003735
GO:0006412
GO:0022625
AF-A0A485AH68-F1-model_v4 50S ribosomal protein L3 0.9591 3 106 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
80.31 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map