F489406
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1066 | 473 | 1043 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300033527|Ga0316586_1000008|Ga0316586_100000820 |
| Length | 239 |
| Sequence | MKGILGKKLGMTQVFTEDGVQIPVTVVEVTPNVVTQIKTEDKDGYNAVQVAVSDKRVKNTSKSLQGHFDKANTAPKRFVKEFRDFEGADELSVGQELPNIFEVGEIIDVQGISKGKGFQGAIKRHNQRRGPMSHGSRFHRAPGAMGNVQDRRVRKGKLLPGHMGDALTTIQNSQIVAFDAEKSLVLVKGNVPGSNNTFVTLKKSVKTPGKIQEIKVLNFNDAALVGSKNESAEEAGNEE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512564013 | Brevibacillus sp. BC25 | Isolate | Rhizosphere |
| 2 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 3 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 4 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 5 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 6 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 7 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 8 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 9 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 10 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 11 | 2857609550 | Domibacillus sp. R-71929 | Isolate | Unclassified |
| 12 | 2881644220 | Siminovitchia terrae LMG 29736 | Isolate | Rhizosphere |
| 13 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 14 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 15 | 2915597211 | Brevibacillus brevis Ag35 | Isolate | Nodule |
| 16 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 17 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 18 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 19 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 20 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 21 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 22 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 23 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 24 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 25 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 26 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 27 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 28 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 40 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 44 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 45 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 46 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 47 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 48 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 49 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 70 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 84 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 92 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 98 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 102 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 105 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 106 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 107 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 108 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 109 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 110 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 111 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 112 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 113 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 122 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 123 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 132 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 135 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 147 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 148 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 149 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300019177 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 155 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 162 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 175 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 246 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300031011 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 252 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 253 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 254 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 255 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 256 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 257 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 258 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 259 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 260 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 261 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 262 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 263 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 268 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 269 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 270 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 272 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 275 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 276 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 278 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 279 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 280 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 282 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 283 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 284 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 286 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 287 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 288 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 290 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 291 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 292 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 293 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 294 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 295 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 296 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 297 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 298 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 299 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 300 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 301 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 302 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 303 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 304 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 305 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 306 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 307 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 308 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 309 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 310 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 311 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 312 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 313 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 314 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 315 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 316 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 317 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 366 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 367 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 368 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 369 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 370 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 373 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 374 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 375 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 376 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 377 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 378 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 379 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 380 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 381 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 382 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 383 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 384 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 385 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 386 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 387 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 454 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 455 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 456 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 457 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 458 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 459 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 460 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 461 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 472 | 8007371054 | Clostridium sp. YIM B02515 | Isolate | Unclassified |
| 473 | 8055531788 | Lysinibacillus pakistanensis LY1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.65 |
| Metatranscriptomes | 9.19 |
| Isolates | 2.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.66 |
| Nodule | 0.09 |
| Rhizoplane | 2.25 |
| Rhizosphere | 83.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1002754 | 3300001904 | Bacteria | 3079 |
| 2 | JGI24736J21556_1003768 | 3300001904 | Bacteria | 2612 |
| 3 | JGI24736J21556_1023445 | 3300001904 | Bacteria | 964 |
| 4 | JGI24741J21665_1004451 | 3300001915 | Bacteria | 3103 |
| 5 | JGI24741J21665_1004493 | 3300001915 | Bacteria | 3078 |
| 6 | JGI24741J21665_1004799 | 3300001915 | Bacteria | 2933 |
| 7 | JGI24741J21665_1008247 | 3300001915 | Bacteria | 1973 |
| 8 | JGI24741J21665_1018685 | 3300001915 | Bacteria | 1106 |
| 9 | JGI24740J21852_10003737 | 3300001979 | Bacteria | 6625 |
| 10 | JGI24740J21852_10006264 | 3300001979 | Bacteria | 4944 |
| 11 | JGI24740J21852_10012232 | 3300001979 | Bacteria | 3240 |
| 12 | JGI25156J39149_1002085 | 3300002705 | Bacteria | 7577 |
| 13 | JGI25156J39149_1003296 | 3300002705 | Bacteria | 5346 |
| 14 | JGI25162J39368_1003895 | 3300002737 | Bacteria | 3875 |
| 15 | JGI25162J39368_1007773 | 3300002737 | Bacteria | 1620 |
| 16 | JGI25157J39369_1001153 | 3300002741 | Bacteria | 11428 |
| 17 | JGI25157J39369_1001750 | 3300002741 | Bacteria | 7146 |
| 18 | JGI25157J39369_1002044 | 3300002741 | Bacteria | 5780 |
| 19 | JGI25151J46595_10007643 | 3300003187 | Bacteria | 5275 |
| 20 | JGI25151J46595_10013580 | 3300003187 | Bacteria | 3661 |
| 21 | Ga0055538_1000196 | 3300003751 | Bacteria | 36369 |
| 22 | Ga0055533_1002319 | 3300003756 | Bacteria | 4392 |
| 23 | Ga0055525_1000111 | 3300003759 | Bacteria | 127836 |
| 24 | Ga0055527_1001334 | 3300003760 | Bacteria | 5331 |
| 25 | Ga0055527_1004862 | 3300003760 | Bacteria | 1803 |
| 26 | Ga0055535_1004862 | 3300003761 | Bacteria | 3121 |
| 27 | Ga0055542_1003848 | 3300003762 | Bacteria | 3875 |
| 28 | Ga0055542_1004903 | 3300003762 | Bacteria | 3121 |
| 29 | Ga0055529_1003204 | 3300003763 | Bacteria | 2799 |
| 30 | Ga0055526_1008536 | 3300003771 | Bacteria | 5088 |
| 31 | Ga0055526_1008987 | 3300003771 | Bacteria | 4886 |
| 32 | Ga0055537_1001096 | 3300003773 | Bacteria | 11761 |
| 33 | Ga0055524_1013602 | 3300003775 | Bacteria | 3064 |
| 34 | Ga0055524_1015666 | 3300003775 | Bacteria | 2753 |
| 35 | Ga0055536_1024081 | 3300003781 | Bacteria | 1773 |
| 36 | Ga0055534_1003331 | 3300003784 | Bacteria | 5088 |
| 37 | Ga0055534_1006907 | 3300003784 | Bacteria | 2790 |
| 38 | Ga0055528_1013611 | 3300003790 | Bacteria | 3070 |
| 39 | Ga0055528_1016393 | 3300003790 | Bacteria | 2622 |
| 40 | Ga0055530_10004966 | 3300003791 | Bacteria | 6579 |
| 41 | Ga0055531_10017875 | 3300003794 | Bacteria | 2963 |
| 42 | Ga0058859_11760642 | 3300004798 | Bacteria | 1466 |
| 43 | Ga0058863_10021952 | 3300004799 | Bacteria | 1762 |
| 44 | Ga0058863_10051910 | 3300004799 | Bacteria | 920 |
| 45 | Ga0058861_10029892 | 3300004800 | Bacteria | 2654 |
| 46 | Ga0058860_10137024 | 3300004801 | Bacteria | 3744 |
| 47 | Ga0058862_10121056 | 3300004803 | Bacteria | 1383 |
| 48 | Ga0065165_1033037 | 3300005262 | Bacteria | 1615 |
| 49 | Ga0065707_10183525 | 3300005295 | Bacteria | 1394 |
| 50 | Ga0070658_10062591 | 3300005327 | Bacteria | 3032 |
| 51 | Ga0070658_10253456 | 3300005327 | Bacteria | 1493 |
| 52 | Ga0070658_10424499 | 3300005327 | Bacteria | 1144 |
| 53 | Ga0070676_10011569 | 3300005328 | Bacteria | 4799 |
| 54 | Ga0070683_100091777 | 3300005329 | Bacteria | 2852 |
| 55 | Ga0070683_100337298 | 3300005329 | Bacteria | 1435 |
| 56 | Ga0070690_100108195 | 3300005330 | Bacteria | 1851 |
| 57 | Ga0070670_100213118 | 3300005331 | Bacteria | 1679 |
| 58 | Ga0070666_10062032 | 3300005335 | Bacteria | 2531 |
| 59 | Ga0070666_10267214 | 3300005335 | Bacteria | 1213 |
| 60 | Ga0070680_100024646 | 3300005336 | Bacteria | 4808 |
| 61 | Ga0070680_100126748 | 3300005336 | Bacteria | 2133 |
| 62 | Ga0070680_100131473 | 3300005336 | Bacteria | 2094 |
| 63 | Ga0070680_100135391 | 3300005336 | Bacteria | 2063 |
| 64 | Ga0070680_100450980 | 3300005336 | Bacteria | 1099 |
| 65 | Ga0070682_100031926 | 3300005337 | Bacteria | 3189 |
| 66 | Ga0070682_100040504 | 3300005337 | Bacteria | 2867 |
| 67 | Ga0070682_100141710 | 3300005337 | Bacteria | 1639 |
| 68 | Ga0070682_100155304 | 3300005337 | Bacteria | 1574 |
| 69 | Ga0070682_100374660 | 3300005337 | Bacteria | 1068 |
| 70 | Ga0070660_100123626 | 3300005339 | Bacteria | 2066 |
| 71 | Ga0070660_100244093 | 3300005339 | Bacteria | 1463 |
| 72 | Ga0070660_100398730 | 3300005339 | Bacteria | 1137 |
| 73 | Ga0070660_100541817 | 3300005339 | Bacteria | 970 |
| 74 | Ga0070689_100041431 | 3300005340 | Bacteria | 3535 |
| 75 | Ga0070691_10019986 | 3300005341 | Bacteria | 3091 |
| 76 | Ga0070691_10048275 | 3300005341 | Bacteria | 2025 |
| 77 | Ga0070661_100015281 | 3300005344 | Bacteria | 5418 |
| 78 | Ga0070661_100042481 | 3300005344 | Bacteria | 3318 |
| 79 | Ga0070661_100097541 | 3300005344 | Bacteria | 2182 |
| 80 | Ga0070661_100138082 | 3300005344 | Bacteria | 1835 |
| 81 | Ga0070661_100169084 | 3300005344 | Bacteria | 1659 |
| 82 | Ga0070661_100187257 | 3300005344 | Bacteria | 1577 |
| 83 | Ga0070661_100369076 | 3300005344 | Bacteria | 1129 |
| 84 | Ga0070661_100699554 | 3300005344 | Bacteria | 826 |
| 85 | Ga0070661_100749257 | 3300005344 | Bacteria | 798 |
| 86 | Ga0070692_10007700 | 3300005345 | Bacteria | 4763 |
| 87 | Ga0070692_10056065 | 3300005345 | Bacteria | 2062 |
| 88 | Ga0070692_10087946 | 3300005345 | Bacteria | 1684 |
| 89 | Ga0070692_10124727 | 3300005345 | Bacteria | 1440 |
| 90 | Ga0070668_100014103 | 3300005347 | Bacteria | 5973 |
| 91 | Ga0070668_100348368 | 3300005347 | Bacteria | 1253 |
| 92 | Ga0070669_100006246 | 3300005353 | Bacteria | 8599 |
| 93 | Ga0070669_100222301 | 3300005353 | Bacteria | 1493 |
| 94 | Ga0070669_100564161 | 3300005353 | Bacteria | 950 |
| 95 | Ga0070675_100638971 | 3300005354 | Bacteria | 967 |
| 96 | Ga0070671_100288936 | 3300005355 | Bacteria | 1395 |
| 97 | Ga0070671_100322516 | 3300005355 | Bacteria | 1316 |
| 98 | Ga0070674_100279417 | 3300005356 | Bacteria | 1323 |
| 99 | Ga0070674_100287754 | 3300005356 | Bacteria | 1305 |
| 100 | Ga0070673_100109100 | 3300005364 | Bacteria | 2292 |
| 101 | Ga0070688_100171238 | 3300005365 | Bacteria | 1499 |
| 102 | Ga0070659_100138001 | 3300005366 | Bacteria | 1984 |
| 103 | Ga0070659_100160932 | 3300005366 | Bacteria | 1835 |
| 104 | Ga0070659_100173711 | 3300005366 | Bacteria | 1766 |
| 105 | Ga0070659_100191871 | 3300005366 | Bacteria | 1679 |
| 106 | Ga0070659_100219319 | 3300005366 | Bacteria | 1569 |
| 107 | Ga0070659_100750336 | 3300005366 | Bacteria | 846 |
| 108 | Ga0070667_100074637 | 3300005367 | Bacteria | 2893 |
| 109 | Ga0070667_100124452 | 3300005367 | Bacteria | 2246 |
| 110 | Ga0070667_100577578 | 3300005367 | Bacteria | 1034 |
| 111 | Ga0070709_10000076 | 3300005434 | Bacteria | 74077 |
| 112 | Ga0070709_10034187 | 3300005434 | Bacteria | 3080 |
| 113 | Ga0070709_10160955 | 3300005434 | Bacteria | 1561 |
| 114 | Ga0070713_100008401 | 3300005436 | Bacteria | 7319 |
| 115 | Ga0070713_100020295 | 3300005436 | Bacteria | 5092 |
| 116 | Ga0070713_100037982 | 3300005436 | Bacteria | 3897 |
| 117 | Ga0070713_100103997 | 3300005436 | Bacteria | 2465 |
| 118 | Ga0070710_10040859 | 3300005437 | Bacteria | 2558 |
| 119 | Ga0070710_10071767 | 3300005437 | Bacteria | 1998 |
| 120 | Ga0070710_10268926 | 3300005437 | Bacteria | 1102 |
| 121 | Ga0070711_100001449 | 3300005439 | Bacteria | 13051 |
| 122 | Ga0070711_100007565 | 3300005439 | Bacteria | 6611 |
| 123 | Ga0070711_100225282 | 3300005439 | Bacteria | 1459 |
| 124 | Ga0070711_100397777 | 3300005439 | Bacteria | 1118 |
| 125 | Ga0070705_100127227 | 3300005440 | Bacteria | 1656 |
| 126 | Ga0070694_100058419 | 3300005444 | Bacteria | 2624 |
| 127 | Ga0070708_100035523 | 3300005445 | Bacteria | 4342 |
| 128 | Ga0070708_100311587 | 3300005445 | Bacteria | 1482 |
| 129 | Ga0070708_100318751 | 3300005445 | Bacteria | 1464 |
| 130 | Ga0070663_100036599 | 3300005455 | Bacteria | 3410 |
| 131 | Ga0070663_100112513 | 3300005455 | Bacteria | 2047 |
| 132 | Ga0070663_100155767 | 3300005455 | Bacteria | 1755 |
| 133 | Ga0070663_100199061 | 3300005455 | Bacteria | 1562 |
| 134 | Ga0070663_100220345 | 3300005455 | Bacteria | 1489 |
| 135 | Ga0070678_100007039 | 3300005456 | Bacteria | 6648 |
| 136 | Ga0070662_100045686 | 3300005457 | Bacteria | 3144 |
| 137 | Ga0070662_100109776 | 3300005457 | Bacteria | 2100 |
| 138 | Ga0070662_100390820 | 3300005457 | Bacteria | 1146 |
| 139 | Ga0070681_10038165 | 3300005458 | Bacteria | 4817 |
| 140 | Ga0070681_10072551 | 3300005458 | Bacteria | 3405 |
| 141 | Ga0070681_10107230 | 3300005458 | Bacteria | 2734 |
| 142 | Ga0070681_10150874 | 3300005458 | Bacteria | 2250 |
| 143 | Ga0070681_10164806 | 3300005458 | Bacteria | 2139 |
| 144 | Ga0068867_100135873 | 3300005459 | Bacteria | 1916 |
| 145 | Ga0068867_100200101 | 3300005459 | Bacteria | 1599 |
| 146 | Ga0070706_100119495 | 3300005467 | Bacteria | 2456 |
| 147 | Ga0070707_100192686 | 3300005468 | Bacteria | 1987 |
| 148 | Ga0070698_100361005 | 3300005471 | Bacteria | 1384 |
| 149 | Ga0070698_100363463 | 3300005471 | Bacteria | 1379 |
| 150 | Ga0070699_100023687 | 3300005518 | Bacteria | 5289 |
| 151 | Ga0070679_100019420 | 3300005530 | Bacteria | 6608 |
| 152 | Ga0070679_100040938 | 3300005530 | Bacteria | 4611 |
| 153 | Ga0070679_100178793 | 3300005530 | Bacteria | 2094 |
| 154 | Ga0070679_100184276 | 3300005530 | Bacteria | 2059 |
| 155 | Ga0070679_100881218 | 3300005530 | Bacteria | 838 |
| 156 | Ga0070684_100050987 | 3300005535 | Bacteria | 3595 |
| 157 | Ga0070684_100083757 | 3300005535 | Bacteria | 2826 |
| 158 | Ga0070684_100088026 | 3300005535 | Bacteria | 2758 |
| 159 | Ga0070697_100006091 | 3300005536 | Bacteria | 9330 |
| 160 | Ga0070697_100049282 | 3300005536 | Bacteria | 3418 |
| 161 | Ga0068853_100029334 | 3300005539 | Bacteria | 4636 |
| 162 | Ga0068853_100035785 | 3300005539 | Bacteria | 4219 |
| 163 | Ga0068853_100146241 | 3300005539 | Bacteria | 2124 |
| 164 | Ga0068853_100155319 | 3300005539 | Bacteria | 2061 |
| 165 | Ga0068853_100167153 | 3300005539 | Bacteria | 1988 |
| 166 | Ga0070695_100005390 | 3300005545 | Bacteria | 7529 |
| 167 | Ga0070695_100077726 | 3300005545 | Bacteria | 2187 |
| 168 | Ga0070696_100004505 | 3300005546 | Bacteria | 9299 |
| 169 | Ga0070696_100124730 | 3300005546 | Bacteria | 1867 |
| 170 | Ga0070696_100128219 | 3300005546 | Bacteria | 1843 |
| 171 | Ga0070696_100141842 | 3300005546 | Bacteria | 1757 |
| 172 | Ga0070696_100153761 | 3300005546 | Bacteria | 1690 |
| 173 | Ga0070693_100000494 | 3300005547 | Bacteria | 17601 |
| 174 | Ga0070693_100091903 | 3300005547 | Bacteria | 1831 |
| 175 | Ga0070665_100000175 | 3300005548 | Bacteria | 113874 |
| 176 | Ga0070665_100000700 | 3300005548 | Bacteria | 44692 |
| 177 | Ga0070665_100105834 | 3300005548 | Bacteria | 2815 |
| 178 | Ga0070704_100013476 | 3300005549 | Bacteria | 5075 |
| 179 | Ga0068855_100231949 | 3300005563 | Bacteria | 2066 |
| 180 | Ga0068855_100258994 | 3300005563 | Bacteria | 1938 |
| 181 | Ga0068855_101050573 | 3300005563 | Bacteria | 854 |
| 182 | Ga0070664_100100832 | 3300005564 | Bacteria | 2510 |
| 183 | Ga0070664_100443888 | 3300005564 | Bacteria | 1190 |
| 184 | Ga0068857_100003667 | 3300005577 | Bacteria | 12865 |
| 185 | Ga0068857_100087151 | 3300005577 | Bacteria | 2792 |
| 186 | Ga0068857_100175464 | 3300005577 | Bacteria | 1950 |
| 187 | Ga0068854_100054151 | 3300005578 | Bacteria | 2884 |
| 188 | Ga0068854_100099085 | 3300005578 | Bacteria | 2182 |
| 189 | Ga0068854_100104882 | 3300005578 | Bacteria | 2124 |
| 190 | Ga0068854_100161998 | 3300005578 | Bacteria | 1733 |
| 191 | Ga0068854_100221682 | 3300005578 | Bacteria | 1496 |
| 192 | Ga0068854_100265326 | 3300005578 | Bacteria | 1376 |
| 193 | Ga0068854_100415343 | 3300005578 | Bacteria | 1116 |
| 194 | Ga0068856_100004797 | 3300005614 | Bacteria | 13405 |
| 195 | Ga0068856_100184419 | 3300005614 | Bacteria | 2100 |
| 196 | Ga0068856_100192491 | 3300005614 | Bacteria | 2053 |
| 197 | Ga0068856_100211399 | 3300005614 | Bacteria | 1955 |
| 198 | Ga0068856_100354244 | 3300005614 | Bacteria | 1486 |
| 199 | Ga0068856_100459289 | 3300005614 | Bacteria | 1294 |
| 200 | Ga0070702_100051791 | 3300005615 | Bacteria | 2352 |
| 201 | Ga0068852_100031217 | 3300005616 | Bacteria | 4393 |
| 202 | Ga0068852_100134375 | 3300005616 | Bacteria | 2282 |
| 203 | Ga0068852_100151291 | 3300005616 | Bacteria | 2158 |
| 204 | Ga0068852_100156348 | 3300005616 | Bacteria | 2124 |
| 205 | Ga0068852_100370010 | 3300005616 | Bacteria | 1404 |
| 206 | Ga0068852_100991777 | 3300005616 | Bacteria | 859 |
| 207 | Ga0068859_100122263 | 3300005617 | Bacteria | 2670 |
| 208 | Ga0068859_100678814 | 3300005617 | Bacteria | 1121 |
| 209 | Ga0068864_100168714 | 3300005618 | Bacteria | 1994 |
| 210 | Ga0068864_100479567 | 3300005618 | Bacteria | 1194 |
| 211 | Ga0068861_100050727 | 3300005719 | Bacteria | 3147 |
| 212 | Ga0068861_100503022 | 3300005719 | Bacteria | 1096 |
| 213 | Ga0068851_10014017 | 3300005834 | Bacteria | 3800 |
| 214 | Ga0068851_10118794 | 3300005834 | Bacteria | 1419 |
| 215 | Ga0068851_10129468 | 3300005834 | Bacteria | 1364 |
| 216 | Ga0068863_100012596 | 3300005841 | Bacteria | 8156 |
| 217 | Ga0068863_100100973 | 3300005841 | Bacteria | 2742 |
| 218 | Ga0068858_100068753 | 3300005842 | Bacteria | 3282 |
| 219 | Ga0068858_100075141 | 3300005842 | Bacteria | 3138 |
| 220 | Ga0068860_100426956 | 3300005843 | Bacteria | 1314 |
| 221 | Ga0068862_100164162 | 3300005844 | Bacteria | 1984 |
| 222 | Ga0081540_1000720 | 3300005983 | Bacteria | 30494 |
| 223 | Ga0070717_10659450 | 3300006028 | Bacteria | 950 |
| 224 | Ga0070716_100092179 | 3300006173 | Bacteria | 1836 |
| 225 | Ga0070716_100198374 | 3300006173 | Bacteria | 1332 |
| 226 | Ga0070716_100380441 | 3300006173 | Bacteria | 1009 |
| 227 | Ga0070712_100055854 | 3300006175 | Bacteria | 2767 |
| 228 | Ga0070712_100057688 | 3300006175 | Bacteria | 2729 |
| 229 | Ga0068871_100100892 | 3300006358 | Bacteria | 2418 |
| 230 | Ga0068871_100436173 | 3300006358 | Bacteria | 1172 |
| 231 | Ga0075434_100195641 | 3300006871 | Bacteria | 2042 |
| 232 | Ga0075434_100278025 | 3300006871 | Bacteria | 1694 |
| 233 | Ga0068865_100440219 | 3300006881 | Bacteria | 1075 |
| 234 | Ga0075436_100051741 | 3300006914 | Bacteria | 2834 |
| 235 | Ga0075436_100125917 | 3300006914 | Bacteria | 1795 |
| 236 | Ga0097620_100122253 | 3300006931 | Bacteria | 2670 |
| 237 | Ga0097620_100678845 | 3300006931 | Bacteria | 1121 |
| 238 | Ga0075435_100021456 | 3300007076 | Bacteria | 4968 |
| 239 | Ga0075435_100176685 | 3300007076 | Bacteria | 1803 |
| 240 | Ga0099794_10033018 | 3300007265 | Bacteria | 2432 |
| 241 | Ga0099794_10132618 | 3300007265 | Bacteria | 1259 |
| 242 | Ga0099794_10216173 | 3300007265 | Bacteria | 984 |
| 243 | Ga0099794_10222807 | 3300007265 | Unclassified | 969 |
| 244 | Ga0099794_10227996 | 3300007265 | Bacteria | 958 |
| 245 | Ga0099795_10030595 | 3300007788 | Bacteria | 1849 |
| 246 | Ga0105240_10054178 | 3300009093 | Bacteria | 5028 |
| 247 | Ga0105240_10113841 | 3300009093 | Bacteria | 3269 |
| 248 | Ga0105240_10261623 | 3300009093 | Bacteria | 1996 |
| 249 | Ga0105240_10270922 | 3300009093 | Bacteria | 1955 |
| 250 | Ga0105240_10274138 | 3300009093 | Bacteria | 1941 |
| 251 | Ga0105240_10282025 | 3300009093 | Bacteria | 1908 |
| 252 | Ga0111539_10344664 | 3300009094 | Bacteria | 1734 |
| 253 | Ga0105247_10014280 | 3300009101 | Bacteria | 4767 |
| 254 | Ga0105242_10341696 | 3300009176 | Bacteria | 1380 |
| 255 | Ga0105248_10241422 | 3300009177 | Bacteria | 2034 |
| 256 | Ga0105248_10280233 | 3300009177 | Bacteria | 1877 |
| 257 | Ga0105248_10886345 | 3300009177 | Bacteria | 1007 |
| 258 | Ga0105237_10051347 | 3300009545 | Bacteria | 4141 |
| 259 | Ga0105237_10073900 | 3300009545 | Bacteria | 3401 |
| 260 | Ga0105237_10161032 | 3300009545 | Unclassified | 2242 |
| 261 | Ga0105237_10167989 | 3300009545 | Bacteria | 2193 |
| 262 | Ga0105237_10239616 | 3300009545 | Bacteria | 1815 |
| 263 | Ga0105238_10022011 | 3300009551 | Bacteria | 6496 |
| 264 | Ga0105238_10067600 | 3300009551 | Bacteria | 3574 |
| 265 | Ga0105238_10145294 | 3300009551 | Bacteria | 2348 |
| 266 | Ga0105238_10214402 | 3300009551 | Bacteria | 1902 |
| 267 | Ga0105238_10361347 | 3300009551 | Bacteria | 1441 |
| 268 | Ga0105238_10494909 | 3300009551 | Bacteria | 1223 |
| 269 | Ga0099796_10027098 | 3300010159 | Bacteria | 1827 |
| 270 | Ga0105239_10006660 | 3300010375 | Bacteria | 13359 |
| 271 | Ga0105239_10053763 | 3300010375 | Bacteria | 4416 |
| 272 | Ga0105239_10141288 | 3300010375 | Bacteria | 2683 |
| 273 | Ga0105239_10244795 | 3300010375 | Bacteria | 2013 |
| 274 | Ga0105239_10280538 | 3300010375 | Bacteria | 1875 |
| 275 | Ga0105246_10140293 | 3300011119 | Bacteria | 1816 |
| 276 | Ga0157323_1003136 | 3300012495 | Bacteria | 976 |
| 277 | Ga0157373_10037570 | 3300013100 | Bacteria | 3471 |
| 278 | Ga0157373_10087027 | 3300013100 | Bacteria | 2202 |
| 279 | Ga0157373_10133595 | 3300013100 | Bacteria | 1744 |
| 280 | Ga0157373_10244996 | 3300013100 | Bacteria | 1267 |
| 281 | Ga0157371_10042032 | 3300013102 | Bacteria | 3259 |
| 282 | Ga0157371_10045126 | 3300013102 | Bacteria | 3137 |
| 283 | Ga0157371_10118940 | 3300013102 | Bacteria | 1878 |
| 284 | Ga0157371_10146760 | 3300013102 | Bacteria | 1681 |
| 285 | Ga0157371_10153337 | 3300013102 | Bacteria | 1644 |
| 286 | Ga0157371_10500069 | 3300013102 | Bacteria | 898 |
| 287 | Ga0157370_10069149 | 3300013104 | Bacteria | 3335 |
| 288 | Ga0157370_10073111 | 3300013104 | Bacteria | 3235 |
| 289 | Ga0157370_10163772 | 3300013104 | Bacteria | 2069 |
| 290 | Ga0157370_10320909 | 3300013104 | Bacteria | 1429 |
| 291 | Ga0157370_10450952 | 3300013104 | Bacteria | 1183 |
| 292 | Ga0157369_10036937 | 3300013105 | Bacteria | 5351 |
| 293 | Ga0157369_10107916 | 3300013105 | Bacteria | 2961 |
| 294 | Ga0157369_10179013 | 3300013105 | Bacteria | 2231 |
| 295 | Ga0157369_10185505 | 3300013105 | Bacteria | 2188 |
| 296 | Ga0157369_10269476 | 3300013105 | Bacteria | 1775 |
| 297 | Ga0157369_10506063 | 3300013105 | Bacteria | 1249 |
| 298 | Ga0157378_10765208 | 3300013297 | Bacteria | 989 |
| 299 | Ga0163162_10070045 | 3300013306 | Bacteria | 3559 |
| 300 | Ga0163162_10574042 | 3300013306 | Bacteria | 1255 |
| 301 | Ga0157372_10045136 | 3300013307 | Bacteria | 4887 |
| 302 | Ga0157372_10082823 | 3300013307 | Bacteria | 3633 |
| 303 | Ga0157372_10157288 | 3300013307 | Bacteria | 2625 |
| 304 | Ga0157372_10257410 | 3300013307 | Bacteria | 2026 |
| 305 | Ga0157372_10310831 | 3300013307 | Bacteria | 1834 |
| 306 | Ga0157372_10411246 | 3300013307 | Bacteria | 1576 |
| 307 | Ga0157372_10484226 | 3300013307 | Bacteria | 1442 |
| 308 | Ga0157372_11119375 | 3300013307 | Bacteria | 911 |
| 309 | Ga0157372_11559379 | 3300013307 | Bacteria | 761 |
| 310 | Ga0163163_10643802 | 3300014325 | Bacteria | 1123 |
| 311 | Ga0182008_10077601 | 3300014497 | Bacteria | 1634 |
| 312 | Ga0182008_10185021 | 3300014497 | Bacteria | 1055 |
| 313 | Ga0157379_10168013 | 3300014968 | Bacteria | 1980 |
| 314 | Ga0157376_10000077 | 3300014969 | Bacteria | 74189 |
| 315 | Ga0157376_10001519 | 3300014969 | Bacteria | 15329 |
| 316 | Ga0157376_10219585 | 3300014969 | Bacteria | 1760 |
| 317 | Ga0157376_10254964 | 3300014969 | Bacteria | 1640 |
| 318 | Ga0182007_10134052 | 3300015262 | Bacteria | 835 |
| 319 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 320 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 321 | Ga0163161_10539761 | 3300017792 | Bacteria | 954 |
| 322 | Ga0184592_126085 | 3300019177 | Bacteria | 1464 |
| 323 | Ga0197907_10574318 | 3300020069 | Bacteria | 1433 |
| 324 | Ga0197907_10947378 | 3300020069 | Bacteria | 3159 |
| 325 | Ga0197907_11264123 | 3300020069 | Bacteria | 778 |
| 326 | Ga0206356_10069576 | 3300020070 | Bacteria | 3317 |
| 327 | Ga0206356_10171056 | 3300020070 | Bacteria | 2333 |
| 328 | Ga0206356_10966620 | 3300020070 | Bacteria | 4089 |
| 329 | Ga0206356_11482326 | 3300020070 | Bacteria | 1521 |
| 330 | Ga0206349_1346577 | 3300020075 | Bacteria | 1686 |
| 331 | Ga0206355_1347985 | 3300020076 | Bacteria | 4206 |
| 332 | Ga0206355_1657004 | 3300020076 | Bacteria | 2465 |
| 333 | Ga0206351_10247550 | 3300020077 | Bacteria | 8297 |
| 334 | Ga0206352_11092907 | 3300020078 | Bacteria | 7966 |
| 335 | Ga0206352_11356790 | 3300020078 | Bacteria | 2706 |
| 336 | Ga0206350_10601137 | 3300020080 | Bacteria | 3515 |
| 337 | Ga0206354_10337548 | 3300020081 | Bacteria | 1915 |
| 338 | Ga0206354_10771806 | 3300020081 | Bacteria | 1286 |
| 339 | Ga0206354_10919723 | 3300020081 | Bacteria | 3008 |
| 340 | Ga0206353_10129542 | 3300020082 | Bacteria | 10452 |
| 341 | Ga0206353_10294942 | 3300020082 | Bacteria | 4933 |
| 342 | Ga0206353_11029087 | 3300020082 | Bacteria | 1412 |
| 343 | Ga0154015_1010654 | 3300020610 | Bacteria | 5497 |
| 344 | Ga0154015_1416341 | 3300020610 | Bacteria | 1104 |
| 345 | Ga0213876_10017049 | 3300021384 | Bacteria | 3837 |
| 346 | Ga0224712_10013385 | 3300022467 | Bacteria | 2610 |
| 347 | Ga0224712_10021892 | 3300022467 | Bacteria | 2195 |
| 348 | Ga0224712_10027027 | 3300022467 | Bacteria | 2037 |
| 349 | Ga0209435_101200 | 3300025206 | Bacteria | 3488 |
| 350 | Ga0209435_106506 | 3300025206 | Bacteria | 1299 |
| 351 | Ga0209784_100310 | 3300025224 | Bacteria | 25654 |
| 352 | Ga0209674_100043 | 3300025226 | Bacteria | 369728 |
| 353 | Ga0209674_102881 | 3300025226 | Bacteria | 3418 |
| 354 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 355 | Ga0209672_102109 | 3300025228 | Bacteria | 5311 |
| 356 | Ga0209563_100103 | 3300025230 | Bacteria | 151835 |
| 357 | Ga0207427_100209 | 3300025231 | Bacteria | 53322 |
| 358 | Ga0207427_104741 | 3300025231 | Bacteria | 2153 |
| 359 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 360 | Ga0209437_100193 | 3300025233 | Bacteria | 122027 |
| 361 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 362 | Ga0209258_104604 | 3300025242 | Bacteria | 2564 |
| 363 | Ga0207425_1039535 | 3300025245 | Bacteria | 903 |
| 364 | Ga0209026_1000060 | 3300025250 | Bacteria | 220052 |
| 365 | Ga0209026_1000274 | 3300025250 | Bacteria | 61312 |
| 366 | Ga0209026_1001271 | 3300025250 | Bacteria | 11502 |
| 367 | Ga0209026_1006743 | 3300025250 | Bacteria | 2739 |
| 368 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 369 | Ga0209148_1000025 | 3300025254 | Bacteria | 663262 |
| 370 | Ga0209759_1001919 | 3300025256 | Bacteria | 10178 |
| 371 | Ga0209759_1010126 | 3300025256 | Bacteria | 2786 |
| 372 | Ga0209759_1016259 | 3300025256 | Bacteria | 1887 |
| 373 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 374 | Ga0209233_1000920 | 3300025261 | Bacteria | 12852 |
| 375 | Ga0209233_1033207 | 3300025261 | Bacteria | 1186 |
| 376 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 377 | Ga0209565_1037789 | 3300025263 | Bacteria | 912 |
| 378 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 379 | Ga0209455_1000095 | 3300025272 | Bacteria | 217487 |
| 380 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 381 | Ga0209673_1002116 | 3300025273 | Bacteria | 14881 |
| 382 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 383 | Ga0209675_1006904 | 3300025291 | Bacteria | 4460 |
| 384 | Ga0209676_1001608 | 3300025292 | Bacteria | 20029 |
| 385 | Ga0209676_1004892 | 3300025292 | Bacteria | 7229 |
| 386 | Ga0209025_1044140 | 3300025294 | Bacteria | 1868 |
| 387 | Ga0209025_1122127 | 3300025294 | Bacteria | 775 |
| 388 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 389 | Ga0209564_1007141 | 3300025295 | Bacteria | 5828 |
| 390 | Ga0209050_1001128 | 3300025298 | Bacteria | 32216 |
| 391 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 392 | Ga0209256_1003821 | 3300025299 | Bacteria | 10090 |
| 393 | Ga0209051_1037982 | 3300025303 | Bacteria | 1758 |
| 394 | Ga0209257_1006382 | 3300025304 | Bacteria | 7632 |
| 395 | Ga0207697_10042053 | 3300025315 | Bacteria | 1877 |
| 396 | Ga0207656_10098242 | 3300025321 | Bacteria | 1339 |
| 397 | Ga0207656_10105805 | 3300025321 | Bacteria | 1295 |
| 398 | Ga0207692_10016367 | 3300025898 | Bacteria | 3283 |
| 399 | Ga0207692_10056387 | 3300025898 | Bacteria | 2015 |
| 400 | Ga0207692_10230442 | 3300025898 | Bacteria | 1102 |
| 401 | Ga0207710_10034664 | 3300025900 | Bacteria | 2219 |
| 402 | Ga0207647_10011795 | 3300025904 | Bacteria | 6108 |
| 403 | Ga0207647_10012806 | 3300025904 | Bacteria | 5826 |
| 404 | Ga0207647_10013393 | 3300025904 | Bacteria | 5686 |
| 405 | Ga0207647_10041903 | 3300025904 | Bacteria | 2875 |
| 406 | Ga0207647_10047348 | 3300025904 | Bacteria | 2675 |
| 407 | Ga0207647_10071130 | 3300025904 | Bacteria | 2099 |
| 408 | Ga0207647_10094179 | 3300025904 | Bacteria | 1784 |
| 409 | Ga0207685_10031330 | 3300025905 | Bacteria | 1903 |
| 410 | Ga0207699_10018682 | 3300025906 | Bacteria | 3679 |
| 411 | Ga0207699_10170900 | 3300025906 | Bacteria | 1454 |
| 412 | Ga0207699_10191605 | 3300025906 | Bacteria | 1380 |
| 413 | Ga0207699_10208563 | 3300025906 | Bacteria | 1328 |
| 414 | Ga0207699_10228437 | 3300025906 | Bacteria | 1274 |
| 415 | Ga0207645_10006593 | 3300025907 | Bacteria | 8303 |
| 416 | Ga0207705_10004273 | 3300025909 | Bacteria | 10819 |
| 417 | Ga0207705_10008046 | 3300025909 | Bacteria | 7728 |
| 418 | Ga0207705_10031780 | 3300025909 | Bacteria | 3770 |
| 419 | Ga0207705_10034450 | 3300025909 | Bacteria | 3620 |
| 420 | Ga0207705_10118746 | 3300025909 | Bacteria | 1960 |
| 421 | Ga0207705_10173090 | 3300025909 | Bacteria | 1626 |
| 422 | Ga0207705_10189107 | 3300025909 | Bacteria | 1556 |
| 423 | Ga0207684_10230671 | 3300025910 | Bacteria | 1597 |
| 424 | Ga0207684_10244280 | 3300025910 | Bacteria | 1549 |
| 425 | Ga0207684_10251617 | 3300025910 | Bacteria | 1524 |
| 426 | Ga0207684_10332351 | 3300025910 | Bacteria | 1309 |
| 427 | Ga0207684_10383432 | 3300025910 | Bacteria | 1209 |
| 428 | Ga0207654_10061667 | 3300025911 | Bacteria | 2195 |
| 429 | Ga0207654_10144552 | 3300025911 | Bacteria | 1521 |
| 430 | Ga0207707_10000210 | 3300025912 | Bacteria | 62292 |
| 431 | Ga0207707_10001339 | 3300025912 | Bacteria | 22957 |
| 432 | Ga0207707_10018111 | 3300025912 | Bacteria | 6137 |
| 433 | Ga0207707_10025201 | 3300025912 | Bacteria | 5202 |
| 434 | Ga0207707_10051492 | 3300025912 | Bacteria | 3585 |
| 435 | Ga0207707_10052498 | 3300025912 | Bacteria | 3549 |
| 436 | Ga0207707_10152834 | 3300025912 | Bacteria | 2018 |
| 437 | Ga0207707_10237996 | 3300025912 | Bacteria | 1583 |
| 438 | Ga0207695_10000818 | 3300025913 | Bacteria | 57675 |
| 439 | Ga0207695_10006299 | 3300025913 | Bacteria | 15447 |
| 440 | Ga0207695_10008130 | 3300025913 | Bacteria | 13192 |
| 441 | Ga0207695_10068969 | 3300025913 | Bacteria | 3621 |
| 442 | Ga0207695_10073537 | 3300025913 | Bacteria | 3483 |
| 443 | Ga0207695_10148552 | 3300025913 | Bacteria | 2285 |
| 444 | Ga0207695_10217754 | 3300025913 | Bacteria | 1818 |
| 445 | Ga0207695_10312640 | 3300025913 | Bacteria | 1461 |
| 446 | Ga0207671_10028839 | 3300025914 | Bacteria | 4146 |
| 447 | Ga0207671_10054495 | 3300025914 | Bacteria | 2963 |
| 448 | Ga0207671_10085943 | 3300025914 | Bacteria | 2364 |
| 449 | Ga0207671_10269984 | 3300025914 | Bacteria | 1340 |
| 450 | Ga0207693_10038470 | 3300025915 | Bacteria | 3768 |
| 451 | Ga0207693_10096232 | 3300025915 | Bacteria | 2321 |
| 452 | Ga0207693_10134099 | 3300025915 | Bacteria | 1947 |
| 453 | Ga0207693_10277593 | 3300025915 | Bacteria | 1313 |
| 454 | Ga0207693_10280409 | 3300025915 | Bacteria | 1306 |
| 455 | Ga0207663_10004162 | 3300025916 | Bacteria | 7164 |
| 456 | Ga0207663_10017954 | 3300025916 | Bacteria | 3951 |
| 457 | Ga0207663_10275735 | 3300025916 | Bacteria | 1247 |
| 458 | Ga0207660_10014060 | 3300025917 | Bacteria | 5253 |
| 459 | Ga0207660_10034597 | 3300025917 | Bacteria | 3503 |
| 460 | Ga0207660_10036194 | 3300025917 | Bacteria | 3431 |
| 461 | Ga0207660_10105351 | 3300025917 | Bacteria | 2113 |
| 462 | Ga0207660_10119378 | 3300025917 | Bacteria | 1995 |
| 463 | Ga0207660_10368253 | 3300025917 | Bacteria | 1154 |
| 464 | Ga0207657_10055348 | 3300025919 | Bacteria | 3427 |
| 465 | Ga0207657_10070713 | 3300025919 | Bacteria | 2956 |
| 466 | Ga0207657_10122412 | 3300025919 | Bacteria | 2140 |
| 467 | Ga0207657_10124909 | 3300025919 | Bacteria | 2114 |
| 468 | Ga0207657_10128163 | 3300025919 | Bacteria | 2082 |
| 469 | Ga0207657_10200956 | 3300025919 | Bacteria | 1603 |
| 470 | Ga0207649_10002213 | 3300025920 | Bacteria | 10987 |
| 471 | Ga0207649_10014504 | 3300025920 | Bacteria | 4414 |
| 472 | Ga0207649_10015259 | 3300025920 | Bacteria | 4316 |
| 473 | Ga0207649_10024587 | 3300025920 | Bacteria | 3503 |
| 474 | Ga0207649_10047910 | 3300025920 | Bacteria | 2633 |
| 475 | Ga0207649_10065071 | 3300025920 | Bacteria | 2307 |
| 476 | Ga0207652_10033428 | 3300025921 | Bacteria | 4330 |
| 477 | Ga0207652_10048121 | 3300025921 | Bacteria | 3644 |
| 478 | Ga0207652_10053020 | 3300025921 | Bacteria | 3483 |
| 479 | Ga0207652_10147343 | 3300025921 | Bacteria | 2107 |
| 480 | Ga0207652_10156736 | 3300025921 | Bacteria | 2040 |
| 481 | Ga0207652_10669003 | 3300025921 | Bacteria | 928 |
| 482 | Ga0207646_10000754 | 3300025922 | Bacteria | 42028 |
| 483 | Ga0207646_10303931 | 3300025922 | Bacteria | 1441 |
| 484 | Ga0207646_10356904 | 3300025922 | Bacteria | 1321 |
| 485 | Ga0207646_10730209 | 3300025922 | Bacteria | 885 |
| 486 | Ga0207681_10105252 | 3300025923 | Bacteria | 2042 |
| 487 | Ga0207694_10028197 | 3300025924 | Bacteria | 4280 |
| 488 | Ga0207694_10088183 | 3300025924 | Bacteria | 2445 |
| 489 | Ga0207694_10119803 | 3300025924 | Bacteria | 2100 |
| 490 | Ga0207694_10160368 | 3300025924 | Bacteria | 1816 |
| 491 | Ga0207694_10714487 | 3300025924 | Bacteria | 845 |
| 492 | Ga0207650_10286074 | 3300025925 | Bacteria | 1343 |
| 493 | Ga0207687_10234006 | 3300025927 | Bacteria | 1452 |
| 494 | Ga0207687_10481145 | 3300025927 | Bacteria | 1034 |
| 495 | Ga0207700_10116306 | 3300025928 | Bacteria | 2161 |
| 496 | Ga0207700_10180340 | 3300025928 | Bacteria | 1768 |
| 497 | Ga0207700_10285416 | 3300025928 | Bacteria | 1421 |
| 498 | Ga0207700_10737458 | 3300025928 | Bacteria | 880 |
| 499 | Ga0207664_10001884 | 3300025929 | Bacteria | 13792 |
| 500 | Ga0207644_10089389 | 3300025931 | Bacteria | 2292 |
| 501 | Ga0207644_10090873 | 3300025931 | Bacteria | 2275 |
| 502 | Ga0207690_10000291 | 3300025932 | Bacteria | 35587 |
| 503 | Ga0207690_10003289 | 3300025932 | Bacteria | 9676 |
| 504 | Ga0207690_10034320 | 3300025932 | Bacteria | 3268 |
| 505 | Ga0207690_10222034 | 3300025932 | Bacteria | 1446 |
| 506 | Ga0207690_10227720 | 3300025932 | Bacteria | 1429 |
| 507 | Ga0207690_10670980 | 3300025932 | Bacteria | 851 |
| 508 | Ga0207690_10809951 | 3300025932 | Bacteria | 774 |
| 509 | Ga0207706_10015708 | 3300025933 | Bacteria | 6844 |
| 510 | Ga0207706_10100114 | 3300025933 | Bacteria | 2550 |
| 511 | Ga0207706_10107956 | 3300025933 | Bacteria | 2449 |
| 512 | Ga0207706_10319011 | 3300025933 | Bacteria | 1352 |
| 513 | Ga0207686_10023003 | 3300025934 | Bacteria | 3595 |
| 514 | Ga0207686_10333629 | 3300025934 | Bacteria | 1137 |
| 515 | Ga0207704_10216261 | 3300025938 | Bacteria | 1414 |
| 516 | Ga0207665_10000959 | 3300025939 | Bacteria | 19542 |
| 517 | Ga0207665_10006155 | 3300025939 | Bacteria | 7969 |
| 518 | Ga0207665_10006268 | 3300025939 | Bacteria | 7894 |
| 519 | Ga0207665_10010543 | 3300025939 | Bacteria | 6070 |
| 520 | Ga0207665_10035786 | 3300025939 | Bacteria | 3297 |
| 521 | Ga0207665_10052220 | 3300025939 | Bacteria | 2754 |
| 522 | Ga0207665_10101234 | 3300025939 | Bacteria | 2011 |
| 523 | Ga0207665_10215796 | 3300025939 | Bacteria | 1404 |
| 524 | Ga0207665_10409253 | 3300025939 | Bacteria | 1034 |
| 525 | Ga0207689_10020406 | 3300025942 | Bacteria | 5577 |
| 526 | Ga0207689_10136777 | 3300025942 | Bacteria | 2018 |
| 527 | Ga0207661_10004252 | 3300025944 | Bacteria | 10024 |
| 528 | Ga0207661_10058973 | 3300025944 | Bacteria | 3091 |
| 529 | Ga0207661_10273592 | 3300025944 | Bacteria | 1507 |
| 530 | Ga0207661_10648918 | 3300025944 | Bacteria | 970 |
| 531 | Ga0207679_10025524 | 3300025945 | Bacteria | 4065 |
| 532 | Ga0207679_10425174 | 3300025945 | Bacteria | 1173 |
| 533 | Ga0207667_10008758 | 3300025949 | Bacteria | 11990 |
| 534 | Ga0207667_10009904 | 3300025949 | Bacteria | 11181 |
| 535 | Ga0207667_10010803 | 3300025949 | Bacteria | 10649 |
| 536 | Ga0207667_10053962 | 3300025949 | Bacteria | 4228 |
| 537 | Ga0207667_10072769 | 3300025949 | Bacteria | 3572 |
| 538 | Ga0207667_10095216 | 3300025949 | Bacteria | 3074 |
| 539 | Ga0207667_10119954 | 3300025949 | Bacteria | 2710 |
| 540 | Ga0207667_10193768 | 3300025949 | Bacteria | 2085 |
| 541 | Ga0207667_10259410 | 3300025949 | Bacteria | 1777 |
| 542 | Ga0207651_10066649 | 3300025960 | Bacteria | 2531 |
| 543 | Ga0207668_10075782 | 3300025972 | Bacteria | 2419 |
| 544 | Ga0207668_10187878 | 3300025972 | Bacteria | 1635 |
| 545 | Ga0207668_10423728 | 3300025972 | Bacteria | 1130 |
| 546 | Ga0207640_10002025 | 3300025981 | Bacteria | 10946 |
| 547 | Ga0207640_10003058 | 3300025981 | Bacteria | 9010 |
| 548 | Ga0207640_10025408 | 3300025981 | Bacteria | 3585 |
| 549 | Ga0207640_10026008 | 3300025981 | Bacteria | 3549 |
| 550 | Ga0207640_10059031 | 3300025981 | Bacteria | 2530 |
| 551 | Ga0207640_10513033 | 3300025981 | Bacteria | 1000 |
| 552 | Ga0207640_10559495 | 3300025981 | Bacteria | 962 |
| 553 | Ga0207658_10028034 | 3300025986 | Bacteria | 3963 |
| 554 | Ga0207658_10106388 | 3300025986 | Bacteria | 2208 |
| 555 | Ga0207677_10157745 | 3300026023 | Bacteria | 1759 |
| 556 | Ga0207677_10345942 | 3300026023 | Bacteria | 1244 |
| 557 | Ga0207703_10163415 | 3300026035 | Bacteria | 1952 |
| 558 | Ga0207703_10205239 | 3300026035 | Bacteria | 1753 |
| 559 | Ga0207639_10000231 | 3300026041 | Bacteria | 41634 |
| 560 | Ga0207639_10016511 | 3300026041 | Bacteria | 5226 |
| 561 | Ga0207639_10029641 | 3300026041 | Bacteria | 4008 |
| 562 | Ga0207639_10047428 | 3300026041 | Bacteria | 3247 |
| 563 | Ga0207639_10125486 | 3300026041 | Bacteria | 2116 |
| 564 | Ga0207639_10452119 | 3300026041 | Bacteria | 1166 |
| 565 | Ga0207678_10016758 | 3300026067 | Bacteria | 6435 |
| 566 | Ga0207678_10049236 | 3300026067 | Bacteria | 3642 |
| 567 | Ga0207678_10055028 | 3300026067 | Bacteria | 3427 |
| 568 | Ga0207678_10130950 | 3300026067 | Bacteria | 2140 |
| 569 | Ga0207678_10137839 | 3300026067 | Bacteria | 2082 |
| 570 | Ga0207678_10220963 | 3300026067 | Bacteria | 1621 |
| 571 | Ga0207678_10271783 | 3300026067 | Bacteria | 1453 |
| 572 | Ga0207678_10729632 | 3300026067 | Bacteria | 873 |
| 573 | Ga0207678_10924653 | 3300026067 | Bacteria | 771 |
| 574 | Ga0207708_10509884 | 3300026075 | Bacteria | 1009 |
| 575 | Ga0207702_10000852 | 3300026078 | Bacteria | 31897 |
| 576 | Ga0207702_10011901 | 3300026078 | Bacteria | 7239 |
| 577 | Ga0207702_10012283 | 3300026078 | Bacteria | 7129 |
| 578 | Ga0207702_10074823 | 3300026078 | Bacteria | 2924 |
| 579 | Ga0207702_10091382 | 3300026078 | Bacteria | 2665 |
| 580 | Ga0207702_10161689 | 3300026078 | Bacteria | 2045 |
| 581 | Ga0207702_10375412 | 3300026078 | Bacteria | 1366 |
| 582 | Ga0207702_10744510 | 3300026078 | Bacteria | 967 |
| 583 | Ga0207641_10183031 | 3300026088 | Bacteria | 1920 |
| 584 | Ga0207641_10546239 | 3300026088 | Bacteria | 1129 |
| 585 | Ga0207648_10168415 | 3300026089 | Bacteria | 1936 |
| 586 | Ga0207648_10310721 | 3300026089 | Bacteria | 1415 |
| 587 | Ga0207676_10162686 | 3300026095 | Bacteria | 1935 |
| 588 | Ga0207676_10285849 | 3300026095 | Bacteria | 1499 |
| 589 | Ga0207674_10001554 | 3300026116 | Bacteria | 29587 |
| 590 | Ga0207674_10017287 | 3300026116 | Bacteria | 7869 |
| 591 | Ga0207674_10059241 | 3300026116 | Bacteria | 3875 |
| 592 | Ga0207674_10111246 | 3300026116 | Bacteria | 2713 |
| 593 | Ga0207674_10142271 | 3300026116 | Bacteria | 2358 |
| 594 | Ga0207675_100106837 | 3300026118 | Bacteria | 2639 |
| 595 | Ga0207675_100774282 | 3300026118 | Bacteria | 972 |
| 596 | Ga0207675_101176735 | 3300026118 | Bacteria | 787 |
| 597 | Ga0207683_10023634 | 3300026121 | Bacteria | 5287 |
| 598 | Ga0207698_10004871 | 3300026142 | Bacteria | 8228 |
| 599 | Ga0207698_10007267 | 3300026142 | Bacteria | 6940 |
| 600 | Ga0207698_10038635 | 3300026142 | Bacteria | 3528 |
| 601 | Ga0207698_10052641 | 3300026142 | Bacteria | 3120 |
| 602 | Ga0207698_10301744 | 3300026142 | Bacteria | 1491 |
| 603 | Ga0207698_10705601 | 3300026142 | Bacteria | 1004 |
| 604 | Ga0209588_1051560 | 3300027671 | Bacteria | 1331 |
| 605 | Ga0209588_1081586 | 3300027671 | Bacteria | 1044 |
| 606 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 607 | Ga0268266_10000259 | 3300028379 | Bacteria | 88660 |
| 608 | Ga0268266_10100303 | 3300028379 | Bacteria | 2550 |
| 609 | Ga0268265_10115242 | 3300028380 | Bacteria | 2202 |
| 610 | Ga0268264_10023204 | 3300028381 | Bacteria | 5063 |
| 611 | Ga0268264_10121193 | 3300028381 | Bacteria | 2305 |
| 612 | Ga0268264_10515755 | 3300028381 | Bacteria | 1168 |
| 613 | Ga0307517_10241588 | 3300028786 | Bacteria | 1071 |
| 614 | Ga0265766_1002482 | 3300030863 | Bacteria | 1024 |
| 615 | Ga0265770_1020074 | 3300030878 | Bacteria | 1053 |
| 616 | Ga0265764_100381 | 3300030882 | Bacteria | 1637 |
| 617 | Ga0265774_100076 | 3300031011 | Bacteria | 2339 |
| 618 | Ga0265760_10004278 | 3300031090 | Bacteria | 4102 |
| 619 | Ga0265760_10074156 | 3300031090 | Bacteria | 1047 |
| 620 | Ga0265760_10114369 | 3300031090 | Unclassified | 862 |
| 621 | Ga0265325_10048727 | 3300031241 | Bacteria | 2188 |
| 622 | Ga0265339_10265934 | 3300031249 | Bacteria | 826 |
| 623 | Ga0307408_100110780 | 3300031548 | Bacteria | 2108 |
| 624 | Ga0316575_10141054 | 3300031665 | Bacteria | 992 |
| 625 | Ga0316576_10006052 | 3300031727 | Bacteria | 7481 |
| 626 | Ga0316576_10187240 | 3300031727 | Bacteria | 1561 |
| 627 | Ga0316578_10032616 | 3300031728 | Bacteria | 2978 |
| 628 | Ga0307413_10146858 | 3300031824 | Bacteria | 1638 |
| 629 | Ga0307413_10837432 | 3300031824 | Bacteria | 776 |
| 630 | Ga0307406_10093487 | 3300031901 | Bacteria | 2030 |
| 631 | Ga0307406_10105057 | 3300031901 | Bacteria | 1932 |
| 632 | Ga0307412_10028293 | 3300031911 | Bacteria | 3505 |
| 633 | Ga0307409_100474526 | 3300031995 | Bacteria | 1212 |
| 634 | Ga0307416_100079046 | 3300032002 | Bacteria | 2770 |
| 635 | Ga0307507_10270077 | 3300033179 | Bacteria | 1075 |
| 636 | Ga0316586_1000008 | 3300033527 | Bacteria | 10390 |
| 637 | Ga0316588_1000021 | 3300033528 | Bacteria | 11292 |
| 638 | Ga0316596_1000103 | 3300033541 | Bacteria | 10744 |
| 639 | Ga0373959_0043986 | 3300034820 | Bacteria | 946 |
| 640 | Ga0373926_0002726 | 3300035083 | Bacteria | 5632 |
| 641 | Ga0373934_0001004 | 3300035086 | Bacteria | 10198 |
| 642 | Ga0373934_0114056 | 3300035086 | Bacteria | 1097 |
| 643 | Ga0373923_0001256 | 3300035111 | Bacteria | 7130 |
| 644 | Ga0373945_0098404 | 3300035116 | Bacteria | 1142 |
| 645 | Ga0373945_0240426 | 3300035116 | Bacteria | 762 |
| 646 | Ga0373953_0066494 | 3300035117 | Bacteria | 1481 |
| 647 | Ga0373954_0005540 | 3300035118 | Bacteria | 5466 |
| 648 | Ga0373954_0015764 | 3300035118 | Bacteria | 3380 |
| 649 | Ga0373954_0042676 | 3300035118 | Bacteria | 2115 |
| 650 | Ga0373956_0019487 | 3300035119 | Bacteria | 2877 |
| 651 | Ga0373957_0000289 | 3300035120 | Bacteria | 12644 |
| 652 | Ga0373957_0034419 | 3300035120 | Bacteria | 1876 |
| 653 | Ga0373943_0117096 | 3300035170 | Bacteria | 1412 |
| 654 | Ga0373946_0023454 | 3300035171 | Bacteria | 2411 |
| 655 | Ga0373955_0161703 | 3300035172 | Bacteria | 1322 |
| 656 | Ga0316574_0051750 | 3300035398 | Bacteria | 2560 |
| 657 | Ga0373931_0021266 | 3300035691 | Bacteria | 3254 |
| 658 | Ga0373935_0010652 | 3300035692 | Bacteria | 5520 |
| 659 | Ga0373927_0000934 | 3300035695 | Bacteria | 22198 |
| 660 | Ga0373927_0004438 | 3300035695 | Bacteria | 9831 |
| 661 | Ga0373933_0000551 | 3300035724 | Bacteria | 23376 |
| 662 | Ga0373933_0002799 | 3300035724 | Bacteria | 9741 |
| 663 | Ga0373933_0188487 | 3300035724 | Bacteria | 1317 |
| 664 | Ga0373947_0000905 | 3300035725 | Bacteria | 17957 |
| 665 | Ga0373947_0008831 | 3300035725 | Bacteria | 5795 |
| 666 | Ga0373937_0000238 | 3300036401 | Bacteria | 53880 |
| 667 | Ga0373937_0005026 | 3300036401 | Bacteria | 11254 |
| 668 | Ga0373937_0016547 | 3300036401 | Bacteria | 6549 |
| 669 | Ga0373937_0049055 | 3300036401 | Bacteria | 3866 |
| 670 | Ga0373937_0377618 | 3300036401 | Bacteria | 1344 |
| 671 | Ga0310112_000276 | 3300036458 | Bacteria | 4093 |
| 672 | Ga0310109_011090 | 3300036534 | Bacteria | 1215 |
| 673 | Ga0310110_004759 | 3300036535 | Bacteria | 1922 |
| 674 | Ga0373925_0001788 | 3300037068 | Bacteria | 17923 |
| 675 | Ga0373925_0009068 | 3300037068 | Bacteria | 7241 |
| 676 | Ga0395899_0001959 | 3300037312 | Bacteria | 16927 |
| 677 | Ga0395899_0042216 | 3300037312 | Bacteria | 3405 |
| 678 | Ga0395899_0432225 | 3300037312 | Bacteria | 865 |
| 679 | Ga0395900_0125348 | 3300037418 | Bacteria | 2634 |
| 680 | Ga0395900_0135347 | 3300037418 | Bacteria | 2524 |
| 681 | Ga0395900_0172278 | 3300037418 | Bacteria | 2202 |
| 682 | Ga0395898_0000558 | 3300037466 | Bacteria | 69802 |
| 683 | Ga0395898_0135016 | 3300037466 | Bacteria | 2362 |
| 684 | Ga0395898_0138563 | 3300037466 | Bacteria | 2329 |
| 685 | Ga0395901_0002939 | 3300038443 | Bacteria | 17197 |
| 686 | Ga0395901_0218962 | 3300038443 | Bacteria | 1990 |
| 687 | Ga0400483_047654 | 3300039062 | Bacteria | 9246 |
| 688 | Ga0400483_168849 | 3300039062 | Bacteria | 24271 |
| 689 | Ga0436365_1034683 | 3300039437 | Bacteria | 2594 |
| 690 | Ga0436361_1002022 | 3300039447 | Bacteria | 749 |
| 691 | Ga0451787_149821 | 3300041441 | Bacteria | 2666 |
| 692 | Ga0451794_28977 | 3300041446 | Bacteria | 1588 |
| 693 | Ga0451793_0393032 | 3300041452 | Bacteria | 3643 |
| 694 | Ga0451805_117344 | 3300041461 | Bacteria | 748 |
| 695 | Ga0451837_0589056 | 3300041494 | Bacteria | 1792 |
| 696 | Ga0451853_1157729 | 3300041512 | Bacteria | 894 |
| 697 | Ga0439437_001431 | 3300042000 | Bacteria | 2515 |
| 698 | Ga0439455_0060019 | 3300042012 | Bacteria | 1007 |
| 699 | Ga0439459_0002369 | 3300042438 | Bacteria | 2898 |
| 700 | Ga0451577_0127243 | 3300042876 | Bacteria | 2283 |
| 701 | Ga0466969_0001060 | 3300044656 | Bacteria | 14842 |
| 702 | Ga0466969_0008941 | 3300044656 | Bacteria | 5311 |
| 703 | Ga0466972_0000416 | 3300044658 | Bacteria | 22317 |
| 704 | Ga0466965_0049044 | 3300044683 | Bacteria | 2093 |
| 705 | Ga0466966_0002549 | 3300044684 | Bacteria | 11933 |
| 706 | Ga0466961_0025162 | 3300044693 | Bacteria | 3830 |
| 707 | Ga0466961_0085616 | 3300044693 | Bacteria | 1992 |
| 708 | Ga0466971_0033841 | 3300044719 | Bacteria | 2290 |
| 709 | Ga0466968_0016253 | 3300044735 | Bacteria | 2961 |
| 710 | Ga0466968_0222672 | 3300044735 | Bacteria | 889 |
| 711 | Ga0466970_0000139 | 3300044765 | Bacteria | 33601 |
| 712 | Ga0466970_0088960 | 3300044765 | Bacteria | 1674 |
| 713 | Ga0466959_0003175 | 3300045049 | Bacteria | 10666 |
| 714 | Ga0466959_0072597 | 3300045049 | Bacteria | 2490 |
| 715 | Ga0466958_0045436 | 3300045836 | Bacteria | 2649 |
| 716 | Ga0466967_0729083 | 3300045976 | Bacteria | 982 |
| 717 | Ga0466967_0743177 | 3300045976 | Bacteria | 973 |
| 718 | Ga0495592_0116471 | 3300046454 | Bacteria | 1885 |
| 719 | Ga0495592_0129288 | 3300046454 | Bacteria | 1768 |
| 720 | Ga0495603_0065572 | 3300046455 | Bacteria | 2140 |
| 721 | Ga0495629_0065391 | 3300046459 | Bacteria | 2538 |
| 722 | Ga0495638_0000007 | 3300046460 | Bacteria | 602783 |
| 723 | Ga0495651_0003059 | 3300046462 | Bacteria | 12909 |
| 724 | Ga0495651_0012754 | 3300046462 | Bacteria | 6488 |
| 725 | Ga0495651_0144083 | 3300046462 | Bacteria | 1724 |
| 726 | Ga0495651_0369488 | 3300046462 | Bacteria | 943 |
| 727 | Ga0495653_0004713 | 3300046463 | Bacteria | 11039 |
| 728 | Ga0495653_0005252 | 3300046463 | Bacteria | 10534 |
| 729 | Ga0495653_0188001 | 3300046463 | Bacteria | 1411 |
| 730 | Ga0495653_0430957 | 3300046463 | Unclassified | 833 |
| 731 | Ga0495653_0668187 | 3300046463 | Bacteria | 633 |
| 732 | Ga0495650_0000202 | 3300046471 | Bacteria | 129910 |
| 733 | Ga0495580_0002827 | 3300046472 | Bacteria | 14922 |
| 734 | Ga0495580_0016376 | 3300046472 | Bacteria | 5564 |
| 735 | Ga0495580_0071634 | 3300046472 | Bacteria | 2421 |
| 736 | Ga0495580_0132657 | 3300046472 | Bacteria | 1727 |
| 737 | Ga0495582_0004462 | 3300046473 | Bacteria | 7870 |
| 738 | Ga0495582_0130173 | 3300046473 | Unclassified | 1421 |
| 739 | Ga0495662_0014892 | 3300046476 | Bacteria | 3779 |
| 740 | Ga0495664_0000007 | 3300046477 | Bacteria | 386710 |
| 741 | Ga0495664_0158325 | 3300046477 | Bacteria | 1374 |
| 742 | Ga0495594_0077145 | 3300046499 | Bacteria | 1858 |
| 743 | Ga0495606_0001329 | 3300046507 | Bacteria | 33751 |
| 744 | Ga0495608_0004716 | 3300046511 | Bacteria | 9758 |
| 745 | Ga0495608_0014220 | 3300046511 | Bacteria | 5523 |
| 746 | Ga0495608_0024720 | 3300046511 | Bacteria | 4105 |
| 747 | Ga0495608_0083762 | 3300046511 | Bacteria | 2070 |
| 748 | Ga0495618_0000035 | 3300046514 | Bacteria | 102739 |
| 749 | Ga0495618_0102156 | 3300046514 | Bacteria | 1835 |
| 750 | Ga0495628_0011006 | 3300046516 | Bacteria | 7660 |
| 751 | Ga0495628_0017722 | 3300046516 | Bacteria | 5917 |
| 752 | Ga0495630_0000610 | 3300046517 | Bacteria | 25880 |
| 753 | Ga0495630_0015980 | 3300046517 | Bacteria | 5484 |
| 754 | Ga0495630_0088337 | 3300046517 | Bacteria | 2341 |
| 755 | Ga0495630_0145341 | 3300046517 | Bacteria | 1803 |
| 756 | Ga0495630_0221500 | 3300046517 | Unclassified | 1444 |
| 757 | Ga0495666_0029996 | 3300046526 | Bacteria | 2672 |
| 758 | Ga0495666_0107669 | 3300046526 | Bacteria | 1310 |
| 759 | Ga0495652_0023062 | 3300046529 | Bacteria | 5519 |
| 760 | Ga0495652_0026177 | 3300046529 | Bacteria | 5155 |
| 761 | Ga0495665_0017344 | 3300046531 | Bacteria | 3873 |
| 762 | Ga0495665_0159246 | 3300046531 | Bacteria | 1177 |
| 763 | Ga0495640_0031243 | 3300046533 | Bacteria | 3802 |
| 764 | Ga0495586_0001676 | 3300046535 | Bacteria | 12153 |
| 765 | Ga0495587_0000383 | 3300046536 | Bacteria | 31535 |
| 766 | Ga0495587_0023543 | 3300046536 | Bacteria | 3784 |
| 767 | Ga0495587_0024675 | 3300046536 | Bacteria | 3682 |
| 768 | Ga0495645_0000033 | 3300046543 | Bacteria | 105930 |
| 769 | Ga0495645_0076839 | 3300046543 | Bacteria | 2401 |
| 770 | Ga0495622_0040458 | 3300046557 | Bacteria | 2169 |
| 771 | Ga0495667_0071691 | 3300046559 | Bacteria | 2259 |
| 772 | Ga0495625_0016676 | 3300046660 | Bacteria | 5771 |
| 773 | Ga0495635_0011568 | 3300046663 | Bacteria | 6186 |
| 774 | Ga0495657_0000027 | 3300046675 | Bacteria | 131421 |
| 775 | Ga0495657_0049456 | 3300046675 | Bacteria | 2831 |
| 776 | Ga0495657_0058966 | 3300046675 | Bacteria | 2547 |
| 777 | Ga0495657_0201940 | 3300046675 | Unclassified | 1211 |
| 778 | Ga0495599_0044494 | 3300046678 | Bacteria | 2784 |
| 779 | Ga0495623_0001135 | 3300046679 | Bacteria | 18014 |
| 780 | Ga0495646_0013837 | 3300046680 | Bacteria | 5129 |
| 781 | Ga0495646_0118500 | 3300046680 | Bacteria | 1500 |
| 782 | Ga0495646_0249493 | 3300046680 | Bacteria | 951 |
| 783 | Ga0495613_0062134 | 3300046689 | Bacteria | 2734 |
| 784 | Ga0495613_0214634 | 3300046689 | Unclassified | 1352 |
| 785 | Ga0495624_0026801 | 3300046690 | Bacteria | 3776 |
| 786 | Ga0495624_0038887 | 3300046690 | Bacteria | 3053 |
| 787 | Ga0495670_0056198 | 3300046691 | Bacteria | 1974 |
| 788 | Ga0495649_0000383 | 3300046694 | Bacteria | 38398 |
| 789 | Ga0495600_0041791 | 3300046809 | Bacteria | 2988 |
| 790 | Ga0495600_0200930 | 3300046809 | Bacteria | 1280 |
| 791 | Ga0495581_0011173 | 3300047315 | Bacteria | 5190 |
| 792 | Ga0495604_0000785 | 3300047317 | Bacteria | 26749 |
| 793 | Ga0495604_0017471 | 3300047317 | Bacteria | 5742 |
| 794 | Ga0495604_0209128 | 3300047317 | Bacteria | 1349 |
| 795 | Ga0495604_0541963 | 3300047317 | Bacteria | 751 |
| 796 | Ga0495674_0022169 | 3300047319 | Bacteria | 5859 |
| 797 | Ga0495674_0184395 | 3300047319 | Bacteria | 1736 |
| 798 | Ga0495674_0245455 | 3300047319 | Bacteria | 1474 |
| 799 | Ga0495680_0081547 | 3300047322 | Bacteria | 2442 |
| 800 | Ga0495680_0223650 | 3300047322 | Unclassified | 1342 |
| 801 | Ga0495675_0002324 | 3300047444 | Bacteria | 11363 |
| 802 | Ga0495684_0006019 | 3300047471 | Bacteria | 9428 |
| 803 | Ga0495684_0010523 | 3300047471 | Bacteria | 7154 |
| 804 | Ga0495684_0093585 | 3300047471 | Bacteria | 2276 |
| 805 | Ga0495684_0208428 | 3300047471 | Bacteria | 1438 |
| 806 | Ga0495593_0000774 | 3300047673 | Bacteria | 18607 |
| 807 | Ga0495593_0083344 | 3300047673 | Bacteria | 1652 |
| 808 | Ga0495602_0000595 | 3300048088 | Bacteria | 33887 |
| 809 | Ga0495602_0019524 | 3300048088 | Bacteria | 6723 |
| 810 | Ga0495602_0111755 | 3300048088 | Bacteria | 2218 |
| 811 | Ga0495614_0038783 | 3300048089 | Bacteria | 2044 |
| 812 | Ga0495614_0081326 | 3300048089 | Unclassified | 1403 |
| 813 | Ga0496100_0473313 | 3300048903 | Bacteria | 963 |
| 814 | Ga0496101_0243688 | 3300048904 | Bacteria | 1399 |
| 815 | Ga0496102_0000002 | 3300048905 | Bacteria | 814588 |
| 816 | Ga0496103_0000017 | 3300048906 | Bacteria | 244768 |
| 817 | Ga0496104_0159892 | 3300048907 | Bacteria | 2161 |
| 818 | Ga0496105_0041905 | 3300048908 | Bacteria | 3773 |
| 819 | Ga0496107_0074215 | 3300048910 | Bacteria | 2475 |
| 820 | Ga0496108_0647932 | 3300048911 | Bacteria | 918 |
| 821 | Ga0496109_0004801 | 3300048912 | Bacteria | 11284 |
| 822 | Ga0496110_0517704 | 3300048913 | Bacteria | 1085 |
| 823 | Ga0496113_0237825 | 3300048916 | Bacteria | 1453 |
| 824 | Ga0496114_0001141 | 3300048917 | Bacteria | 20073 |
| 825 | Ga0496114_0055393 | 3300048917 | Bacteria | 3307 |
| 826 | Ga0496114_0146312 | 3300048917 | Bacteria | 2048 |
| 827 | Ga0496115_0002269 | 3300048918 | Bacteria | 13760 |
| 828 | Ga0496115_0002867 | 3300048918 | Bacteria | 12421 |
| 829 | Ga0496115_0082599 | 3300048918 | Bacteria | 2618 |
| 830 | Ga0496115_0137021 | 3300048918 | Bacteria | 2018 |
| 831 | Ga0496115_0145132 | 3300048918 | Bacteria | 1958 |
| 832 | Ga0496115_0316099 | 3300048918 | Bacteria | 1278 |
| 833 | Ga0496116_0021441 | 3300048919 | Bacteria | 4874 |
| 834 | Ga0496116_0076103 | 3300048919 | Bacteria | 2103 |
| 835 | Ga0496117_0000124 | 3300048920 | Bacteria | 169701 |
| 836 | Ga0496117_0032904 | 3300048920 | Bacteria | 3931 |
| 837 | Ga0496117_0063248 | 3300048920 | Bacteria | 2530 |
| 838 | Ga0496118_0001647 | 3300048921 | Bacteria | 32855 |
| 839 | Ga0496118_0012321 | 3300048921 | Bacteria | 8227 |
| 840 | Ga0496118_0092393 | 3300048921 | Bacteria | 2077 |
| 841 | Ga0496119_0000020 | 3300048922 | Bacteria | 285602 |
| 842 | Ga0496119_0016519 | 3300048922 | Bacteria | 5611 |
| 843 | Ga0496119_0089994 | 3300048922 | Bacteria | 1747 |
| 844 | Ga0496120_0000006 | 3300048923 | Bacteria | 445068 |
| 845 | Ga0496120_0002172 | 3300048923 | Bacteria | 20837 |
| 846 | Ga0496120_0035080 | 3300048923 | Bacteria | 2999 |
| 847 | Ga0496121_0002121 | 3300048924 | Bacteria | 31165 |
| 848 | Ga0496121_0005001 | 3300048924 | Bacteria | 17352 |
| 849 | Ga0496121_0016314 | 3300048924 | Bacteria | 7676 |
| 850 | Ga0496121_0060216 | 3300048924 | Bacteria | 3124 |
| 851 | Ga0496122_0000040 | 3300048925 | Bacteria | 285095 |
| 852 | Ga0496122_0000140 | 3300048925 | Bacteria | 169037 |
| 853 | Ga0496122_0000802 | 3300048925 | Bacteria | 60277 |
| 854 | Ga0496122_0007916 | 3300048925 | Bacteria | 11642 |
| 855 | Ga0496122_0043480 | 3300048925 | Bacteria | 3519 |
| 856 | Ga0496122_0124335 | 3300048925 | Bacteria | 1655 |
| 857 | Ga0496123_0000572 | 3300048926 | Bacteria | 62779 |
| 858 | Ga0496123_0004284 | 3300048926 | Bacteria | 15176 |
| 859 | Ga0496123_0022627 | 3300048926 | Bacteria | 4838 |
| 860 | Ga0496124_0010706 | 3300048927 | Bacteria | 9252 |
| 861 | Ga0496124_0101554 | 3300048927 | Bacteria | 2330 |
| 862 | Ga0496125_0000010 | 3300048928 | Bacteria | 671167 |
| 863 | Ga0496126_0000060 | 3300048929 | Bacteria | 264944 |
| 864 | Ga0496126_0002082 | 3300048929 | Bacteria | 28029 |
| 865 | Ga0496126_0028743 | 3300048929 | Bacteria | 5292 |
| 866 | Ga0496126_0119779 | 3300048929 | Bacteria | 2284 |
| 867 | Ga0496126_0225492 | 3300048929 | Bacteria | 1572 |
| 868 | Ga0501306_009115 | 3300049127 | Bacteria | 1225 |
| 869 | Ga0501308_013235 | 3300049128 | Bacteria | 951 |
| 870 | Ga0501309_016200 | 3300049129 | Bacteria | 1014 |
| 871 | Ga0501341_05108 | 3300049131 | Bacteria | 780 |
| 872 | Ga0501343_003268 | 3300049132 | Bacteria | 1186 |
| 873 | Ga0501305_000306 | 3300049161 | Bacteria | 3821 |
| 874 | Ga0501305_007127 | 3300049161 | Bacteria | 1409 |
| 875 | Ga0501305_013396 | 3300049161 | Bacteria | 1134 |
| 876 | Ga0501307_004411 | 3300049162 | Bacteria | 1434 |
| 877 | Ga0501307_008447 | 3300049162 | Bacteria | 1157 |
| 878 | Ga0501307_015629 | 3300049162 | Bacteria | 939 |
| 879 | Ga0501307_030725 | 3300049162 | Bacteria | 743 |
| 880 | Ga0495678_016742 | 3300049459 | Bacteria | 3341 |
| 881 | Ga0495682_0095818 | 3300049460 | Bacteria | 1065 |
| 882 | Ga0501311_000061 | 3300049527 | Bacteria | 4751 |
| 883 | Ga0501311_000124 | 3300049527 | Bacteria | 3927 |
| 884 | Ga0501312_000051 | 3300049528 | Bacteria | 7173 |
| 885 | Ga0501312_000171 | 3300049528 | Bacteria | 4337 |
| 886 | Ga0501313_000884 | 3300049529 | Bacteria | 2334 |
| 887 | Ga0501314_001682 | 3300049530 | Bacteria | 1634 |
| 888 | Ga0501315_000777 | 3300049531 | Bacteria | 2403 |
| 889 | Ga0501315_032343 | 3300049531 | Bacteria | 759 |
| 890 | Ga0501316_032252 | 3300049532 | Bacteria | 705 |
| 891 | Ga0501317_000397 | 3300049533 | Bacteria | 2969 |
| 892 | Ga0501318_017451 | 3300049534 | Bacteria | 877 |
| 893 | Ga0501319_003952 | 3300049535 | Bacteria | 1014 |
| 894 | Ga0501320_000012 | 3300049536 | Bacteria | 8841 |
| 895 | Ga0501320_001616 | 3300049536 | Bacteria | 1689 |
| 896 | Ga0501321_004655 | 3300049537 | Bacteria | 1321 |
| 897 | Ga0501321_005495 | 3300049537 | Bacteria | 1256 |
| 898 | Ga0501321_006267 | 3300049537 | Bacteria | 1204 |
| 899 | Ga0501323_000549 | 3300049539 | Bacteria | 2838 |
| 900 | Ga0501323_000727 | 3300049539 | Bacteria | 2601 |
| 901 | Ga0501324_016790 | 3300049540 | Bacteria | 721 |
| 902 | Ga0501326_00100 | 3300049542 | Bacteria | 2712 |
| 903 | Ga0501327_01403 | 3300049543 | Bacteria | 1150 |
| 904 | Ga0501328_00508 | 3300049544 | Bacteria | 1328 |
| 905 | Ga0501331_05830 | 3300049547 | Bacteria | 711 |
| 906 | Ga0501332_03127 | 3300049548 | Bacteria | 948 |
| 907 | Ga0501332_03708 | 3300049548 | Bacteria | 891 |
| 908 | Ga0501334_01717 | 3300049550 | Bacteria | 1243 |
| 909 | Ga0501335_004678 | 3300049551 | Bacteria | 1204 |
| 910 | Ga0501335_009713 | 3300049551 | Bacteria | 920 |
| 911 | Ga0501336_001466 | 3300049552 | Bacteria | 1408 |
| 912 | Ga0501338_01561 | 3300049554 | Bacteria | 1241 |
| 913 | Ga0501031_0011709 | 3300049568 | Bacteria | 5721 |
| 914 | Ga0501031_0249142 | 3300049568 | Bacteria | 1154 |
| 915 | Ga0501031_0388182 | 3300049568 | Bacteria | 903 |
| 916 | Ga0501032_0002355 | 3300049569 | Bacteria | 14808 |
| 917 | Ga0501032_0020602 | 3300049569 | Bacteria | 4590 |
| 918 | Ga0501032_0025237 | 3300049569 | Bacteria | 4098 |
| 919 | Ga0501032_0253464 | 3300049569 | Bacteria | 1142 |
| 920 | Ga0501032_0294043 | 3300049569 | Bacteria | 1050 |
| 921 | Ga0501033_0003263 | 3300049570 | Bacteria | 13428 |
| 922 | Ga0501033_0012162 | 3300049570 | Bacteria | 6569 |
| 923 | Ga0501034_0005654 | 3300049571 | Bacteria | 13601 |
| 924 | Ga0501034_0025504 | 3300049571 | Bacteria | 6019 |
| 925 | Ga0501034_0056333 | 3300049571 | Bacteria | 3955 |
| 926 | Ga0501034_0214299 | 3300049571 | Bacteria | 1880 |
| 927 | Ga0501034_0396200 | 3300049571 | Unclassified | 1304 |
| 928 | Ga0501034_0826266 | 3300049571 | Bacteria | 818 |
| 929 | Ga0501036_0332906 | 3300049572 | Bacteria | 1268 |
| 930 | Ga0501036_0603738 | 3300049572 | Bacteria | 910 |
| 931 | Ga0501037_0001372 | 3300049573 | Bacteria | 17876 |
| 932 | Ga0501037_0127086 | 3300049573 | Bacteria | 1829 |
| 933 | Ga0501038_0000314 | 3300049574 | Bacteria | 41462 |
| 934 | Ga0501038_0013134 | 3300049574 | Bacteria | 7553 |
| 935 | Ga0501038_0059410 | 3300049574 | Bacteria | 3275 |
| 936 | Ga0501038_0199794 | 3300049574 | Bacteria | 1605 |
| 937 | Ga0501039_0020620 | 3300049575 | Bacteria | 5050 |
| 938 | Ga0501039_0036074 | 3300049575 | Bacteria | 3814 |
| 939 | Ga0501042_0056670 | 3300049578 | Bacteria | 2796 |
| 940 | Ga0501042_0144574 | 3300049578 | Bacteria | 1715 |
| 941 | Ga0501042_0343336 | 3300049578 | Bacteria | 1079 |
| 942 | Ga0501043_0001324 | 3300049579 | Bacteria | 21677 |
| 943 | Ga0501043_0030616 | 3300049579 | Bacteria | 4230 |
| 944 | Ga0501043_0269409 | 3300049579 | Bacteria | 1307 |
| 945 | Ga0501046_0001012 | 3300049580 | Bacteria | 27395 |
| 946 | Ga0501046_0034206 | 3300049580 | Bacteria | 4102 |
| 947 | Ga0501046_0100330 | 3300049580 | Bacteria | 2221 |
| 948 | Ga0501046_0113833 | 3300049580 | Bacteria | 2064 |
| 949 | Ga0501046_0334541 | 3300049580 | Bacteria | 1101 |
| 950 | Ga0501047_0000250 | 3300049581 | Bacteria | 63699 |
| 951 | Ga0501047_0004195 | 3300049581 | Bacteria | 13568 |
| 952 | Ga0501047_0103652 | 3300049581 | Bacteria | 2725 |
| 953 | Ga0501047_0103968 | 3300049581 | Bacteria | 2720 |
| 954 | Ga0501047_0188557 | 3300049581 | Bacteria | 1926 |
| 955 | Ga0501047_0232735 | 3300049581 | Bacteria | 1695 |
| 956 | Ga0501048_0017992 | 3300049582 | Bacteria | 5200 |
| 957 | Ga0501048_0021518 | 3300049582 | Bacteria | 4723 |
| 958 | Ga0501048_0029557 | 3300049582 | Bacteria | 3972 |
| 959 | Ga0501067_0015294 | 3300049583 | Bacteria | 4246 |
| 960 | Ga0501068_0246210 | 3300049584 | Bacteria | 1138 |
| 961 | Ga0501069_0060151 | 3300049585 | Bacteria | 2120 |
| 962 | Ga0501069_0089872 | 3300049585 | Bacteria | 1736 |
| 963 | Ga0501069_0109992 | 3300049585 | Bacteria | 1568 |
| 964 | Ga0501069_0522550 | 3300049585 | Bacteria | 709 |
| 965 | Ga0501070_0006574 | 3300049586 | Bacteria | 9894 |
| 966 | Ga0501070_0033585 | 3300049586 | Bacteria | 4293 |
| 967 | Ga0501070_0036917 | 3300049586 | Bacteria | 4080 |
| 968 | Ga0501070_0063643 | 3300049586 | Bacteria | 3055 |
| 969 | Ga0501070_0138119 | 3300049586 | Bacteria | 2012 |
| 970 | Ga0501070_0144521 | 3300049586 | Bacteria | 1963 |
| 971 | Ga0501070_0162900 | 3300049586 | Bacteria | 1838 |
| 972 | Ga0501070_0247835 | 3300049586 | Bacteria | 1457 |
| 973 | Ga0501071_0015438 | 3300049587 | Bacteria | 5243 |
| 974 | Ga0501071_0088182 | 3300049587 | Bacteria | 2276 |
| 975 | Ga0501073_0001831 | 3300049589 | Bacteria | 15830 |
| 976 | Ga0501073_0059390 | 3300049589 | Bacteria | 2671 |
| 977 | Ga0501073_0077593 | 3300049589 | Bacteria | 2311 |
| 978 | Ga0501073_0588853 | 3300049589 | Bacteria | 768 |
| 979 | Ga0501074_0000980 | 3300049590 | Bacteria | 18498 |
| 980 | Ga0501074_0060097 | 3300049590 | Bacteria | 2737 |
| 981 | Ga0501074_0069493 | 3300049590 | Bacteria | 2532 |
| 982 | Ga0501074_0148950 | 3300049590 | Bacteria | 1673 |
| 983 | Ga0501074_0154724 | 3300049590 | Bacteria | 1638 |
| 984 | Ga0501076_0515508 | 3300049592 | Bacteria | 986 |
| 985 | Ga0501079_0213512 | 3300049741 | Bacteria | 1507 |
| 986 | Ga0501079_0285027 | 3300049741 | Bacteria | 1291 |
| 987 | Ga0501079_0374970 | 3300049741 | Bacteria | 1115 |
| 988 | Ga0501080_0002282 | 3300049742 | Bacteria | 16696 |
| 989 | Ga0501080_0021405 | 3300049742 | Bacteria | 5985 |
| 990 | Ga0501080_0049719 | 3300049742 | Bacteria | 3902 |
| 991 | Ga0501080_0062331 | 3300049742 | Bacteria | 3470 |
| 992 | Ga0501080_0089179 | 3300049742 | Bacteria | 2865 |
| 993 | Ga0501080_0107130 | 3300049742 | Bacteria | 2590 |
| 994 | Ga0501081_0073960 | 3300049743 | Bacteria | 2377 |
| 995 | Ga0501083_0057300 | 3300049744 | Bacteria | 2608 |
| 996 | Ga0501083_0154216 | 3300049744 | Bacteria | 1504 |
| 997 | Ga0501035_0000666 | 3300049822 | Bacteria | 37861 |
| 998 | Ga0501035_0043368 | 3300049822 | Bacteria | 4053 |
| 999 | Ga0501035_0069939 | 3300049822 | Bacteria | 3110 |
| 1000 | Ga0501035_0307897 | 3300049822 | Bacteria | 1333 |
| 1001 | Ga0501035_0508787 | 3300049822 | Bacteria | 991 |
| 1002 | Ga0501035_0742204 | 3300049822 | Bacteria | 788 |
| 1003 | Ga0501035_0769091 | 3300049822 | Bacteria | 771 |
| 1004 | Ga0501044_0004802 | 3300049823 | Bacteria | 15112 |
| 1005 | Ga0501044_0017351 | 3300049823 | Bacteria | 7721 |
| 1006 | Ga0501044_0154438 | 3300049823 | Bacteria | 2275 |
| 1007 | Ga0501044_0199878 | 3300049823 | Bacteria | 1957 |
| 1008 | Ga0501044_0406799 | 3300049823 | Bacteria | 1272 |
| 1009 | Ga0501044_0590676 | 3300049823 | Bacteria | 1004 |
| 1010 | Ga0501045_0273922 | 3300049824 | Bacteria | 1256 |
| 1011 | nmdc:mga0n895_277153_c1 | 3300050512 | Bacteria | 1701 |
| 1012 | nmdc:mga0rr50_215952_c1 | 3300050513 | Bacteria | 1582 |
| 1013 | nmdc:mga0rr50_437874_c1 | 3300050513 | Bacteria | 1107 |
| 1014 | nmdc:mga0rr50_517934_c1 | 3300050513 | Unclassified | 1015 |
| 1015 | nmdc:mga0rr50_73583_c1 | 3300050513 | Bacteria | 2613 |
| 1016 | nmdc:mga08x19_365_c1 | 3300050514 | Bacteria | 32003 |
| 1017 | nmdc:mga08x19_57597_c1 | 3300050514 | Bacteria | 2512 |
| 1018 | nmdc:mga0a205_903698_c1 | 3300050515 | Bacteria | 730 |
| 1019 | Ga0495601_0003409 | 3300053077 | Bacteria | 9110 |
| 1020 | Ga0495601_0015194 | 3300053077 | Bacteria | 4651 |
| 1021 | Ga0495612_0000369 | 3300053078 | Bacteria | 18070 |
| 1022 | Ga0495612_0000772 | 3300053078 | Bacteria | 13040 |
| 1023 | Ga0495619_0130096 | 3300053085 | Bacteria | 1729 |
| 1024 | Ga0500647_0000104 | 3300053091 | Bacteria | 16366 |
| 1025 | Ga0500648_000010 | 3300053097 | Bacteria | 53408 |
| 1026 | Ga0500556_0000303 | 3300053104 | Bacteria | 37613 |
| 1027 | Ga0500585_099340 | 3300053144 | Bacteria | 1049 |
| 1028 | Ga0500586_095330 | 3300053145 | Bacteria | 1044 |
| 1029 | Ga0500620_109363 | 3300053155 | Bacteria | 968 |
| 1030 | Ga0500633_0015716 | 3300053160 | Bacteria | 2178 |
| 1031 | Ga0500599_000007 | 3300053736 | Bacteria | 77262 |
| 1032 | Ga0501084_0245529 | 3300054114 | Bacteria | 1511 |
| 1033 | Ga0501084_0576817 | 3300054114 | Bacteria | 950 |
| 1034 | Ga0587073_0001891 | 3300059492 | Bacteria | 2575 |
| 1035 | Ga0587088_001539 | 3300059508 | Bacteria | 2415 |
| 1036 | Ga0587106_000089 | 3300059605 | Bacteria | 4305 |
| 1037 | Ga0587101_006283 | 3300059623 | Bacteria | 1356 |
| 1038 | Ga0587075_006913 | 3300059644 | Bacteria | 1408 |
| 1039 | Ga0587076_017558 | 3300059645 | Bacteria | 1142 |
| 1040 | Ga0587079_003247 | 3300059647 | Bacteria | 2100 |
| 1041 | Ga0587111_0101286 | 3300060346 | Bacteria | 718 |
| 1042 | Ga0501082_0146414 | 3300060353 | Bacteria | 2050 |
| 1043 | Ga0501082_0507194 | 3300060353 | Bacteria | 1054 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046463 | Ga0495653_0668187 | Ga0495653_0668187_22_540 | 172 |
| 2 | 3300035117 | Ga0373953_0066494 | Ga0373953_0066494_355_1092 | 174 |
| 3 | 3300035118 | Ga0373954_0015764 | Ga0373954_0015764_373_1110 | 174 |
| 4 | 3300003759 | Ga0055525_1000111 | Ga0055525_100011138 | 177 |
| 5 | 3300003760 | Ga0055527_1001334 | Ga0055527_10013342 | 177 |
| 6 | 3300003761 | Ga0055535_1004862 | Ga0055535_10048626 | 177 |
| 7 | 3300003762 | Ga0055542_1004903 | Ga0055542_10049031 | 177 |
| 8 | 3300025228 | Ga0209672_100004 | Ga0209672_1000041295 | 177 |
| 9 | 3300025230 | Ga0209563_100103 | Ga0209563_10010338 | 177 |
| 10 | 3300025242 | Ga0209258_100003 | Ga0209258_1000031295 | 177 |
| 11 | 3300025254 | Ga0209148_1000025 | Ga0209148_1000025599 | 177 |
| 12 | 3300025272 | Ga0209455_1000004 | Ga0209455_10000041295 | 177 |
| 13 | 3300053104 | Ga0500556_0000303 | Ga0500556_0000303_5450_6109 | 177 |
| 14 | 3300053160 | Ga0500633_0015716 | Ga0500633_0015716_1430_2089 | 177 |
| 15 | 3300053736 | Ga0500599_000007 | Ga0500599_000007_55052_55711 | 177 |
| 16 | 3300002705 | JGI25156J39149_1003296 | JGI25156J39149_10032964 | 178 |
| 17 | 3300002741 | JGI25157J39369_1001750 | JGI25157J39369_100175013 | 178 |
| 18 | 3300025250 | Ga0209026_1000060 | Ga0209026_10000603 | 178 |
| 19 | 3300025256 | Ga0209759_1001919 | Ga0209759_10019193 | 178 |
| 20 | 3300037312 | Ga0395899_0001959 | Ga0395899_0001959_15206_15847 | 178 |
| 21 | 3300037466 | Ga0395898_0000558 | Ga0395898_0000558_1060_1701 | 178 |
| 22 | 3300044656 | Ga0466969_0008941 | Ga0466969_0008941_3920_4561 | 178 |
| 23 | 3300044684 | Ga0466966_0002549 | Ga0466966_0002549_851_1492 | 178 |
| 24 | 3300044693 | Ga0466961_0085616 | Ga0466961_0085616_999_1640 | 178 |
| 25 | 3300044719 | Ga0466971_0033841 | Ga0466971_0033841_1504_2145 | 178 |
| 26 | 3300044765 | Ga0466970_0088960 | Ga0466970_0088960_211_852 | 178 |
| 27 | 3300045049 | Ga0466959_0072597 | Ga0466959_0072597_999_1640 | 178 |
| 28 | 3300045836 | Ga0466958_0045436 | Ga0466958_0045436_1323_1964 | 178 |
| 29 | 3300001915 | JGI24741J21665_1004799 | JGI24741J21665_10047994 | 186 |
| 30 | 3300005336 | Ga0070680_100126748 | Ga0070680_1001267482 | 186 |
| 31 | 3300005344 | Ga0070661_100097541 | Ga0070661_1000975413 | 186 |
| 32 | 3300005345 | Ga0070692_10124727 | Ga0070692_101247273 | 186 |
| 33 | 3300005455 | Ga0070663_100199061 | Ga0070663_1001990612 | 186 |
| 34 | 3300005539 | Ga0068853_100167153 | Ga0068853_1001671532 | 186 |
| 35 | 3300005578 | Ga0068854_100099085 | Ga0068854_1000990853 | 186 |
| 36 | 3300005616 | Ga0068852_100134375 | Ga0068852_1001343753 | 186 |
| 37 | 3300009093 | Ga0105240_10261623 | Ga0105240_102616233 | 186 |
| 38 | 3300013102 | Ga0157371_10153337 | Ga0157371_101533372 | 186 |
| 39 | 3300013105 | Ga0157369_10185505 | Ga0157369_101855053 | 186 |
| 40 | 3300025909 | Ga0207705_10118746 | Ga0207705_101187463 | 186 |
| 41 | 3300025913 | Ga0207695_10217754 | Ga0207695_102177543 | 186 |
| 42 | 3300025919 | Ga0207657_10122412 | Ga0207657_101224123 | 186 |
| 43 | 3300025920 | Ga0207649_10014504 | Ga0207649_100145044 | 186 |
| 44 | 3300025932 | Ga0207690_10034320 | Ga0207690_100343203 | 186 |
| 45 | 3300025949 | Ga0207667_10009904 | Ga0207667_1000990422 | 186 |
| 46 | 3300025981 | Ga0207640_10059031 | Ga0207640_100590313 | 186 |
| 47 | 3300026041 | Ga0207639_10000231 | Ga0207639_100002317 | 186 |
| 48 | 3300026067 | Ga0207678_10130950 | Ga0207678_101309503 | 186 |
| 49 | 3300026142 | Ga0207698_10004871 | Ga0207698_100048713 | 186 |
| 50 | 3300005617 | Ga0068859_100678814 | Ga0068859_1006788142 | 188 |
| 51 | 3300006931 | Ga0097620_100678845 | Ga0097620_1006788452 | 188 |
| 52 | 3300025294 | Ga0209025_1044140 | Ga0209025_10441402 | 189 |
| 53 | 3300041461 | Ga0451805_117344 | Ga0451805_117344_159_734 | 191 |
| 54 | 3300049127 | Ga0501306_009115 | Ga0501306_009115_352_981 | 191 |
| 55 | 3300049128 | Ga0501308_013235 | Ga0501308_013235_202_831 | 191 |
| 56 | 3300049129 | Ga0501309_016200 | Ga0501309_016200_372_1001 | 191 |
| 57 | 3300049131 | Ga0501341_05108 | Ga0501341_05108_114_740 | 191 |
| 58 | 3300049529 | Ga0501313_000884 | Ga0501313_000884_511_1140 | 191 |
| 59 | 3300049532 | Ga0501316_032252 | Ga0501316_032252_36_665 | 191 |
| 60 | 3300049547 | Ga0501331_05830 | Ga0501331_05830_31_660 | 191 |
| 61 | 3300007265 | Ga0099794_10227996 | Ga0099794_102279962 | 192 |
| 62 | 3300041512 | Ga0451853_1157729 | Ga0451853_1157729_188_829 | 192 |
| 63 | 3300049132 | Ga0501343_003268 | Ga0501343_003268_112_741 | 192 |
| 64 | 3300049161 | Ga0501305_013396 | Ga0501305_013396_490_1119 | 192 |
| 65 | 3300049527 | Ga0501311_000124 | Ga0501311_000124_3087_3716 | 192 |
| 66 | 3300049528 | Ga0501312_000171 | Ga0501312_000171_3177_3806 | 192 |
| 67 | 3300049531 | Ga0501315_032343 | Ga0501315_032343_19_648 | 192 |
| 68 | 3300049535 | Ga0501319_003952 | Ga0501319_003952_309_938 | 192 |
| 69 | 3300049537 | Ga0501321_004655 | Ga0501321_004655_581_1210 | 192 |
| 70 | 3300049539 | Ga0501323_000549 | Ga0501323_000549_562_1191 | 192 |
| 71 | 3300049540 | Ga0501324_016790 | Ga0501324_016790_71_700 | 192 |
| 72 | 3300049542 | Ga0501326_00100 | Ga0501326_00100_533_1162 | 192 |
| 73 | 3300049543 | Ga0501327_01403 | Ga0501327_01403_410_1039 | 192 |
| 74 | 3300049544 | Ga0501328_00508 | Ga0501328_00508_433_1062 | 192 |
| 75 | 3300049548 | Ga0501332_03127 | Ga0501332_03127_302_931 | 192 |
| 76 | 3300049550 | Ga0501334_01717 | Ga0501334_01717_264_893 | 192 |
| 77 | 3300049551 | Ga0501335_004678 | Ga0501335_004678_117_746 | 192 |
| 78 | 3300049552 | Ga0501336_001466 | Ga0501336_001466_261_890 | 192 |
| 79 | 3300049554 | Ga0501338_01561 | Ga0501338_01561_501_1130 | 192 |
| 80 | 3300003763 | Ga0055529_1003204 | Ga0055529_10032042 | 193 |
| 81 | 3300005327 | Ga0070658_10424499 | Ga0070658_104244992 | 193 |
| 82 | 3300005336 | Ga0070680_100024646 | Ga0070680_1000246468 | 193 |
| 83 | 3300005366 | Ga0070659_100138001 | Ga0070659_1001380012 | 193 |
| 84 | 3300005455 | Ga0070663_100155767 | Ga0070663_1001557672 | 193 |
| 85 | 3300005458 | Ga0070681_10038165 | Ga0070681_100381658 | 193 |
| 86 | 3300005530 | Ga0070679_100040938 | Ga0070679_1000409382 | 193 |
| 87 | 3300005578 | Ga0068854_100054151 | Ga0068854_1000541512 | 193 |
| 88 | 3300009093 | Ga0105240_10282025 | Ga0105240_102820253 | 193 |
| 89 | 3300013104 | Ga0157370_10320909 | Ga0157370_103209092 | 193 |
| 90 | 3300013307 | Ga0157372_10411246 | Ga0157372_104112462 | 193 |
| 91 | 3300025909 | Ga0207705_10173090 | Ga0207705_101730903 | 193 |
| 92 | 3300025912 | Ga0207707_10237996 | Ga0207707_102379963 | 193 |
| 93 | 3300025917 | Ga0207660_10034597 | Ga0207660_100345976 | 193 |
| 94 | 3300025921 | Ga0207652_10033428 | Ga0207652_100334283 | 193 |
| 95 | 3300025949 | Ga0207667_10259410 | Ga0207667_102594102 | 193 |
| 96 | 3300026067 | Ga0207678_10220963 | Ga0207678_102209632 | 193 |
| 97 | 3300049162 | Ga0501307_015629 | Ga0501307_015629_277_906 | 193 |
| 98 | 3300049533 | Ga0501317_000397 | Ga0501317_000397_564_1193 | 193 |
| 99 | 3300049537 | Ga0501321_005495 | Ga0501321_005495_516_1145 | 193 |
| 100 | 3300049569 | Ga0501032_0253464 | Ga0501032_0253464_229_870 | 193 |
| 101 | 3300049572 | Ga0501036_0332906 | Ga0501036_0332906_263_904 | 193 |
| 102 | 3300049581 | Ga0501047_0103652 | Ga0501047_0103652_1743_2384 | 193 |
| 103 | 3300049585 | Ga0501069_0089872 | Ga0501069_0089872_296_937 | 193 |
| 104 | 3300049586 | Ga0501070_0006574 | Ga0501070_0006574_473_1114 | 193 |
| 105 | 3300049586 | Ga0501070_0063643 | Ga0501070_0063643_1155_1796 | 193 |
| 106 | 3300049587 | Ga0501071_0015438 | Ga0501071_0015438_4129_4770 | 193 |
| 107 | 3300049589 | Ga0501073_0001831 | Ga0501073_0001831_14793_15434 | 193 |
| 108 | 3300049590 | Ga0501074_0000980 | Ga0501074_0000980_17627_18268 | 193 |
| 109 | 3300049741 | Ga0501079_0213512 | Ga0501079_0213512_504_1145 | 193 |
| 110 | 3300049742 | Ga0501080_0002282 | Ga0501080_0002282_542_1183 | 193 |
| 111 | 3300049822 | Ga0501035_0307897 | Ga0501035_0307897_384_1025 | 193 |
| 112 | 3300049823 | Ga0501044_0017351 | Ga0501044_0017351_4916_5557 | 193 |
| 113 | 3300046680 | Ga0495646_0249493 | Ga0495646_0249493_31_648 | 194 |
| 114 | 3300049574 | Ga0501038_0059410 | Ga0501038_0059410_288_929 | 195 |
| 115 | 3300049586 | Ga0501070_0247835 | Ga0501070_0247835_380_1021 | 195 |
| 116 | 3300049590 | Ga0501074_0069493 | Ga0501074_0069493_1070_1711 | 195 |
| 117 | 3300049742 | Ga0501080_0021405 | Ga0501080_0021405_4765_5406 | 195 |
| 118 | 3300049822 | Ga0501035_0742204 | Ga0501035_0742204_32_673 | 195 |
| 119 | 3300049823 | Ga0501044_0199878 | Ga0501044_0199878_999_1640 | 195 |
| 120 | 3300025921 | Ga0207652_10669003 | Ga0207652_106690032 | 196 |
| 121 | 3300048927 | Ga0496124_0010706 | Ga0496124_0010706_5275_5916 | 196 |
| 122 | 3300049537 | Ga0501321_006267 | Ga0501321_006267_582_1181 | 196 |
| 123 | 3300049548 | Ga0501332_03708 | Ga0501332_03708_277_876 | 196 |
| 124 | 3300049551 | Ga0501335_009713 | Ga0501335_009713_14_613 | 196 |
| 125 | 3300044735 | Ga0466968_0222672 | Ga0466968_0222672_100_717 | 198 |
| 126 | 3300046472 | Ga0495580_0132657 | Ga0495580_0132657_1106_1711 | 198 |
| 127 | 3300049571 | Ga0501034_0396200 | Ga0501034_0396200_259_861 | 198 |
| 128 | iso_pu_bacteria | 2895395659 | 2895397474 | 198 |
| 129 | 3300046689 | Ga0495613_0214634 | Ga0495613_0214634_18_638 | 199 |
| 130 | iso_pu_bacteria | 2881644220 | 2881649638 | 199 |
| 131 | 3300046463 | Ga0495653_0004713 | Ga0495653_0004713_3653_4270 | 200 |
| 132 | 3300046514 | Ga0495618_0000035 | Ga0495618_0000035_81346_81963 | 200 |
| 133 | 3300046543 | Ga0495645_0000033 | Ga0495645_0000033_21376_21993 | 200 |
| 134 | 3300049162 | Ga0501307_004411 | Ga0501307_004411_537_1166 | 200 |
| 135 | 3300049536 | Ga0501320_000012 | Ga0501320_000012_7924_8553 | 200 |
| 136 | 3300053077 | Ga0495601_0003409 | Ga0495601_0003409_1181_1798 | 200 |
| 137 | 3300053078 | Ga0495612_0000369 | Ga0495612_0000369_11551_12168 | 200 |
| 138 | iso_pu_bacteria | 8055531788 | 8055533618 | 200 |
| 139 | 3300009551 | Ga0105238_10214402 | Ga0105238_102144022 | 202 |
| 140 | 3300010375 | Ga0105239_10006660 | Ga0105239_100066603 | 202 |
| 141 | 3300010375 | Ga0105239_10053763 | Ga0105239_100537633 | 202 |
| 142 | 3300013102 | Ga0157371_10500069 | Ga0157371_105000692 | 202 |
| 143 | 3300013306 | Ga0163162_10070045 | Ga0163162_100700453 | 202 |
| 144 | 3300014969 | Ga0157376_10219585 | Ga0157376_102195853 | 202 |
| 145 | 3300020069 | Ga0197907_10574318 | Ga0197907_105743182 | 202 |
| 146 | 3300031727 | Ga0316576_10006052 | Ga0316576_100060524 | 202 |
| 147 | 3300031727 | Ga0316576_10187240 | Ga0316576_101872402 | 202 |
| 148 | 3300034820 | Ga0373959_0043986 | Ga0373959_0043986_129_743 | 202 |
| 149 | 3300035398 | Ga0316574_0051750 | Ga0316574_0051750_1443_2051 | 202 |
| 150 | 3300041441 | Ga0451787_149821 | Ga0451787_149821_940_1551 | 202 |
| 151 | 3300041446 | Ga0451794_28977 | Ga0451794_28977_682_1290 | 202 |
| 152 | 3300041452 | Ga0451793_0393032 | Ga0451793_0393032_861_1469 | 202 |
| 153 | 3300041494 | Ga0451837_0589056 | Ga0451837_0589056_365_976 | 202 |
| 154 | 3300042438 | Ga0439459_0002369 | Ga0439459_0002369_263_871 | 202 |
| 155 | 3300044658 | Ga0466972_0000416 | Ga0466972_0000416_2071_2682 | 202 |
| 156 | 3300044765 | Ga0466970_0000139 | Ga0466970_0000139_1149_1760 | 202 |
| 157 | 3300046460 | Ga0495638_0000007 | Ga0495638_0000007_600180_600788 | 202 |
| 158 | 3300046471 | Ga0495650_0000202 | Ga0495650_0000202_11856_12464 | 202 |
| 159 | 3300046507 | Ga0495606_0001329 | Ga0495606_0001329_32015_32623 | 202 |
| 160 | 3300046557 | Ga0495622_0040458 | Ga0495622_0040458_1476_2084 | 202 |
| 161 | 3300046660 | Ga0495625_0016676 | Ga0495625_0016676_1411_2019 | 202 |
| 162 | 3300046694 | Ga0495649_0000383 | Ga0495649_0000383_1327_1935 | 202 |
| 163 | 3300048903 | Ga0496100_0473313 | Ga0496100_0473313_325_933 | 202 |
| 164 | 3300048904 | Ga0496101_0243688 | Ga0496101_0243688_775_1383 | 202 |
| 165 | 3300048907 | Ga0496104_0159892 | Ga0496104_0159892_1274_1882 | 202 |
| 166 | 3300048908 | Ga0496105_0041905 | Ga0496105_0041905_793_1401 | 202 |
| 167 | 3300048917 | Ga0496114_0055393 | Ga0496114_0055393_733_1341 | 202 |
| 168 | 3300048918 | Ga0496115_0145132 | Ga0496115_0145132_1328_1936 | 202 |
| 169 | 3300048920 | Ga0496117_0032904 | Ga0496117_0032904_2860_3471 | 202 |
| 170 | 3300048920 | Ga0496117_0063248 | Ga0496117_0063248_1653_2261 | 202 |
| 171 | 3300048921 | Ga0496118_0001647 | Ga0496118_0001647_1031_1642 | 202 |
| 172 | 3300048921 | Ga0496118_0092393 | Ga0496118_0092393_905_1513 | 202 |
| 173 | 3300048922 | Ga0496119_0016519 | Ga0496119_0016519_1260_1868 | 202 |
| 174 | 3300048923 | Ga0496120_0035080 | Ga0496120_0035080_2171_2779 | 202 |
| 175 | 3300048924 | Ga0496121_0016314 | Ga0496121_0016314_2093_2701 | 202 |
| 176 | 3300048924 | Ga0496121_0060216 | Ga0496121_0060216_465_1073 | 202 |
| 177 | 3300048929 | Ga0496126_0028743 | Ga0496126_0028743_1564_2172 | 202 |
| 178 | 3300048929 | Ga0496126_0225492 | Ga0496126_0225492_515_1126 | 202 |
| 179 | 3300049459 | Ga0495678_016742 | Ga0495678_016742_2273_2881 | 202 |
| 180 | 3300049460 | Ga0495682_0095818 | Ga0495682_0095818_229_837 | 202 |
| 181 | 3300049568 | Ga0501031_0011709 | Ga0501031_0011709_4249_4860 | 202 |
| 182 | 3300049569 | Ga0501032_0002355 | Ga0501032_0002355_878_1489 | 202 |
| 183 | 3300049569 | Ga0501032_0020602 | Ga0501032_0020602_3191_3805 | 202 |
| 184 | 3300049570 | Ga0501033_0003263 | Ga0501033_0003263_869_1480 | 202 |
| 185 | 3300049571 | Ga0501034_0005654 | Ga0501034_0005654_211_822 | 202 |
| 186 | 3300049571 | Ga0501034_0025504 | Ga0501034_0025504_786_1400 | 202 |
| 187 | 3300049573 | Ga0501037_0001372 | Ga0501037_0001372_15527_16138 | 202 |
| 188 | 3300049574 | Ga0501038_0000314 | Ga0501038_0000314_582_1193 | 202 |
| 189 | 3300049575 | Ga0501039_0020620 | Ga0501039_0020620_686_1297 | 202 |
| 190 | 3300049575 | Ga0501039_0036074 | Ga0501039_0036074_2093_2707 | 202 |
| 191 | 3300049579 | Ga0501043_0001324 | Ga0501043_0001324_20195_20806 | 202 |
| 192 | 3300049580 | Ga0501046_0001012 | Ga0501046_0001012_853_1464 | 202 |
| 193 | 3300049581 | Ga0501047_0004195 | Ga0501047_0004195_12077_12688 | 202 |
| 194 | 3300049582 | Ga0501048_0017992 | Ga0501048_0017992_64_675 | 202 |
| 195 | 3300049585 | Ga0501069_0522550 | Ga0501069_0522550_15_626 | 202 |
| 196 | 3300049589 | Ga0501073_0077593 | Ga0501073_0077593_224_835 | 202 |
| 197 | 3300049742 | Ga0501080_0089179 | Ga0501080_0089179_2131_2742 | 202 |
| 198 | 3300049822 | Ga0501035_0000666 | Ga0501035_0000666_18692_19303 | 202 |
| 199 | 3300049823 | Ga0501044_0004802 | Ga0501044_0004802_13625_14236 | 202 |
| 200 | 3300049823 | Ga0501044_0590676 | Ga0501044_0590676_31_639 | 202 |
| 201 | 3300054114 | Ga0501084_0576817 | Ga0501084_0576817_15_629 | 202 |
| 202 | iso_pu_bacteria | 2857604169 | 2857608873 | 203 |
| 203 | iso_pu_bacteria | 2857609550 | 2857613416 | 203 |
| 204 | 3300003751 | Ga0055538_1000196 | Ga0055538_10001964 | 204 |
| 205 | 3300025224 | Ga0209784_100310 | Ga0209784_1003103 | 204 |
| 206 | iso_pu_bacteria | 2512564013 | 2512635739 | 204 |
| 207 | iso_pu_bacteria | 2857465823 | 2857472351 | 204 |
| 208 | iso_pu_bacteria | 2857591370 | 2857597784 | 204 |
| 209 | iso_pu_bacteria | 2915597211 | 2915598703 | 204 |
| 210 | iso_pu_bacteria | 2929183550 | 2929183849 | 204 |
| 211 | 3300005563 | Ga0068855_101050573 | Ga0068855_1010505732 | 205 |
| 212 | 3300005615 | Ga0070702_100051791 | Ga0070702_1000517912 | 205 |
| 213 | 3300005616 | Ga0068852_100991777 | Ga0068852_1009917772 | 205 |
| 214 | 3300017792 | Ga0163161_10539761 | Ga0163161_105397612 | 205 |
| 215 | 3300025927 | Ga0207687_10234006 | Ga0207687_102340062 | 205 |
| 216 | 3300026023 | Ga0207677_10157745 | Ga0207677_101577452 | 205 |
| 217 | 3300026075 | Ga0207708_10509884 | Ga0207708_105098842 | 205 |
| 218 | 3300026078 | Ga0207702_10744510 | Ga0207702_107445102 | 205 |
| 219 | 3300026118 | Ga0207675_101176735 | Ga0207675_1011767351 | 205 |
| 220 | 3300031665 | Ga0316575_10141054 | Ga0316575_101410541 | 205 |
| 221 | 3300031728 | Ga0316578_10032616 | Ga0316578_100326162 | 205 |
| 222 | 3300031901 | Ga0307406_10105057 | Ga0307406_101050572 | 205 |
| 223 | 3300045976 | Ga0466967_0729083 | Ga0466967_0729083_279_896 | 205 |
| 224 | 3300046462 | Ga0495651_0369488 | Ga0495651_0369488_256_873 | 205 |
| 225 | 3300046477 | Ga0495664_0000007 | Ga0495664_0000007_122974_123591 | 205 |
| 226 | 3300046517 | Ga0495630_0000610 | Ga0495630_0000610_23334_23951 | 205 |
| 227 | 3300046675 | Ga0495657_0000027 | Ga0495657_0000027_108456_109073 | 205 |
| 228 | 3300046809 | Ga0495600_0041791 | Ga0495600_0041791_272_889 | 205 |
| 229 | 3300047471 | Ga0495684_0093585 | Ga0495684_0093585_1083_1700 | 205 |
| 230 | 3300048905 | Ga0496102_0000002 | Ga0496102_0000002_648095_648712 | 205 |
| 231 | 3300048906 | Ga0496103_0000017 | Ga0496103_0000017_241312_241929 | 205 |
| 232 | 3300048911 | Ga0496108_0647932 | Ga0496108_0647932_96_713 | 205 |
| 233 | 3300048912 | Ga0496109_0004801 | Ga0496109_0004801_3989_4606 | 205 |
| 234 | 3300048913 | Ga0496110_0517704 | Ga0496110_0517704_283_900 | 205 |
| 235 | 3300053077 | Ga0495601_0015194 | Ga0495601_0015194_1316_1933 | 205 |
| 236 | iso_pu_bacteria | 8007371054 | 8007374602 | 205 |
| 237 | 3300026067 | Ga0207678_10924653 | Ga0207678_109246531 | 206 |
| 238 | 3300033527 | Ga0316586_1000008 | Ga0316586_100000820 | 206 |
| 239 | 3300048925 | Ga0496122_0124335 | Ga0496122_0124335_534_1154 | 206 |
| 240 | 3300005434 | Ga0070709_10000076 | Ga0070709_1000007626 | 207 |
| 241 | 3300006173 | Ga0070716_100380441 | Ga0070716_1003804411 | 207 |
| 242 | 3300025939 | Ga0207665_10409253 | Ga0207665_104092531 | 207 |
| 243 | 3300049161 | Ga0501305_000306 | Ga0501305_000306_2438_3070 | 207 |
| 244 | 3300049528 | Ga0501312_000051 | Ga0501312_000051_430_1062 | 207 |
| 245 | 3300049531 | Ga0501315_000777 | Ga0501315_000777_1418_2050 | 207 |
| 246 | 3300049534 | Ga0501318_017451 | Ga0501318_017451_52_684 | 207 |
| 247 | 3300053091 | Ga0500647_0000104 | Ga0500647_0000104_1525_2190 | 207 |
| 248 | 3300053097 | Ga0500648_000010 | Ga0500648_000010_13948_14613 | 207 |
| 249 | 3300053144 | Ga0500585_099340 | Ga0500585_099340_127_792 | 207 |
| 250 | 3300053145 | Ga0500586_095330 | Ga0500586_095330_107_772 | 207 |
| 251 | 3300006871 | Ga0075434_100195641 | Ga0075434_1001956412 | 208 |
| 252 | 3300037312 | Ga0395899_0432225 | Ga0395899_0432225_138_764 | 208 |
| 253 | 3300044656 | Ga0466969_0001060 | Ga0466969_0001060_13684_14310 | 208 |
| 254 | 3300044683 | Ga0466965_0049044 | Ga0466965_0049044_818_1444 | 208 |
| 255 | 3300044693 | Ga0466961_0025162 | Ga0466961_0025162_2309_2935 | 208 |
| 256 | 3300044735 | Ga0466968_0016253 | Ga0466968_0016253_1523_2149 | 208 |
| 257 | 3300045049 | Ga0466959_0003175 | Ga0466959_0003175_8219_8845 | 208 |
| 258 | 3300048924 | Ga0496121_0002121 | Ga0496121_0002121_492_1151 | 208 |
| 259 | 3300049527 | Ga0501311_000061 | Ga0501311_000061_3682_4311 | 208 |
| 260 | 3300049530 | Ga0501314_001682 | Ga0501314_001682_509_1138 | 208 |
| 261 | 3300049536 | Ga0501320_001616 | Ga0501320_001616_10_639 | 208 |
| 262 | 3300049539 | Ga0501323_000727 | Ga0501323_000727_1437_2066 | 208 |
| 263 | 3300005295 | Ga0065707_10183525 | Ga0065707_101835252 | 209 |
| 264 | 3300005356 | Ga0070674_100287754 | Ga0070674_1002877541 | 209 |
| 265 | 3300005434 | Ga0070709_10034187 | Ga0070709_100341873 | 209 |
| 266 | 3300005436 | Ga0070713_100020295 | Ga0070713_1000202952 | 209 |
| 267 | 3300005436 | Ga0070713_100037982 | Ga0070713_1000379822 | 209 |
| 268 | 3300005439 | Ga0070711_100001449 | Ga0070711_1000014499 | 209 |
| 269 | 3300005439 | Ga0070711_100007565 | Ga0070711_1000075656 | 209 |
| 270 | 3300005440 | Ga0070705_100127227 | Ga0070705_1001272271 | 209 |
| 271 | 3300005444 | Ga0070694_100058419 | Ga0070694_1000584193 | 209 |
| 272 | 3300005445 | Ga0070708_100035523 | Ga0070708_1000355237 | 209 |
| 273 | 3300005445 | Ga0070708_100311587 | Ga0070708_1003115872 | 209 |
| 274 | 3300005445 | Ga0070708_100318751 | Ga0070708_1003187512 | 209 |
| 275 | 3300005458 | Ga0070681_10164806 | Ga0070681_101648062 | 209 |
| 276 | 3300005459 | Ga0068867_100200101 | Ga0068867_1002001012 | 209 |
| 277 | 3300005467 | Ga0070706_100119495 | Ga0070706_1001194953 | 209 |
| 278 | 3300005468 | Ga0070707_100192686 | Ga0070707_1001926863 | 209 |
| 279 | 3300005471 | Ga0070698_100361005 | Ga0070698_1003610052 | 209 |
| 280 | 3300005518 | Ga0070699_100023687 | Ga0070699_1000236874 | 209 |
| 281 | 3300005530 | Ga0070679_100019420 | Ga0070679_1000194203 | 209 |
| 282 | 3300005536 | Ga0070697_100006091 | Ga0070697_1000060913 | 209 |
| 283 | 3300005536 | Ga0070697_100049282 | Ga0070697_1000492826 | 209 |
| 284 | 3300005545 | Ga0070695_100005390 | Ga0070695_1000053903 | 209 |
| 285 | 3300005545 | Ga0070695_100077726 | Ga0070695_1000777262 | 209 |
| 286 | 3300005546 | Ga0070696_100004505 | Ga0070696_1000045053 | 209 |
| 287 | 3300005547 | Ga0070693_100000494 | Ga0070693_1000004943 | 209 |
| 288 | 3300005548 | Ga0070665_100000700 | Ga0070665_10000070028 | 209 |
| 289 | 3300005549 | Ga0070704_100013476 | Ga0070704_1000134768 | 209 |
| 290 | 3300005841 | Ga0068863_100012596 | Ga0068863_1000125964 | 209 |
| 291 | 3300006028 | Ga0070717_10659450 | Ga0070717_106594501 | 209 |
| 292 | 3300006173 | Ga0070716_100092179 | Ga0070716_1000921793 | 209 |
| 293 | 3300006175 | Ga0070712_100057688 | Ga0070712_1000576882 | 209 |
| 294 | 3300006871 | Ga0075434_100278025 | Ga0075434_1002780252 | 209 |
| 295 | 3300006881 | Ga0068865_100440219 | Ga0068865_1004402192 | 209 |
| 296 | 3300006914 | Ga0075436_100051741 | Ga0075436_1000517413 | 209 |
| 297 | 3300006914 | Ga0075436_100125917 | Ga0075436_1001259172 | 209 |
| 298 | 3300007076 | Ga0075435_100021456 | Ga0075435_1000214562 | 209 |
| 299 | 3300007076 | Ga0075435_100176685 | Ga0075435_1001766852 | 209 |
| 300 | 3300007265 | Ga0099794_10033018 | Ga0099794_100330183 | 209 |
| 301 | 3300007265 | Ga0099794_10216173 | Ga0099794_102161731 | 209 |
| 302 | 3300007265 | Ga0099794_10222807 | Ga0099794_102228071 | 209 |
| 303 | 3300009176 | Ga0105242_10341696 | Ga0105242_103416962 | 209 |
| 304 | 3300009177 | Ga0105248_10886345 | Ga0105248_108863452 | 209 |
| 305 | 3300009545 | Ga0105237_10161032 | Ga0105237_101610321 | 209 |
| 306 | 3300013297 | Ga0157378_10765208 | Ga0157378_107652082 | 209 |
| 307 | 3300013306 | Ga0163162_10574042 | Ga0163162_105740422 | 209 |
| 308 | 3300013307 | Ga0157372_10310831 | Ga0157372_103108312 | 209 |
| 309 | 3300014969 | Ga0157376_10000077 | Ga0157376_1000007779 | 209 |
| 310 | 3300014969 | Ga0157376_10001519 | Ga0157376_1000151929 | 209 |
| 311 | 3300021384 | Ga0213876_10017049 | Ga0213876_100170494 | 209 |
| 312 | 3300025898 | Ga0207692_10230442 | Ga0207692_102304422 | 209 |
| 313 | 3300025905 | Ga0207685_10031330 | Ga0207685_100313303 | 209 |
| 314 | 3300025906 | Ga0207699_10018682 | Ga0207699_100186823 | 209 |
| 315 | 3300025906 | Ga0207699_10191605 | Ga0207699_101916051 | 209 |
| 316 | 3300025906 | Ga0207699_10208563 | Ga0207699_102085632 | 209 |
| 317 | 3300025906 | Ga0207699_10228437 | Ga0207699_102284373 | 209 |
| 318 | 3300025910 | Ga0207684_10230671 | Ga0207684_102306712 | 209 |
| 319 | 3300025910 | Ga0207684_10244280 | Ga0207684_102442803 | 209 |
| 320 | 3300025910 | Ga0207684_10251617 | Ga0207684_102516173 | 209 |
| 321 | 3300025910 | Ga0207684_10332351 | Ga0207684_103323512 | 209 |
| 322 | 3300025910 | Ga0207684_10383432 | Ga0207684_103834322 | 209 |
| 323 | 3300025912 | Ga0207707_10152834 | Ga0207707_101528343 | 209 |
| 324 | 3300025914 | Ga0207671_10085943 | Ga0207671_100859432 | 209 |
| 325 | 3300025915 | Ga0207693_10038470 | Ga0207693_100384706 | 209 |
| 326 | 3300025915 | Ga0207693_10096232 | Ga0207693_100962322 | 209 |
| 327 | 3300025915 | Ga0207693_10277593 | Ga0207693_102775932 | 209 |
| 328 | 3300025916 | Ga0207663_10004162 | Ga0207663_100041625 | 209 |
| 329 | 3300025916 | Ga0207663_10017954 | Ga0207663_100179547 | 209 |
| 330 | 3300025922 | Ga0207646_10000754 | Ga0207646_100007543 | 209 |
| 331 | 3300025922 | Ga0207646_10303931 | Ga0207646_103039312 | 209 |
| 332 | 3300025922 | Ga0207646_10356904 | Ga0207646_103569042 | 209 |
| 333 | 3300025928 | Ga0207700_10285416 | Ga0207700_102854163 | 209 |
| 334 | 3300025934 | Ga0207686_10023003 | Ga0207686_100230032 | 209 |
| 335 | 3300025938 | Ga0207704_10216261 | Ga0207704_102162612 | 209 |
| 336 | 3300025939 | Ga0207665_10000959 | Ga0207665_100009593 | 209 |
| 337 | 3300025939 | Ga0207665_10006155 | Ga0207665_1000615515 | 209 |
| 338 | 3300025939 | Ga0207665_10006268 | Ga0207665_100062683 | 209 |
| 339 | 3300025939 | Ga0207665_10010543 | Ga0207665_100105434 | 209 |
| 340 | 3300025939 | Ga0207665_10035786 | Ga0207665_100357866 | 209 |
| 341 | 3300026035 | Ga0207703_10163415 | Ga0207703_101634152 | 209 |
| 342 | 3300026088 | Ga0207641_10546239 | Ga0207641_105462392 | 209 |
| 343 | 3300026089 | Ga0207648_10310721 | Ga0207648_103107212 | 209 |
| 344 | 3300027671 | Ga0209588_1051560 | Ga0209588_10515602 | 209 |
| 345 | 3300027671 | Ga0209588_1081586 | Ga0209588_10815861 | 209 |
| 346 | 3300028379 | Ga0268266_10000259 | Ga0268266_1000025956 | 209 |
| 347 | 3300028381 | Ga0268264_10515755 | Ga0268264_105157552 | 209 |
| 348 | 3300030878 | Ga0265770_1020074 | Ga0265770_10200742 | 209 |
| 349 | 3300031090 | Ga0265760_10074156 | Ga0265760_100741562 | 209 |
| 350 | 3300031090 | Ga0265760_10114369 | Ga0265760_101143691 | 209 |
| 351 | 3300031241 | Ga0265325_10048727 | Ga0265325_100487273 | 209 |
| 352 | 3300031249 | Ga0265339_10265934 | Ga0265339_102659341 | 209 |
| 353 | 3300033541 | Ga0316596_1000103 | Ga0316596_100010321 | 209 |
| 354 | 3300035083 | Ga0373926_0002726 | Ga0373926_0002726_4876_5544 | 209 |
| 355 | 3300035086 | Ga0373934_0001004 | Ga0373934_0001004_635_1288 | 209 |
| 356 | 3300035086 | Ga0373934_0114056 | Ga0373934_0114056_402_1043 | 209 |
| 357 | 3300035111 | Ga0373923_0001256 | Ga0373923_0001256_486_1127 | 209 |
| 358 | 3300035116 | Ga0373945_0098404 | Ga0373945_0098404_401_1069 | 209 |
| 359 | 3300035116 | Ga0373945_0240426 | Ga0373945_0240426_44_685 | 209 |
| 360 | 3300035118 | Ga0373954_0005540 | Ga0373954_0005540_1326_1967 | 209 |
| 361 | 3300035118 | Ga0373954_0042676 | Ga0373954_0042676_817_1458 | 209 |
| 362 | 3300035119 | Ga0373956_0019487 | Ga0373956_0019487_1563_2204 | 209 |
| 363 | 3300035120 | Ga0373957_0000289 | Ga0373957_0000289_816_1469 | 209 |
| 364 | 3300035120 | Ga0373957_0034419 | Ga0373957_0034419_357_998 | 209 |
| 365 | 3300035170 | Ga0373943_0117096 | Ga0373943_0117096_660_1328 | 209 |
| 366 | 3300035171 | Ga0373946_0023454 | Ga0373946_0023454_528_1196 | 209 |
| 367 | 3300035172 | Ga0373955_0161703 | Ga0373955_0161703_68_709 | 209 |
| 368 | 3300035691 | Ga0373931_0021266 | Ga0373931_0021266_234_875 | 209 |
| 369 | 3300035692 | Ga0373935_0010652 | Ga0373935_0010652_4337_4978 | 209 |
| 370 | 3300035695 | Ga0373927_0000934 | Ga0373927_0000934_20018_20659 | 209 |
| 371 | 3300035695 | Ga0373927_0004438 | Ga0373927_0004438_8606_9274 | 209 |
| 372 | 3300035724 | Ga0373933_0000551 | Ga0373933_0000551_2196_2849 | 209 |
| 373 | 3300035724 | Ga0373933_0002799 | Ga0373933_0002799_1022_1663 | 209 |
| 374 | 3300035724 | Ga0373933_0188487 | Ga0373933_0188487_518_1174 | 209 |
| 375 | 3300035725 | Ga0373947_0000905 | Ga0373947_0000905_5372_6013 | 209 |
| 376 | 3300035725 | Ga0373947_0008831 | Ga0373947_0008831_4332_5000 | 209 |
| 377 | 3300036401 | Ga0373937_0000238 | Ga0373937_0000238_52738_53379 | 209 |
| 378 | 3300036401 | Ga0373937_0005026 | Ga0373937_0005026_1472_2113 | 209 |
| 379 | 3300036401 | Ga0373937_0016547 | Ga0373937_0016547_5262_5915 | 209 |
| 380 | 3300036401 | Ga0373937_0049055 | Ga0373937_0049055_2126_2782 | 209 |
| 381 | 3300036401 | Ga0373937_0377618 | Ga0373937_0377618_524_1165 | 209 |
| 382 | 3300037068 | Ga0373925_0001788 | Ga0373925_0001788_16691_17359 | 209 |
| 383 | 3300037068 | Ga0373925_0009068 | Ga0373925_0009068_2639_3280 | 209 |
| 384 | 3300039437 | Ga0436365_1034683 | Ga0436365_1034683_813_1469 | 209 |
| 385 | 3300046454 | Ga0495592_0116471 | Ga0495592_0116471_571_1212 | 209 |
| 386 | 3300046454 | Ga0495592_0129288 | Ga0495592_0129288_571_1224 | 209 |
| 387 | 3300046455 | Ga0495603_0065572 | Ga0495603_0065572_457_1098 | 209 |
| 388 | 3300046459 | Ga0495629_0065391 | Ga0495629_0065391_241_882 | 209 |
| 389 | 3300046462 | Ga0495651_0003059 | Ga0495651_0003059_11517_12158 | 209 |
| 390 | 3300046462 | Ga0495651_0012754 | Ga0495651_0012754_431_1072 | 209 |
| 391 | 3300046462 | Ga0495651_0144083 | Ga0495651_0144083_710_1363 | 209 |
| 392 | 3300046463 | Ga0495653_0005252 | Ga0495653_0005252_752_1393 | 209 |
| 393 | 3300046463 | Ga0495653_0188001 | Ga0495653_0188001_314_955 | 209 |
| 394 | 3300046463 | Ga0495653_0430957 | Ga0495653_0430957_84_737 | 209 |
| 395 | 3300046472 | Ga0495580_0002827 | Ga0495580_0002827_563_1204 | 209 |
| 396 | 3300046472 | Ga0495580_0016376 | Ga0495580_0016376_4381_5022 | 209 |
| 397 | 3300046472 | Ga0495580_0071634 | Ga0495580_0071634_1508_2149 | 209 |
| 398 | 3300046473 | Ga0495582_0004462 | Ga0495582_0004462_6228_6869 | 209 |
| 399 | 3300046473 | Ga0495582_0130173 | Ga0495582_0130173_25_666 | 209 |
| 400 | 3300046476 | Ga0495662_0014892 | Ga0495662_0014892_933_1574 | 209 |
| 401 | 3300046477 | Ga0495664_0158325 | Ga0495664_0158325_274_915 | 209 |
| 402 | 3300046499 | Ga0495594_0077145 | Ga0495594_0077145_489_1130 | 209 |
| 403 | 3300046511 | Ga0495608_0004716 | Ga0495608_0004716_7983_8624 | 209 |
| 404 | 3300046511 | Ga0495608_0014220 | Ga0495608_0014220_4286_4939 | 209 |
| 405 | 3300046511 | Ga0495608_0083762 | Ga0495608_0083762_1312_1953 | 209 |
| 406 | 3300046514 | Ga0495618_0102156 | Ga0495618_0102156_538_1179 | 209 |
| 407 | 3300046516 | Ga0495628_0011006 | Ga0495628_0011006_556_1197 | 209 |
| 408 | 3300046517 | Ga0495630_0015980 | Ga0495630_0015980_4273_4914 | 209 |
| 409 | 3300046517 | Ga0495630_0145341 | Ga0495630_0145341_634_1302 | 209 |
| 410 | 3300046517 | Ga0495630_0221500 | Ga0495630_0221500_724_1365 | 209 |
| 411 | 3300046526 | Ga0495666_0029996 | Ga0495666_0029996_1495_2136 | 209 |
| 412 | 3300046526 | Ga0495666_0107669 | Ga0495666_0107669_360_1001 | 209 |
| 413 | 3300046529 | Ga0495652_0023062 | Ga0495652_0023062_4399_5040 | 209 |
| 414 | 3300046529 | Ga0495652_0026177 | Ga0495652_0026177_3520_4161 | 209 |
| 415 | 3300046531 | Ga0495665_0017344 | Ga0495665_0017344_2662_3303 | 209 |
| 416 | 3300046531 | Ga0495665_0159246 | Ga0495665_0159246_489_1130 | 209 |
| 417 | 3300046533 | Ga0495640_0031243 | Ga0495640_0031243_1405_2046 | 209 |
| 418 | 3300046535 | Ga0495586_0001676 | Ga0495586_0001676_10942_11583 | 209 |
| 419 | 3300046536 | Ga0495587_0000383 | Ga0495587_0000383_7796_8437 | 209 |
| 420 | 3300046536 | Ga0495587_0023543 | Ga0495587_0023543_2226_2879 | 209 |
| 421 | 3300046536 | Ga0495587_0024675 | Ga0495587_0024675_1175_1816 | 209 |
| 422 | 3300046543 | Ga0495645_0076839 | Ga0495645_0076839_1190_1831 | 209 |
| 423 | 3300046559 | Ga0495667_0071691 | Ga0495667_0071691_1142_1783 | 209 |
| 424 | 3300046663 | Ga0495635_0011568 | Ga0495635_0011568_626_1267 | 209 |
| 425 | 3300046675 | Ga0495657_0049456 | Ga0495657_0049456_623_1264 | 209 |
| 426 | 3300046675 | Ga0495657_0201940 | Ga0495657_0201940_107_760 | 209 |
| 427 | 3300046678 | Ga0495599_0044494 | Ga0495599_0044494_1944_2585 | 209 |
| 428 | 3300046679 | Ga0495623_0001135 | Ga0495623_0001135_16823_17464 | 209 |
| 429 | 3300046680 | Ga0495646_0013837 | Ga0495646_0013837_344_985 | 209 |
| 430 | 3300046689 | Ga0495613_0062134 | Ga0495613_0062134_622_1263 | 209 |
| 431 | 3300046690 | Ga0495624_0026801 | Ga0495624_0026801_2930_3598 | 209 |
| 432 | 3300046690 | Ga0495624_0038887 | Ga0495624_0038887_556_1197 | 209 |
| 433 | 3300046691 | Ga0495670_0056198 | Ga0495670_0056198_733_1362 | 209 |
| 434 | 3300046809 | Ga0495600_0200930 | Ga0495600_0200930_583_1236 | 209 |
| 435 | 3300047315 | Ga0495581_0011173 | Ga0495581_0011173_377_1018 | 209 |
| 436 | 3300047317 | Ga0495604_0000785 | Ga0495604_0000785_618_1271 | 209 |
| 437 | 3300047317 | Ga0495604_0017471 | Ga0495604_0017471_957_1598 | 209 |
| 438 | 3300047317 | Ga0495604_0209128 | Ga0495604_0209128_78_719 | 209 |
| 439 | 3300047317 | Ga0495604_0541963 | Ga0495604_0541963_65_706 | 209 |
| 440 | 3300047319 | Ga0495674_0022169 | Ga0495674_0022169_1074_1715 | 209 |
| 441 | 3300047319 | Ga0495674_0245455 | Ga0495674_0245455_588_1229 | 209 |
| 442 | 3300047322 | Ga0495680_0081547 | Ga0495680_0081547_981_1634 | 209 |
| 443 | 3300047322 | Ga0495680_0223650 | Ga0495680_0223650_564_1205 | 209 |
| 444 | 3300047444 | Ga0495675_0002324 | Ga0495675_0002324_9347_9988 | 209 |
| 445 | 3300047471 | Ga0495684_0006019 | Ga0495684_0006019_7967_8608 | 209 |
| 446 | 3300047471 | Ga0495684_0208428 | Ga0495684_0208428_548_1189 | 209 |
| 447 | 3300047673 | Ga0495593_0000774 | Ga0495593_0000774_17353_17994 | 209 |
| 448 | 3300047673 | Ga0495593_0083344 | Ga0495593_0083344_987_1628 | 209 |
| 449 | 3300048088 | Ga0495602_0000595 | Ga0495602_0000595_2382_3023 | 209 |
| 450 | 3300048088 | Ga0495602_0019524 | Ga0495602_0019524_571_1212 | 209 |
| 451 | 3300048088 | Ga0495602_0111755 | Ga0495602_0111755_1445_2098 | 209 |
| 452 | 3300048089 | Ga0495614_0038783 | Ga0495614_0038783_652_1293 | 209 |
| 453 | 3300048089 | Ga0495614_0081326 | Ga0495614_0081326_614_1255 | 209 |
| 454 | 3300048917 | Ga0496114_0001141 | Ga0496114_0001141_18902_19543 | 209 |
| 455 | 3300048918 | Ga0496115_0002867 | Ga0496115_0002867_3210_3851 | 209 |
| 456 | 3300048918 | Ga0496115_0082599 | Ga0496115_0082599_1322_1978 | 209 |
| 457 | 3300048918 | Ga0496115_0316099 | Ga0496115_0316099_291_932 | 209 |
| 458 | 3300048919 | Ga0496116_0021441 | Ga0496116_0021441_471_1103 | 209 |
| 459 | 3300048919 | Ga0496116_0076103 | Ga0496116_0076103_733_1368 | 209 |
| 460 | 3300048920 | Ga0496117_0000124 | Ga0496117_0000124_91130_91765 | 209 |
| 461 | 3300048921 | Ga0496118_0012321 | Ga0496118_0012321_2688_3323 | 209 |
| 462 | 3300048922 | Ga0496119_0000020 | Ga0496119_0000020_110219_110854 | 209 |
| 463 | 3300048922 | Ga0496119_0089994 | Ga0496119_0089994_958_1590 | 209 |
| 464 | 3300048923 | Ga0496120_0000006 | Ga0496120_0000006_250944_251579 | 209 |
| 465 | 3300048923 | Ga0496120_0002172 | Ga0496120_0002172_18352_18987 | 209 |
| 466 | 3300048925 | Ga0496122_0000040 | Ga0496122_0000040_145132_145767 | 209 |
| 467 | 3300048925 | Ga0496122_0000140 | Ga0496122_0000140_100441_101073 | 209 |
| 468 | 3300048925 | Ga0496122_0000802 | Ga0496122_0000802_42566_43201 | 209 |
| 469 | 3300048925 | Ga0496122_0007916 | Ga0496122_0007916_5298_5927 | 209 |
| 470 | 3300048925 | Ga0496122_0043480 | Ga0496122_0043480_2682_3314 | 209 |
| 471 | 3300048926 | Ga0496123_0000572 | Ga0496123_0000572_16670_17305 | 209 |
| 472 | 3300048926 | Ga0496123_0004284 | Ga0496123_0004284_1565_2200 | 209 |
| 473 | 3300048926 | Ga0496123_0022627 | Ga0496123_0022627_2561_3193 | 209 |
| 474 | 3300048927 | Ga0496124_0101554 | Ga0496124_0101554_1649_2284 | 209 |
| 475 | 3300048928 | Ga0496125_0000010 | Ga0496125_0000010_149228_149863 | 209 |
| 476 | 3300048929 | Ga0496126_0000060 | Ga0496126_0000060_250303_250938 | 209 |
| 477 | 3300048929 | Ga0496126_0002082 | Ga0496126_0002082_5777_6409 | 209 |
| 478 | 3300050512 | nmdc:mga0n895_277153_c1 | nmdc:mga0n895_277153_c1_508_1164 | 209 |
| 479 | 3300050513 | nmdc:mga0rr50_215952_c1 | nmdc:mga0rr50_215952_c1_51_719 | 209 |
| 480 | 3300050513 | nmdc:mga0rr50_437874_c1 | nmdc:mga0rr50_437874_c1_384_1025 | 209 |
| 481 | 3300050513 | nmdc:mga0rr50_517934_c1 | nmdc:mga0rr50_517934_c1_60_701 | 209 |
| 482 | 3300050513 | nmdc:mga0rr50_73583_c1 | nmdc:mga0rr50_73583_c1_357_1013 | 209 |
| 483 | 3300050514 | nmdc:mga08x19_365_c1 | nmdc:mga08x19_365_c1_30786_31454 | 209 |
| 484 | 3300050514 | nmdc:mga08x19_57597_c1 | nmdc:mga08x19_57597_c1_637_1296 | 209 |
| 485 | 3300050515 | nmdc:mga0a205_903698_c1 | nmdc:mga0a205_903698_c1_27_668 | 209 |
| 486 | 3300053078 | Ga0495612_0000772 | Ga0495612_0000772_11843_12484 | 209 |
| 487 | 3300053085 | Ga0495619_0130096 | Ga0495619_0130096_514_1167 | 209 |
| 488 | 3300059645 | Ga0587076_017558 | Ga0587076_017558_52_681 | 209 |
| 489 | iso_pu_bacteria | 2537561836 | 2538834132 | 209 |
| 490 | iso_pu_bacteria | 2643221562 | 2643829524 | 209 |
| 491 | iso_pu_bacteria | 2643221577 | 2643895221 | 209 |
| 492 | iso_pu_bacteria | 2643221685 | 2644477380 | 209 |
| 493 | iso_pu_bacteria | 2687453130 | 2687584041 | 209 |
| 494 | iso_pu_bacteria | 2739367700 | 2739732124 | 209 |
| 495 | iso_pu_bacteria | 2884411467 | 2884413728 | 209 |
| 496 | iso_pu_bacteria | 2928963466 | 2928964822 | 209 |
| 497 | 3300005434 | Ga0070709_10160955 | Ga0070709_101609552 | 210 |
| 498 | 3300005436 | Ga0070713_100103997 | Ga0070713_1001039973 | 210 |
| 499 | 3300005437 | Ga0070710_10071767 | Ga0070710_100717672 | 210 |
| 500 | 3300005439 | Ga0070711_100397777 | Ga0070711_1003977772 | 210 |
| 501 | 3300005471 | Ga0070698_100363463 | Ga0070698_1003634632 | 210 |
| 502 | 3300006173 | Ga0070716_100198374 | Ga0070716_1001983742 | 210 |
| 503 | 3300007265 | Ga0099794_10132618 | Ga0099794_101326181 | 210 |
| 504 | 3300007788 | Ga0099795_10030595 | Ga0099795_100305953 | 210 |
| 505 | 3300009094 | Ga0111539_10344664 | Ga0111539_103446642 | 210 |
| 506 | 3300010159 | Ga0099796_10027098 | Ga0099796_100270982 | 210 |
| 507 | 3300014968 | Ga0157379_10168013 | Ga0157379_101680133 | 210 |
| 508 | 3300025906 | Ga0207699_10170900 | Ga0207699_101709002 | 210 |
| 509 | 3300025915 | Ga0207693_10280409 | Ga0207693_102804092 | 210 |
| 510 | 3300025916 | Ga0207663_10275735 | Ga0207663_102757352 | 210 |
| 511 | 3300025922 | Ga0207646_10730209 | Ga0207646_107302091 | 210 |
| 512 | 3300025928 | Ga0207700_10180340 | Ga0207700_101803402 | 210 |
| 513 | 3300025939 | Ga0207665_10052220 | Ga0207665_100522204 | 210 |
| 514 | 3300025939 | Ga0207665_10215796 | Ga0207665_102157961 | 210 |
| 515 | 3300031090 | Ga0265760_10004278 | Ga0265760_100042783 | 210 |
| 516 | 3300033528 | Ga0316588_1000021 | Ga0316588_100002121 | 210 |
| 517 | 3300039062 | Ga0400483_047654 | Ga0400483_047654_7081_7716 | 210 |
| 518 | 3300039062 | Ga0400483_168849 | Ga0400483_168849_22968_23603 | 210 |
| 519 | 3300046511 | Ga0495608_0024720 | Ga0495608_0024720_1794_2450 | 210 |
| 520 | 3300046516 | Ga0495628_0017722 | Ga0495628_0017722_5247_5903 | 210 |
| 521 | 3300046517 | Ga0495630_0088337 | Ga0495630_0088337_271_927 | 210 |
| 522 | 3300046675 | Ga0495657_0058966 | Ga0495657_0058966_451_1107 | 210 |
| 523 | 3300046680 | Ga0495646_0118500 | Ga0495646_0118500_121_777 | 210 |
| 524 | 3300047319 | Ga0495674_0184395 | Ga0495674_0184395_540_1196 | 210 |
| 525 | 3300047471 | Ga0495684_0010523 | Ga0495684_0010523_5973_6629 | 210 |
| 526 | 3300060346 | Ga0587111_0101286 | Ga0587111_0101286_31_669 | 210 |
| 527 | 3300003187 | JGI25151J46595_10007643 | JGI25151J46595_100076434 | 212 |
| 528 | 3300003187 | JGI25151J46595_10013580 | JGI25151J46595_100135804 | 212 |
| 529 | 3300003771 | Ga0055526_1008536 | Ga0055526_10085362 | 212 |
| 530 | 3300003771 | Ga0055526_1008987 | Ga0055526_10089872 | 212 |
| 531 | 3300003773 | Ga0055537_1001096 | Ga0055537_10010962 | 212 |
| 532 | 3300003775 | Ga0055524_1013602 | Ga0055524_10136022 | 212 |
| 533 | 3300003775 | Ga0055524_1015666 | Ga0055524_10156664 | 212 |
| 534 | 3300003781 | Ga0055536_1024081 | Ga0055536_10240812 | 212 |
| 535 | 3300003784 | Ga0055534_1003331 | Ga0055534_10033318 | 212 |
| 536 | 3300003784 | Ga0055534_1006907 | Ga0055534_10069074 | 212 |
| 537 | 3300003790 | Ga0055528_1013611 | Ga0055528_10136114 | 212 |
| 538 | 3300003790 | Ga0055528_1016393 | Ga0055528_10163932 | 212 |
| 539 | 3300003791 | Ga0055530_10004966 | Ga0055530_100049664 | 212 |
| 540 | 3300003794 | Ga0055531_10017875 | Ga0055531_100178754 | 212 |
| 541 | 3300005353 | Ga0070669_100222301 | Ga0070669_1002223012 | 212 |
| 542 | 3300009093 | Ga0105240_10054178 | Ga0105240_100541785 | 212 |
| 543 | 3300009177 | Ga0105248_10280233 | Ga0105248_102802332 | 212 |
| 544 | 3300012495 | Ga0157323_1003136 | Ga0157323_10031362 | 212 |
| 545 | 3300015689 | Ga0183360_10001 | Ga0183360_100012728 | 212 |
| 546 | 3300025245 | Ga0207425_1039535 | Ga0207425_10395352 | 212 |
| 547 | 3300025263 | Ga0209565_1000001 | Ga0209565_10000011145 | 212 |
| 548 | 3300025263 | Ga0209565_1037789 | Ga0209565_10377892 | 212 |
| 549 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000011145 | 212 |
| 550 | 3300025273 | Ga0209673_1002116 | Ga0209673_100211625 | 212 |
| 551 | 3300025291 | Ga0209675_1000001 | Ga0209675_10000011388 | 212 |
| 552 | 3300025291 | Ga0209675_1006904 | Ga0209675_10069047 | 212 |
| 553 | 3300025292 | Ga0209676_1001608 | Ga0209676_100160831 | 212 |
| 554 | 3300025292 | Ga0209676_1004892 | Ga0209676_10048922 | 212 |
| 555 | 3300025294 | Ga0209025_1122127 | Ga0209025_11221271 | 212 |
| 556 | 3300025295 | Ga0209564_1000001 | Ga0209564_10000011550 | 212 |
| 557 | 3300025295 | Ga0209564_1007141 | Ga0209564_100714111 | 212 |
| 558 | 3300025298 | Ga0209050_1001128 | Ga0209050_100112840 | 212 |
| 559 | 3300025299 | Ga0209256_1000002 | Ga0209256_10000023 | 212 |
| 560 | 3300025299 | Ga0209256_1003821 | Ga0209256_10038213 | 212 |
| 561 | 3300025304 | Ga0209257_1006382 | Ga0209257_100638217 | 212 |
| 562 | 3300031548 | Ga0307408_100110780 | Ga0307408_1001107802 | 212 |
| 563 | 3300031824 | Ga0307413_10837432 | Ga0307413_108374321 | 212 |
| 564 | 3300031901 | Ga0307406_10093487 | Ga0307406_100934872 | 212 |
| 565 | 3300031911 | Ga0307412_10028293 | Ga0307412_100282937 | 212 |
| 566 | 3300032002 | Ga0307416_100079046 | Ga0307416_1000790464 | 212 |
| 567 | 3300042876 | Ga0451577_0127243 | Ga0451577_0127243_326_979 | 212 |
| 568 | 3300048924 | Ga0496121_0005001 | Ga0496121_0005001_15934_16587 | 212 |
| 569 | 3300049161 | Ga0501305_007127 | Ga0501305_007127_173_826 | 212 |
| 570 | 3300049162 | Ga0501307_008447 | Ga0501307_008447_175_828 | 212 |
| 571 | 3300049162 | Ga0501307_030725 | Ga0501307_030725_31_708 | 212 |
| 572 | 3300049579 | Ga0501043_0030616 | Ga0501043_0030616_2752_3405 | 212 |
| 573 | iso_pu_bacteria | 2941489479 | 2941490077 | 212 |
| 574 | iso_pu_bacteria | 2995948881 | 2995950363 | 212 |
| 575 | iso_pu_bacteria | 8003014200 | 8003015003 | 212 |
| 576 | 3300001904 | JGI24736J21556_1002754 | JGI24736J21556_10027546 | 213 |
| 577 | 3300001904 | JGI24736J21556_1003768 | JGI24736J21556_10037684 | 213 |
| 578 | 3300001904 | JGI24736J21556_1023445 | JGI24736J21556_10234451 | 213 |
| 579 | 3300001915 | JGI24741J21665_1004451 | JGI24741J21665_10044512 | 213 |
| 580 | 3300001915 | JGI24741J21665_1004493 | JGI24741J21665_10044933 | 213 |
| 581 | 3300001915 | JGI24741J21665_1008247 | JGI24741J21665_10082473 | 213 |
| 582 | 3300001915 | JGI24741J21665_1018685 | JGI24741J21665_10186852 | 213 |
| 583 | 3300001979 | JGI24740J21852_10003737 | JGI24740J21852_1000373713 | 213 |
| 584 | 3300001979 | JGI24740J21852_10006264 | JGI24740J21852_100062643 | 213 |
| 585 | 3300001979 | JGI24740J21852_10012232 | JGI24740J21852_100122322 | 213 |
| 586 | 3300002705 | JGI25156J39149_1002085 | JGI25156J39149_100208513 | 213 |
| 587 | 3300002737 | JGI25162J39368_1003895 | JGI25162J39368_10038952 | 213 |
| 588 | 3300002737 | JGI25162J39368_1007773 | JGI25162J39368_10077732 | 213 |
| 589 | 3300002741 | JGI25157J39369_1001153 | JGI25157J39369_10011533 | 213 |
| 590 | 3300002741 | JGI25157J39369_1002044 | JGI25157J39369_10020443 | 213 |
| 591 | 3300003756 | Ga0055533_1002319 | Ga0055533_10023192 | 213 |
| 592 | 3300003760 | Ga0055527_1004862 | Ga0055527_10048623 | 213 |
| 593 | 3300003762 | Ga0055542_1003848 | Ga0055542_10038486 | 213 |
| 594 | 3300004798 | Ga0058859_11760642 | Ga0058859_117606422 | 213 |
| 595 | 3300004799 | Ga0058863_10021952 | Ga0058863_100219522 | 213 |
| 596 | 3300004799 | Ga0058863_10051910 | Ga0058863_100519102 | 213 |
| 597 | 3300004800 | Ga0058861_10029892 | Ga0058861_100298922 | 213 |
| 598 | 3300004801 | Ga0058860_10137024 | Ga0058860_101370246 | 213 |
| 599 | 3300004803 | Ga0058862_10121056 | Ga0058862_101210562 | 213 |
| 600 | 3300005262 | Ga0065165_1033037 | Ga0065165_10330373 | 213 |
| 601 | 3300005327 | Ga0070658_10062591 | Ga0070658_100625912 | 213 |
| 602 | 3300005327 | Ga0070658_10253456 | Ga0070658_102534562 | 213 |
| 603 | 3300005328 | Ga0070676_10011569 | Ga0070676_100115692 | 213 |
| 604 | 3300005329 | Ga0070683_100091777 | Ga0070683_1000917773 | 213 |
| 605 | 3300005329 | Ga0070683_100337298 | Ga0070683_1003372982 | 213 |
| 606 | 3300005330 | Ga0070690_100108195 | Ga0070690_1001081952 | 213 |
| 607 | 3300005331 | Ga0070670_100213118 | Ga0070670_1002131182 | 213 |
| 608 | 3300005335 | Ga0070666_10062032 | Ga0070666_100620322 | 213 |
| 609 | 3300005335 | Ga0070666_10267214 | Ga0070666_102672141 | 213 |
| 610 | 3300005336 | Ga0070680_100131473 | Ga0070680_1001314733 | 213 |
| 611 | 3300005336 | Ga0070680_100135391 | Ga0070680_1001353913 | 213 |
| 612 | 3300005336 | Ga0070680_100450980 | Ga0070680_1004509802 | 213 |
| 613 | 3300005337 | Ga0070682_100031926 | Ga0070682_1000319262 | 213 |
| 614 | 3300005337 | Ga0070682_100040504 | Ga0070682_1000405041 | 213 |
| 615 | 3300005337 | Ga0070682_100141710 | Ga0070682_1001417103 | 213 |
| 616 | 3300005337 | Ga0070682_100155304 | Ga0070682_1001553043 | 213 |
| 617 | 3300005337 | Ga0070682_100374660 | Ga0070682_1003746602 | 213 |
| 618 | 3300005339 | Ga0070660_100123626 | Ga0070660_1001236263 | 213 |
| 619 | 3300005339 | Ga0070660_100244093 | Ga0070660_1002440932 | 213 |
| 620 | 3300005339 | Ga0070660_100398730 | Ga0070660_1003987301 | 213 |
| 621 | 3300005339 | Ga0070660_100541817 | Ga0070660_1005418172 | 213 |
| 622 | 3300005340 | Ga0070689_100041431 | Ga0070689_1000414315 | 213 |
| 623 | 3300005341 | Ga0070691_10019986 | Ga0070691_100199864 | 213 |
| 624 | 3300005341 | Ga0070691_10048275 | Ga0070691_100482753 | 213 |
| 625 | 3300005344 | Ga0070661_100015281 | Ga0070661_1000152819 | 213 |
| 626 | 3300005344 | Ga0070661_100042481 | Ga0070661_1000424813 | 213 |
| 627 | 3300005344 | Ga0070661_100138082 | Ga0070661_1001380823 | 213 |
| 628 | 3300005344 | Ga0070661_100169084 | Ga0070661_1001690842 | 213 |
| 629 | 3300005344 | Ga0070661_100187257 | Ga0070661_1001872571 | 213 |
| 630 | 3300005344 | Ga0070661_100369076 | Ga0070661_1003690762 | 213 |
| 631 | 3300005344 | Ga0070661_100699554 | Ga0070661_1006995541 | 213 |
| 632 | 3300005344 | Ga0070661_100749257 | Ga0070661_1007492571 | 213 |
| 633 | 3300005345 | Ga0070692_10007700 | Ga0070692_100077008 | 213 |
| 634 | 3300005345 | Ga0070692_10056065 | Ga0070692_100560652 | 213 |
| 635 | 3300005345 | Ga0070692_10087946 | Ga0070692_100879463 | 213 |
| 636 | 3300005347 | Ga0070668_100014103 | Ga0070668_1000141034 | 213 |
| 637 | 3300005347 | Ga0070668_100348368 | Ga0070668_1003483682 | 213 |
| 638 | 3300005353 | Ga0070669_100006246 | Ga0070669_1000062464 | 213 |
| 639 | 3300005353 | Ga0070669_100564161 | Ga0070669_1005641611 | 213 |
| 640 | 3300005354 | Ga0070675_100638971 | Ga0070675_1006389712 | 213 |
| 641 | 3300005355 | Ga0070671_100288936 | Ga0070671_1002889362 | 213 |
| 642 | 3300005355 | Ga0070671_100322516 | Ga0070671_1003225162 | 213 |
| 643 | 3300005356 | Ga0070674_100279417 | Ga0070674_1002794172 | 213 |
| 644 | 3300005364 | Ga0070673_100109100 | Ga0070673_1001091004 | 213 |
| 645 | 3300005365 | Ga0070688_100171238 | Ga0070688_1001712382 | 213 |
| 646 | 3300005366 | Ga0070659_100160932 | Ga0070659_1001609323 | 213 |
| 647 | 3300005366 | Ga0070659_100173711 | Ga0070659_1001737113 | 213 |
| 648 | 3300005366 | Ga0070659_100191871 | Ga0070659_1001918712 | 213 |
| 649 | 3300005366 | Ga0070659_100219319 | Ga0070659_1002193193 | 213 |
| 650 | 3300005366 | Ga0070659_100750336 | Ga0070659_1007503362 | 213 |
| 651 | 3300005367 | Ga0070667_100074637 | Ga0070667_1000746372 | 213 |
| 652 | 3300005367 | Ga0070667_100124452 | Ga0070667_1001244524 | 213 |
| 653 | 3300005367 | Ga0070667_100577578 | Ga0070667_1005775781 | 213 |
| 654 | 3300005436 | Ga0070713_100008401 | Ga0070713_1000084013 | 213 |
| 655 | 3300005437 | Ga0070710_10040859 | Ga0070710_100408593 | 213 |
| 656 | 3300005437 | Ga0070710_10268926 | Ga0070710_102689262 | 213 |
| 657 | 3300005439 | Ga0070711_100225282 | Ga0070711_1002252823 | 213 |
| 658 | 3300005455 | Ga0070663_100036599 | Ga0070663_1000365992 | 213 |
| 659 | 3300005455 | Ga0070663_100112513 | Ga0070663_1001125132 | 213 |
| 660 | 3300005455 | Ga0070663_100220345 | Ga0070663_1002203452 | 213 |
| 661 | 3300005456 | Ga0070678_100007039 | Ga0070678_10000703910 | 213 |
| 662 | 3300005457 | Ga0070662_100045686 | Ga0070662_1000456866 | 213 |
| 663 | 3300005457 | Ga0070662_100109776 | Ga0070662_1001097761 | 213 |
| 664 | 3300005457 | Ga0070662_100390820 | Ga0070662_1003908202 | 213 |
| 665 | 3300005458 | Ga0070681_10072551 | Ga0070681_100725516 | 213 |
| 666 | 3300005458 | Ga0070681_10107230 | Ga0070681_101072304 | 213 |
| 667 | 3300005458 | Ga0070681_10150874 | Ga0070681_101508743 | 213 |
| 668 | 3300005459 | Ga0068867_100135873 | Ga0068867_1001358732 | 213 |
| 669 | 3300005530 | Ga0070679_100178793 | Ga0070679_1001787933 | 213 |
| 670 | 3300005530 | Ga0070679_100184276 | Ga0070679_1001842763 | 213 |
| 671 | 3300005530 | Ga0070679_100881218 | Ga0070679_1008812181 | 213 |
| 672 | 3300005535 | Ga0070684_100050987 | Ga0070684_1000509875 | 213 |
| 673 | 3300005535 | Ga0070684_100083757 | Ga0070684_1000837572 | 213 |
| 674 | 3300005535 | Ga0070684_100088026 | Ga0070684_1000880264 | 213 |
| 675 | 3300005539 | Ga0068853_100029334 | Ga0068853_1000293347 | 213 |
| 676 | 3300005539 | Ga0068853_100035785 | Ga0068853_1000357857 | 213 |
| 677 | 3300005539 | Ga0068853_100146241 | Ga0068853_1001462412 | 213 |
| 678 | 3300005539 | Ga0068853_100155319 | Ga0068853_1001553192 | 213 |
| 679 | 3300005546 | Ga0070696_100124730 | Ga0070696_1001247303 | 213 |
| 680 | 3300005546 | Ga0070696_100128219 | Ga0070696_1001282191 | 213 |
| 681 | 3300005546 | Ga0070696_100141842 | Ga0070696_1001418423 | 213 |
| 682 | 3300005546 | Ga0070696_100153761 | Ga0070696_1001537612 | 213 |
| 683 | 3300005547 | Ga0070693_100091903 | Ga0070693_1000919032 | 213 |
| 684 | 3300005548 | Ga0070665_100000175 | Ga0070665_100000175112 | 213 |
| 685 | 3300005548 | Ga0070665_100105834 | Ga0070665_1001058343 | 213 |
| 686 | 3300005563 | Ga0068855_100231949 | Ga0068855_1002319492 | 213 |
| 687 | 3300005563 | Ga0068855_100258994 | Ga0068855_1002589944 | 213 |
| 688 | 3300005564 | Ga0070664_100100832 | Ga0070664_1001008322 | 213 |
| 689 | 3300005564 | Ga0070664_100443888 | Ga0070664_1004438882 | 213 |
| 690 | 3300005577 | Ga0068857_100003667 | Ga0068857_1000036673 | 213 |
| 691 | 3300005577 | Ga0068857_100087151 | Ga0068857_1000871514 | 213 |
| 692 | 3300005577 | Ga0068857_100175464 | Ga0068857_1001754643 | 213 |
| 693 | 3300005578 | Ga0068854_100104882 | Ga0068854_1001048823 | 213 |
| 694 | 3300005578 | Ga0068854_100161998 | Ga0068854_1001619982 | 213 |
| 695 | 3300005578 | Ga0068854_100221682 | Ga0068854_1002216822 | 213 |
| 696 | 3300005578 | Ga0068854_100265326 | Ga0068854_1002653262 | 213 |
| 697 | 3300005578 | Ga0068854_100415343 | Ga0068854_1004153432 | 213 |
| 698 | 3300005614 | Ga0068856_100004797 | Ga0068856_1000047973 | 213 |
| 699 | 3300005614 | Ga0068856_100184419 | Ga0068856_1001844192 | 213 |
| 700 | 3300005614 | Ga0068856_100192491 | Ga0068856_1001924913 | 213 |
| 701 | 3300005614 | Ga0068856_100211399 | Ga0068856_1002113992 | 213 |
| 702 | 3300005614 | Ga0068856_100354244 | Ga0068856_1003542442 | 213 |
| 703 | 3300005614 | Ga0068856_100459289 | Ga0068856_1004592892 | 213 |
| 704 | 3300005616 | Ga0068852_100031217 | Ga0068852_1000312177 | 213 |
| 705 | 3300005616 | Ga0068852_100151291 | Ga0068852_1001512913 | 213 |
| 706 | 3300005616 | Ga0068852_100156348 | Ga0068852_1001563483 | 213 |
| 707 | 3300005616 | Ga0068852_100370010 | Ga0068852_1003700101 | 213 |
| 708 | 3300005617 | Ga0068859_100122263 | Ga0068859_1001222633 | 213 |
| 709 | 3300005618 | Ga0068864_100168714 | Ga0068864_1001687143 | 213 |
| 710 | 3300005618 | Ga0068864_100479567 | Ga0068864_1004795672 | 213 |
| 711 | 3300005719 | Ga0068861_100050727 | Ga0068861_1000507274 | 213 |
| 712 | 3300005719 | Ga0068861_100503022 | Ga0068861_1005030222 | 213 |
| 713 | 3300005834 | Ga0068851_10014017 | Ga0068851_100140177 | 213 |
| 714 | 3300005834 | Ga0068851_10118794 | Ga0068851_101187942 | 213 |
| 715 | 3300005834 | Ga0068851_10129468 | Ga0068851_101294682 | 213 |
| 716 | 3300005841 | Ga0068863_100100973 | Ga0068863_1001009734 | 213 |
| 717 | 3300005842 | Ga0068858_100068753 | Ga0068858_1000687534 | 213 |
| 718 | 3300005842 | Ga0068858_100075141 | Ga0068858_1000751415 | 213 |
| 719 | 3300005843 | Ga0068860_100426956 | Ga0068860_1004269563 | 213 |
| 720 | 3300005844 | Ga0068862_100164162 | Ga0068862_1001641623 | 213 |
| 721 | 3300005983 | Ga0081540_1000720 | Ga0081540_100072010 | 213 |
| 722 | 3300006175 | Ga0070712_100055854 | Ga0070712_1000558544 | 213 |
| 723 | 3300006358 | Ga0068871_100100892 | Ga0068871_1001008924 | 213 |
| 724 | 3300006358 | Ga0068871_100436173 | Ga0068871_1004361732 | 213 |
| 725 | 3300006931 | Ga0097620_100122253 | Ga0097620_1001222533 | 213 |
| 726 | 3300009093 | Ga0105240_10113841 | Ga0105240_101138416 | 213 |
| 727 | 3300009093 | Ga0105240_10270922 | Ga0105240_102709222 | 213 |
| 728 | 3300009093 | Ga0105240_10274138 | Ga0105240_102741382 | 213 |
| 729 | 3300009101 | Ga0105247_10014280 | Ga0105247_100142802 | 213 |
| 730 | 3300009177 | Ga0105248_10241422 | Ga0105248_102414223 | 213 |
| 731 | 3300009545 | Ga0105237_10051347 | Ga0105237_100513473 | 213 |
| 732 | 3300009545 | Ga0105237_10073900 | Ga0105237_100739005 | 213 |
| 733 | 3300009545 | Ga0105237_10167989 | Ga0105237_101679892 | 213 |
| 734 | 3300009545 | Ga0105237_10239616 | Ga0105237_102396162 | 213 |
| 735 | 3300009551 | Ga0105238_10022011 | Ga0105238_1002201113 | 213 |
| 736 | 3300009551 | Ga0105238_10067600 | Ga0105238_100676004 | 213 |
| 737 | 3300009551 | Ga0105238_10145294 | Ga0105238_101452943 | 213 |
| 738 | 3300009551 | Ga0105238_10361347 | Ga0105238_103613472 | 213 |
| 739 | 3300009551 | Ga0105238_10494909 | Ga0105238_104949092 | 213 |
| 740 | 3300010375 | Ga0105239_10141288 | Ga0105239_101412883 | 213 |
| 741 | 3300010375 | Ga0105239_10244795 | Ga0105239_102447953 | 213 |
| 742 | 3300010375 | Ga0105239_10280538 | Ga0105239_102805383 | 213 |
| 743 | 3300011119 | Ga0105246_10140293 | Ga0105246_101402933 | 213 |
| 744 | 3300013100 | Ga0157373_10037570 | Ga0157373_100375706 | 213 |
| 745 | 3300013100 | Ga0157373_10087027 | Ga0157373_100870274 | 213 |
| 746 | 3300013100 | Ga0157373_10133595 | Ga0157373_101335952 | 213 |
| 747 | 3300013100 | Ga0157373_10244996 | Ga0157373_102449962 | 213 |
| 748 | 3300013102 | Ga0157371_10042032 | Ga0157371_100420325 | 213 |
| 749 | 3300013102 | Ga0157371_10045126 | Ga0157371_100451263 | 213 |
| 750 | 3300013102 | Ga0157371_10118940 | Ga0157371_101189403 | 213 |
| 751 | 3300013102 | Ga0157371_10146760 | Ga0157371_101467603 | 213 |
| 752 | 3300013104 | Ga0157370_10069149 | Ga0157370_100691493 | 213 |
| 753 | 3300013104 | Ga0157370_10073111 | Ga0157370_100731112 | 213 |
| 754 | 3300013104 | Ga0157370_10163772 | Ga0157370_101637723 | 213 |
| 755 | 3300013104 | Ga0157370_10450952 | Ga0157370_104509522 | 213 |
| 756 | 3300013105 | Ga0157369_10036937 | Ga0157369_100369373 | 213 |
| 757 | 3300013105 | Ga0157369_10107916 | Ga0157369_101079164 | 213 |
| 758 | 3300013105 | Ga0157369_10179013 | Ga0157369_101790133 | 213 |
| 759 | 3300013105 | Ga0157369_10269476 | Ga0157369_102694763 | 213 |
| 760 | 3300013105 | Ga0157369_10506063 | Ga0157369_105060632 | 213 |
| 761 | 3300013307 | Ga0157372_10045136 | Ga0157372_100451363 | 213 |
| 762 | 3300013307 | Ga0157372_10082823 | Ga0157372_100828233 | 213 |
| 763 | 3300013307 | Ga0157372_10157288 | Ga0157372_101572883 | 213 |
| 764 | 3300013307 | Ga0157372_10257410 | Ga0157372_102574103 | 213 |
| 765 | 3300013307 | Ga0157372_10484226 | Ga0157372_104842262 | 213 |
| 766 | 3300013307 | Ga0157372_11119375 | Ga0157372_111193752 | 213 |
| 767 | 3300013307 | Ga0157372_11559379 | Ga0157372_115593791 | 213 |
| 768 | 3300014325 | Ga0163163_10643802 | Ga0163163_106438022 | 213 |
| 769 | 3300014497 | Ga0182008_10077601 | Ga0182008_100776013 | 213 |
| 770 | 3300014497 | Ga0182008_10185021 | Ga0182008_101850212 | 213 |
| 771 | 3300014969 | Ga0157376_10254964 | Ga0157376_102549643 | 213 |
| 772 | 3300015262 | Ga0182007_10134052 | Ga0182007_101340522 | 213 |
| 773 | 3300015687 | Ga0183368_1002 | Ga0183368_1002396 | 213 |
| 774 | 3300019177 | Ga0184592_126085 | Ga0184592_1260852 | 213 |
| 775 | 3300020069 | Ga0197907_10947378 | Ga0197907_109473783 | 213 |
| 776 | 3300020069 | Ga0197907_11264123 | Ga0197907_112641231 | 213 |
| 777 | 3300020070 | Ga0206356_10069576 | Ga0206356_100695762 | 213 |
| 778 | 3300020070 | Ga0206356_10171056 | Ga0206356_101710563 | 213 |
| 779 | 3300020070 | Ga0206356_10966620 | Ga0206356_109666203 | 213 |
| 780 | 3300020070 | Ga0206356_11482326 | Ga0206356_114823262 | 213 |
| 781 | 3300020075 | Ga0206349_1346577 | Ga0206349_13465772 | 213 |
| 782 | 3300020076 | Ga0206355_1347985 | Ga0206355_13479853 | 213 |
| 783 | 3300020076 | Ga0206355_1657004 | Ga0206355_16570042 | 213 |
| 784 | 3300020077 | Ga0206351_10247550 | Ga0206351_102475503 | 213 |
| 785 | 3300020078 | Ga0206352_11092907 | Ga0206352_110929072 | 213 |
| 786 | 3300020078 | Ga0206352_11356790 | Ga0206352_113567902 | 213 |
| 787 | 3300020080 | Ga0206350_10601137 | Ga0206350_106011373 | 213 |
| 788 | 3300020081 | Ga0206354_10337548 | Ga0206354_103375483 | 213 |
| 789 | 3300020081 | Ga0206354_10771806 | Ga0206354_107718062 | 213 |
| 790 | 3300020081 | Ga0206354_10919723 | Ga0206354_109197235 | 213 |
| 791 | 3300020082 | Ga0206353_10129542 | Ga0206353_1012954221 | 213 |
| 792 | 3300020082 | Ga0206353_10294942 | Ga0206353_102949428 | 213 |
| 793 | 3300020082 | Ga0206353_11029087 | Ga0206353_110290872 | 213 |
| 794 | 3300020610 | Ga0154015_1010654 | Ga0154015_10106543 | 213 |
| 795 | 3300020610 | Ga0154015_1416341 | Ga0154015_14163412 | 213 |
| 796 | 3300022467 | Ga0224712_10013385 | Ga0224712_100133852 | 213 |
| 797 | 3300022467 | Ga0224712_10021892 | Ga0224712_100218922 | 213 |
| 798 | 3300022467 | Ga0224712_10027027 | Ga0224712_100270274 | 213 |
| 799 | 3300025206 | Ga0209435_101200 | Ga0209435_1012003 | 213 |
| 800 | 3300025206 | Ga0209435_106506 | Ga0209435_1065062 | 213 |
| 801 | 3300025226 | Ga0209674_100043 | Ga0209674_100043364 | 213 |
| 802 | 3300025226 | Ga0209674_102881 | Ga0209674_1028815 | 213 |
| 803 | 3300025228 | Ga0209672_102109 | Ga0209672_1021097 | 213 |
| 804 | 3300025231 | Ga0207427_100209 | Ga0207427_1002093 | 213 |
| 805 | 3300025231 | Ga0207427_104741 | Ga0207427_1047411 | 213 |
| 806 | 3300025233 | Ga0209437_100020 | Ga0209437_100020623 | 213 |
| 807 | 3300025233 | Ga0209437_100193 | Ga0209437_100193108 | 213 |
| 808 | 3300025242 | Ga0209258_104604 | Ga0209258_1046042 | 213 |
| 809 | 3300025250 | Ga0209026_1000274 | Ga0209026_100027450 | 213 |
| 810 | 3300025250 | Ga0209026_1001271 | Ga0209026_10012713 | 213 |
| 811 | 3300025250 | Ga0209026_1006743 | Ga0209026_10067434 | 213 |
| 812 | 3300025254 | Ga0209148_1000002 | Ga0209148_10000021281 | 213 |
| 813 | 3300025256 | Ga0209759_1010126 | Ga0209759_10101263 | 213 |
| 814 | 3300025256 | Ga0209759_1016259 | Ga0209759_10162591 | 213 |
| 815 | 3300025261 | Ga0209233_1000020 | Ga0209233_10000203 | 213 |
| 816 | 3300025261 | Ga0209233_1000920 | Ga0209233_100092025 | 213 |
| 817 | 3300025261 | Ga0209233_1033207 | Ga0209233_10332072 | 213 |
| 818 | 3300025272 | Ga0209455_1000095 | Ga0209455_100009569 | 213 |
| 819 | 3300025303 | Ga0209051_1037982 | Ga0209051_10379822 | 213 |
| 820 | 3300025315 | Ga0207697_10042053 | Ga0207697_100420533 | 213 |
| 821 | 3300025321 | Ga0207656_10098242 | Ga0207656_100982422 | 213 |
| 822 | 3300025321 | Ga0207656_10105805 | Ga0207656_101058052 | 213 |
| 823 | 3300025898 | Ga0207692_10016367 | Ga0207692_100163673 | 213 |
| 824 | 3300025898 | Ga0207692_10056387 | Ga0207692_100563872 | 213 |
| 825 | 3300025900 | Ga0207710_10034664 | Ga0207710_100346644 | 213 |
| 826 | 3300025904 | Ga0207647_10011795 | Ga0207647_1001179512 | 213 |
| 827 | 3300025904 | Ga0207647_10012806 | Ga0207647_100128068 | 213 |
| 828 | 3300025904 | Ga0207647_10013393 | Ga0207647_1001339311 | 213 |
| 829 | 3300025904 | Ga0207647_10041903 | Ga0207647_100419032 | 213 |
| 830 | 3300025904 | Ga0207647_10047348 | Ga0207647_100473484 | 213 |
| 831 | 3300025904 | Ga0207647_10071130 | Ga0207647_100711303 | 213 |
| 832 | 3300025904 | Ga0207647_10094179 | Ga0207647_100941793 | 213 |
| 833 | 3300025907 | Ga0207645_10006593 | Ga0207645_100065934 | 213 |
| 834 | 3300025909 | Ga0207705_10004273 | Ga0207705_100042733 | 213 |
| 835 | 3300025909 | Ga0207705_10008046 | Ga0207705_100080463 | 213 |
| 836 | 3300025909 | Ga0207705_10031780 | Ga0207705_100317804 | 213 |
| 837 | 3300025909 | Ga0207705_10034450 | Ga0207705_100344503 | 213 |
| 838 | 3300025909 | Ga0207705_10189107 | Ga0207705_101891072 | 213 |
| 839 | 3300025911 | Ga0207654_10061667 | Ga0207654_100616672 | 213 |
| 840 | 3300025911 | Ga0207654_10144552 | Ga0207654_101445523 | 213 |
| 841 | 3300025912 | Ga0207707_10000210 | Ga0207707_100002103 | 213 |
| 842 | 3300025912 | Ga0207707_10001339 | Ga0207707_100013393 | 213 |
| 843 | 3300025912 | Ga0207707_10018111 | Ga0207707_100181112 | 213 |
| 844 | 3300025912 | Ga0207707_10025201 | Ga0207707_100252013 | 213 |
| 845 | 3300025912 | Ga0207707_10051492 | Ga0207707_100514924 | 213 |
| 846 | 3300025912 | Ga0207707_10052498 | Ga0207707_100524986 | 213 |
| 847 | 3300025913 | Ga0207695_10000818 | Ga0207695_1000081847 | 213 |
| 848 | 3300025913 | Ga0207695_10006299 | Ga0207695_100062993 | 213 |
| 849 | 3300025913 | Ga0207695_10008130 | Ga0207695_100081308 | 213 |
| 850 | 3300025913 | Ga0207695_10068969 | Ga0207695_100689696 | 213 |
| 851 | 3300025913 | Ga0207695_10073537 | Ga0207695_100735373 | 213 |
| 852 | 3300025913 | Ga0207695_10148552 | Ga0207695_101485522 | 213 |
| 853 | 3300025913 | Ga0207695_10312640 | Ga0207695_103126402 | 213 |
| 854 | 3300025914 | Ga0207671_10028839 | Ga0207671_100288393 | 213 |
| 855 | 3300025914 | Ga0207671_10054495 | Ga0207671_100544952 | 213 |
| 856 | 3300025914 | Ga0207671_10269984 | Ga0207671_102699843 | 213 |
| 857 | 3300025915 | Ga0207693_10134099 | Ga0207693_101340992 | 213 |
| 858 | 3300025917 | Ga0207660_10014060 | Ga0207660_100140603 | 213 |
| 859 | 3300025917 | Ga0207660_10036194 | Ga0207660_100361943 | 213 |
| 860 | 3300025917 | Ga0207660_10105351 | Ga0207660_101053513 | 213 |
| 861 | 3300025917 | Ga0207660_10119378 | Ga0207660_101193783 | 213 |
| 862 | 3300025917 | Ga0207660_10368253 | Ga0207660_103682532 | 213 |
| 863 | 3300025919 | Ga0207657_10055348 | Ga0207657_100553483 | 213 |
| 864 | 3300025919 | Ga0207657_10070713 | Ga0207657_100707133 | 213 |
| 865 | 3300025919 | Ga0207657_10124909 | Ga0207657_101249093 | 213 |
| 866 | 3300025919 | Ga0207657_10128163 | Ga0207657_101281633 | 213 |
| 867 | 3300025919 | Ga0207657_10200956 | Ga0207657_102009561 | 213 |
| 868 | 3300025920 | Ga0207649_10002213 | Ga0207649_100022133 | 213 |
| 869 | 3300025920 | Ga0207649_10015259 | Ga0207649_100152593 | 213 |
| 870 | 3300025920 | Ga0207649_10024587 | Ga0207649_100245872 | 213 |
| 871 | 3300025920 | Ga0207649_10047910 | Ga0207649_100479104 | 213 |
| 872 | 3300025920 | Ga0207649_10065071 | Ga0207649_100650712 | 213 |
| 873 | 3300025921 | Ga0207652_10048121 | Ga0207652_100481216 | 213 |
| 874 | 3300025921 | Ga0207652_10053020 | Ga0207652_100530203 | 213 |
| 875 | 3300025921 | Ga0207652_10147343 | Ga0207652_101473433 | 213 |
| 876 | 3300025921 | Ga0207652_10156736 | Ga0207652_101567363 | 213 |
| 877 | 3300025923 | Ga0207681_10105252 | Ga0207681_101052522 | 213 |
| 878 | 3300025924 | Ga0207694_10028197 | Ga0207694_100281973 | 213 |
| 879 | 3300025924 | Ga0207694_10088183 | Ga0207694_100881834 | 213 |
| 880 | 3300025924 | Ga0207694_10119803 | Ga0207694_101198033 | 213 |
| 881 | 3300025924 | Ga0207694_10160368 | Ga0207694_101603682 | 213 |
| 882 | 3300025924 | Ga0207694_10714487 | Ga0207694_107144872 | 213 |
| 883 | 3300025925 | Ga0207650_10286074 | Ga0207650_102860743 | 213 |
| 884 | 3300025927 | Ga0207687_10481145 | Ga0207687_104811452 | 213 |
| 885 | 3300025928 | Ga0207700_10116306 | Ga0207700_101163063 | 213 |
| 886 | 3300025928 | Ga0207700_10737458 | Ga0207700_107374582 | 213 |
| 887 | 3300025929 | Ga0207664_10001884 | Ga0207664_100018843 | 213 |
| 888 | 3300025931 | Ga0207644_10089389 | Ga0207644_100893892 | 213 |
| 889 | 3300025931 | Ga0207644_10090873 | Ga0207644_100908734 | 213 |
| 890 | 3300025932 | Ga0207690_10000291 | Ga0207690_1000029129 | 213 |
| 891 | 3300025932 | Ga0207690_10003289 | Ga0207690_100032893 | 213 |
| 892 | 3300025932 | Ga0207690_10222034 | Ga0207690_102220342 | 213 |
| 893 | 3300025932 | Ga0207690_10227720 | Ga0207690_102277202 | 213 |
| 894 | 3300025932 | Ga0207690_10670980 | Ga0207690_106709801 | 213 |
| 895 | 3300025932 | Ga0207690_10809951 | Ga0207690_108099511 | 213 |
| 896 | 3300025933 | Ga0207706_10015708 | Ga0207706_100157081 | 213 |
| 897 | 3300025933 | Ga0207706_10100114 | Ga0207706_101001143 | 213 |
| 898 | 3300025933 | Ga0207706_10107956 | Ga0207706_101079564 | 213 |
| 899 | 3300025933 | Ga0207706_10319011 | Ga0207706_103190112 | 213 |
| 900 | 3300025934 | Ga0207686_10333629 | Ga0207686_103336292 | 213 |
| 901 | 3300025939 | Ga0207665_10101234 | Ga0207665_101012343 | 213 |
| 902 | 3300025942 | Ga0207689_10020406 | Ga0207689_100204064 | 213 |
| 903 | 3300025942 | Ga0207689_10136777 | Ga0207689_101367773 | 213 |
| 904 | 3300025944 | Ga0207661_10004252 | Ga0207661_100042523 | 213 |
| 905 | 3300025944 | Ga0207661_10058973 | Ga0207661_100589733 | 213 |
| 906 | 3300025944 | Ga0207661_10273592 | Ga0207661_102735922 | 213 |
| 907 | 3300025944 | Ga0207661_10648918 | Ga0207661_106489181 | 213 |
| 908 | 3300025945 | Ga0207679_10025524 | Ga0207679_100255247 | 213 |
| 909 | 3300025945 | Ga0207679_10425174 | Ga0207679_104251742 | 213 |
| 910 | 3300025949 | Ga0207667_10008758 | Ga0207667_1000875823 | 213 |
| 911 | 3300025949 | Ga0207667_10010803 | Ga0207667_100108033 | 213 |
| 912 | 3300025949 | Ga0207667_10053962 | Ga0207667_100539623 | 213 |
| 913 | 3300025949 | Ga0207667_10072769 | Ga0207667_100727693 | 213 |
| 914 | 3300025949 | Ga0207667_10095216 | Ga0207667_100952164 | 213 |
| 915 | 3300025949 | Ga0207667_10119954 | Ga0207667_101199542 | 213 |
| 916 | 3300025949 | Ga0207667_10193768 | Ga0207667_101937682 | 213 |
| 917 | 3300025960 | Ga0207651_10066649 | Ga0207651_100666492 | 213 |
| 918 | 3300025972 | Ga0207668_10075782 | Ga0207668_100757823 | 213 |
| 919 | 3300025972 | Ga0207668_10187878 | Ga0207668_101878782 | 213 |
| 920 | 3300025972 | Ga0207668_10423728 | Ga0207668_104237282 | 213 |
| 921 | 3300025981 | Ga0207640_10002025 | Ga0207640_1000202521 | 213 |
| 922 | 3300025981 | Ga0207640_10003058 | Ga0207640_100030583 | 213 |
| 923 | 3300025981 | Ga0207640_10025408 | Ga0207640_100254083 | 213 |
| 924 | 3300025981 | Ga0207640_10026008 | Ga0207640_100260083 | 213 |
| 925 | 3300025981 | Ga0207640_10513033 | Ga0207640_105130332 | 213 |
| 926 | 3300025981 | Ga0207640_10559495 | Ga0207640_105594952 | 213 |
| 927 | 3300025986 | Ga0207658_10028034 | Ga0207658_100280347 | 213 |
| 928 | 3300025986 | Ga0207658_10106388 | Ga0207658_101063882 | 213 |
| 929 | 3300026023 | Ga0207677_10345942 | Ga0207677_103459422 | 213 |
| 930 | 3300026035 | Ga0207703_10205239 | Ga0207703_102052393 | 213 |
| 931 | 3300026041 | Ga0207639_10016511 | Ga0207639_100165119 | 213 |
| 932 | 3300026041 | Ga0207639_10029641 | Ga0207639_100296413 | 213 |
| 933 | 3300026041 | Ga0207639_10047428 | Ga0207639_100474286 | 213 |
| 934 | 3300026041 | Ga0207639_10125486 | Ga0207639_101254863 | 213 |
| 935 | 3300026041 | Ga0207639_10452119 | Ga0207639_104521192 | 213 |
| 936 | 3300026067 | Ga0207678_10016758 | Ga0207678_100167582 | 213 |
| 937 | 3300026067 | Ga0207678_10049236 | Ga0207678_100492366 | 213 |
| 938 | 3300026067 | Ga0207678_10055028 | Ga0207678_100550283 | 213 |
| 939 | 3300026067 | Ga0207678_10137839 | Ga0207678_101378393 | 213 |
| 940 | 3300026067 | Ga0207678_10271783 | Ga0207678_102717832 | 213 |
| 941 | 3300026067 | Ga0207678_10729632 | Ga0207678_107296322 | 213 |
| 942 | 3300026078 | Ga0207702_10000852 | Ga0207702_1000085218 | 213 |
| 943 | 3300026078 | Ga0207702_10011901 | Ga0207702_1001190114 | 213 |
| 944 | 3300026078 | Ga0207702_10012283 | Ga0207702_1001228314 | 213 |
| 945 | 3300026078 | Ga0207702_10074823 | Ga0207702_100748233 | 213 |
| 946 | 3300026078 | Ga0207702_10091382 | Ga0207702_100913823 | 213 |
| 947 | 3300026078 | Ga0207702_10161689 | Ga0207702_101616892 | 213 |
| 948 | 3300026078 | Ga0207702_10375412 | Ga0207702_103754122 | 213 |
| 949 | 3300026088 | Ga0207641_10183031 | Ga0207641_101830313 | 213 |
| 950 | 3300026089 | Ga0207648_10168415 | Ga0207648_101684153 | 213 |
| 951 | 3300026095 | Ga0207676_10162686 | Ga0207676_101626862 | 213 |
| 952 | 3300026095 | Ga0207676_10285849 | Ga0207676_102858493 | 213 |
| 953 | 3300026116 | Ga0207674_10001554 | Ga0207674_100015542 | 213 |
| 954 | 3300026116 | Ga0207674_10017287 | Ga0207674_100172873 | 213 |
| 955 | 3300026116 | Ga0207674_10059241 | Ga0207674_100592414 | 213 |
| 956 | 3300026116 | Ga0207674_10111246 | Ga0207674_101112463 | 213 |
| 957 | 3300026116 | Ga0207674_10142271 | Ga0207674_101422714 | 213 |
| 958 | 3300026118 | Ga0207675_100106837 | Ga0207675_1001068372 | 213 |
| 959 | 3300026118 | Ga0207675_100774282 | Ga0207675_1007742822 | 213 |
| 960 | 3300026121 | Ga0207683_10023634 | Ga0207683_1002363410 | 213 |
| 961 | 3300026142 | Ga0207698_10007267 | Ga0207698_100072673 | 213 |
| 962 | 3300026142 | Ga0207698_10038635 | Ga0207698_100386356 | 213 |
| 963 | 3300026142 | Ga0207698_10052641 | Ga0207698_100526413 | 213 |
| 964 | 3300026142 | Ga0207698_10301744 | Ga0207698_103017442 | 213 |
| 965 | 3300026142 | Ga0207698_10705601 | Ga0207698_107056011 | 213 |
| 966 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000013285 | 213 |
| 967 | 3300028379 | Ga0268266_10100303 | Ga0268266_101003033 | 213 |
| 968 | 3300028380 | Ga0268265_10115242 | Ga0268265_101152424 | 213 |
| 969 | 3300028381 | Ga0268264_10023204 | Ga0268264_100232042 | 213 |
| 970 | 3300028381 | Ga0268264_10121193 | Ga0268264_101211933 | 213 |
| 971 | 3300028786 | Ga0307517_10241588 | Ga0307517_102415882 | 213 |
| 972 | 3300030863 | Ga0265766_1002482 | Ga0265766_10024822 | 213 |
| 973 | 3300030882 | Ga0265764_100381 | Ga0265764_1003812 | 213 |
| 974 | 3300031011 | Ga0265774_100076 | Ga0265774_1000764 | 213 |
| 975 | 3300031824 | Ga0307413_10146858 | Ga0307413_101468582 | 213 |
| 976 | 3300031995 | Ga0307409_100474526 | Ga0307409_1004745262 | 213 |
| 977 | 3300033179 | Ga0307507_10270077 | Ga0307507_102700772 | 213 |
| 978 | 3300036458 | Ga0310112_000276 | Ga0310112_000276_2700_3341 | 213 |
| 979 | 3300036534 | Ga0310109_011090 | Ga0310109_011090_387_1028 | 213 |
| 980 | 3300036535 | Ga0310110_004759 | Ga0310110_004759_584_1225 | 213 |
| 981 | 3300037312 | Ga0395899_0042216 | Ga0395899_0042216_498_1139 | 213 |
| 982 | 3300037418 | Ga0395900_0125348 | Ga0395900_0125348_12_653 | 213 |
| 983 | 3300037418 | Ga0395900_0135347 | Ga0395900_0135347_1111_1752 | 213 |
| 984 | 3300037418 | Ga0395900_0172278 | Ga0395900_0172278_598_1239 | 213 |
| 985 | 3300037466 | Ga0395898_0135016 | Ga0395898_0135016_930_1571 | 213 |
| 986 | 3300037466 | Ga0395898_0138563 | Ga0395898_0138563_594_1235 | 213 |
| 987 | 3300038443 | Ga0395901_0002939 | Ga0395901_0002939_1001_1642 | 213 |
| 988 | 3300038443 | Ga0395901_0218962 | Ga0395901_0218962_782_1423 | 213 |
| 989 | 3300039447 | Ga0436361_1002022 | Ga0436361_1002022_85_726 | 213 |
| 990 | 3300042000 | Ga0439437_001431 | Ga0439437_001431_1319_1960 | 213 |
| 991 | 3300042012 | Ga0439455_0060019 | Ga0439455_0060019_218_859 | 213 |
| 992 | 3300045976 | Ga0466967_0743177 | Ga0466967_0743177_84_731 | 213 |
| 993 | 3300048910 | Ga0496107_0074215 | Ga0496107_0074215_209_856 | 213 |
| 994 | 3300048916 | Ga0496113_0237825 | Ga0496113_0237825_593_1234 | 213 |
| 995 | 3300048917 | Ga0496114_0146312 | Ga0496114_0146312_378_1025 | 213 |
| 996 | 3300048918 | Ga0496115_0002269 | Ga0496115_0002269_12210_12851 | 213 |
| 997 | 3300048918 | Ga0496115_0137021 | Ga0496115_0137021_466_1113 | 213 |
| 998 | 3300048929 | Ga0496126_0119779 | Ga0496126_0119779_971_1618 | 213 |
| 999 | 3300049568 | Ga0501031_0249142 | Ga0501031_0249142_16_657 | 213 |
| 1000 | 3300049568 | Ga0501031_0388182 | Ga0501031_0388182_158_799 | 213 |
| 1001 | 3300049569 | Ga0501032_0025237 | Ga0501032_0025237_2589_3230 | 213 |
| 1002 | 3300049569 | Ga0501032_0294043 | Ga0501032_0294043_78_719 | 213 |
| 1003 | 3300049570 | Ga0501033_0012162 | Ga0501033_0012162_5779_6420 | 213 |
| 1004 | 3300049571 | Ga0501034_0056333 | Ga0501034_0056333_2804_3445 | 213 |
| 1005 | 3300049571 | Ga0501034_0214299 | Ga0501034_0214299_1166_1807 | 213 |
| 1006 | 3300049571 | Ga0501034_0826266 | Ga0501034_0826266_62_703 | 213 |
| 1007 | 3300049572 | Ga0501036_0603738 | Ga0501036_0603738_171_812 | 213 |
| 1008 | 3300049573 | Ga0501037_0127086 | Ga0501037_0127086_938_1585 | 213 |
| 1009 | 3300049574 | Ga0501038_0013134 | Ga0501038_0013134_1530_2171 | 213 |
| 1010 | 3300049574 | Ga0501038_0199794 | Ga0501038_0199794_571_1212 | 213 |
| 1011 | 3300049578 | Ga0501042_0056670 | Ga0501042_0056670_1162_1803 | 213 |
| 1012 | 3300049578 | Ga0501042_0144574 | Ga0501042_0144574_803_1450 | 213 |
| 1013 | 3300049578 | Ga0501042_0343336 | Ga0501042_0343336_398_1039 | 213 |
| 1014 | 3300049579 | Ga0501043_0269409 | Ga0501043_0269409_17_658 | 213 |
| 1015 | 3300049580 | Ga0501046_0034206 | Ga0501046_0034206_2334_2975 | 213 |
| 1016 | 3300049580 | Ga0501046_0100330 | Ga0501046_0100330_697_1344 | 213 |
| 1017 | 3300049580 | Ga0501046_0113833 | Ga0501046_0113833_562_1203 | 213 |
| 1018 | 3300049580 | Ga0501046_0334541 | Ga0501046_0334541_425_1066 | 213 |
| 1019 | 3300049581 | Ga0501047_0000250 | Ga0501047_0000250_493_1134 | 213 |
| 1020 | 3300049581 | Ga0501047_0103968 | Ga0501047_0103968_89_736 | 213 |
| 1021 | 3300049581 | Ga0501047_0188557 | Ga0501047_0188557_759_1400 | 213 |
| 1022 | 3300049581 | Ga0501047_0232735 | Ga0501047_0232735_563_1204 | 213 |
| 1023 | 3300049582 | Ga0501048_0021518 | Ga0501048_0021518_3370_4011 | 213 |
| 1024 | 3300049582 | Ga0501048_0029557 | Ga0501048_0029557_2958_3605 | 213 |
| 1025 | 3300049583 | Ga0501067_0015294 | Ga0501067_0015294_3118_3765 | 213 |
| 1026 | 3300049584 | Ga0501068_0246210 | Ga0501068_0246210_184_831 | 213 |
| 1027 | 3300049585 | Ga0501069_0060151 | Ga0501069_0060151_864_1505 | 213 |
| 1028 | 3300049585 | Ga0501069_0109992 | Ga0501069_0109992_431_1072 | 213 |
| 1029 | 3300049586 | Ga0501070_0033585 | Ga0501070_0033585_3173_3820 | 213 |
| 1030 | 3300049586 | Ga0501070_0036917 | Ga0501070_0036917_568_1209 | 213 |
| 1031 | 3300049586 | Ga0501070_0138119 | Ga0501070_0138119_575_1216 | 213 |
| 1032 | 3300049586 | Ga0501070_0144521 | Ga0501070_0144521_389_1030 | 213 |
| 1033 | 3300049586 | Ga0501070_0162900 | Ga0501070_0162900_687_1328 | 213 |
| 1034 | 3300049587 | Ga0501071_0088182 | Ga0501071_0088182_906_1553 | 213 |
| 1035 | 3300049589 | Ga0501073_0059390 | Ga0501073_0059390_1273_1914 | 213 |
| 1036 | 3300049589 | Ga0501073_0588853 | Ga0501073_0588853_42_683 | 213 |
| 1037 | 3300049590 | Ga0501074_0060097 | Ga0501074_0060097_1107_1748 | 213 |
| 1038 | 3300049590 | Ga0501074_0148950 | Ga0501074_0148950_938_1585 | 213 |
| 1039 | 3300049590 | Ga0501074_0154724 | Ga0501074_0154724_42_683 | 213 |
| 1040 | 3300049592 | Ga0501076_0515508 | Ga0501076_0515508_82_723 | 213 |
| 1041 | 3300049741 | Ga0501079_0285027 | Ga0501079_0285027_400_1047 | 213 |
| 1042 | 3300049741 | Ga0501079_0374970 | Ga0501079_0374970_19_660 | 213 |
| 1043 | 3300049742 | Ga0501080_0049719 | Ga0501080_0049719_665_1312 | 213 |
| 1044 | 3300049742 | Ga0501080_0062331 | Ga0501080_0062331_826_1467 | 213 |
| 1045 | 3300049742 | Ga0501080_0107130 | Ga0501080_0107130_1555_2196 | 213 |
| 1046 | 3300049743 | Ga0501081_0073960 | Ga0501081_0073960_158_805 | 213 |
| 1047 | 3300049744 | Ga0501083_0057300 | Ga0501083_0057300_1717_2364 | 213 |
| 1048 | 3300049744 | Ga0501083_0154216 | Ga0501083_0154216_234_875 | 213 |
| 1049 | 3300049822 | Ga0501035_0043368 | Ga0501035_0043368_2958_3599 | 213 |
| 1050 | 3300049822 | Ga0501035_0069939 | Ga0501035_0069939_535_1176 | 213 |
| 1051 | 3300049822 | Ga0501035_0508787 | Ga0501035_0508787_78_719 | 213 |
| 1052 | 3300049822 | Ga0501035_0769091 | Ga0501035_0769091_15_656 | 213 |
| 1053 | 3300049823 | Ga0501044_0154438 | Ga0501044_0154438_55_696 | 213 |
| 1054 | 3300049823 | Ga0501044_0406799 | Ga0501044_0406799_245_892 | 213 |
| 1055 | 3300049824 | Ga0501045_0273922 | Ga0501045_0273922_23_664 | 213 |
| 1056 | 3300053155 | Ga0500620_109363 | Ga0500620_109363_230_877 | 213 |
| 1057 | 3300054114 | Ga0501084_0245529 | Ga0501084_0245529_633_1274 | 213 |
| 1058 | 3300059492 | Ga0587073_0001891 | Ga0587073_0001891_582_1223 | 213 |
| 1059 | 3300059508 | Ga0587088_001539 | Ga0587088_001539_1155_1796 | 213 |
| 1060 | 3300059605 | Ga0587106_000089 | Ga0587106_000089_826_1467 | 213 |
| 1061 | 3300059623 | Ga0587101_006283 | Ga0587101_006283_557_1198 | 213 |
| 1062 | 3300059644 | Ga0587075_006913 | Ga0587075_006913_207_848 | 213 |
| 1063 | 3300059647 | Ga0587079_003247 | Ga0587079_003247_788_1429 | 213 |
| 1064 | 3300060353 | Ga0501082_0146414 | Ga0501082_0146414_697_1344 | 213 |
| 1065 | 3300060353 | Ga0501082_0507194 | Ga0501082_0507194_367_1008 | 213 |
| 1066 | iso_pu_bacteria | 2939611941 | 2939612733 | 213 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c93-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.9543 | 3 | 212 |
| 8c97-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.9529 | 3 | 213 |
| 8c93-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.943 | 3 | 212 |
| 8c97-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.9415 | 3 | 213 |
| 6pvk-assembly1.cif.gz_D | bacterial 45srbga ribosomal particle class a | 0.9317 | 3 | 212 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WH87_35_101_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9766 | 35 | 99 | 3.30.160.810 |
| af_Q9SKX4_88_148_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.973 | 35 | 85 | 3.30.160.810 |
| af_Q9LIT4_106_169_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9582 | 35 | 99 | 3.30.160.810 |
| af_P60438_33_95_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9485 | 34 | 97 | 3.30.160.810 |
| af_Q54I61_95_160_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9399 | 33 | 97 | 3.30.160.810 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A812F856-F1-model_v4 | It binds directly near the 3'-end of the 23S rRNA | 0.9711 | 3 | 86 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A2V6DPT5-F1-model_v4 | 50S ribosomal protein L3 | 0.9675 | 1 | 86 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A3B9LAN4-F1-model_v4 | 50S ribosomal protein L3 | 0.9623 | 4 | 124 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A447N332-F1-model_v4 | 50S ribosomal protein L3 | 0.9597 | 3 | 86 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A485AH68-F1-model_v4 | 50S ribosomal protein L3 | 0.9591 | 3 | 106 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar