F489335
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1063 | 390 | 2126 | 271 |
Family's Representative Sequence
| Representative Sequence | 3300049582|Ga0501048_0127641|Ga0501048_0127641_616_1569 |
| Length | 317 |
| Sequence | MAGAENASKVVQDSTSSSFSARRPGTDGVHAATSARQHTDSTIREGDMSGWNAMSYDAKDTILRVVHHEAEQFFDLVDSDDAWESPTGAGHWQVRDLVGHLVDTTEAYFVAFDAARNHAEVDPAWGLPGMAERVDSQAQALRSVPRAELMERLRTDYAKMREIHEGLSEDDWTNLMVPHFYMGPLPAFFYPAFQLMDYGVHSWDVRQGTGRAHGLDGEAADLLAPFMFVLWKYTCDVTGVDPLVLGIRITSGPNAGDTRVSIGDGMDYEPGPVDDLDTVLEFDPGSFVLTAFGRTNAGTIRGDRQRAERYLNLFFRI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 8 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 9 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 12 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 100 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 135 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 199 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 209 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 210 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 212 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 213 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 214 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 215 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 216 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 217 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 218 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 219 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 220 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 221 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 222 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 224 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 227 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 236 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 241 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 256 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 257 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 258 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 259 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 260 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 261 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 262 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 263 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 264 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 265 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 266 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 267 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 268 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 269 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 270 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 271 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 272 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 273 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 274 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 275 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 276 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 277 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 278 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 337 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 338 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 339 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 342 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 343 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 364 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 371 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 384 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 389 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 390 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.3 |
| Metatranscriptomes | 4.52 |
| Isolates | 0.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.09 |
| Nodule | 0 |
| Rhizoplane | 5.17 |
| Rhizosphere | 93.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501048_0127641 | 3300049582 | Bacteria | 1799 |
| 2 | SwRhRL3b_contig_3218519 | 2162886006 | Bacteria | 2421 |
| 3 | SwRhRL2b_contig_1162259 | 2162886007 | Bacteria | 3264 |
| 4 | JGI24740J21852_10023551 | 3300001979 | Bacteria | 2101 |
| 5 | JGI24737J22298_10012008 | 3300001990 | Bacteria | 2829 |
| 6 | rootH1_10019379 | 3300003316 | Bacteria | 2506 |
| 7 | JGI25407J50210_10011208 | 3300003373 | Bacteria | 2289 |
| 8 | JGI25407J50210_10014099 | 3300003373 | Bacteria | 2059 |
| 9 | JGI25405J52794_10036385 | 3300003911 | Bacteria | 1033 |
| 10 | Ga0058859_11127628 | 3300004798 | Unclassified | 1041 |
| 11 | Ga0058859_11245634 | 3300004798 | Bacteria | 923 |
| 12 | Ga0058863_10065652 | 3300004799 | Bacteria | 1369 |
| 13 | Ga0058863_11873860 | 3300004799 | Bacteria | 1791 |
| 14 | Ga0058860_11876494 | 3300004801 | Bacteria | 1399 |
| 15 | Ga0058860_12191030 | 3300004801 | Bacteria | 1366 |
| 16 | Ga0058862_10044071 | 3300004803 | Bacteria | 955 |
| 17 | Ga0058862_12728235 | 3300004803 | Bacteria | 1436 |
| 18 | Ga0065704_10000443 | 3300005289 | Bacteria | 21010 |
| 19 | Ga0065704_10167379 | 3300005289 | Bacteria | 1314 |
| 20 | Ga0065715_10342035 | 3300005293 | Bacteria | 965 |
| 21 | Ga0065707_10042627 | 3300005295 | Unclassified | 1224 |
| 22 | Ga0065707_10082128 | 3300005295 | Bacteria | 21253 |
| 23 | Ga0065707_10084513 | 3300005295 | Bacteria | 7116 |
| 24 | Ga0065707_10378474 | 3300005295 | Bacteria | 880 |
| 25 | Ga0070658_10172574 | 3300005327 | Bacteria | 1817 |
| 26 | Ga0070683_100001463 | 3300005329 | Bacteria | 18156 |
| 27 | Ga0070683_100038145 | 3300005329 | Bacteria | 4402 |
| 28 | Ga0070683_100058981 | 3300005329 | Bacteria | 3566 |
| 29 | Ga0070683_100148479 | 3300005329 | Bacteria | 2222 |
| 30 | Ga0070690_100203160 | 3300005330 | Bacteria | 1380 |
| 31 | Ga0068869_100066263 | 3300005334 | Bacteria | 2660 |
| 32 | Ga0070666_10080692 | 3300005335 | Bacteria | 2224 |
| 33 | Ga0070680_100351199 | 3300005336 | Bacteria | 1254 |
| 34 | Ga0070680_100399281 | 3300005336 | Bacteria | 1172 |
| 35 | Ga0070682_100053961 | 3300005337 | Bacteria | 2520 |
| 36 | Ga0068868_100085535 | 3300005338 | Bacteria | 2534 |
| 37 | Ga0068868_100086786 | 3300005338 | Bacteria | 2516 |
| 38 | Ga0070660_100109482 | 3300005339 | Bacteria | 2196 |
| 39 | Ga0070691_10003974 | 3300005341 | Bacteria | 6691 |
| 40 | Ga0070691_10220315 | 3300005341 | Bacteria | 1005 |
| 41 | Ga0070687_100048363 | 3300005343 | Bacteria | 2187 |
| 42 | Ga0070661_100373922 | 3300005344 | Bacteria | 1122 |
| 43 | Ga0070692_10135552 | 3300005345 | Bacteria | 1388 |
| 44 | Ga0070692_10141485 | 3300005345 | Bacteria | 1362 |
| 45 | Ga0070668_100016228 | 3300005347 | Bacteria | 5571 |
| 46 | Ga0070668_100032036 | 3300005347 | Bacteria | 4000 |
| 47 | Ga0070668_100166430 | 3300005347 | Bacteria | 1792 |
| 48 | Ga0070674_100039737 | 3300005356 | Bacteria | 3178 |
| 49 | Ga0070673_100335295 | 3300005364 | Bacteria | 1339 |
| 50 | Ga0070673_100444409 | 3300005364 | Bacteria | 1165 |
| 51 | Ga0070659_100073205 | 3300005366 | Bacteria | 2727 |
| 52 | Ga0070667_100131393 | 3300005367 | Bacteria | 2186 |
| 53 | Ga0070703_10021242 | 3300005406 | Bacteria | 1896 |
| 54 | Ga0070703_10043785 | 3300005406 | Unclassified | 1405 |
| 55 | Ga0070709_10001473 | 3300005434 | Bacteria | 12696 |
| 56 | Ga0070709_10099741 | 3300005434 | Unclassified | 1932 |
| 57 | Ga0070709_10290597 | 3300005434 | Bacteria | 1191 |
| 58 | Ga0070714_100054899 | 3300005435 | Bacteria | 3404 |
| 59 | Ga0070714_100093225 | 3300005435 | Bacteria | 2640 |
| 60 | Ga0070713_100002567 | 3300005436 | Bacteria | 11865 |
| 61 | Ga0070713_100003245 | 3300005436 | Bacteria | 10725 |
| 62 | Ga0070713_100050234 | 3300005436 | Bacteria | 3444 |
| 63 | Ga0070713_100080951 | 3300005436 | Bacteria | 2770 |
| 64 | Ga0070710_10011620 | 3300005437 | Bacteria | 4354 |
| 65 | Ga0070710_10013826 | 3300005437 | Bacteria | 4051 |
| 66 | Ga0070710_10070994 | 3300005437 | Bacteria | 2007 |
| 67 | Ga0070701_10147901 | 3300005438 | Bacteria | 1350 |
| 68 | Ga0070711_100020123 | 3300005439 | Bacteria | 4295 |
| 69 | Ga0070705_100085368 | 3300005440 | Bacteria | 1951 |
| 70 | Ga0070705_100216461 | 3300005440 | Bacteria | 1323 |
| 71 | Ga0070705_100559881 | 3300005440 | Bacteria | 878 |
| 72 | Ga0070700_100061066 | 3300005441 | Unclassified | 2377 |
| 73 | Ga0070700_100106135 | 3300005441 | Unclassified | 1859 |
| 74 | Ga0070700_100449571 | 3300005441 | Bacteria | 980 |
| 75 | Ga0070694_100015334 | 3300005444 | Bacteria | 4811 |
| 76 | Ga0070694_100118132 | 3300005444 | Bacteria | 1899 |
| 77 | Ga0070708_100001090 | 3300005445 | Bacteria | 20733 |
| 78 | Ga0070708_100038294 | 3300005445 | Bacteria | 4189 |
| 79 | Ga0070708_100091089 | 3300005445 | Bacteria | 2776 |
| 80 | Ga0070663_100292785 | 3300005455 | Bacteria | 1301 |
| 81 | Ga0070678_100002797 | 3300005456 | Bacteria | 9643 |
| 82 | Ga0070678_100039449 | 3300005456 | Bacteria | 3332 |
| 83 | Ga0070662_100018037 | 3300005457 | Bacteria | 4768 |
| 84 | Ga0070662_100027333 | 3300005457 | Bacteria | 3959 |
| 85 | Ga0068867_100586713 | 3300005459 | Bacteria | 970 |
| 86 | Ga0070706_100000133 | 3300005467 | Bacteria | 92343 |
| 87 | Ga0070706_100001026 | 3300005467 | Bacteria | 30302 |
| 88 | Ga0070706_100002668 | 3300005467 | Bacteria | 17864 |
| 89 | Ga0070706_100004689 | 3300005467 | Bacteria | 13110 |
| 90 | Ga0070706_100005186 | 3300005467 | Bacteria | 12436 |
| 91 | Ga0070706_100005303 | 3300005467 | Bacteria | 12288 |
| 92 | Ga0070706_100011788 | 3300005467 | Bacteria | 8115 |
| 93 | Ga0070706_100016224 | 3300005467 | Bacteria | 6880 |
| 94 | Ga0070706_100041377 | 3300005467 | Bacteria | 4255 |
| 95 | Ga0070706_100098838 | 3300005467 | Bacteria | 2712 |
| 96 | Ga0070706_100246921 | 3300005467 | Bacteria | 1666 |
| 97 | Ga0070707_100000176 | 3300005468 | Bacteria | 62533 |
| 98 | Ga0070707_100000482 | 3300005468 | Bacteria | 39396 |
| 99 | Ga0070707_100002121 | 3300005468 | Bacteria | 18983 |
| 100 | Ga0070707_100044337 | 3300005468 | Bacteria | 4258 |
| 101 | Ga0070707_100050312 | 3300005468 | Bacteria | 3994 |
| 102 | Ga0070707_100284807 | 3300005468 | Bacteria | 1606 |
| 103 | Ga0070707_100328884 | 3300005468 | Bacteria | 1485 |
| 104 | Ga0070698_100000504 | 3300005471 | Bacteria | 41462 |
| 105 | Ga0070698_100001605 | 3300005471 | Bacteria | 25142 |
| 106 | Ga0070698_100004911 | 3300005471 | Bacteria | 14664 |
| 107 | Ga0070698_100023430 | 3300005471 | Bacteria | 6455 |
| 108 | Ga0070698_100047461 | 3300005471 | Unclassified | 4389 |
| 109 | Ga0070698_100048921 | 3300005471 | Bacteria | 4319 |
| 110 | Ga0070698_100054317 | 3300005471 | Unclassified | 4067 |
| 111 | Ga0070698_100063492 | 3300005471 | Bacteria | 3724 |
| 112 | Ga0070698_100078994 | 3300005471 | Unclassified | 3287 |
| 113 | Ga0070698_100106743 | 3300005471 | Bacteria | 2769 |
| 114 | Ga0070698_100128866 | 3300005471 | Bacteria | 2486 |
| 115 | Ga0070698_100169437 | 3300005471 | Bacteria | 2125 |
| 116 | Ga0070698_100285628 | 3300005471 | Unclassified | 1581 |
| 117 | Ga0070698_100306172 | 3300005471 | Bacteria | 1520 |
| 118 | Ga0070699_100001393 | 3300005518 | Bacteria | 22220 |
| 119 | Ga0070699_100017628 | 3300005518 | Bacteria | 6130 |
| 120 | Ga0070699_100035425 | 3300005518 | Bacteria | 4315 |
| 121 | Ga0070699_100386048 | 3300005518 | Unclassified | 1265 |
| 122 | Ga0070679_100279964 | 3300005530 | Bacteria | 1621 |
| 123 | Ga0070679_100705210 | 3300005530 | Unclassified | 952 |
| 124 | Ga0070684_100013071 | 3300005535 | Bacteria | 6681 |
| 125 | Ga0070684_100021280 | 3300005535 | Bacteria | 5394 |
| 126 | Ga0070684_100044362 | 3300005535 | Bacteria | 3846 |
| 127 | Ga0070684_100251078 | 3300005535 | Bacteria | 1617 |
| 128 | Ga0070697_100047108 | 3300005536 | Bacteria | 3496 |
| 129 | Ga0070697_100063907 | 3300005536 | Bacteria | 3006 |
| 130 | Ga0068853_100023449 | 3300005539 | Bacteria | 5167 |
| 131 | Ga0070686_100033047 | 3300005544 | Bacteria | 3176 |
| 132 | Ga0070695_100033414 | 3300005545 | Bacteria | 3218 |
| 133 | Ga0070695_100109668 | 3300005545 | Bacteria | 1871 |
| 134 | Ga0070693_100014606 | 3300005547 | Bacteria | 4027 |
| 135 | Ga0070665_100152693 | 3300005548 | Unclassified | 2312 |
| 136 | Ga0070704_100025909 | 3300005549 | Unclassified | 3866 |
| 137 | Ga0070704_100127325 | 3300005549 | Bacteria | 1967 |
| 138 | Ga0070704_100219037 | 3300005549 | Bacteria | 1546 |
| 139 | Ga0070704_100324057 | 3300005549 | Bacteria | 1292 |
| 140 | Ga0068855_100170763 | 3300005563 | Bacteria | 2463 |
| 141 | Ga0068855_100456238 | 3300005563 | Bacteria | 1394 |
| 142 | Ga0068855_100719510 | 3300005563 | Bacteria | 1067 |
| 143 | Ga0070664_100089036 | 3300005564 | Bacteria | 2670 |
| 144 | Ga0068857_100012182 | 3300005577 | Bacteria | 7479 |
| 145 | Ga0068857_100047229 | 3300005577 | Bacteria | 3822 |
| 146 | Ga0068857_100136943 | 3300005577 | Bacteria | 2211 |
| 147 | Ga0068857_100146642 | 3300005577 | Bacteria | 2135 |
| 148 | Ga0068854_100249383 | 3300005578 | Bacteria | 1417 |
| 149 | Ga0068856_100008570 | 3300005614 | Bacteria | 9941 |
| 150 | Ga0068856_100093626 | 3300005614 | Bacteria | 2990 |
| 151 | Ga0068856_100154674 | 3300005614 | Bacteria | 2303 |
| 152 | Ga0068856_100459260 | 3300005614 | Bacteria | 1294 |
| 153 | Ga0068856_100521932 | 3300005614 | Bacteria | 1209 |
| 154 | Ga0070702_100029371 | 3300005615 | Bacteria | 2989 |
| 155 | Ga0070702_100066630 | 3300005615 | Bacteria | 2112 |
| 156 | Ga0068852_100147377 | 3300005616 | Bacteria | 2185 |
| 157 | Ga0068852_100239563 | 3300005616 | Bacteria | 1733 |
| 158 | Ga0068852_100521273 | 3300005616 | Bacteria | 1186 |
| 159 | Ga0068859_100135213 | 3300005617 | Unclassified | 2538 |
| 160 | Ga0068859_100176563 | 3300005617 | Bacteria | 2218 |
| 161 | Ga0068859_100228649 | 3300005617 | Unclassified | 1948 |
| 162 | Ga0068859_100323170 | 3300005617 | Bacteria | 1637 |
| 163 | Ga0068859_100386100 | 3300005617 | Unclassified | 1496 |
| 164 | Ga0068864_100040044 | 3300005618 | Unclassified | 4008 |
| 165 | Ga0068864_100057065 | 3300005618 | Bacteria | 3373 |
| 166 | Ga0068866_10018127 | 3300005718 | Bacteria | 3179 |
| 167 | Ga0068866_10155721 | 3300005718 | Bacteria | 1328 |
| 168 | Ga0068861_100028205 | 3300005719 | Bacteria | 4096 |
| 169 | Ga0068861_100261811 | 3300005719 | Bacteria | 1481 |
| 170 | Ga0068861_100431161 | 3300005719 | Bacteria | 1177 |
| 171 | Ga0068861_100618789 | 3300005719 | Bacteria | 996 |
| 172 | Ga0068870_10124351 | 3300005840 | Bacteria | 1490 |
| 173 | Ga0068863_100048931 | 3300005841 | Bacteria | 4008 |
| 174 | Ga0068863_100223278 | 3300005841 | Bacteria | 1815 |
| 175 | Ga0068858_100017789 | 3300005842 | Bacteria | 6655 |
| 176 | Ga0068858_100493276 | 3300005842 | Unclassified | 1183 |
| 177 | Ga0068860_100044534 | 3300005843 | Bacteria | 4229 |
| 178 | Ga0068860_100082290 | 3300005843 | Bacteria | 3062 |
| 179 | Ga0068862_100213665 | 3300005844 | Bacteria | 1744 |
| 180 | Ga0081455_10001196 | 3300005937 | Bacteria | 32499 |
| 181 | Ga0081455_10001884 | 3300005937 | Bacteria | 25242 |
| 182 | Ga0081455_10012456 | 3300005937 | Bacteria | 8486 |
| 183 | Ga0081455_10018256 | 3300005937 | Bacteria | 6691 |
| 184 | Ga0081455_10028069 | 3300005937 | Bacteria | 5146 |
| 185 | Ga0081455_10083346 | 3300005937 | Bacteria | 2613 |
| 186 | Ga0081455_10093872 | 3300005937 | Bacteria | 2425 |
| 187 | Ga0081455_10110766 | 3300005937 | Bacteria | 2182 |
| 188 | Ga0081455_10112369 | 3300005937 | Bacteria | 2162 |
| 189 | Ga0081538_10000439 | 3300005981 | Bacteria | 46752 |
| 190 | Ga0081538_10001065 | 3300005981 | Bacteria | 29204 |
| 191 | Ga0081538_10001354 | 3300005981 | Bacteria | 25218 |
| 192 | Ga0081538_10011651 | 3300005981 | Bacteria | 7109 |
| 193 | Ga0081538_10015961 | 3300005981 | Bacteria | 5785 |
| 194 | Ga0081540_1000548 | 3300005983 | Bacteria | 36395 |
| 195 | Ga0081540_1001646 | 3300005983 | Bacteria | 19006 |
| 196 | Ga0081540_1004092 | 3300005983 | Bacteria | 11272 |
| 197 | Ga0081539_10002659 | 3300005985 | Bacteria | 24348 |
| 198 | Ga0081539_10007525 | 3300005985 | Bacteria | 9874 |
| 199 | Ga0081539_10015493 | 3300005985 | Bacteria | 5535 |
| 200 | Ga0081539_10040406 | 3300005985 | Bacteria | 2738 |
| 201 | Ga0081539_10083931 | 3300005985 | Bacteria | 1666 |
| 202 | Ga0070717_10005187 | 3300006028 | Bacteria | 9494 |
| 203 | Ga0070717_10020265 | 3300006028 | Bacteria | 5226 |
| 204 | Ga0070717_10023959 | 3300006028 | Bacteria | 4842 |
| 205 | Ga0070717_10066162 | 3300006028 | Bacteria | 3005 |
| 206 | Ga0070717_10084658 | 3300006028 | Bacteria | 2668 |
| 207 | Ga0070717_10139646 | 3300006028 | Bacteria | 2089 |
| 208 | Ga0070717_10177239 | 3300006028 | Bacteria | 1856 |
| 209 | Ga0070717_10203592 | 3300006028 | Bacteria | 1734 |
| 210 | Ga0070717_10392219 | 3300006028 | Bacteria | 1246 |
| 211 | Ga0075432_10000582 | 3300006058 | Bacteria | 11034 |
| 212 | Ga0075432_10009306 | 3300006058 | Bacteria | 3345 |
| 213 | Ga0075432_10014210 | 3300006058 | Bacteria | 2711 |
| 214 | Ga0075432_10112641 | 3300006058 | Bacteria | 1015 |
| 215 | Ga0070715_10018496 | 3300006163 | Bacteria | 2656 |
| 216 | Ga0070715_10024955 | 3300006163 | Bacteria | 2363 |
| 217 | Ga0070715_10041051 | 3300006163 | Bacteria | 1937 |
| 218 | Ga0070715_10078330 | 3300006163 | Bacteria | 1494 |
| 219 | Ga0070716_100009210 | 3300006173 | Bacteria | 4917 |
| 220 | Ga0070716_100010044 | 3300006173 | Bacteria | 4736 |
| 221 | Ga0070716_100131084 | 3300006173 | Unclassified | 1585 |
| 222 | Ga0070712_100001569 | 3300006175 | Bacteria | 13979 |
| 223 | Ga0070712_100050373 | 3300006175 | Bacteria | 2897 |
| 224 | Ga0070712_100140132 | 3300006175 | Bacteria | 1844 |
| 225 | Ga0097621_100043256 | 3300006237 | Bacteria | 3631 |
| 226 | Ga0097621_100678527 | 3300006237 | Bacteria | 947 |
| 227 | Ga0068871_100065716 | 3300006358 | Bacteria | 2971 |
| 228 | Ga0068871_100116068 | 3300006358 | Bacteria | 2257 |
| 229 | Ga0075428_100007986 | 3300006844 | Bacteria | 11738 |
| 230 | Ga0075428_100008346 | 3300006844 | Bacteria | 11486 |
| 231 | Ga0075428_100009860 | 3300006844 | Bacteria | 10615 |
| 232 | Ga0075428_100016309 | 3300006844 | Bacteria | 8211 |
| 233 | Ga0075428_100038679 | 3300006844 | Bacteria | 5250 |
| 234 | Ga0075428_100042899 | 3300006844 | Bacteria | 4973 |
| 235 | Ga0075428_100048687 | 3300006844 | Bacteria | 4652 |
| 236 | Ga0075428_100085874 | 3300006844 | Bacteria | 3432 |
| 237 | Ga0075428_100146659 | 3300006844 | Bacteria | 2565 |
| 238 | Ga0075428_100639506 | 3300006844 | Bacteria | 1135 |
| 239 | Ga0075430_100015845 | 3300006846 | Bacteria | 6420 |
| 240 | Ga0075430_100023142 | 3300006846 | Bacteria | 5284 |
| 241 | Ga0075430_100071533 | 3300006846 | Bacteria | 2910 |
| 242 | Ga0075430_100131707 | 3300006846 | Bacteria | 2084 |
| 243 | Ga0075430_100139107 | 3300006846 | Bacteria | 2022 |
| 244 | Ga0075430_100387034 | 3300006846 | Bacteria | 1154 |
| 245 | Ga0075431_100000655 | 3300006847 | Bacteria | 29411 |
| 246 | Ga0075431_100022463 | 3300006847 | Bacteria | 6449 |
| 247 | Ga0075431_100032343 | 3300006847 | Bacteria | 5391 |
| 248 | Ga0075431_100033074 | 3300006847 | Bacteria | 5329 |
| 249 | Ga0075431_100037463 | 3300006847 | Bacteria | 4995 |
| 250 | Ga0075431_100061596 | 3300006847 | Bacteria | 3872 |
| 251 | Ga0075433_10003360 | 3300006852 | Bacteria | 12371 |
| 252 | Ga0075433_10003786 | 3300006852 | Bacteria | 11716 |
| 253 | Ga0075433_10023330 | 3300006852 | Bacteria | 5206 |
| 254 | Ga0075433_10034761 | 3300006852 | Bacteria | 4331 |
| 255 | Ga0075433_10142843 | 3300006852 | Bacteria | 2128 |
| 256 | Ga0075434_100001264 | 3300006871 | Bacteria | 21084 |
| 257 | Ga0075434_100001550 | 3300006871 | Bacteria | 19467 |
| 258 | Ga0075434_100107566 | 3300006871 | Bacteria | 2799 |
| 259 | Ga0075434_100146637 | 3300006871 | Bacteria | 2380 |
| 260 | Ga0075434_100269903 | 3300006871 | Bacteria | 1721 |
| 261 | Ga0075429_100008172 | 3300006880 | Bacteria | 9094 |
| 262 | Ga0075429_100008208 | 3300006880 | Bacteria | 9078 |
| 263 | Ga0075429_100018033 | 3300006880 | Bacteria | 6105 |
| 264 | Ga0075429_100166692 | 3300006880 | Bacteria | 1930 |
| 265 | Ga0068865_100031722 | 3300006881 | Bacteria | 3524 |
| 266 | Ga0068865_100038579 | 3300006881 | Bacteria | 3235 |
| 267 | Ga0068865_100194569 | 3300006881 | Bacteria | 1571 |
| 268 | Ga0075436_100006661 | 3300006914 | Bacteria | 7910 |
| 269 | Ga0075436_100045437 | 3300006914 | Bacteria | 3029 |
| 270 | Ga0075436_100165604 | 3300006914 | Unclassified | 1559 |
| 271 | Ga0075436_100333801 | 3300006914 | Bacteria | 1091 |
| 272 | Ga0097620_100135201 | 3300006931 | Unclassified | 2538 |
| 273 | Ga0097620_100176573 | 3300006931 | Bacteria | 2218 |
| 274 | Ga0097620_100228643 | 3300006931 | Unclassified | 1948 |
| 275 | Ga0097620_100323215 | 3300006931 | Bacteria | 1637 |
| 276 | Ga0097620_100386092 | 3300006931 | Unclassified | 1496 |
| 277 | Ga0075435_100009058 | 3300007076 | Bacteria | 7181 |
| 278 | Ga0075435_100011330 | 3300007076 | Bacteria | 6554 |
| 279 | Ga0075435_100017976 | 3300007076 | Bacteria | 5361 |
| 280 | Ga0075435_100051730 | 3300007076 | Bacteria | 3309 |
| 281 | Ga0075435_100103768 | 3300007076 | Bacteria | 2358 |
| 282 | Ga0075435_100139160 | 3300007076 | Unclassified | 2036 |
| 283 | Ga0099794_10028699 | 3300007265 | Bacteria | 2588 |
| 284 | Ga0105251_10036355 | 3300009011 | Bacteria | 2424 |
| 285 | Ga0105250_10122292 | 3300009092 | Unclassified | 1071 |
| 286 | Ga0105240_10129005 | 3300009093 | Bacteria | 3035 |
| 287 | Ga0105240_10500448 | 3300009093 | Bacteria | 1351 |
| 288 | Ga0111539_10013335 | 3300009094 | Bacteria | 10269 |
| 289 | Ga0111539_10016681 | 3300009094 | Bacteria | 9103 |
| 290 | Ga0111539_10022795 | 3300009094 | Bacteria | 7691 |
| 291 | Ga0111539_10049222 | 3300009094 | Bacteria | 5027 |
| 292 | Ga0111539_10123155 | 3300009094 | Bacteria | 3039 |
| 293 | Ga0111539_10746873 | 3300009094 | Bacteria | 1139 |
| 294 | Ga0105245_10064523 | 3300009098 | Bacteria | 3309 |
| 295 | Ga0105245_10091645 | 3300009098 | Bacteria | 2797 |
| 296 | Ga0105245_10115806 | 3300009098 | Bacteria | 2498 |
| 297 | Ga0105245_10252344 | 3300009098 | Bacteria | 1714 |
| 298 | Ga0105247_10047818 | 3300009101 | Bacteria | 2628 |
| 299 | Ga0105247_10061923 | 3300009101 | Bacteria | 2321 |
| 300 | Ga0114129_10000001 | 3300009147 | Bacteria | 292978 |
| 301 | Ga0114129_10014817 | 3300009147 | Bacteria | 11110 |
| 302 | Ga0114129_10020866 | 3300009147 | Bacteria | 9306 |
| 303 | Ga0114129_10057681 | 3300009147 | Bacteria | 5432 |
| 304 | Ga0114129_10061210 | 3300009147 | Bacteria | 5261 |
| 305 | Ga0114129_10128003 | 3300009147 | Bacteria | 3490 |
| 306 | Ga0114129_10175588 | 3300009147 | Bacteria | 2918 |
| 307 | Ga0114129_10439754 | 3300009147 | Bacteria | 1712 |
| 308 | Ga0114129_10466871 | 3300009147 | Unclassified | 1653 |
| 309 | Ga0114129_10548149 | 3300009147 | Bacteria | 1504 |
| 310 | Ga0114129_10635947 | 3300009147 | Bacteria | 1379 |
| 311 | Ga0114129_11074077 | 3300009147 | Unclassified | 1009 |
| 312 | Ga0105243_10029951 | 3300009148 | Bacteria | 4188 |
| 313 | Ga0105243_10061693 | 3300009148 | Bacteria | 2999 |
| 314 | Ga0105243_10200834 | 3300009148 | Unclassified | 1748 |
| 315 | Ga0105243_10269413 | 3300009148 | Bacteria | 1528 |
| 316 | Ga0105243_10300372 | 3300009148 | Unclassified | 1455 |
| 317 | Ga0105243_10423931 | 3300009148 | Bacteria | 1242 |
| 318 | Ga0105241_10334586 | 3300009174 | Bacteria | 1310 |
| 319 | Ga0105242_10062568 | 3300009176 | Bacteria | 3063 |
| 320 | Ga0105242_10063619 | 3300009176 | Bacteria | 3038 |
| 321 | Ga0105242_10231475 | 3300009176 | Bacteria | 1656 |
| 322 | Ga0105248_10048664 | 3300009177 | Bacteria | 4755 |
| 323 | Ga0105237_10082395 | 3300009545 | Bacteria | 3208 |
| 324 | Ga0105237_10147209 | 3300009545 | Bacteria | 2350 |
| 325 | Ga0105237_10841571 | 3300009545 | Unclassified | 924 |
| 326 | Ga0105238_10192416 | 3300009551 | Bacteria | 2016 |
| 327 | Ga0105238_10327346 | 3300009551 | Bacteria | 1519 |
| 328 | Ga0105249_10011082 | 3300009553 | Bacteria | 7922 |
| 329 | Ga0105249_10016717 | 3300009553 | Bacteria | 6511 |
| 330 | Ga0105249_10101795 | 3300009553 | Bacteria | 2702 |
| 331 | Ga0105249_10128128 | 3300009553 | Bacteria | 2419 |
| 332 | Ga0105249_10181487 | 3300009553 | Bacteria | 2048 |
| 333 | Ga0105249_10286900 | 3300009553 | Bacteria | 1646 |
| 334 | Ga0105249_10581335 | 3300009553 | Bacteria | 1173 |
| 335 | Ga0105239_10041362 | 3300010375 | Bacteria | 5052 |
| 336 | Ga0105239_10105558 | 3300010375 | Bacteria | 3120 |
| 337 | Ga0105239_10333823 | 3300010375 | Bacteria | 1710 |
| 338 | Ga0105239_10857719 | 3300010375 | Bacteria | 1042 |
| 339 | Ga0105246_10029979 | 3300011119 | Bacteria | 3588 |
| 340 | Ga0105246_10081269 | 3300011119 | Bacteria | 2309 |
| 341 | Ga0105246_10131506 | 3300011119 | Bacteria | 1870 |
| 342 | Ga0105246_10256181 | 3300011119 | Bacteria | 1391 |
| 343 | Ga0157342_1001407 | 3300012507 | Bacteria | 1774 |
| 344 | Ga0157371_10047334 | 3300013102 | Bacteria | 3057 |
| 345 | Ga0157370_10030431 | 3300013104 | Bacteria | 5289 |
| 346 | Ga0157370_10031855 | 3300013104 | Bacteria | 5154 |
| 347 | Ga0157369_10104551 | 3300013105 | Bacteria | 3015 |
| 348 | Ga0157369_10283506 | 3300013105 | Bacteria | 1725 |
| 349 | Ga0157369_10311175 | 3300013105 | Bacteria | 1638 |
| 350 | Ga0157374_10204473 | 3300013296 | Bacteria | 1935 |
| 351 | Ga0157378_10066752 | 3300013297 | Bacteria | 3223 |
| 352 | Ga0163162_10037844 | 3300013306 | Bacteria | 4815 |
| 353 | Ga0163162_10061652 | 3300013306 | Bacteria | 3788 |
| 354 | Ga0163162_10336865 | 3300013306 | Bacteria | 1641 |
| 355 | Ga0157372_10107151 | 3300013307 | Bacteria | 3197 |
| 356 | Ga0157372_10346051 | 3300013307 | Bacteria | 1732 |
| 357 | Ga0157372_10346404 | 3300013307 | Bacteria | 1731 |
| 358 | Ga0157372_10752836 | 3300013307 | Unclassified | 1133 |
| 359 | Ga0157375_10024766 | 3300013308 | Bacteria | 5561 |
| 360 | Ga0157375_10061677 | 3300013308 | Bacteria | 3724 |
| 361 | Ga0157375_10453848 | 3300013308 | Unclassified | 1447 |
| 362 | Ga0157375_10505561 | 3300013308 | Unclassified | 1372 |
| 363 | Ga0163163_10039330 | 3300014325 | Bacteria | 4616 |
| 364 | Ga0157380_10039401 | 3300014326 | Bacteria | 3674 |
| 365 | Ga0157380_10519153 | 3300014326 | Bacteria | 1161 |
| 366 | Ga0157377_10030312 | 3300014745 | Bacteria | 2929 |
| 367 | Ga0157377_10348536 | 3300014745 | Unclassified | 993 |
| 368 | Ga0157379_10006261 | 3300014968 | Bacteria | 10247 |
| 369 | Ga0157376_10056136 | 3300014969 | Bacteria | 3288 |
| 370 | Ga0157376_10273349 | 3300014969 | Bacteria | 1588 |
| 371 | Ga0163161_10034708 | 3300017792 | Bacteria | 3609 |
| 372 | Ga0163161_10499746 | 3300017792 | Bacteria | 990 |
| 373 | Ga0197907_10225339 | 3300020069 | Bacteria | 1898 |
| 374 | Ga0197907_10277679 | 3300020069 | Unclassified | 1192 |
| 375 | Ga0197907_10470509 | 3300020069 | Bacteria | 3082 |
| 376 | Ga0197907_10902623 | 3300020069 | Bacteria | 1641 |
| 377 | Ga0197907_10984839 | 3300020069 | Bacteria | 1412 |
| 378 | Ga0197907_11257832 | 3300020069 | Bacteria | 1324 |
| 379 | Ga0206356_10106052 | 3300020070 | Bacteria | 3240 |
| 380 | Ga0206356_10216668 | 3300020070 | Unclassified | 1166 |
| 381 | Ga0206356_10369112 | 3300020070 | Bacteria | 1566 |
| 382 | Ga0206356_11428032 | 3300020070 | Bacteria | 1391 |
| 383 | Ga0206356_11705868 | 3300020070 | Bacteria | 1575 |
| 384 | Ga0206349_1134039 | 3300020075 | Unclassified | 2305 |
| 385 | Ga0206349_1818514 | 3300020075 | Bacteria | 2418 |
| 386 | Ga0206349_1860141 | 3300020075 | Bacteria | 983 |
| 387 | Ga0206355_1105940 | 3300020076 | Bacteria | 1915 |
| 388 | Ga0206355_1206412 | 3300020076 | Unclassified | 1225 |
| 389 | Ga0206351_10249285 | 3300020077 | Unclassified | 2795 |
| 390 | Ga0206352_10264739 | 3300020078 | Unclassified | 1098 |
| 391 | Ga0206352_10356421 | 3300020078 | Bacteria | 1497 |
| 392 | Ga0206352_11336596 | 3300020078 | Bacteria | 2059 |
| 393 | Ga0206350_10060753 | 3300020080 | Unclassified | 1700 |
| 394 | Ga0206350_11219577 | 3300020080 | Bacteria | 1449 |
| 395 | Ga0206350_11605962 | 3300020080 | Bacteria | 1394 |
| 396 | Ga0206354_10160929 | 3300020081 | Bacteria | 1671 |
| 397 | Ga0206354_10370402 | 3300020081 | Bacteria | 2428 |
| 398 | Ga0206354_10745353 | 3300020081 | Bacteria | 3216 |
| 399 | Ga0206354_10799651 | 3300020081 | Bacteria | 1070 |
| 400 | Ga0206354_10812046 | 3300020081 | Bacteria | 4298 |
| 401 | Ga0206353_10443559 | 3300020082 | Bacteria | 1617 |
| 402 | Ga0206353_11296763 | 3300020082 | Bacteria | 6061 |
| 403 | Ga0206353_11527532 | 3300020082 | Bacteria | 3426 |
| 404 | Ga0224712_10002553 | 3300022467 | Bacteria | 4522 |
| 405 | Ga0224712_10038090 | 3300022467 | Bacteria | 1794 |
| 406 | Ga0224712_10050539 | 3300022467 | Bacteria | 1615 |
| 407 | Ga0224712_10050926 | 3300022467 | Bacteria | 1610 |
| 408 | Ga0224712_10124253 | 3300022467 | Bacteria | 1121 |
| 409 | Ga0224712_10182993 | 3300022467 | Bacteria | 945 |
| 410 | Ga0207653_10002312 | 3300025885 | Bacteria | 6083 |
| 411 | Ga0207692_10004841 | 3300025898 | Bacteria | 5357 |
| 412 | Ga0207692_10008731 | 3300025898 | Bacteria | 4207 |
| 413 | Ga0207692_10123019 | 3300025898 | Bacteria | 1455 |
| 414 | Ga0207642_10036679 | 3300025899 | Bacteria | 2106 |
| 415 | Ga0207642_10108366 | 3300025899 | Bacteria | 1409 |
| 416 | Ga0207710_10023890 | 3300025900 | Bacteria | 2629 |
| 417 | Ga0207710_10098798 | 3300025900 | Bacteria | 1374 |
| 418 | Ga0207688_10008232 | 3300025901 | Bacteria | 5667 |
| 419 | Ga0207688_10010597 | 3300025901 | Bacteria | 5012 |
| 420 | Ga0207647_10029303 | 3300025904 | Bacteria | 3564 |
| 421 | Ga0207647_10092248 | 3300025904 | Unclassified | 1806 |
| 422 | Ga0207685_10019314 | 3300025905 | Bacteria | 2244 |
| 423 | Ga0207685_10105909 | 3300025905 | Bacteria | 1211 |
| 424 | Ga0207699_10000555 | 3300025906 | Bacteria | 18421 |
| 425 | Ga0207699_10000761 | 3300025906 | Bacteria | 15434 |
| 426 | Ga0207699_10013524 | 3300025906 | Bacteria | 4181 |
| 427 | Ga0207643_10021911 | 3300025908 | Bacteria | 3515 |
| 428 | Ga0207705_10127895 | 3300025909 | Bacteria | 1889 |
| 429 | Ga0207684_10000599 | 3300025910 | Bacteria | 43115 |
| 430 | Ga0207684_10000967 | 3300025910 | Bacteria | 32207 |
| 431 | Ga0207684_10004345 | 3300025910 | Bacteria | 13386 |
| 432 | Ga0207684_10005872 | 3300025910 | Bacteria | 11241 |
| 433 | Ga0207684_10029194 | 3300025910 | Bacteria | 4698 |
| 434 | Ga0207684_10040664 | 3300025910 | Archaea | 3941 |
| 435 | Ga0207684_10052390 | 3300025910 | Bacteria | 3463 |
| 436 | Ga0207684_10072216 | 3300025910 | Bacteria | 2931 |
| 437 | Ga0207684_10151658 | 3300025910 | Bacteria | 1994 |
| 438 | Ga0207684_10193035 | 3300025910 | Unclassified | 1756 |
| 439 | Ga0207654_10284717 | 3300025911 | Bacteria | 1119 |
| 440 | Ga0207707_10229702 | 3300025912 | Bacteria | 1614 |
| 441 | Ga0207693_10003808 | 3300025915 | Bacteria | 12843 |
| 442 | Ga0207693_10004257 | 3300025915 | Bacteria | 12135 |
| 443 | Ga0207693_10033975 | 3300025915 | Bacteria | 4023 |
| 444 | Ga0207663_10007144 | 3300025916 | Bacteria | 5772 |
| 445 | Ga0207660_10080792 | 3300025917 | Unclassified | 2388 |
| 446 | Ga0207660_10447139 | 3300025917 | Bacteria | 1045 |
| 447 | Ga0207662_10018897 | 3300025918 | Bacteria | 3915 |
| 448 | Ga0207657_10015063 | 3300025919 | Bacteria | 7510 |
| 449 | Ga0207652_10163623 | 3300025921 | Bacteria | 1995 |
| 450 | Ga0207652_10401552 | 3300025921 | Unclassified | 1237 |
| 451 | Ga0207646_10000811 | 3300025922 | Bacteria | 40685 |
| 452 | Ga0207646_10001035 | 3300025922 | Bacteria | 35522 |
| 453 | Ga0207646_10005172 | 3300025922 | Bacteria | 13799 |
| 454 | Ga0207646_10011107 | 3300025922 | Bacteria | 8743 |
| 455 | Ga0207646_10018172 | 3300025922 | Bacteria | 6563 |
| 456 | Ga0207646_10033193 | 3300025922 | Bacteria | 4670 |
| 457 | Ga0207646_10082229 | 3300025922 | Bacteria | 2880 |
| 458 | Ga0207646_10451654 | 3300025922 | Bacteria | 1160 |
| 459 | Ga0207694_10531306 | 3300025924 | Bacteria | 986 |
| 460 | Ga0207687_10057200 | 3300025927 | Bacteria | 2739 |
| 461 | Ga0207687_10057371 | 3300025927 | Bacteria | 2736 |
| 462 | Ga0207687_10182847 | 3300025927 | Bacteria | 1625 |
| 463 | Ga0207687_10333491 | 3300025927 | Bacteria | 1231 |
| 464 | Ga0207700_10000558 | 3300025928 | Bacteria | 21900 |
| 465 | Ga0207700_10001918 | 3300025928 | Bacteria | 11831 |
| 466 | Ga0207700_10015157 | 3300025928 | Bacteria | 5073 |
| 467 | Ga0207700_10028862 | 3300025928 | Bacteria | 3909 |
| 468 | Ga0207700_10159812 | 3300025928 | Bacteria | 1870 |
| 469 | Ga0207700_10191567 | 3300025928 | Unclassified | 1718 |
| 470 | Ga0207664_10000706 | 3300025929 | Bacteria | 22745 |
| 471 | Ga0207664_10001977 | 3300025929 | Bacteria | 13492 |
| 472 | Ga0207664_10060803 | 3300025929 | Bacteria | 3012 |
| 473 | Ga0207664_10071738 | 3300025929 | Bacteria | 2791 |
| 474 | Ga0207664_10403723 | 3300025929 | Unclassified | 1216 |
| 475 | Ga0207644_10378990 | 3300025931 | Bacteria | 1153 |
| 476 | Ga0207690_10026581 | 3300025932 | Bacteria | 3645 |
| 477 | Ga0207706_10003790 | 3300025933 | Bacteria | 14412 |
| 478 | Ga0207706_10106062 | 3300025933 | Bacteria | 2472 |
| 479 | Ga0207686_10471239 | 3300025934 | Unclassified | 969 |
| 480 | Ga0207709_10122771 | 3300025935 | Bacteria | 1757 |
| 481 | Ga0207709_10267893 | 3300025935 | Bacteria | 1256 |
| 482 | Ga0207709_10357011 | 3300025935 | Unclassified | 1105 |
| 483 | Ga0207670_10173436 | 3300025936 | Bacteria | 1619 |
| 484 | Ga0207704_10022983 | 3300025938 | Bacteria | 3352 |
| 485 | Ga0207704_10144409 | 3300025938 | Bacteria | 1669 |
| 486 | Ga0207665_10014174 | 3300025939 | Bacteria | 5244 |
| 487 | Ga0207665_10015571 | 3300025939 | Bacteria | 4990 |
| 488 | Ga0207665_10030098 | 3300025939 | Bacteria | 3588 |
| 489 | Ga0207711_10188364 | 3300025941 | Bacteria | 1879 |
| 490 | Ga0207689_10116786 | 3300025942 | Bacteria | 2193 |
| 491 | Ga0207661_10071498 | 3300025944 | Bacteria | 2835 |
| 492 | Ga0207661_10181619 | 3300025944 | Bacteria | 1838 |
| 493 | Ga0207661_10291623 | 3300025944 | Bacteria | 1460 |
| 494 | Ga0207679_10069465 | 3300025945 | Bacteria | 2651 |
| 495 | Ga0207667_10176433 | 3300025949 | Bacteria | 2195 |
| 496 | Ga0207651_10406415 | 3300025960 | Bacteria | 1159 |
| 497 | Ga0207712_10032779 | 3300025961 | Bacteria | 3508 |
| 498 | Ga0207668_10100897 | 3300025972 | Bacteria | 2144 |
| 499 | Ga0207640_10123158 | 3300025981 | Unclassified | 1862 |
| 500 | Ga0207703_10066359 | 3300026035 | Bacteria | 2968 |
| 501 | Ga0207703_10504975 | 3300026035 | Bacteria | 1135 |
| 502 | Ga0207639_10028967 | 3300026041 | Bacteria | 4049 |
| 503 | Ga0207639_10048520 | 3300026041 | Bacteria | 3214 |
| 504 | Ga0207678_10010009 | 3300026067 | Bacteria | 8321 |
| 505 | Ga0207708_10140368 | 3300026075 | Bacteria | 1895 |
| 506 | Ga0207708_10156618 | 3300026075 | Bacteria | 1796 |
| 507 | Ga0207702_10013876 | 3300026078 | Bacteria | 6692 |
| 508 | Ga0207702_10042023 | 3300026078 | Bacteria | 3834 |
| 509 | Ga0207702_10203834 | 3300026078 | Unclassified | 1835 |
| 510 | Ga0207702_10599964 | 3300026078 | Bacteria | 1080 |
| 511 | Ga0207641_10039866 | 3300026088 | Bacteria | 3930 |
| 512 | Ga0207641_10074128 | 3300026088 | Bacteria | 2935 |
| 513 | Ga0207648_10050017 | 3300026089 | Bacteria | 3656 |
| 514 | Ga0207676_10026997 | 3300026095 | Bacteria | 4273 |
| 515 | Ga0207676_10202150 | 3300026095 | Bacteria | 1756 |
| 516 | Ga0207674_10000027 | 3300026116 | Bacteria | 150200 |
| 517 | Ga0207674_10031858 | 3300026116 | Bacteria | 5534 |
| 518 | Ga0207674_10148676 | 3300026116 | Bacteria | 2300 |
| 519 | Ga0207674_10573973 | 3300026116 | Bacteria | 1089 |
| 520 | Ga0207675_100022932 | 3300026118 | Bacteria | 5806 |
| 521 | Ga0207675_100035155 | 3300026118 | Bacteria | 4674 |
| 522 | Ga0207675_100055459 | 3300026118 | Bacteria | 3697 |
| 523 | Ga0207675_100072240 | 3300026118 | Bacteria | 3227 |
| 524 | Ga0207675_100334795 | 3300026118 | Bacteria | 1480 |
| 525 | Ga0207675_100533719 | 3300026118 | Unclassified | 1171 |
| 526 | Ga0207683_10003345 | 3300026121 | Bacteria | 13979 |
| 527 | Ga0207683_10075214 | 3300026121 | Bacteria | 2989 |
| 528 | Ga0207683_10242210 | 3300026121 | Bacteria | 1645 |
| 529 | Ga0207698_10443139 | 3300026142 | Bacteria | 1252 |
| 530 | Ga0207428_10004650 | 3300027907 | Bacteria | 13003 |
| 531 | Ga0207428_10004915 | 3300027907 | Bacteria | 12600 |
| 532 | Ga0207428_10008457 | 3300027907 | Bacteria | 9292 |
| 533 | Ga0207428_10131306 | 3300027907 | Bacteria | 1916 |
| 534 | Ga0268266_10374255 | 3300028379 | Bacteria | 1342 |
| 535 | Ga0268265_10139413 | 3300028380 | Bacteria | 2028 |
| 536 | Ga0268265_10194679 | 3300028380 | Bacteria | 1754 |
| 537 | Ga0268264_10094623 | 3300028381 | Bacteria | 2583 |
| 538 | Ga0268264_10398409 | 3300028381 | Bacteria | 1322 |
| 539 | Ga0268264_10399007 | 3300028381 | Bacteria | 1321 |
| 540 | Ga0265318_10043065 | 3300028577 | Unclassified | 1711 |
| 541 | Ga0265338_10213949 | 3300028800 | Unclassified | 1445 |
| 542 | Ga0265330_10113409 | 3300031235 | Unclassified | 1157 |
| 543 | Ga0265320_10027982 | 3300031240 | Unclassified | 2932 |
| 544 | Ga0265320_10114764 | 3300031240 | Unclassified | 1232 |
| 545 | Ga0307509_10143914 | 3300031507 | Bacteria | 2314 |
| 546 | Ga0307408_100062499 | 3300031548 | Bacteria | 2721 |
| 547 | Ga0307408_100223902 | 3300031548 | Bacteria | 1536 |
| 548 | Ga0307408_100381496 | 3300031548 | Bacteria | 1205 |
| 549 | Ga0307516_10122094 | 3300031730 | Bacteria | 2393 |
| 550 | Ga0307405_10162603 | 3300031731 | Bacteria | 1583 |
| 551 | Ga0307405_10269931 | 3300031731 | Unclassified | 1275 |
| 552 | Ga0307413_10152232 | 3300031824 | Bacteria | 1613 |
| 553 | Ga0307413_10271995 | 3300031824 | Unclassified | 1269 |
| 554 | Ga0307410_10001030 | 3300031852 | Bacteria | 12093 |
| 555 | Ga0307410_10115410 | 3300031852 | Bacteria | 1949 |
| 556 | Ga0307410_10247219 | 3300031852 | Unclassified | 1385 |
| 557 | Ga0307406_10022836 | 3300031901 | Bacteria | 3715 |
| 558 | Ga0307406_10097344 | 3300031901 | Bacteria | 1995 |
| 559 | Ga0307406_10150211 | 3300031901 | Bacteria | 1661 |
| 560 | Ga0307406_10237307 | 3300031901 | Bacteria | 1365 |
| 561 | Ga0307407_10003918 | 3300031903 | Bacteria | 6213 |
| 562 | Ga0307412_10029424 | 3300031911 | Bacteria | 3447 |
| 563 | Ga0307412_10185573 | 3300031911 | Bacteria | 1568 |
| 564 | Ga0307409_100001173 | 3300031995 | Bacteria | 12513 |
| 565 | Ga0307409_100010612 | 3300031995 | Bacteria | 5741 |
| 566 | Ga0307409_100101217 | 3300031995 | Bacteria | 2390 |
| 567 | Ga0307409_100133967 | 3300031995 | Bacteria | 2122 |
| 568 | Ga0307409_100197084 | 3300031995 | Unclassified | 1798 |
| 569 | Ga0307409_100419197 | 3300031995 | Bacteria | 1284 |
| 570 | Ga0307416_100012514 | 3300032002 | Bacteria | 5719 |
| 571 | Ga0307416_100037944 | 3300032002 | Bacteria | 3712 |
| 572 | Ga0307416_100085840 | 3300032002 | Bacteria | 2680 |
| 573 | Ga0307416_100095823 | 3300032002 | Bacteria | 2564 |
| 574 | Ga0307416_100245547 | 3300032002 | Bacteria | 1738 |
| 575 | Ga0307416_100458081 | 3300032002 | Bacteria | 1330 |
| 576 | Ga0307416_100933001 | 3300032002 | Unclassified | 969 |
| 577 | Ga0307414_10039403 | 3300032004 | Bacteria | 3182 |
| 578 | Ga0307414_10492283 | 3300032004 | Unclassified | 1083 |
| 579 | Ga0307411_10002120 | 3300032005 | Bacteria | 8578 |
| 580 | Ga0307411_10035200 | 3300032005 | Bacteria | 3124 |
| 581 | Ga0307411_10043543 | 3300032005 | Bacteria | 2872 |
| 582 | Ga0307411_10327393 | 3300032005 | Bacteria | 1240 |
| 583 | Ga0307411_10373579 | 3300032005 | Unclassified | 1170 |
| 584 | Ga0307411_10438531 | 3300032005 | Bacteria | 1089 |
| 585 | Ga0307415_100000052 | 3300032126 | Bacteria | 50285 |
| 586 | Ga0307415_100009472 | 3300032126 | Bacteria | 5463 |
| 587 | Ga0307415_100011962 | 3300032126 | Bacteria | 4996 |
| 588 | Ga0307415_100025582 | 3300032126 | Bacteria | 3707 |
| 589 | Ga0307415_100032717 | 3300032126 | Bacteria | 3367 |
| 590 | Ga0307415_100073483 | 3300032126 | Bacteria | 2413 |
| 591 | Ga0307415_100116849 | 3300032126 | Bacteria | 1991 |
| 592 | Ga0307415_100148397 | 3300032126 | Bacteria | 1801 |
| 593 | Ga0307415_100220930 | 3300032126 | Unclassified | 1519 |
| 594 | Ga0373948_0026830 | 3300034817 | Bacteria | 1137 |
| 595 | Ga0373950_0010229 | 3300034818 | Bacteria | 1512 |
| 596 | Ga0373958_0008183 | 3300034819 | Bacteria | 1688 |
| 597 | Ga0373959_0006166 | 3300034820 | Bacteria | 1984 |
| 598 | Ga0373938_0020211 | 3300034957 | Bacteria | 1339 |
| 599 | Ga0373926_0015314 | 3300035083 | Bacteria | 2614 |
| 600 | Ga0373928_0008617 | 3300035084 | Bacteria | 1982 |
| 601 | Ga0373929_0012525 | 3300035085 | Bacteria | 1613 |
| 602 | Ga0373934_0002560 | 3300035086 | Bacteria | 6689 |
| 603 | Ga0373934_0008140 | 3300035086 | Bacteria | 3904 |
| 604 | Ga0373934_0029791 | 3300035086 | Bacteria | 2133 |
| 605 | Ga0373934_0103309 | 3300035086 | Unclassified | 1152 |
| 606 | Ga0373951_0030540 | 3300035091 | Bacteria | 1268 |
| 607 | Ga0373952_0004407 | 3300035092 | Bacteria | 2554 |
| 608 | Ga0373923_0001781 | 3300035111 | Bacteria | 6347 |
| 609 | Ga0373923_0037537 | 3300035111 | Bacteria | 1982 |
| 610 | Ga0373932_0052797 | 3300035112 | Bacteria | 1211 |
| 611 | Ga0373936_0006172 | 3300035113 | Bacteria | 4516 |
| 612 | Ga0373936_0058738 | 3300035113 | Bacteria | 1566 |
| 613 | Ga0373941_0021950 | 3300035115 | Bacteria | 1807 |
| 614 | Ga0373945_0020919 | 3300035116 | Bacteria | 2244 |
| 615 | Ga0373945_0149810 | 3300035116 | Bacteria | 945 |
| 616 | Ga0373953_0000098 | 3300035117 | Bacteria | 21032 |
| 617 | Ga0373953_0003311 | 3300035117 | Bacteria | 5001 |
| 618 | Ga0373953_0026809 | 3300035117 | Bacteria | 2210 |
| 619 | Ga0373953_0029025 | 3300035117 | Bacteria | 2137 |
| 620 | Ga0373954_0008625 | 3300035118 | Bacteria | 4482 |
| 621 | Ga0373954_0040016 | 3300035118 | Bacteria | 2183 |
| 622 | Ga0373956_0000476 | 3300035119 | Bacteria | 16441 |
| 623 | Ga0373956_0002164 | 3300035119 | Bacteria | 8113 |
| 624 | Ga0373956_0024982 | 3300035119 | Bacteria | 2579 |
| 625 | Ga0373957_0001091 | 3300035120 | Bacteria | 7175 |
| 626 | Ga0373957_0004904 | 3300035120 | Bacteria | 4110 |
| 627 | Ga0373957_0007936 | 3300035120 | Bacteria | 3417 |
| 628 | Ga0373943_0067404 | 3300035170 | Bacteria | 1805 |
| 629 | Ga0373943_0097553 | 3300035170 | Bacteria | 1531 |
| 630 | Ga0373946_0021191 | 3300035171 | Bacteria | 2518 |
| 631 | Ga0373946_0055198 | 3300035171 | Bacteria | 1674 |
| 632 | Ga0373955_0000004 | 3300035172 | Bacteria | 108650 |
| 633 | Ga0373955_0125453 | 3300035172 | Bacteria | 1495 |
| 634 | Ga0373942_0024833 | 3300035207 | Bacteria | 1540 |
| 635 | Ga0373962_0055601 | 3300035242 | Unclassified | 1150 |
| 636 | Ga0373924_0003964 | 3300035410 | Bacteria | 5137 |
| 637 | Ga0373924_0010887 | 3300035410 | Bacteria | 3367 |
| 638 | Ga0373924_0074021 | 3300035410 | Unclassified | 1440 |
| 639 | Ga0373931_0030843 | 3300035691 | Bacteria | 2762 |
| 640 | Ga0373931_0128112 | 3300035691 | Bacteria | 1458 |
| 641 | Ga0373935_0009714 | 3300035692 | Bacteria | 5760 |
| 642 | Ga0373935_0148967 | 3300035692 | Bacteria | 1586 |
| 643 | Ga0373935_0297995 | 3300035692 | Bacteria | 1139 |
| 644 | Ga0373927_0000061 | 3300035695 | Bacteria | 77622 |
| 645 | Ga0373927_0266894 | 3300035695 | Bacteria | 1125 |
| 646 | Ga0373933_0000005 | 3300035724 | Bacteria | 128820 |
| 647 | Ga0373933_0010757 | 3300035724 | Bacteria | 5021 |
| 648 | Ga0373933_0010966 | 3300035724 | Bacteria | 4977 |
| 649 | Ga0373933_0030598 | 3300035724 | Bacteria | 3117 |
| 650 | Ga0373933_0074812 | 3300035724 | Bacteria | 2066 |
| 651 | Ga0373933_0371032 | 3300035724 | Unclassified | 931 |
| 652 | Ga0373947_0005352 | 3300035725 | Bacteria | 7493 |
| 653 | Ga0373937_0000077 | 3300036401 | Bacteria | 89075 |
| 654 | Ga0373937_0062752 | 3300036401 | Bacteria | 3416 |
| 655 | Ga0372808_021105 | 3300036459 | Bacteria | 936 |
| 656 | Ga0373925_0035401 | 3300037068 | Bacteria | 3683 |
| 657 | Ga0373925_0043894 | 3300037068 | Bacteria | 3319 |
| 658 | Ga0373925_0250765 | 3300037068 | Bacteria | 1419 |
| 659 | Ga0395899_0219818 | 3300037312 | Bacteria | 1316 |
| 660 | Ga0395900_0012521 | 3300037418 | Bacteria | 8677 |
| 661 | Ga0395900_0022271 | 3300037418 | Bacteria | 6483 |
| 662 | Ga0395900_0116288 | 3300037418 | Bacteria | 2744 |
| 663 | Ga0395900_0144950 | 3300037418 | Bacteria | 2429 |
| 664 | Ga0395900_0330553 | 3300037418 | Bacteria | 1502 |
| 665 | Ga0395898_0004897 | 3300037466 | Bacteria | 14537 |
| 666 | Ga0395898_0020617 | 3300037466 | Bacteria | 6695 |
| 667 | Ga0395898_0122546 | 3300037466 | Bacteria | 2491 |
| 668 | Ga0395905_0008839 | 3300037471 | Bacteria | 9899 |
| 669 | Ga0395905_0298067 | 3300037471 | Bacteria | 1499 |
| 670 | Ga0395901_0009032 | 3300038443 | Bacteria | 10091 |
| 671 | Ga0395901_0017821 | 3300038443 | Bacteria | 7247 |
| 672 | Ga0395901_0187229 | 3300038443 | Bacteria | 2171 |
| 673 | Ga0395901_0239075 | 3300038443 | Bacteria | 1894 |
| 674 | Ga0395901_0595696 | 3300038443 | Bacteria | 1115 |
| 675 | Ga0436363_0245620 | 3300039450 | Bacteria | 1084 |
| 676 | Ga0436363_0566087 | 3300039450 | Bacteria | 2328 |
| 677 | Ga0439448_0000420 | 3300042005 | Bacteria | 9732 |
| 678 | Ga0439450_000073 | 3300042008 | Bacteria | 9571 |
| 679 | Ga0439454_004566 | 3300042011 | Bacteria | 1605 |
| 680 | Ga0439456_029928 | 3300042013 | Bacteria | 1164 |
| 681 | Ga0439463_000652 | 3300042016 | Bacteria | 9616 |
| 682 | Ga0450914_004130 | 3300042118 | Bacteria | 1160 |
| 683 | Ga0450888_001556 | 3300042126 | Bacteria | 2211 |
| 684 | Ga0439435_0101769 | 3300042436 | Bacteria | 884 |
| 685 | Ga0439444_0001306 | 3300042437 | Bacteria | 3185 |
| 686 | Ga0439444_0001934 | 3300042437 | Bacteria | 2763 |
| 687 | Ga0439464_0000078 | 3300042439 | Bacteria | 13860 |
| 688 | Ga0439460_0007933 | 3300042461 | Bacteria | 2670 |
| 689 | Ga0451577_0052117 | 3300042876 | Bacteria | 3654 |
| 690 | Ga0451577_0199628 | 3300042876 | Bacteria | 1806 |
| 691 | Ga0451577_0326283 | 3300042876 | Unclassified | 1392 |
| 692 | Ga0451577_0330864 | 3300042876 | Bacteria | 1382 |
| 693 | Ga0439440_0039097 | 3300042993 | Bacteria | 1150 |
| 694 | Ga0453683_0207644 | 3300044673 | Unclassified | 1244 |
| 695 | Ga0466961_0164049 | 3300044693 | Bacteria | 1384 |
| 696 | Ga0466961_0349016 | 3300044693 | Bacteria | 901 |
| 697 | Ga0466963_0027594 | 3300044694 | Bacteria | 3637 |
| 698 | Ga0453684_0207338 | 3300044712 | Unclassified | 2281 |
| 699 | Ga0453684_0356054 | 3300044712 | Unclassified | 1649 |
| 700 | Ga0453684_0514272 | 3300044712 | Bacteria | 1324 |
| 701 | Ga0453684_0610058 | 3300044712 | Unclassified | 1195 |
| 702 | Ga0466970_0085077 | 3300044765 | Bacteria | 1713 |
| 703 | Ga0466959_0175496 | 3300045049 | Bacteria | 1501 |
| 704 | Ga0466959_0186267 | 3300045049 | Bacteria | 1450 |
| 705 | Ga0451576_0011082 | 3300045051 | Bacteria | 10287 |
| 706 | Ga0451576_0015589 | 3300045051 | Bacteria | 8413 |
| 707 | Ga0451576_0054154 | 3300045051 | Bacteria | 4201 |
| 708 | Ga0451576_0074520 | 3300045051 | Unclassified | 3532 |
| 709 | Ga0451576_0115489 | 3300045051 | Bacteria | 2794 |
| 710 | Ga0451576_0264004 | 3300045051 | Bacteria | 1800 |
| 711 | Ga0451576_0328892 | 3300045051 | Unclassified | 1600 |
| 712 | Ga0466958_0137352 | 3300045836 | Bacteria | 1538 |
| 713 | Ga0466967_0001185 | 3300045976 | Bacteria | 14632 |
| 714 | Ga0466967_0051801 | 3300045976 | Bacteria | 3600 |
| 715 | Ga0466967_0071945 | 3300045976 | Bacteria | 3097 |
| 716 | Ga0466967_0297014 | 3300045976 | Bacteria | 1553 |
| 717 | Ga0466967_0331795 | 3300045976 | Bacteria | 1469 |
| 718 | Ga0495592_0000010 | 3300046454 | Bacteria | 157001 |
| 719 | Ga0495592_0022313 | 3300046454 | Bacteria | 4816 |
| 720 | Ga0495592_0109044 | 3300046454 | Bacteria | 1961 |
| 721 | Ga0495603_0036108 | 3300046455 | Bacteria | 2967 |
| 722 | Ga0495603_0058610 | 3300046455 | Bacteria | 2276 |
| 723 | Ga0495603_0066310 | 3300046455 | Bacteria | 2126 |
| 724 | Ga0495603_0095813 | 3300046455 | Bacteria | 1734 |
| 725 | Ga0495629_0005227 | 3300046459 | Bacteria | 9711 |
| 726 | Ga0495629_0023800 | 3300046459 | Bacteria | 4361 |
| 727 | Ga0495629_0023848 | 3300046459 | Bacteria | 4357 |
| 728 | Ga0495629_0102857 | 3300046459 | Unclassified | 1993 |
| 729 | Ga0495629_0139002 | 3300046459 | Bacteria | 1690 |
| 730 | Ga0495641_0022914 | 3300046461 | Bacteria | 3114 |
| 731 | Ga0495641_0048509 | 3300046461 | Bacteria | 1947 |
| 732 | Ga0495641_0056206 | 3300046461 | Unclassified | 1784 |
| 733 | Ga0495651_0000006 | 3300046462 | Bacteria | 171575 |
| 734 | Ga0495651_0003311 | 3300046462 | Bacteria | 12370 |
| 735 | Ga0495651_0004959 | 3300046462 | Bacteria | 10167 |
| 736 | Ga0495651_0108273 | 3300046462 | Bacteria | 2058 |
| 737 | Ga0495651_0276371 | 3300046462 | Unclassified | 1136 |
| 738 | Ga0495653_0022085 | 3300046463 | Bacteria | 5150 |
| 739 | Ga0495653_0071377 | 3300046463 | Bacteria | 2596 |
| 740 | Ga0495653_0160410 | 3300046463 | Bacteria | 1561 |
| 741 | Ga0495653_0230527 | 3300046463 | Bacteria | 1239 |
| 742 | Ga0495580_0100704 | 3300046472 | Bacteria | 2009 |
| 743 | Ga0495580_0113108 | 3300046472 | Bacteria | 1885 |
| 744 | Ga0495580_0224057 | 3300046472 | Bacteria | 1292 |
| 745 | Ga0495582_0000075 | 3300046473 | Bacteria | 49940 |
| 746 | Ga0495582_0005715 | 3300046473 | Bacteria | 6927 |
| 747 | Ga0495582_0026321 | 3300046473 | Bacteria | 3188 |
| 748 | Ga0495639_0037234 | 3300046475 | Bacteria | 2181 |
| 749 | Ga0495662_0004456 | 3300046476 | Bacteria | 7035 |
| 750 | Ga0495662_0229823 | 3300046476 | Bacteria | 914 |
| 751 | Ga0495664_0007101 | 3300046477 | Bacteria | 6206 |
| 752 | Ga0495664_0051937 | 3300046477 | Bacteria | 2434 |
| 753 | Ga0495584_0114510 | 3300046491 | Bacteria | 1365 |
| 754 | Ga0495594_0016704 | 3300046499 | Bacteria | 3869 |
| 755 | Ga0495594_0100761 | 3300046499 | Bacteria | 1625 |
| 756 | Ga0495608_0000161 | 3300046511 | Bacteria | 47857 |
| 757 | Ga0495608_0007761 | 3300046511 | Bacteria | 7556 |
| 758 | Ga0495608_0090608 | 3300046511 | Bacteria | 1978 |
| 759 | Ga0495618_0010485 | 3300046514 | Bacteria | 5606 |
| 760 | Ga0495618_0058612 | 3300046514 | Bacteria | 2439 |
| 761 | Ga0495618_0345693 | 3300046514 | Unclassified | 917 |
| 762 | Ga0495620_0070415 | 3300046515 | Unclassified | 1433 |
| 763 | Ga0495628_0002479 | 3300046516 | Bacteria | 16630 |
| 764 | Ga0495628_0010850 | 3300046516 | Bacteria | 7712 |
| 765 | Ga0495628_0116122 | 3300046516 | Bacteria | 2055 |
| 766 | Ga0495630_0030823 | 3300046517 | Bacteria | 3991 |
| 767 | Ga0495630_0045709 | 3300046517 | Bacteria | 3272 |
| 768 | Ga0495630_0048035 | 3300046517 | Bacteria | 3194 |
| 769 | Ga0495666_0061732 | 3300046526 | Bacteria | 1790 |
| 770 | Ga0495666_0064110 | 3300046526 | Bacteria | 1754 |
| 771 | Ga0495652_0004827 | 3300046529 | Bacteria | 12820 |
| 772 | Ga0495652_0076582 | 3300046529 | Bacteria | 2774 |
| 773 | Ga0495652_0189261 | 3300046529 | Bacteria | 1572 |
| 774 | Ga0495652_0197524 | 3300046529 | Bacteria | 1529 |
| 775 | Ga0495652_0254179 | 3300046529 | Bacteria | 1300 |
| 776 | Ga0495665_0009457 | 3300046531 | Bacteria | 5275 |
| 777 | Ga0495665_0012829 | 3300046531 | Bacteria | 4534 |
| 778 | Ga0495665_0108488 | 3300046531 | Bacteria | 1456 |
| 779 | Ga0495640_0044173 | 3300046533 | Bacteria | 3099 |
| 780 | Ga0495640_0061905 | 3300046533 | Bacteria | 2540 |
| 781 | Ga0495640_0067221 | 3300046533 | Bacteria | 2414 |
| 782 | Ga0495586_0005637 | 3300046535 | Bacteria | 6690 |
| 783 | Ga0495586_0034500 | 3300046535 | Bacteria | 2718 |
| 784 | Ga0495587_0000152 | 3300046536 | Bacteria | 51432 |
| 785 | Ga0495587_0010554 | 3300046536 | Bacteria | 5875 |
| 786 | Ga0495587_0026240 | 3300046536 | Bacteria | 3553 |
| 787 | Ga0495587_0061439 | 3300046536 | Bacteria | 2201 |
| 788 | Ga0495645_0019648 | 3300046543 | Bacteria | 4866 |
| 789 | Ga0495645_0043638 | 3300046543 | Unclassified | 3271 |
| 790 | Ga0495645_0073189 | 3300046543 | Bacteria | 2468 |
| 791 | Ga0495645_0089401 | 3300046543 | Bacteria | 2202 |
| 792 | Ga0495645_0113648 | 3300046543 | Bacteria | 1914 |
| 793 | Ga0495645_0151838 | 3300046543 | Unclassified | 1608 |
| 794 | Ga0495645_0241303 | 3300046543 | Bacteria | 1205 |
| 795 | Ga0495667_0000153 | 3300046559 | Bacteria | 46974 |
| 796 | Ga0495667_0056349 | 3300046559 | Bacteria | 2584 |
| 797 | Ga0495667_0143278 | 3300046559 | Bacteria | 1539 |
| 798 | Ga0495656_0080269 | 3300046615 | Bacteria | 1471 |
| 799 | Ga0495634_0010474 | 3300046642 | Bacteria | 6789 |
| 800 | Ga0495634_0017510 | 3300046642 | Bacteria | 5110 |
| 801 | Ga0495635_0036979 | 3300046663 | Bacteria | 3380 |
| 802 | Ga0495635_0204788 | 3300046663 | Bacteria | 1337 |
| 803 | Ga0495588_0182083 | 3300046674 | Bacteria | 1110 |
| 804 | Ga0495657_0000082 | 3300046675 | Bacteria | 85101 |
| 805 | Ga0495657_0032663 | 3300046675 | Bacteria | 3630 |
| 806 | Ga0495657_0074997 | 3300046675 | Bacteria | 2199 |
| 807 | Ga0495657_0089187 | 3300046675 | Bacteria | 1981 |
| 808 | Ga0495599_0000028 | 3300046678 | Bacteria | 113952 |
| 809 | Ga0495599_0021886 | 3300046678 | Bacteria | 3991 |
| 810 | Ga0495599_0034288 | 3300046678 | Bacteria | 3189 |
| 811 | Ga0495599_0062366 | 3300046678 | Bacteria | 2329 |
| 812 | Ga0495599_0064579 | 3300046678 | Bacteria | 2286 |
| 813 | Ga0495599_0071552 | 3300046678 | Bacteria | 2164 |
| 814 | Ga0495599_0307269 | 3300046678 | Bacteria | 956 |
| 815 | Ga0495623_0000746 | 3300046679 | Bacteria | 21773 |
| 816 | Ga0495623_0005272 | 3300046679 | Bacteria | 8478 |
| 817 | Ga0495623_0060886 | 3300046679 | Bacteria | 2368 |
| 818 | Ga0495623_0093124 | 3300046679 | Bacteria | 1845 |
| 819 | Ga0495646_0057430 | 3300046680 | Unclassified | 2329 |
| 820 | Ga0495658_0015036 | 3300046683 | Bacteria | 3965 |
| 821 | Ga0495658_0050485 | 3300046683 | Bacteria | 2353 |
| 822 | Ga0495658_0292659 | 3300046683 | Unclassified | 1029 |
| 823 | Ga0495613_0001013 | 3300046689 | Bacteria | 21355 |
| 824 | Ga0495613_0006937 | 3300046689 | Bacteria | 8448 |
| 825 | Ga0495613_0013623 | 3300046689 | Bacteria | 6034 |
| 826 | Ga0495624_0074233 | 3300046690 | Bacteria | 2113 |
| 827 | Ga0495600_0002836 | 3300046809 | Bacteria | 10086 |
| 828 | Ga0495600_0098398 | 3300046809 | Bacteria | 1907 |
| 829 | Ga0495581_0003536 | 3300047315 | Bacteria | 8971 |
| 830 | Ga0495581_0005979 | 3300047315 | Bacteria | 7049 |
| 831 | Ga0495581_0009543 | 3300047315 | Bacteria | 5614 |
| 832 | Ga0495581_0159117 | 3300047315 | Bacteria | 1320 |
| 833 | Ga0495604_0000086 | 3300047317 | Bacteria | 79200 |
| 834 | Ga0495604_0024493 | 3300047317 | Bacteria | 4815 |
| 835 | Ga0495604_0055756 | 3300047317 | Bacteria | 3045 |
| 836 | Ga0495604_0229052 | 3300047317 | Unclassified | 1276 |
| 837 | Ga0495674_0013693 | 3300047319 | Bacteria | 7619 |
| 838 | Ga0495674_0021036 | 3300047319 | Bacteria | 6036 |
| 839 | Ga0495674_0074816 | 3300047319 | Bacteria | 2915 |
| 840 | Ga0495674_0228738 | 3300047319 | Bacteria | 1535 |
| 841 | Ga0495676_0045576 | 3300047321 | Bacteria | 3568 |
| 842 | Ga0495676_0076641 | 3300047321 | Bacteria | 2552 |
| 843 | Ga0495676_0123021 | 3300047321 | Bacteria | 1884 |
| 844 | Ga0495676_0416093 | 3300047321 | Bacteria | 890 |
| 845 | Ga0495680_0000326 | 3300047322 | Bacteria | 53618 |
| 846 | Ga0495680_0013668 | 3300047322 | Bacteria | 7069 |
| 847 | Ga0495680_0039779 | 3300047322 | Bacteria | 3748 |
| 848 | Ga0495680_0040098 | 3300047322 | Bacteria | 3731 |
| 849 | Ga0495680_0092747 | 3300047322 | Bacteria | 2261 |
| 850 | Ga0495680_0235874 | 3300047322 | Unclassified | 1301 |
| 851 | Ga0495680_0359910 | 3300047322 | Bacteria | 1011 |
| 852 | Ga0495675_0000729 | 3300047444 | Bacteria | 20553 |
| 853 | Ga0495684_0013926 | 3300047471 | Bacteria | 6186 |
| 854 | Ga0495684_0068630 | 3300047471 | Bacteria | 2695 |
| 855 | Ga0495684_0163466 | 3300047471 | Bacteria | 1659 |
| 856 | Ga0495593_0033570 | 3300047673 | Bacteria | 2794 |
| 857 | Ga0495593_0060384 | 3300047673 | Bacteria | 1985 |
| 858 | Ga0495593_0185628 | 3300047673 | Bacteria | 1047 |
| 859 | Ga0495602_0000049 | 3300048088 | Bacteria | 114354 |
| 860 | Ga0495602_0039169 | 3300048088 | Bacteria | 4369 |
| 861 | Ga0495602_0045785 | 3300048088 | Bacteria | 3956 |
| 862 | Ga0495602_0074995 | 3300048088 | Bacteria | 2872 |
| 863 | Ga0495602_0093104 | 3300048088 | Bacteria | 2494 |
| 864 | Ga0495614_0106050 | 3300048089 | Bacteria | 1231 |
| 865 | Ga0496100_0023654 | 3300048903 | Bacteria | 3736 |
| 866 | Ga0496101_0063467 | 3300048904 | Bacteria | 2689 |
| 867 | Ga0496101_0072935 | 3300048904 | Bacteria | 2521 |
| 868 | Ga0496102_0018211 | 3300048905 | Bacteria | 6165 |
| 869 | Ga0496102_0057409 | 3300048905 | Bacteria | 3554 |
| 870 | Ga0496102_0127986 | 3300048905 | Bacteria | 2375 |
| 871 | Ga0496102_0287069 | 3300048905 | Bacteria | 1551 |
| 872 | Ga0496103_0086085 | 3300048906 | Bacteria | 1981 |
| 873 | Ga0496104_0036122 | 3300048907 | Bacteria | 4616 |
| 874 | Ga0496104_0049958 | 3300048907 | Bacteria | 3945 |
| 875 | Ga0496104_0091645 | 3300048907 | Bacteria | 2905 |
| 876 | Ga0496104_0285699 | 3300048907 | Bacteria | 1562 |
| 877 | Ga0496104_0429882 | 3300048907 | Bacteria | 1232 |
| 878 | Ga0496104_0644838 | 3300048907 | Unclassified | 968 |
| 879 | Ga0496105_0023215 | 3300048908 | Bacteria | 5029 |
| 880 | Ga0496105_0023575 | 3300048908 | Bacteria | 4992 |
| 881 | Ga0496105_0044132 | 3300048908 | Bacteria | 3676 |
| 882 | Ga0496105_0061917 | 3300048908 | Bacteria | 3088 |
| 883 | Ga0496105_0208557 | 3300048908 | Bacteria | 1593 |
| 884 | Ga0496106_0033861 | 3300048909 | Bacteria | 3814 |
| 885 | Ga0496106_0058693 | 3300048909 | Bacteria | 2913 |
| 886 | Ga0496106_0126675 | 3300048909 | Bacteria | 2000 |
| 887 | Ga0496107_0145002 | 3300048910 | Bacteria | 1755 |
| 888 | Ga0496107_0201846 | 3300048910 | Archaea | 1478 |
| 889 | Ga0496107_0206463 | 3300048910 | Bacteria | 1460 |
| 890 | Ga0496108_0005432 | 3300048911 | Bacteria | 10297 |
| 891 | Ga0496108_0011312 | 3300048911 | Bacteria | 7250 |
| 892 | Ga0496108_0126741 | 3300048911 | Bacteria | 2192 |
| 893 | Ga0496108_0139883 | 3300048911 | Bacteria | 2085 |
| 894 | Ga0496108_0207297 | 3300048911 | Bacteria | 1701 |
| 895 | Ga0496108_0266118 | 3300048911 | Bacteria | 1492 |
| 896 | Ga0496108_0496762 | 3300048911 | Bacteria | 1066 |
| 897 | Ga0496109_0010090 | 3300048912 | Bacteria | 8059 |
| 898 | Ga0496109_0048774 | 3300048912 | Bacteria | 3853 |
| 899 | Ga0496109_0072750 | 3300048912 | Bacteria | 3158 |
| 900 | Ga0496109_0079396 | 3300048912 | Bacteria | 3023 |
| 901 | Ga0496109_0681885 | 3300048912 | Bacteria | 965 |
| 902 | Ga0496110_0011780 | 3300048913 | Bacteria | 7177 |
| 903 | Ga0496110_0054322 | 3300048913 | Bacteria | 3523 |
| 904 | Ga0496110_0068664 | 3300048913 | Bacteria | 3137 |
| 905 | Ga0496111_0059657 | 3300048914 | Bacteria | 2765 |
| 906 | Ga0496111_0082646 | 3300048914 | Bacteria | 2346 |
| 907 | Ga0496111_0113804 | 3300048914 | Bacteria | 1994 |
| 908 | Ga0496111_0334266 | 3300048914 | Bacteria | 1122 |
| 909 | Ga0496112_0126662 | 3300048915 | Bacteria | 2524 |
| 910 | Ga0496112_0132518 | 3300048915 | Bacteria | 2463 |
| 911 | Ga0496112_0142403 | 3300048915 | Bacteria | 2367 |
| 912 | Ga0496113_0016990 | 3300048916 | Bacteria | 5039 |
| 913 | Ga0496113_0150093 | 3300048916 | Bacteria | 1838 |
| 914 | Ga0496114_0103750 | 3300048917 | Bacteria | 2430 |
| 915 | Ga0496114_0141329 | 3300048917 | Bacteria | 2084 |
| 916 | Ga0496114_0181643 | 3300048917 | Bacteria | 1837 |
| 917 | Ga0496114_0507769 | 3300048917 | Bacteria | 1066 |
| 918 | Ga0496114_0852040 | 3300048917 | Bacteria | 791 |
| 919 | Ga0496115_0135775 | 3300048918 | Unclassified | 2028 |
| 920 | Ga0501295_025811 | 3300049518 | Bacteria | 1119 |
| 921 | Ga0501031_0021321 | 3300049568 | Bacteria | 4224 |
| 922 | Ga0501033_0009856 | 3300049570 | Bacteria | 7330 |
| 923 | Ga0501033_0225950 | 3300049570 | Bacteria | 1331 |
| 924 | Ga0501033_0313913 | 3300049570 | Bacteria | 1102 |
| 925 | Ga0501034_0652088 | 3300049571 | Bacteria | 954 |
| 926 | Ga0501036_0035944 | 3300049572 | Bacteria | 4191 |
| 927 | Ga0501037_0085037 | 3300049573 | Bacteria | 2290 |
| 928 | Ga0501038_0204184 | 3300049574 | Bacteria | 1584 |
| 929 | Ga0501038_0310504 | 3300049574 | Bacteria | 1236 |
| 930 | Ga0501039_0003928 | 3300049575 | Bacteria | 11173 |
| 931 | Ga0501039_0009195 | 3300049575 | Bacteria | 7531 |
| 932 | Ga0501039_0117136 | 3300049575 | Bacteria | 2086 |
| 933 | Ga0501039_0275628 | 3300049575 | Bacteria | 1322 |
| 934 | Ga0501040_0015709 | 3300049576 | Bacteria | 5005 |
| 935 | Ga0501041_0002972 | 3300049577 | Bacteria | 9718 |
| 936 | Ga0501041_0026412 | 3300049577 | Bacteria | 3493 |
| 937 | Ga0501041_0030083 | 3300049577 | Bacteria | 3278 |
| 938 | Ga0501042_0006227 | 3300049578 | Bacteria | 7746 |
| 939 | Ga0501042_0008873 | 3300049578 | Bacteria | 6667 |
| 940 | Ga0501042_0013030 | 3300049578 | Bacteria | 5650 |
| 941 | Ga0501042_0106391 | 3300049578 | Bacteria | 2019 |
| 942 | Ga0501043_0069772 | 3300049579 | Bacteria | 2761 |
| 943 | Ga0501043_0214738 | 3300049579 | Bacteria | 1490 |
| 944 | Ga0501046_0008266 | 3300049580 | Bacteria | 9086 |
| 945 | Ga0501046_0188519 | 3300049580 | Bacteria | 1539 |
| 946 | Ga0501046_0260620 | 3300049580 | Bacteria | 1274 |
| 947 | Ga0501048_0038046 | 3300049582 | Bacteria | 3454 |
| 948 | Ga0501048_0372955 | 3300049582 | Unclassified | 1018 |
| 949 | Ga0501067_0002075 | 3300049583 | Bacteria | 11034 |
| 950 | Ga0501067_0016570 | 3300049583 | Bacteria | 4073 |
| 951 | Ga0501069_0042478 | 3300049585 | Bacteria | 2515 |
| 952 | Ga0501071_0037174 | 3300049587 | Bacteria | 3475 |
| 953 | Ga0501071_0100107 | 3300049587 | Bacteria | 2136 |
| 954 | Ga0501071_0192926 | 3300049587 | Unclassified | 1528 |
| 955 | Ga0501072_0085838 | 3300049588 | Bacteria | 2497 |
| 956 | Ga0501072_0173323 | 3300049588 | Unclassified | 1721 |
| 957 | Ga0501074_0021979 | 3300049590 | Bacteria | 4633 |
| 958 | Ga0501074_0023931 | 3300049590 | Bacteria | 4438 |
| 959 | Ga0501074_0061309 | 3300049590 | Unclassified | 2710 |
| 960 | Ga0501075_0004135 | 3300049591 | Bacteria | 9799 |
| 961 | Ga0501075_0022583 | 3300049591 | Bacteria | 4597 |
| 962 | Ga0501075_0179931 | 3300049591 | Bacteria | 1613 |
| 963 | Ga0501075_0291399 | 3300049591 | Bacteria | 1243 |
| 964 | Ga0501075_0401379 | 3300049591 | Bacteria | 1045 |
| 965 | Ga0501075_0414866 | 3300049591 | Unclassified | 1027 |
| 966 | Ga0501075_0721674 | 3300049591 | Unclassified | 759 |
| 967 | Ga0501076_0004501 | 3300049592 | Bacteria | 9927 |
| 968 | Ga0501076_0053147 | 3300049592 | Bacteria | 3209 |
| 969 | Ga0501076_0164957 | 3300049592 | Bacteria | 1805 |
| 970 | Ga0501076_0196903 | 3300049592 | Bacteria | 1645 |
| 971 | Ga0501076_0265452 | 3300049592 | Unclassified | 1406 |
| 972 | Ga0501077_0012346 | 3300049593 | Bacteria | 5351 |
| 973 | Ga0501077_0284660 | 3300049593 | Unclassified | 1052 |
| 974 | Ga0501243_003069 | 3300049675 | Bacteria | 2465 |
| 975 | Ga0501079_0015229 | 3300049741 | Bacteria | 5866 |
| 976 | Ga0501079_0021616 | 3300049741 | Bacteria | 4922 |
| 977 | Ga0501079_0091515 | 3300049741 | Bacteria | 2357 |
| 978 | Ga0501080_0105263 | 3300049742 | Unclassified | 2616 |
| 979 | Ga0501081_0011034 | 3300049743 | Bacteria | 5907 |
| 980 | Ga0501081_0036702 | 3300049743 | Bacteria | 3342 |
| 981 | Ga0501081_0335965 | 3300049743 | Unclassified | 1112 |
| 982 | Ga0501083_0248931 | 3300049744 | Unclassified | 1157 |
| 983 | Ga0501035_0021576 | 3300049822 | Bacteria | 5922 |
| 984 | Ga0501045_0005664 | 3300049824 | Bacteria | 8643 |
| 985 | Ga0501045_0103538 | 3300049824 | Unclassified | 2108 |
| 986 | Ga0501045_0165412 | 3300049824 | Bacteria | 1647 |
| 987 | Ga0501045_0213297 | 3300049824 | Bacteria | 1438 |
| 988 | Ga0501212_000772 | 3300049851 | Bacteria | 3313 |
| 989 | nmdc:mga05p37_1141_c1 | 3300050507 | Bacteria | 30525 |
| 990 | nmdc:mga05p37_118154_c1 | 3300050507 | Bacteria | 3258 |
| 991 | nmdc:mga05p37_161942_c1 | 3300050507 | Bacteria | 2732 |
| 992 | nmdc:mga05p37_16928_c1 | 3300050507 | Bacteria | 8790 |
| 993 | nmdc:mga05p37_1964_c1 | 3300050507 | Bacteria | 23980 |
| 994 | nmdc:mga05p37_277885_c1 | 3300050507 | Unclassified | 1998 |
| 995 | nmdc:mga05p37_349435_c1 | 3300050507 | Bacteria | 1741 |
| 996 | nmdc:mga05p37_41228_c1 | 3300050507 | Bacteria | 5669 |
| 997 | nmdc:mga05p37_49456_c1 | 3300050507 | Bacteria | 5171 |
| 998 | nmdc:mga05p37_5653_c1 | 3300050507 | Bacteria | 14704 |
| 999 | nmdc:mga05p37_8148_c1 | 3300050507 | Bacteria | 12387 |
| 1000 | nmdc:mga09592_11509_c1 | 3300050508 | Bacteria | 7199 |
| 1001 | nmdc:mga09592_1637_c1 | 3300050508 | Bacteria | 18036 |
| 1002 | nmdc:mga09592_174141_c1 | 3300050508 | Bacteria | 1861 |
| 1003 | nmdc:mga09592_18743_c1 | 3300050508 | Bacteria | 5676 |
| 1004 | nmdc:mga09592_333926_c1 | 3300050508 | Bacteria | 1312 |
| 1005 | nmdc:mga09592_892_c1 | 3300050508 | Bacteria | 23407 |
| 1006 | nmdc:mga0qj67_16_c1 | 3300050509 | Bacteria | 124323 |
| 1007 | nmdc:mga0qj67_21564_c1 | 3300050509 | Bacteria | 4942 |
| 1008 | nmdc:mga0qj67_266485_c1 | 3300050509 | Bacteria | 1389 |
| 1009 | nmdc:mga0qj67_380671_c1 | 3300050509 | Unclassified | 1140 |
| 1010 | nmdc:mga0qj67_63181_c1 | 3300050509 | Bacteria | 2944 |
| 1011 | nmdc:mga06r32_155048_c1 | 3300050510 | Bacteria | 2271 |
| 1012 | nmdc:mga06r32_161227_c1 | 3300050510 | Bacteria | 2225 |
| 1013 | nmdc:mga06r32_26628_c1 | 3300050510 | Bacteria | 5394 |
| 1014 | nmdc:mga06r32_316681_c1 | 3300050510 | Bacteria | 1546 |
| 1015 | nmdc:mga06r32_38_c2 | 3300050510 | Bacteria | 21664 |
| 1016 | nmdc:mga06r32_493497_c1 | 3300050510 | Unclassified | 1202 |
| 1017 | nmdc:mga06r32_8283_c1 | 3300050510 | Bacteria | 9359 |
| 1018 | nmdc:mga06r32_828_c1 | 3300050510 | Bacteria | 27433 |
| 1019 | nmdc:mga08y16_6021_c1 | 3300050511 | Bacteria | 12712 |
| 1020 | nmdc:mga08y16_620152_c1 | 3300050511 | Bacteria | 1089 |
| 1021 | nmdc:mga0n895_20705_c1 | 3300050512 | Bacteria | 6140 |
| 1022 | nmdc:mga0n895_210487_c1 | 3300050512 | Bacteria | 1975 |
| 1023 | nmdc:mga0n895_401947_c1 | 3300050512 | Bacteria | 1385 |
| 1024 | nmdc:mga0n895_51309_c1 | 3300050512 | Bacteria | 4047 |
| 1025 | nmdc:mga0n895_885976_c1 | 3300050512 | Bacteria | 878 |
| 1026 | nmdc:mga0rr50_130417_c1 | 3300050513 | Unclassified | 2012 |
| 1027 | nmdc:mga0rr50_161109_c1 | 3300050513 | Unclassified | 1821 |
| 1028 | nmdc:mga0rr50_26502_c1 | 3300050513 | Bacteria | 4046 |
| 1029 | nmdc:mga0rr50_38257_c1 | 3300050513 | Bacteria | 3470 |
| 1030 | nmdc:mga0rr50_9311_c1 | 3300050513 | Bacteria | 6170 |
| 1031 | nmdc:mga08x19_194782_c1 | 3300050514 | Unclassified | 1388 |
| 1032 | nmdc:mga08x19_27306_c1 | 3300050514 | Bacteria | 3569 |
| 1033 | nmdc:mga08x19_302478_c1 | 3300050514 | Bacteria | 1111 |
| 1034 | nmdc:mga08x19_307007_c1 | 3300050514 | Bacteria | 1103 |
| 1035 | nmdc:mga0a205_224749_c1 | 3300050515 | Unclassified | 1762 |
| 1036 | nmdc:mga0a205_2978_c1 | 3300050515 | Bacteria | 13608 |
| 1037 | nmdc:mga0a205_33385_c1 | 3300050515 | Bacteria | 4935 |
| 1038 | nmdc:mga0a205_55318_c1 | 3300050515 | Bacteria | 3833 |
| 1039 | nmdc:mga0a205_6264_c1 | 3300050515 | Bacteria | 10741 |
| 1040 | nmdc:mga0a205_85851_c1 | 3300050515 | Bacteria | 3039 |
| 1041 | nmdc:mga0a205_96495_c1 | 3300050515 | Bacteria | 2855 |
| 1042 | Ga0495601_0007082 | 3300053077 | Bacteria | 6570 |
| 1043 | Ga0495601_0008037 | 3300053077 | Bacteria | 6217 |
| 1044 | Ga0495601_0020008 | 3300053077 | Bacteria | 4085 |
| 1045 | Ga0495601_0047598 | 3300053077 | Bacteria | 2700 |
| 1046 | Ga0495601_0155869 | 3300053077 | Bacteria | 1491 |
| 1047 | Ga0495595_0000194 | 3300053084 | Bacteria | 24737 |
| 1048 | Ga0495595_0009026 | 3300053084 | Bacteria | 4117 |
| 1049 | Ga0495619_0000751 | 3300053085 | Bacteria | 21143 |
| 1050 | Ga0495619_0013119 | 3300053085 | Bacteria | 5222 |
| 1051 | Ga0500579_108774 | 3300053143 | Bacteria | 1406 |
| 1052 | Ga0501084_0007637 | 3300054114 | Bacteria | 8918 |
| 1053 | Ga0501084_0055143 | 3300054114 | Bacteria | 3325 |
| 1054 | Ga0501084_0621063 | 3300054114 | Unclassified | 913 |
| 1055 | Ga0587083_0046077 | 3300059505 | Bacteria | 933 |
| 1056 | Ga0587094_012693 | 3300059513 | Bacteria | 1128 |
| 1057 | Ga0501082_0007351 | 3300060353 | Bacteria | 9504 |
| 1058 | Ga0501082_0115459 | 3300060353 | Bacteria | 2325 |
| 1059 | Ga0530510_0046728 | 3300061734 | Bacteria | 3127 |
| 1060 | Ga0530510_0237721 | 3300061734 | Bacteria | 1356 |
| 1061 | Ga0530510_0241243 | 3300061734 | Unclassified | 1345 |
| 1062 | 2808873971 | 2808606365 | Bacteria | 4301966 |
| 1063 | 2816424897 | 2816332119 | Bacteria | 8120218 |
| 1064 | Ga0501048_0127641 | |||
| 1065 | SwRhRL3b_contig_3218519 | |||
| 1066 | SwRhRL2b_contig_1162259 | |||
| 1067 | JGI24740J21852_10023551 | |||
| 1068 | JGI24737J22298_10012008 | |||
| 1069 | rootH1_10019379 | |||
| 1070 | JGI25407J50210_10011208 | |||
| 1071 | JGI25407J50210_10014099 | |||
| 1072 | JGI25405J52794_10036385 | |||
| 1073 | Ga0058859_11127628 | |||
| 1074 | Ga0058859_11245634 | |||
| 1075 | Ga0058863_10065652 | |||
| 1076 | Ga0058863_11873860 | |||
| 1077 | Ga0058860_11876494 | |||
| 1078 | Ga0058860_12191030 | |||
| 1079 | Ga0058862_10044071 | |||
| 1080 | Ga0058862_12728235 | |||
| 1081 | Ga0065704_10000443 | |||
| 1082 | Ga0065704_10167379 | |||
| 1083 | Ga0065715_10342035 | |||
| 1084 | Ga0065707_10042627 | |||
| 1085 | Ga0065707_10082128 | |||
| 1086 | Ga0065707_10084513 | |||
| 1087 | Ga0065707_10378474 | |||
| 1088 | Ga0070658_10172574 | |||
| 1089 | Ga0070683_100001463 | |||
| 1090 | Ga0070683_100038145 | |||
| 1091 | Ga0070683_100058981 | |||
| 1092 | Ga0070683_100148479 | |||
| 1093 | Ga0070690_100203160 | |||
| 1094 | Ga0068869_100066263 | |||
| 1095 | Ga0070666_10080692 | |||
| 1096 | Ga0070680_100351199 | |||
| 1097 | Ga0070680_100399281 | |||
| 1098 | Ga0070682_100053961 | |||
| 1099 | Ga0068868_100085535 | |||
| 1100 | Ga0068868_100086786 | |||
| 1101 | Ga0070660_100109482 | |||
| 1102 | Ga0070691_10003974 | |||
| 1103 | Ga0070691_10220315 | |||
| 1104 | Ga0070687_100048363 | |||
| 1105 | Ga0070661_100373922 | |||
| 1106 | Ga0070692_10135552 | |||
| 1107 | Ga0070692_10141485 | |||
| 1108 | Ga0070668_100016228 | |||
| 1109 | Ga0070668_100032036 | |||
| 1110 | Ga0070668_100166430 | |||
| 1111 | Ga0070674_100039737 | |||
| 1112 | Ga0070673_100335295 | |||
| 1113 | Ga0070673_100444409 | |||
| 1114 | Ga0070659_100073205 | |||
| 1115 | Ga0070667_100131393 | |||
| 1116 | Ga0070703_10021242 | |||
| 1117 | Ga0070703_10043785 | |||
| 1118 | Ga0070709_10001473 | |||
| 1119 | Ga0070709_10099741 | |||
| 1120 | Ga0070709_10290597 | |||
| 1121 | Ga0070714_100054899 | |||
| 1122 | Ga0070714_100093225 | |||
| 1123 | Ga0070713_100002567 | |||
| 1124 | Ga0070713_100003245 | |||
| 1125 | Ga0070713_100050234 | |||
| 1126 | Ga0070713_100080951 | |||
| 1127 | Ga0070710_10011620 | |||
| 1128 | Ga0070710_10013826 | |||
| 1129 | Ga0070710_10070994 | |||
| 1130 | Ga0070701_10147901 | |||
| 1131 | Ga0070711_100020123 | |||
| 1132 | Ga0070705_100085368 | |||
| 1133 | Ga0070705_100216461 | |||
| 1134 | Ga0070705_100559881 | |||
| 1135 | Ga0070700_100061066 | |||
| 1136 | Ga0070700_100106135 | |||
| 1137 | Ga0070700_100449571 | |||
| 1138 | Ga0070694_100015334 | |||
| 1139 | Ga0070694_100118132 | |||
| 1140 | Ga0070708_100001090 | |||
| 1141 | Ga0070708_100038294 | |||
| 1142 | Ga0070708_100091089 | |||
| 1143 | Ga0070663_100292785 | |||
| 1144 | Ga0070678_100002797 | |||
| 1145 | Ga0070678_100039449 | |||
| 1146 | Ga0070662_100018037 | |||
| 1147 | Ga0070662_100027333 | |||
| 1148 | Ga0068867_100586713 | |||
| 1149 | Ga0070706_100000133 | |||
| 1150 | Ga0070706_100001026 | |||
| 1151 | Ga0070706_100002668 | |||
| 1152 | Ga0070706_100004689 | |||
| 1153 | Ga0070706_100005186 | |||
| 1154 | Ga0070706_100005303 | |||
| 1155 | Ga0070706_100011788 | |||
| 1156 | Ga0070706_100016224 | |||
| 1157 | Ga0070706_100041377 | |||
| 1158 | Ga0070706_100098838 | |||
| 1159 | Ga0070706_100246921 | |||
| 1160 | Ga0070707_100000176 | |||
| 1161 | Ga0070707_100000482 | |||
| 1162 | Ga0070707_100002121 | |||
| 1163 | Ga0070707_100044337 | |||
| 1164 | Ga0070707_100050312 | |||
| 1165 | Ga0070707_100284807 | |||
| 1166 | Ga0070707_100328884 | |||
| 1167 | Ga0070698_100000504 | |||
| 1168 | Ga0070698_100001605 | |||
| 1169 | Ga0070698_100004911 | |||
| 1170 | Ga0070698_100023430 | |||
| 1171 | Ga0070698_100047461 | |||
| 1172 | Ga0070698_100048921 | |||
| 1173 | Ga0070698_100054317 | |||
| 1174 | Ga0070698_100063492 | |||
| 1175 | Ga0070698_100078994 | |||
| 1176 | Ga0070698_100106743 | |||
| 1177 | Ga0070698_100128866 | |||
| 1178 | Ga0070698_100169437 | |||
| 1179 | Ga0070698_100285628 | |||
| 1180 | Ga0070698_100306172 | |||
| 1181 | Ga0070699_100001393 | |||
| 1182 | Ga0070699_100017628 | |||
| 1183 | Ga0070699_100035425 | |||
| 1184 | Ga0070699_100386048 | |||
| 1185 | Ga0070679_100279964 | |||
| 1186 | Ga0070679_100705210 | |||
| 1187 | Ga0070684_100013071 | |||
| 1188 | Ga0070684_100021280 | |||
| 1189 | Ga0070684_100044362 | |||
| 1190 | Ga0070684_100251078 | |||
| 1191 | Ga0070697_100047108 | |||
| 1192 | Ga0070697_100063907 | |||
| 1193 | Ga0068853_100023449 | |||
| 1194 | Ga0070686_100033047 | |||
| 1195 | Ga0070695_100033414 | |||
| 1196 | Ga0070695_100109668 | |||
| 1197 | Ga0070693_100014606 | |||
| 1198 | Ga0070665_100152693 | |||
| 1199 | Ga0070704_100025909 | |||
| 1200 | Ga0070704_100127325 | |||
| 1201 | Ga0070704_100219037 | |||
| 1202 | Ga0070704_100324057 | |||
| 1203 | Ga0068855_100170763 | |||
| 1204 | Ga0068855_100456238 | |||
| 1205 | Ga0068855_100719510 | |||
| 1206 | Ga0070664_100089036 | |||
| 1207 | Ga0068857_100012182 | |||
| 1208 | Ga0068857_100047229 | |||
| 1209 | Ga0068857_100136943 | |||
| 1210 | Ga0068857_100146642 | |||
| 1211 | Ga0068854_100249383 | |||
| 1212 | Ga0068856_100008570 | |||
| 1213 | Ga0068856_100093626 | |||
| 1214 | Ga0068856_100154674 | |||
| 1215 | Ga0068856_100459260 | |||
| 1216 | Ga0068856_100521932 | |||
| 1217 | Ga0070702_100029371 | |||
| 1218 | Ga0070702_100066630 | |||
| 1219 | Ga0068852_100147377 | |||
| 1220 | Ga0068852_100239563 | |||
| 1221 | Ga0068852_100521273 | |||
| 1222 | Ga0068859_100135213 | |||
| 1223 | Ga0068859_100176563 | |||
| 1224 | Ga0068859_100228649 | |||
| 1225 | Ga0068859_100323170 | |||
| 1226 | Ga0068859_100386100 | |||
| 1227 | Ga0068864_100040044 | |||
| 1228 | Ga0068864_100057065 | |||
| 1229 | Ga0068866_10018127 | |||
| 1230 | Ga0068866_10155721 | |||
| 1231 | Ga0068861_100028205 | |||
| 1232 | Ga0068861_100261811 | |||
| 1233 | Ga0068861_100431161 | |||
| 1234 | Ga0068861_100618789 | |||
| 1235 | Ga0068870_10124351 | |||
| 1236 | Ga0068863_100048931 | |||
| 1237 | Ga0068863_100223278 | |||
| 1238 | Ga0068858_100017789 | |||
| 1239 | Ga0068858_100493276 | |||
| 1240 | Ga0068860_100044534 | |||
| 1241 | Ga0068860_100082290 | |||
| 1242 | Ga0068862_100213665 | |||
| 1243 | Ga0081455_10001196 | |||
| 1244 | Ga0081455_10001884 | |||
| 1245 | Ga0081455_10012456 | |||
| 1246 | Ga0081455_10018256 | |||
| 1247 | Ga0081455_10028069 | |||
| 1248 | Ga0081455_10083346 | |||
| 1249 | Ga0081455_10093872 | |||
| 1250 | Ga0081455_10110766 | |||
| 1251 | Ga0081455_10112369 | |||
| 1252 | Ga0081538_10000439 | |||
| 1253 | Ga0081538_10001065 | |||
| 1254 | Ga0081538_10001354 | |||
| 1255 | Ga0081538_10011651 | |||
| 1256 | Ga0081538_10015961 | |||
| 1257 | Ga0081540_1000548 | |||
| 1258 | Ga0081540_1001646 | |||
| 1259 | Ga0081540_1004092 | |||
| 1260 | Ga0081539_10002659 | |||
| 1261 | Ga0081539_10007525 | |||
| 1262 | Ga0081539_10015493 | |||
| 1263 | Ga0081539_10040406 | |||
| 1264 | Ga0081539_10083931 | |||
| 1265 | Ga0070717_10005187 | |||
| 1266 | Ga0070717_10020265 | |||
| 1267 | Ga0070717_10023959 | |||
| 1268 | Ga0070717_10066162 | |||
| 1269 | Ga0070717_10084658 | |||
| 1270 | Ga0070717_10139646 | |||
| 1271 | Ga0070717_10177239 | |||
| 1272 | Ga0070717_10203592 | |||
| 1273 | Ga0070717_10392219 | |||
| 1274 | Ga0075432_10000582 | |||
| 1275 | Ga0075432_10009306 | |||
| 1276 | Ga0075432_10014210 | |||
| 1277 | Ga0075432_10112641 | |||
| 1278 | Ga0070715_10018496 | |||
| 1279 | Ga0070715_10024955 | |||
| 1280 | Ga0070715_10041051 | |||
| 1281 | Ga0070715_10078330 | |||
| 1282 | Ga0070716_100009210 | |||
| 1283 | Ga0070716_100010044 | |||
| 1284 | Ga0070716_100131084 | |||
| 1285 | Ga0070712_100001569 | |||
| 1286 | Ga0070712_100050373 | |||
| 1287 | Ga0070712_100140132 | |||
| 1288 | Ga0097621_100043256 | |||
| 1289 | Ga0097621_100678527 | |||
| 1290 | Ga0068871_100065716 | |||
| 1291 | Ga0068871_100116068 | |||
| 1292 | Ga0075428_100007986 | |||
| 1293 | Ga0075428_100008346 | |||
| 1294 | Ga0075428_100009860 | |||
| 1295 | Ga0075428_100016309 | |||
| 1296 | Ga0075428_100038679 | |||
| 1297 | Ga0075428_100042899 | |||
| 1298 | Ga0075428_100048687 | |||
| 1299 | Ga0075428_100085874 | |||
| 1300 | Ga0075428_100146659 | |||
| 1301 | Ga0075428_100639506 | |||
| 1302 | Ga0075430_100015845 | |||
| 1303 | Ga0075430_100023142 | |||
| 1304 | Ga0075430_100071533 | |||
| 1305 | Ga0075430_100131707 | |||
| 1306 | Ga0075430_100139107 | |||
| 1307 | Ga0075430_100387034 | |||
| 1308 | Ga0075431_100000655 | |||
| 1309 | Ga0075431_100022463 | |||
| 1310 | Ga0075431_100032343 | |||
| 1311 | Ga0075431_100033074 | |||
| 1312 | Ga0075431_100037463 | |||
| 1313 | Ga0075431_100061596 | |||
| 1314 | Ga0075433_10003360 | |||
| 1315 | Ga0075433_10003786 | |||
| 1316 | Ga0075433_10023330 | |||
| 1317 | Ga0075433_10034761 | |||
| 1318 | Ga0075433_10142843 | |||
| 1319 | Ga0075434_100001264 | |||
| 1320 | Ga0075434_100001550 | |||
| 1321 | Ga0075434_100107566 | |||
| 1322 | Ga0075434_100146637 | |||
| 1323 | Ga0075434_100269903 | |||
| 1324 | Ga0075429_100008172 | |||
| 1325 | Ga0075429_100008208 | |||
| 1326 | Ga0075429_100018033 | |||
| 1327 | Ga0075429_100166692 | |||
| 1328 | Ga0068865_100031722 | |||
| 1329 | Ga0068865_100038579 | |||
| 1330 | Ga0068865_100194569 | |||
| 1331 | Ga0075436_100006661 | |||
| 1332 | Ga0075436_100045437 | |||
| 1333 | Ga0075436_100165604 | |||
| 1334 | Ga0075436_100333801 | |||
| 1335 | Ga0097620_100135201 | |||
| 1336 | Ga0097620_100176573 | |||
| 1337 | Ga0097620_100228643 | |||
| 1338 | Ga0097620_100323215 | |||
| 1339 | Ga0097620_100386092 | |||
| 1340 | Ga0075435_100009058 | |||
| 1341 | Ga0075435_100011330 | |||
| 1342 | Ga0075435_100017976 | |||
| 1343 | Ga0075435_100051730 | |||
| 1344 | Ga0075435_100103768 | |||
| 1345 | Ga0075435_100139160 | |||
| 1346 | Ga0099794_10028699 | |||
| 1347 | Ga0105251_10036355 | |||
| 1348 | Ga0105250_10122292 | |||
| 1349 | Ga0105240_10129005 | |||
| 1350 | Ga0105240_10500448 | |||
| 1351 | Ga0111539_10013335 | |||
| 1352 | Ga0111539_10016681 | |||
| 1353 | Ga0111539_10022795 | |||
| 1354 | Ga0111539_10049222 | |||
| 1355 | Ga0111539_10123155 | |||
| 1356 | Ga0111539_10746873 | |||
| 1357 | Ga0105245_10064523 | |||
| 1358 | Ga0105245_10091645 | |||
| 1359 | Ga0105245_10115806 | |||
| 1360 | Ga0105245_10252344 | |||
| 1361 | Ga0105247_10047818 | |||
| 1362 | Ga0105247_10061923 | |||
| 1363 | Ga0114129_10000001 | |||
| 1364 | Ga0114129_10014817 | |||
| 1365 | Ga0114129_10020866 | |||
| 1366 | Ga0114129_10057681 | |||
| 1367 | Ga0114129_10061210 | |||
| 1368 | Ga0114129_10128003 | |||
| 1369 | Ga0114129_10175588 | |||
| 1370 | Ga0114129_10439754 | |||
| 1371 | Ga0114129_10466871 | |||
| 1372 | Ga0114129_10548149 | |||
| 1373 | Ga0114129_10635947 | |||
| 1374 | Ga0114129_11074077 | |||
| 1375 | Ga0105243_10029951 | |||
| 1376 | Ga0105243_10061693 | |||
| 1377 | Ga0105243_10200834 | |||
| 1378 | Ga0105243_10269413 | |||
| 1379 | Ga0105243_10300372 | |||
| 1380 | Ga0105243_10423931 | |||
| 1381 | Ga0105241_10334586 | |||
| 1382 | Ga0105242_10062568 | |||
| 1383 | Ga0105242_10063619 | |||
| 1384 | Ga0105242_10231475 | |||
| 1385 | Ga0105248_10048664 | |||
| 1386 | Ga0105237_10082395 | |||
| 1387 | Ga0105237_10147209 | |||
| 1388 | Ga0105237_10841571 | |||
| 1389 | Ga0105238_10192416 | |||
| 1390 | Ga0105238_10327346 | |||
| 1391 | Ga0105249_10011082 | |||
| 1392 | Ga0105249_10016717 | |||
| 1393 | Ga0105249_10101795 | |||
| 1394 | Ga0105249_10128128 | |||
| 1395 | Ga0105249_10181487 | |||
| 1396 | Ga0105249_10286900 | |||
| 1397 | Ga0105249_10581335 | |||
| 1398 | Ga0105239_10041362 | |||
| 1399 | Ga0105239_10105558 | |||
| 1400 | Ga0105239_10333823 | |||
| 1401 | Ga0105239_10857719 | |||
| 1402 | Ga0105246_10029979 | |||
| 1403 | Ga0105246_10081269 | |||
| 1404 | Ga0105246_10131506 | |||
| 1405 | Ga0105246_10256181 | |||
| 1406 | Ga0157342_1001407 | |||
| 1407 | Ga0157371_10047334 | |||
| 1408 | Ga0157370_10030431 | |||
| 1409 | Ga0157370_10031855 | |||
| 1410 | Ga0157369_10104551 | |||
| 1411 | Ga0157369_10283506 | |||
| 1412 | Ga0157369_10311175 | |||
| 1413 | Ga0157374_10204473 | |||
| 1414 | Ga0157378_10066752 | |||
| 1415 | Ga0163162_10037844 | |||
| 1416 | Ga0163162_10061652 | |||
| 1417 | Ga0163162_10336865 | |||
| 1418 | Ga0157372_10107151 | |||
| 1419 | Ga0157372_10346051 | |||
| 1420 | Ga0157372_10346404 | |||
| 1421 | Ga0157372_10752836 | |||
| 1422 | Ga0157375_10024766 | |||
| 1423 | Ga0157375_10061677 | |||
| 1424 | Ga0157375_10453848 | |||
| 1425 | Ga0157375_10505561 | |||
| 1426 | Ga0163163_10039330 | |||
| 1427 | Ga0157380_10039401 | |||
| 1428 | Ga0157380_10519153 | |||
| 1429 | Ga0157377_10030312 | |||
| 1430 | Ga0157377_10348536 | |||
| 1431 | Ga0157379_10006261 | |||
| 1432 | Ga0157376_10056136 | |||
| 1433 | Ga0157376_10273349 | |||
| 1434 | Ga0163161_10034708 | |||
| 1435 | Ga0163161_10499746 | |||
| 1436 | Ga0197907_10225339 | |||
| 1437 | Ga0197907_10277679 | |||
| 1438 | Ga0197907_10470509 | |||
| 1439 | Ga0197907_10902623 | |||
| 1440 | Ga0197907_10984839 | |||
| 1441 | Ga0197907_11257832 | |||
| 1442 | Ga0206356_10106052 | |||
| 1443 | Ga0206356_10216668 | |||
| 1444 | Ga0206356_10369112 | |||
| 1445 | Ga0206356_11428032 | |||
| 1446 | Ga0206356_11705868 | |||
| 1447 | Ga0206349_1134039 | |||
| 1448 | Ga0206349_1818514 | |||
| 1449 | Ga0206349_1860141 | |||
| 1450 | Ga0206355_1105940 | |||
| 1451 | Ga0206355_1206412 | |||
| 1452 | Ga0206351_10249285 | |||
| 1453 | Ga0206352_10264739 | |||
| 1454 | Ga0206352_10356421 | |||
| 1455 | Ga0206352_11336596 | |||
| 1456 | Ga0206350_10060753 | |||
| 1457 | Ga0206350_11219577 | |||
| 1458 | Ga0206350_11605962 | |||
| 1459 | Ga0206354_10160929 | |||
| 1460 | Ga0206354_10370402 | |||
| 1461 | Ga0206354_10745353 | |||
| 1462 | Ga0206354_10799651 | |||
| 1463 | Ga0206354_10812046 | |||
| 1464 | Ga0206353_10443559 | |||
| 1465 | Ga0206353_11296763 | |||
| 1466 | Ga0206353_11527532 | |||
| 1467 | Ga0224712_10002553 | |||
| 1468 | Ga0224712_10038090 | |||
| 1469 | Ga0224712_10050539 | |||
| 1470 | Ga0224712_10050926 | |||
| 1471 | Ga0224712_10124253 | |||
| 1472 | Ga0224712_10182993 | |||
| 1473 | Ga0207653_10002312 | |||
| 1474 | Ga0207692_10004841 | |||
| 1475 | Ga0207692_10008731 | |||
| 1476 | Ga0207692_10123019 | |||
| 1477 | Ga0207642_10036679 | |||
| 1478 | Ga0207642_10108366 | |||
| 1479 | Ga0207710_10023890 | |||
| 1480 | Ga0207710_10098798 | |||
| 1481 | Ga0207688_10008232 | |||
| 1482 | Ga0207688_10010597 | |||
| 1483 | Ga0207647_10029303 | |||
| 1484 | Ga0207647_10092248 | |||
| 1485 | Ga0207685_10019314 | |||
| 1486 | Ga0207685_10105909 | |||
| 1487 | Ga0207699_10000555 | |||
| 1488 | Ga0207699_10000761 | |||
| 1489 | Ga0207699_10013524 | |||
| 1490 | Ga0207643_10021911 | |||
| 1491 | Ga0207705_10127895 | |||
| 1492 | Ga0207684_10000599 | |||
| 1493 | Ga0207684_10000967 | |||
| 1494 | Ga0207684_10004345 | |||
| 1495 | Ga0207684_10005872 | |||
| 1496 | Ga0207684_10029194 | |||
| 1497 | Ga0207684_10040664 | |||
| 1498 | Ga0207684_10052390 | |||
| 1499 | Ga0207684_10072216 | |||
| 1500 | Ga0207684_10151658 | |||
| 1501 | Ga0207684_10193035 | |||
| 1502 | Ga0207654_10284717 | |||
| 1503 | Ga0207707_10229702 | |||
| 1504 | Ga0207693_10003808 | |||
| 1505 | Ga0207693_10004257 | |||
| 1506 | Ga0207693_10033975 | |||
| 1507 | Ga0207663_10007144 | |||
| 1508 | Ga0207660_10080792 | |||
| 1509 | Ga0207660_10447139 | |||
| 1510 | Ga0207662_10018897 | |||
| 1511 | Ga0207657_10015063 | |||
| 1512 | Ga0207652_10163623 | |||
| 1513 | Ga0207652_10401552 | |||
| 1514 | Ga0207646_10000811 | |||
| 1515 | Ga0207646_10001035 | |||
| 1516 | Ga0207646_10005172 | |||
| 1517 | Ga0207646_10011107 | |||
| 1518 | Ga0207646_10018172 | |||
| 1519 | Ga0207646_10033193 | |||
| 1520 | Ga0207646_10082229 | |||
| 1521 | Ga0207646_10451654 | |||
| 1522 | Ga0207694_10531306 | |||
| 1523 | Ga0207687_10057200 | |||
| 1524 | Ga0207687_10057371 | |||
| 1525 | Ga0207687_10182847 | |||
| 1526 | Ga0207687_10333491 | |||
| 1527 | Ga0207700_10000558 | |||
| 1528 | Ga0207700_10001918 | |||
| 1529 | Ga0207700_10015157 | |||
| 1530 | Ga0207700_10028862 | |||
| 1531 | Ga0207700_10159812 | |||
| 1532 | Ga0207700_10191567 | |||
| 1533 | Ga0207664_10000706 | |||
| 1534 | Ga0207664_10001977 | |||
| 1535 | Ga0207664_10060803 | |||
| 1536 | Ga0207664_10071738 | |||
| 1537 | Ga0207664_10403723 | |||
| 1538 | Ga0207644_10378990 | |||
| 1539 | Ga0207690_10026581 | |||
| 1540 | Ga0207706_10003790 | |||
| 1541 | Ga0207706_10106062 | |||
| 1542 | Ga0207686_10471239 | |||
| 1543 | Ga0207709_10122771 | |||
| 1544 | Ga0207709_10267893 | |||
| 1545 | Ga0207709_10357011 | |||
| 1546 | Ga0207670_10173436 | |||
| 1547 | Ga0207704_10022983 | |||
| 1548 | Ga0207704_10144409 | |||
| 1549 | Ga0207665_10014174 | |||
| 1550 | Ga0207665_10015571 | |||
| 1551 | Ga0207665_10030098 | |||
| 1552 | Ga0207711_10188364 | |||
| 1553 | Ga0207689_10116786 | |||
| 1554 | Ga0207661_10071498 | |||
| 1555 | Ga0207661_10181619 | |||
| 1556 | Ga0207661_10291623 | |||
| 1557 | Ga0207679_10069465 | |||
| 1558 | Ga0207667_10176433 | |||
| 1559 | Ga0207651_10406415 | |||
| 1560 | Ga0207712_10032779 | |||
| 1561 | Ga0207668_10100897 | |||
| 1562 | Ga0207640_10123158 | |||
| 1563 | Ga0207703_10066359 | |||
| 1564 | Ga0207703_10504975 | |||
| 1565 | Ga0207639_10028967 | |||
| 1566 | Ga0207639_10048520 | |||
| 1567 | Ga0207678_10010009 | |||
| 1568 | Ga0207708_10140368 | |||
| 1569 | Ga0207708_10156618 | |||
| 1570 | Ga0207702_10013876 | |||
| 1571 | Ga0207702_10042023 | |||
| 1572 | Ga0207702_10203834 | |||
| 1573 | Ga0207702_10599964 | |||
| 1574 | Ga0207641_10039866 | |||
| 1575 | Ga0207641_10074128 | |||
| 1576 | Ga0207648_10050017 | |||
| 1577 | Ga0207676_10026997 | |||
| 1578 | Ga0207676_10202150 | |||
| 1579 | Ga0207674_10000027 | |||
| 1580 | Ga0207674_10031858 | |||
| 1581 | Ga0207674_10148676 | |||
| 1582 | Ga0207674_10573973 | |||
| 1583 | Ga0207675_100022932 | |||
| 1584 | Ga0207675_100035155 | |||
| 1585 | Ga0207675_100055459 | |||
| 1586 | Ga0207675_100072240 | |||
| 1587 | Ga0207675_100334795 | |||
| 1588 | Ga0207675_100533719 | |||
| 1589 | Ga0207683_10003345 | |||
| 1590 | Ga0207683_10075214 | |||
| 1591 | Ga0207683_10242210 | |||
| 1592 | Ga0207698_10443139 | |||
| 1593 | Ga0207428_10004650 | |||
| 1594 | Ga0207428_10004915 | |||
| 1595 | Ga0207428_10008457 | |||
| 1596 | Ga0207428_10131306 | |||
| 1597 | Ga0268266_10374255 | |||
| 1598 | Ga0268265_10139413 | |||
| 1599 | Ga0268265_10194679 | |||
| 1600 | Ga0268264_10094623 | |||
| 1601 | Ga0268264_10398409 | |||
| 1602 | Ga0268264_10399007 | |||
| 1603 | Ga0265318_10043065 | |||
| 1604 | Ga0265338_10213949 | |||
| 1605 | Ga0265330_10113409 | |||
| 1606 | Ga0265320_10027982 | |||
| 1607 | Ga0265320_10114764 | |||
| 1608 | Ga0307509_10143914 | |||
| 1609 | Ga0307408_100062499 | |||
| 1610 | Ga0307408_100223902 | |||
| 1611 | Ga0307408_100381496 | |||
| 1612 | Ga0307516_10122094 | |||
| 1613 | Ga0307405_10162603 | |||
| 1614 | Ga0307405_10269931 | |||
| 1615 | Ga0307413_10152232 | |||
| 1616 | Ga0307413_10271995 | |||
| 1617 | Ga0307410_10001030 | |||
| 1618 | Ga0307410_10115410 | |||
| 1619 | Ga0307410_10247219 | |||
| 1620 | Ga0307406_10022836 | |||
| 1621 | Ga0307406_10097344 | |||
| 1622 | Ga0307406_10150211 | |||
| 1623 | Ga0307406_10237307 | |||
| 1624 | Ga0307407_10003918 | |||
| 1625 | Ga0307412_10029424 | |||
| 1626 | Ga0307412_10185573 | |||
| 1627 | Ga0307409_100001173 | |||
| 1628 | Ga0307409_100010612 | |||
| 1629 | Ga0307409_100101217 | |||
| 1630 | Ga0307409_100133967 | |||
| 1631 | Ga0307409_100197084 | |||
| 1632 | Ga0307409_100419197 | |||
| 1633 | Ga0307416_100012514 | |||
| 1634 | Ga0307416_100037944 | |||
| 1635 | Ga0307416_100085840 | |||
| 1636 | Ga0307416_100095823 | |||
| 1637 | Ga0307416_100245547 | |||
| 1638 | Ga0307416_100458081 | |||
| 1639 | Ga0307416_100933001 | |||
| 1640 | Ga0307414_10039403 | |||
| 1641 | Ga0307414_10492283 | |||
| 1642 | Ga0307411_10002120 | |||
| 1643 | Ga0307411_10035200 | |||
| 1644 | Ga0307411_10043543 | |||
| 1645 | Ga0307411_10327393 | |||
| 1646 | Ga0307411_10373579 | |||
| 1647 | Ga0307411_10438531 | |||
| 1648 | Ga0307415_100000052 | |||
| 1649 | Ga0307415_100009472 | |||
| 1650 | Ga0307415_100011962 | |||
| 1651 | Ga0307415_100025582 | |||
| 1652 | Ga0307415_100032717 | |||
| 1653 | Ga0307415_100073483 | |||
| 1654 | Ga0307415_100116849 | |||
| 1655 | Ga0307415_100148397 | |||
| 1656 | Ga0307415_100220930 | |||
| 1657 | Ga0373948_0026830 | |||
| 1658 | Ga0373950_0010229 | |||
| 1659 | Ga0373958_0008183 | |||
| 1660 | Ga0373959_0006166 | |||
| 1661 | Ga0373938_0020211 | |||
| 1662 | Ga0373926_0015314 | |||
| 1663 | Ga0373928_0008617 | |||
| 1664 | Ga0373929_0012525 | |||
| 1665 | Ga0373934_0002560 | |||
| 1666 | Ga0373934_0008140 | |||
| 1667 | Ga0373934_0029791 | |||
| 1668 | Ga0373934_0103309 | |||
| 1669 | Ga0373951_0030540 | |||
| 1670 | Ga0373952_0004407 | |||
| 1671 | Ga0373923_0001781 | |||
| 1672 | Ga0373923_0037537 | |||
| 1673 | Ga0373932_0052797 | |||
| 1674 | Ga0373936_0006172 | |||
| 1675 | Ga0373936_0058738 | |||
| 1676 | Ga0373941_0021950 | |||
| 1677 | Ga0373945_0020919 | |||
| 1678 | Ga0373945_0149810 | |||
| 1679 | Ga0373953_0000098 | |||
| 1680 | Ga0373953_0003311 | |||
| 1681 | Ga0373953_0026809 | |||
| 1682 | Ga0373953_0029025 | |||
| 1683 | Ga0373954_0008625 | |||
| 1684 | Ga0373954_0040016 | |||
| 1685 | Ga0373956_0000476 | |||
| 1686 | Ga0373956_0002164 | |||
| 1687 | Ga0373956_0024982 | |||
| 1688 | Ga0373957_0001091 | |||
| 1689 | Ga0373957_0004904 | |||
| 1690 | Ga0373957_0007936 | |||
| 1691 | Ga0373943_0067404 | |||
| 1692 | Ga0373943_0097553 | |||
| 1693 | Ga0373946_0021191 | |||
| 1694 | Ga0373946_0055198 | |||
| 1695 | Ga0373955_0000004 | |||
| 1696 | Ga0373955_0125453 | |||
| 1697 | Ga0373942_0024833 | |||
| 1698 | Ga0373962_0055601 | |||
| 1699 | Ga0373924_0003964 | |||
| 1700 | Ga0373924_0010887 | |||
| 1701 | Ga0373924_0074021 | |||
| 1702 | Ga0373931_0030843 | |||
| 1703 | Ga0373931_0128112 | |||
| 1704 | Ga0373935_0009714 | |||
| 1705 | Ga0373935_0148967 | |||
| 1706 | Ga0373935_0297995 | |||
| 1707 | Ga0373927_0000061 | |||
| 1708 | Ga0373927_0266894 | |||
| 1709 | Ga0373933_0000005 | |||
| 1710 | Ga0373933_0010757 | |||
| 1711 | Ga0373933_0010966 | |||
| 1712 | Ga0373933_0030598 | |||
| 1713 | Ga0373933_0074812 | |||
| 1714 | Ga0373933_0371032 | |||
| 1715 | Ga0373947_0005352 | |||
| 1716 | Ga0373937_0000077 | |||
| 1717 | Ga0373937_0062752 | |||
| 1718 | Ga0372808_021105 | |||
| 1719 | Ga0373925_0035401 | |||
| 1720 | Ga0373925_0043894 | |||
| 1721 | Ga0373925_0250765 | |||
| 1722 | Ga0395899_0219818 | |||
| 1723 | Ga0395900_0012521 | |||
| 1724 | Ga0395900_0022271 | |||
| 1725 | Ga0395900_0116288 | |||
| 1726 | Ga0395900_0144950 | |||
| 1727 | Ga0395900_0330553 | |||
| 1728 | Ga0395898_0004897 | |||
| 1729 | Ga0395898_0020617 | |||
| 1730 | Ga0395898_0122546 | |||
| 1731 | Ga0395905_0008839 | |||
| 1732 | Ga0395905_0298067 | |||
| 1733 | Ga0395901_0009032 | |||
| 1734 | Ga0395901_0017821 | |||
| 1735 | Ga0395901_0187229 | |||
| 1736 | Ga0395901_0239075 | |||
| 1737 | Ga0395901_0595696 | |||
| 1738 | Ga0436363_0245620 | |||
| 1739 | Ga0436363_0566087 | |||
| 1740 | Ga0439448_0000420 | |||
| 1741 | Ga0439450_000073 | |||
| 1742 | Ga0439454_004566 | |||
| 1743 | Ga0439456_029928 | |||
| 1744 | Ga0439463_000652 | |||
| 1745 | Ga0450914_004130 | |||
| 1746 | Ga0450888_001556 | |||
| 1747 | Ga0439435_0101769 | |||
| 1748 | Ga0439444_0001306 | |||
| 1749 | Ga0439444_0001934 | |||
| 1750 | Ga0439464_0000078 | |||
| 1751 | Ga0439460_0007933 | |||
| 1752 | Ga0451577_0052117 | |||
| 1753 | Ga0451577_0199628 | |||
| 1754 | Ga0451577_0326283 | |||
| 1755 | Ga0451577_0330864 | |||
| 1756 | Ga0439440_0039097 | |||
| 1757 | Ga0453683_0207644 | |||
| 1758 | Ga0466961_0164049 | |||
| 1759 | Ga0466961_0349016 | |||
| 1760 | Ga0466963_0027594 | |||
| 1761 | Ga0453684_0207338 | |||
| 1762 | Ga0453684_0356054 | |||
| 1763 | Ga0453684_0514272 | |||
| 1764 | Ga0453684_0610058 | |||
| 1765 | Ga0466970_0085077 | |||
| 1766 | Ga0466959_0175496 | |||
| 1767 | Ga0466959_0186267 | |||
| 1768 | Ga0451576_0011082 | |||
| 1769 | Ga0451576_0015589 | |||
| 1770 | Ga0451576_0054154 | |||
| 1771 | Ga0451576_0074520 | |||
| 1772 | Ga0451576_0115489 | |||
| 1773 | Ga0451576_0264004 | |||
| 1774 | Ga0451576_0328892 | |||
| 1775 | Ga0466958_0137352 | |||
| 1776 | Ga0466967_0001185 | |||
| 1777 | Ga0466967_0051801 | |||
| 1778 | Ga0466967_0071945 | |||
| 1779 | Ga0466967_0297014 | |||
| 1780 | Ga0466967_0331795 | |||
| 1781 | Ga0495592_0000010 | |||
| 1782 | Ga0495592_0022313 | |||
| 1783 | Ga0495592_0109044 | |||
| 1784 | Ga0495603_0036108 | |||
| 1785 | Ga0495603_0058610 | |||
| 1786 | Ga0495603_0066310 | |||
| 1787 | Ga0495603_0095813 | |||
| 1788 | Ga0495629_0005227 | |||
| 1789 | Ga0495629_0023800 | |||
| 1790 | Ga0495629_0023848 | |||
| 1791 | Ga0495629_0102857 | |||
| 1792 | Ga0495629_0139002 | |||
| 1793 | Ga0495641_0022914 | |||
| 1794 | Ga0495641_0048509 | |||
| 1795 | Ga0495641_0056206 | |||
| 1796 | Ga0495651_0000006 | |||
| 1797 | Ga0495651_0003311 | |||
| 1798 | Ga0495651_0004959 | |||
| 1799 | Ga0495651_0108273 | |||
| 1800 | Ga0495651_0276371 | |||
| 1801 | Ga0495653_0022085 | |||
| 1802 | Ga0495653_0071377 | |||
| 1803 | Ga0495653_0160410 | |||
| 1804 | Ga0495653_0230527 | |||
| 1805 | Ga0495580_0100704 | |||
| 1806 | Ga0495580_0113108 | |||
| 1807 | Ga0495580_0224057 | |||
| 1808 | Ga0495582_0000075 | |||
| 1809 | Ga0495582_0005715 | |||
| 1810 | Ga0495582_0026321 | |||
| 1811 | Ga0495639_0037234 | |||
| 1812 | Ga0495662_0004456 | |||
| 1813 | Ga0495662_0229823 | |||
| 1814 | Ga0495664_0007101 | |||
| 1815 | Ga0495664_0051937 | |||
| 1816 | Ga0495584_0114510 | |||
| 1817 | Ga0495594_0016704 | |||
| 1818 | Ga0495594_0100761 | |||
| 1819 | Ga0495608_0000161 | |||
| 1820 | Ga0495608_0007761 | |||
| 1821 | Ga0495608_0090608 | |||
| 1822 | Ga0495618_0010485 | |||
| 1823 | Ga0495618_0058612 | |||
| 1824 | Ga0495618_0345693 | |||
| 1825 | Ga0495620_0070415 | |||
| 1826 | Ga0495628_0002479 | |||
| 1827 | Ga0495628_0010850 | |||
| 1828 | Ga0495628_0116122 | |||
| 1829 | Ga0495630_0030823 | |||
| 1830 | Ga0495630_0045709 | |||
| 1831 | Ga0495630_0048035 | |||
| 1832 | Ga0495666_0061732 | |||
| 1833 | Ga0495666_0064110 | |||
| 1834 | Ga0495652_0004827 | |||
| 1835 | Ga0495652_0076582 | |||
| 1836 | Ga0495652_0189261 | |||
| 1837 | Ga0495652_0197524 | |||
| 1838 | Ga0495652_0254179 | |||
| 1839 | Ga0495665_0009457 | |||
| 1840 | Ga0495665_0012829 | |||
| 1841 | Ga0495665_0108488 | |||
| 1842 | Ga0495640_0044173 | |||
| 1843 | Ga0495640_0061905 | |||
| 1844 | Ga0495640_0067221 | |||
| 1845 | Ga0495586_0005637 | |||
| 1846 | Ga0495586_0034500 | |||
| 1847 | Ga0495587_0000152 | |||
| 1848 | Ga0495587_0010554 | |||
| 1849 | Ga0495587_0026240 | |||
| 1850 | Ga0495587_0061439 | |||
| 1851 | Ga0495645_0019648 | |||
| 1852 | Ga0495645_0043638 | |||
| 1853 | Ga0495645_0073189 | |||
| 1854 | Ga0495645_0089401 | |||
| 1855 | Ga0495645_0113648 | |||
| 1856 | Ga0495645_0151838 | |||
| 1857 | Ga0495645_0241303 | |||
| 1858 | Ga0495667_0000153 | |||
| 1859 | Ga0495667_0056349 | |||
| 1860 | Ga0495667_0143278 | |||
| 1861 | Ga0495656_0080269 | |||
| 1862 | Ga0495634_0010474 | |||
| 1863 | Ga0495634_0017510 | |||
| 1864 | Ga0495635_0036979 | |||
| 1865 | Ga0495635_0204788 | |||
| 1866 | Ga0495588_0182083 | |||
| 1867 | Ga0495657_0000082 | |||
| 1868 | Ga0495657_0032663 | |||
| 1869 | Ga0495657_0074997 | |||
| 1870 | Ga0495657_0089187 | |||
| 1871 | Ga0495599_0000028 | |||
| 1872 | Ga0495599_0021886 | |||
| 1873 | Ga0495599_0034288 | |||
| 1874 | Ga0495599_0062366 | |||
| 1875 | Ga0495599_0064579 | |||
| 1876 | Ga0495599_0071552 | |||
| 1877 | Ga0495599_0307269 | |||
| 1878 | Ga0495623_0000746 | |||
| 1879 | Ga0495623_0005272 | |||
| 1880 | Ga0495623_0060886 | |||
| 1881 | Ga0495623_0093124 | |||
| 1882 | Ga0495646_0057430 | |||
| 1883 | Ga0495658_0015036 | |||
| 1884 | Ga0495658_0050485 | |||
| 1885 | Ga0495658_0292659 | |||
| 1886 | Ga0495613_0001013 | |||
| 1887 | Ga0495613_0006937 | |||
| 1888 | Ga0495613_0013623 | |||
| 1889 | Ga0495624_0074233 | |||
| 1890 | Ga0495600_0002836 | |||
| 1891 | Ga0495600_0098398 | |||
| 1892 | Ga0495581_0003536 | |||
| 1893 | Ga0495581_0005979 | |||
| 1894 | Ga0495581_0009543 | |||
| 1895 | Ga0495581_0159117 | |||
| 1896 | Ga0495604_0000086 | |||
| 1897 | Ga0495604_0024493 | |||
| 1898 | Ga0495604_0055756 | |||
| 1899 | Ga0495604_0229052 | |||
| 1900 | Ga0495674_0013693 | |||
| 1901 | Ga0495674_0021036 | |||
| 1902 | Ga0495674_0074816 | |||
| 1903 | Ga0495674_0228738 | |||
| 1904 | Ga0495676_0045576 | |||
| 1905 | Ga0495676_0076641 | |||
| 1906 | Ga0495676_0123021 | |||
| 1907 | Ga0495676_0416093 | |||
| 1908 | Ga0495680_0000326 | |||
| 1909 | Ga0495680_0013668 | |||
| 1910 | Ga0495680_0039779 | |||
| 1911 | Ga0495680_0040098 | |||
| 1912 | Ga0495680_0092747 | |||
| 1913 | Ga0495680_0235874 | |||
| 1914 | Ga0495680_0359910 | |||
| 1915 | Ga0495675_0000729 | |||
| 1916 | Ga0495684_0013926 | |||
| 1917 | Ga0495684_0068630 | |||
| 1918 | Ga0495684_0163466 | |||
| 1919 | Ga0495593_0033570 | |||
| 1920 | Ga0495593_0060384 | |||
| 1921 | Ga0495593_0185628 | |||
| 1922 | Ga0495602_0000049 | |||
| 1923 | Ga0495602_0039169 | |||
| 1924 | Ga0495602_0045785 | |||
| 1925 | Ga0495602_0074995 | |||
| 1926 | Ga0495602_0093104 | |||
| 1927 | Ga0495614_0106050 | |||
| 1928 | Ga0496100_0023654 | |||
| 1929 | Ga0496101_0063467 | |||
| 1930 | Ga0496101_0072935 | |||
| 1931 | Ga0496102_0018211 | |||
| 1932 | Ga0496102_0057409 | |||
| 1933 | Ga0496102_0127986 | |||
| 1934 | Ga0496102_0287069 | |||
| 1935 | Ga0496103_0086085 | |||
| 1936 | Ga0496104_0036122 | |||
| 1937 | Ga0496104_0049958 | |||
| 1938 | Ga0496104_0091645 | |||
| 1939 | Ga0496104_0285699 | |||
| 1940 | Ga0496104_0429882 | |||
| 1941 | Ga0496104_0644838 | |||
| 1942 | Ga0496105_0023215 | |||
| 1943 | Ga0496105_0023575 | |||
| 1944 | Ga0496105_0044132 | |||
| 1945 | Ga0496105_0061917 | |||
| 1946 | Ga0496105_0208557 | |||
| 1947 | Ga0496106_0033861 | |||
| 1948 | Ga0496106_0058693 | |||
| 1949 | Ga0496106_0126675 | |||
| 1950 | Ga0496107_0145002 | |||
| 1951 | Ga0496107_0201846 | |||
| 1952 | Ga0496107_0206463 | |||
| 1953 | Ga0496108_0005432 | |||
| 1954 | Ga0496108_0011312 | |||
| 1955 | Ga0496108_0126741 | |||
| 1956 | Ga0496108_0139883 | |||
| 1957 | Ga0496108_0207297 | |||
| 1958 | Ga0496108_0266118 | |||
| 1959 | Ga0496108_0496762 | |||
| 1960 | Ga0496109_0010090 | |||
| 1961 | Ga0496109_0048774 | |||
| 1962 | Ga0496109_0072750 | |||
| 1963 | Ga0496109_0079396 | |||
| 1964 | Ga0496109_0681885 | |||
| 1965 | Ga0496110_0011780 | |||
| 1966 | Ga0496110_0054322 | |||
| 1967 | Ga0496110_0068664 | |||
| 1968 | Ga0496111_0059657 | |||
| 1969 | Ga0496111_0082646 | |||
| 1970 | Ga0496111_0113804 | |||
| 1971 | Ga0496111_0334266 | |||
| 1972 | Ga0496112_0126662 | |||
| 1973 | Ga0496112_0132518 | |||
| 1974 | Ga0496112_0142403 | |||
| 1975 | Ga0496113_0016990 | |||
| 1976 | Ga0496113_0150093 | |||
| 1977 | Ga0496114_0103750 | |||
| 1978 | Ga0496114_0141329 | |||
| 1979 | Ga0496114_0181643 | |||
| 1980 | Ga0496114_0507769 | |||
| 1981 | Ga0496114_0852040 | |||
| 1982 | Ga0496115_0135775 | |||
| 1983 | Ga0501295_025811 | |||
| 1984 | Ga0501031_0021321 | |||
| 1985 | Ga0501033_0009856 | |||
| 1986 | Ga0501033_0225950 | |||
| 1987 | Ga0501033_0313913 | |||
| 1988 | Ga0501034_0652088 | |||
| 1989 | Ga0501036_0035944 | |||
| 1990 | Ga0501037_0085037 | |||
| 1991 | Ga0501038_0204184 | |||
| 1992 | Ga0501038_0310504 | |||
| 1993 | Ga0501039_0003928 | |||
| 1994 | Ga0501039_0009195 | |||
| 1995 | Ga0501039_0117136 | |||
| 1996 | Ga0501039_0275628 | |||
| 1997 | Ga0501040_0015709 | |||
| 1998 | Ga0501041_0002972 | |||
| 1999 | Ga0501041_0026412 | |||
| 2000 | Ga0501041_0030083 | |||
| 2001 | Ga0501042_0006227 | |||
| 2002 | Ga0501042_0008873 | |||
| 2003 | Ga0501042_0013030 | |||
| 2004 | Ga0501042_0106391 | |||
| 2005 | Ga0501043_0069772 | |||
| 2006 | Ga0501043_0214738 | |||
| 2007 | Ga0501046_0008266 | |||
| 2008 | Ga0501046_0188519 | |||
| 2009 | Ga0501046_0260620 | |||
| 2010 | Ga0501048_0038046 | |||
| 2011 | Ga0501048_0372955 | |||
| 2012 | Ga0501067_0002075 | |||
| 2013 | Ga0501067_0016570 | |||
| 2014 | Ga0501069_0042478 | |||
| 2015 | Ga0501071_0037174 | |||
| 2016 | Ga0501071_0100107 | |||
| 2017 | Ga0501071_0192926 | |||
| 2018 | Ga0501072_0085838 | |||
| 2019 | Ga0501072_0173323 | |||
| 2020 | Ga0501074_0021979 | |||
| 2021 | Ga0501074_0023931 | |||
| 2022 | Ga0501074_0061309 | |||
| 2023 | Ga0501075_0004135 | |||
| 2024 | Ga0501075_0022583 | |||
| 2025 | Ga0501075_0179931 | |||
| 2026 | Ga0501075_0291399 | |||
| 2027 | Ga0501075_0401379 | |||
| 2028 | Ga0501075_0414866 | |||
| 2029 | Ga0501075_0721674 | |||
| 2030 | Ga0501076_0004501 | |||
| 2031 | Ga0501076_0053147 | |||
| 2032 | Ga0501076_0164957 | |||
| 2033 | Ga0501076_0196903 | |||
| 2034 | Ga0501076_0265452 | |||
| 2035 | Ga0501077_0012346 | |||
| 2036 | Ga0501077_0284660 | |||
| 2037 | Ga0501243_003069 | |||
| 2038 | Ga0501079_0015229 | |||
| 2039 | Ga0501079_0021616 | |||
| 2040 | Ga0501079_0091515 | |||
| 2041 | Ga0501080_0105263 | |||
| 2042 | Ga0501081_0011034 | |||
| 2043 | Ga0501081_0036702 | |||
| 2044 | Ga0501081_0335965 | |||
| 2045 | Ga0501083_0248931 | |||
| 2046 | Ga0501035_0021576 | |||
| 2047 | Ga0501045_0005664 | |||
| 2048 | Ga0501045_0103538 | |||
| 2049 | Ga0501045_0165412 | |||
| 2050 | Ga0501045_0213297 | |||
| 2051 | Ga0501212_000772 | |||
| 2052 | nmdc:mga05p37_1141_c1 | |||
| 2053 | nmdc:mga05p37_118154_c1 | |||
| 2054 | nmdc:mga05p37_161942_c1 | |||
| 2055 | nmdc:mga05p37_16928_c1 | |||
| 2056 | nmdc:mga05p37_1964_c1 | |||
| 2057 | nmdc:mga05p37_277885_c1 | |||
| 2058 | nmdc:mga05p37_349435_c1 | |||
| 2059 | nmdc:mga05p37_41228_c1 | |||
| 2060 | nmdc:mga05p37_49456_c1 | |||
| 2061 | nmdc:mga05p37_5653_c1 | |||
| 2062 | nmdc:mga05p37_8148_c1 | |||
| 2063 | nmdc:mga09592_11509_c1 | |||
| 2064 | nmdc:mga09592_1637_c1 | |||
| 2065 | nmdc:mga09592_174141_c1 | |||
| 2066 | nmdc:mga09592_18743_c1 | |||
| 2067 | nmdc:mga09592_333926_c1 | |||
| 2068 | nmdc:mga09592_892_c1 | |||
| 2069 | nmdc:mga0qj67_16_c1 | |||
| 2070 | nmdc:mga0qj67_21564_c1 | |||
| 2071 | nmdc:mga0qj67_266485_c1 | |||
| 2072 | nmdc:mga0qj67_380671_c1 | |||
| 2073 | nmdc:mga0qj67_63181_c1 | |||
| 2074 | nmdc:mga06r32_155048_c1 | |||
| 2075 | nmdc:mga06r32_161227_c1 | |||
| 2076 | nmdc:mga06r32_26628_c1 | |||
| 2077 | nmdc:mga06r32_316681_c1 | |||
| 2078 | nmdc:mga06r32_38_c2 | |||
| 2079 | nmdc:mga06r32_493497_c1 | |||
| 2080 | nmdc:mga06r32_8283_c1 | |||
| 2081 | nmdc:mga06r32_828_c1 | |||
| 2082 | nmdc:mga08y16_6021_c1 | |||
| 2083 | nmdc:mga08y16_620152_c1 | |||
| 2084 | nmdc:mga0n895_20705_c1 | |||
| 2085 | nmdc:mga0n895_210487_c1 | |||
| 2086 | nmdc:mga0n895_401947_c1 | |||
| 2087 | nmdc:mga0n895_51309_c1 | |||
| 2088 | nmdc:mga0n895_885976_c1 | |||
| 2089 | nmdc:mga0rr50_130417_c1 | |||
| 2090 | nmdc:mga0rr50_161109_c1 | |||
| 2091 | nmdc:mga0rr50_26502_c1 | |||
| 2092 | nmdc:mga0rr50_38257_c1 | |||
| 2093 | nmdc:mga0rr50_9311_c1 | |||
| 2094 | nmdc:mga08x19_194782_c1 | |||
| 2095 | nmdc:mga08x19_27306_c1 | |||
| 2096 | nmdc:mga08x19_302478_c1 | |||
| 2097 | nmdc:mga08x19_307007_c1 | |||
| 2098 | nmdc:mga0a205_224749_c1 | |||
| 2099 | nmdc:mga0a205_2978_c1 | |||
| 2100 | nmdc:mga0a205_33385_c1 | |||
| 2101 | nmdc:mga0a205_55318_c1 | |||
| 2102 | nmdc:mga0a205_6264_c1 | |||
| 2103 | nmdc:mga0a205_85851_c1 | |||
| 2104 | nmdc:mga0a205_96495_c1 | |||
| 2105 | Ga0495601_0007082 | |||
| 2106 | Ga0495601_0008037 | |||
| 2107 | Ga0495601_0020008 | |||
| 2108 | Ga0495601_0047598 | |||
| 2109 | Ga0495601_0155869 | |||
| 2110 | Ga0495595_0000194 | |||
| 2111 | Ga0495595_0009026 | |||
| 2112 | Ga0495619_0000751 | |||
| 2113 | Ga0495619_0013119 | |||
| 2114 | Ga0500579_108774 | |||
| 2115 | Ga0501084_0007637 | |||
| 2116 | Ga0501084_0055143 | |||
| 2117 | Ga0501084_0621063 | |||
| 2118 | Ga0587083_0046077 | |||
| 2119 | Ga0587094_012693 | |||
| 2120 | Ga0501082_0007351 | |||
| 2121 | Ga0501082_0115459 | |||
| 2122 | Ga0530510_0046728 | |||
| 2123 | Ga0530510_0237721 | |||
| 2124 | Ga0530510_0241243 | |||
| 2125 | 2808873971 | |||
| 2126 | 2816424897 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5cqv-assembly1.cif.gz_B | crystal structure of uncharacterized protein q8dwv2 from streptococcus agalactiae | 0.8114 | 1 | 116 |
| 5cog-assembly1.cif.gz_A | crystal structure of yeast irc4 | 0.8074 | 2 | 152 |
| 5cof-assembly1.cif.gz_A | crystal structure of uncharacterised protein q1r1x2 from escherichia coli uti89 | 0.8026 | 6 | 159 |
| 7mtl-assembly1.cif.gz_B | crystal structure of colibactin self-resistance protein clbs in complex with a dsdna | 0.7949 | 6 | 157 |
| 5civ-assembly1.cif.gz_A | sibling lethal factor precursor - dfsb | 0.7866 | 2 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5cqvB01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8113 | 1 | 116 | 1.20.120.450 |
| 5cogA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8074 | 2 | 152 | 1.20.120.450 |
| 5civA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7725 | 2 | 160 | 1.20.120.450 |
| 2nsgA01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7717 | 6 | 151 | 1.20.120.450 |
| af_Q9VB10_297_412_3.30.1050.10 | Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain | 0.7651 | 183 | 258 | 3.30.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2MMI7-F1-model_v4 | Mycothiol-dependent maleylpyruvate isomerase metal-binding domain-containing protein | 1.001 | 1 | 140 |
GO:0046872
|
| AF-A0A536MH37-F1-model_v4 | Mycothiol-dependent maleylpyruvate isomerase metal-binding domain-containing protein | 0.9876 | 1 | 154 |
GO:0046872
|
| AF-A0A3B9KA84-F1-model_v4 | Mycothiol-dependent maleylpyruvate isomerase metal-binding domain-containing protein | 0.9846 | 1 | 261 |
GO:0046872
|
| AF-A0A3B9KA84-F1-model_v4 | Mycothiol-dependent maleylpyruvate isomerase metal-binding domain-containing protein | 0.9734 | 1 | 261 |
GO:0046872
|
| AF-A0A535ZUC1-F1-model_v4 | Mycothiol-dependent maleylpyruvate isomerase metal-binding domain-containing protein | 0.9721 | 1 | 263 |
GO:0046872
|