F489335

General Info

Members Datasets Scaffolds Average Seq Length
1063 390 2126 271

Family's Representative Sequence

Representative Sequence 3300049582|Ga0501048_0127641|Ga0501048_0127641_616_1569
Length 317
Sequence MAGAENASKVVQDSTSSSFSARRPGTDGVHAATSARQHTDSTIREGDMSGWNAMSYDAKDTILRVVHHEAEQFFDLVDSDDAWESPTGAGHWQVRDLVGHLVDTTEAYFVAFDAARNHAEVDPAWGLPGMAERVDSQAQALRSVPRAELMERLRTDYAKMREIHEGLSEDDWTNLMVPHFYMGPLPAFFYPAFQLMDYGVHSWDVRQGTGRAHGLDGEAADLLAPFMFVLWKYTCDVTGVDPLVLGIRITSGPNAGDTRVSIGDGMDYEPGPVDDLDTVLEFDPGSFVLTAFGRTNAGTIRGDRQRAERYLNLFFRI

Samples

Sample ID Description Type Environment
1 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
135 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
199 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
200 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
201 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
202 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
216 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
217 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
218 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
219 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
220 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
221 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
222 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
223 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
224 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
225 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
226 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
227 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
229 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
231 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
232 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
233 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
234 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
235 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
240 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
241 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
256 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
257 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
258 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
259 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
260 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
261 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
262 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
263 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
264 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
265 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
266 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
267 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
268 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
269 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
270 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
271 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
272 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
273 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
274 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
275 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
276 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
277 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
278 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
279 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
280 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
281 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
287 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
288 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
289 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
292 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
293 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
297 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
298 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
299 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
300 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
301 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
302 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
303 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
304 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
305 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
306 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
307 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
308 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
309 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
310 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
311 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
312 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
313 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
314 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
317 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
320 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
321 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
322 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
323 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
343 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
356 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
357 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
358 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
359 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
360 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
361 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
362 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
363 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
364 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
365 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
366 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
367 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
368 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
371 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
372 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
373 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
374 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
375 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
376 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
377 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
378 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
379 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
380 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
381 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
382 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
383 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
384 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
385 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
388 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
389 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
390 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.3
Metatranscriptomes 4.52
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.09
Nodule 0
Rhizoplane 5.17
Rhizosphere 93.7
Stem 0
Stem Tuber 0
Unclassified 10.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501048_0127641 3300049582 Bacteria 1799
2 SwRhRL3b_contig_3218519 2162886006 Bacteria 2421
3 SwRhRL2b_contig_1162259 2162886007 Bacteria 3264
4 JGI24740J21852_10023551 3300001979 Bacteria 2101
5 JGI24737J22298_10012008 3300001990 Bacteria 2829
6 rootH1_10019379 3300003316 Bacteria 2506
7 JGI25407J50210_10011208 3300003373 Bacteria 2289
8 JGI25407J50210_10014099 3300003373 Bacteria 2059
9 JGI25405J52794_10036385 3300003911 Bacteria 1033
10 Ga0058859_11127628 3300004798 Unclassified 1041
11 Ga0058859_11245634 3300004798 Bacteria 923
12 Ga0058863_10065652 3300004799 Bacteria 1369
13 Ga0058863_11873860 3300004799 Bacteria 1791
14 Ga0058860_11876494 3300004801 Bacteria 1399
15 Ga0058860_12191030 3300004801 Bacteria 1366
16 Ga0058862_10044071 3300004803 Bacteria 955
17 Ga0058862_12728235 3300004803 Bacteria 1436
18 Ga0065704_10000443 3300005289 Bacteria 21010
19 Ga0065704_10167379 3300005289 Bacteria 1314
20 Ga0065715_10342035 3300005293 Bacteria 965
21 Ga0065707_10042627 3300005295 Unclassified 1224
22 Ga0065707_10082128 3300005295 Bacteria 21253
23 Ga0065707_10084513 3300005295 Bacteria 7116
24 Ga0065707_10378474 3300005295 Bacteria 880
25 Ga0070658_10172574 3300005327 Bacteria 1817
26 Ga0070683_100001463 3300005329 Bacteria 18156
27 Ga0070683_100038145 3300005329 Bacteria 4402
28 Ga0070683_100058981 3300005329 Bacteria 3566
29 Ga0070683_100148479 3300005329 Bacteria 2222
30 Ga0070690_100203160 3300005330 Bacteria 1380
31 Ga0068869_100066263 3300005334 Bacteria 2660
32 Ga0070666_10080692 3300005335 Bacteria 2224
33 Ga0070680_100351199 3300005336 Bacteria 1254
34 Ga0070680_100399281 3300005336 Bacteria 1172
35 Ga0070682_100053961 3300005337 Bacteria 2520
36 Ga0068868_100085535 3300005338 Bacteria 2534
37 Ga0068868_100086786 3300005338 Bacteria 2516
38 Ga0070660_100109482 3300005339 Bacteria 2196
39 Ga0070691_10003974 3300005341 Bacteria 6691
40 Ga0070691_10220315 3300005341 Bacteria 1005
41 Ga0070687_100048363 3300005343 Bacteria 2187
42 Ga0070661_100373922 3300005344 Bacteria 1122
43 Ga0070692_10135552 3300005345 Bacteria 1388
44 Ga0070692_10141485 3300005345 Bacteria 1362
45 Ga0070668_100016228 3300005347 Bacteria 5571
46 Ga0070668_100032036 3300005347 Bacteria 4000
47 Ga0070668_100166430 3300005347 Bacteria 1792
48 Ga0070674_100039737 3300005356 Bacteria 3178
49 Ga0070673_100335295 3300005364 Bacteria 1339
50 Ga0070673_100444409 3300005364 Bacteria 1165
51 Ga0070659_100073205 3300005366 Bacteria 2727
52 Ga0070667_100131393 3300005367 Bacteria 2186
53 Ga0070703_10021242 3300005406 Bacteria 1896
54 Ga0070703_10043785 3300005406 Unclassified 1405
55 Ga0070709_10001473 3300005434 Bacteria 12696
56 Ga0070709_10099741 3300005434 Unclassified 1932
57 Ga0070709_10290597 3300005434 Bacteria 1191
58 Ga0070714_100054899 3300005435 Bacteria 3404
59 Ga0070714_100093225 3300005435 Bacteria 2640
60 Ga0070713_100002567 3300005436 Bacteria 11865
61 Ga0070713_100003245 3300005436 Bacteria 10725
62 Ga0070713_100050234 3300005436 Bacteria 3444
63 Ga0070713_100080951 3300005436 Bacteria 2770
64 Ga0070710_10011620 3300005437 Bacteria 4354
65 Ga0070710_10013826 3300005437 Bacteria 4051
66 Ga0070710_10070994 3300005437 Bacteria 2007
67 Ga0070701_10147901 3300005438 Bacteria 1350
68 Ga0070711_100020123 3300005439 Bacteria 4295
69 Ga0070705_100085368 3300005440 Bacteria 1951
70 Ga0070705_100216461 3300005440 Bacteria 1323
71 Ga0070705_100559881 3300005440 Bacteria 878
72 Ga0070700_100061066 3300005441 Unclassified 2377
73 Ga0070700_100106135 3300005441 Unclassified 1859
74 Ga0070700_100449571 3300005441 Bacteria 980
75 Ga0070694_100015334 3300005444 Bacteria 4811
76 Ga0070694_100118132 3300005444 Bacteria 1899
77 Ga0070708_100001090 3300005445 Bacteria 20733
78 Ga0070708_100038294 3300005445 Bacteria 4189
79 Ga0070708_100091089 3300005445 Bacteria 2776
80 Ga0070663_100292785 3300005455 Bacteria 1301
81 Ga0070678_100002797 3300005456 Bacteria 9643
82 Ga0070678_100039449 3300005456 Bacteria 3332
83 Ga0070662_100018037 3300005457 Bacteria 4768
84 Ga0070662_100027333 3300005457 Bacteria 3959
85 Ga0068867_100586713 3300005459 Bacteria 970
86 Ga0070706_100000133 3300005467 Bacteria 92343
87 Ga0070706_100001026 3300005467 Bacteria 30302
88 Ga0070706_100002668 3300005467 Bacteria 17864
89 Ga0070706_100004689 3300005467 Bacteria 13110
90 Ga0070706_100005186 3300005467 Bacteria 12436
91 Ga0070706_100005303 3300005467 Bacteria 12288
92 Ga0070706_100011788 3300005467 Bacteria 8115
93 Ga0070706_100016224 3300005467 Bacteria 6880
94 Ga0070706_100041377 3300005467 Bacteria 4255
95 Ga0070706_100098838 3300005467 Bacteria 2712
96 Ga0070706_100246921 3300005467 Bacteria 1666
97 Ga0070707_100000176 3300005468 Bacteria 62533
98 Ga0070707_100000482 3300005468 Bacteria 39396
99 Ga0070707_100002121 3300005468 Bacteria 18983
100 Ga0070707_100044337 3300005468 Bacteria 4258
101 Ga0070707_100050312 3300005468 Bacteria 3994
102 Ga0070707_100284807 3300005468 Bacteria 1606
103 Ga0070707_100328884 3300005468 Bacteria 1485
104 Ga0070698_100000504 3300005471 Bacteria 41462
105 Ga0070698_100001605 3300005471 Bacteria 25142
106 Ga0070698_100004911 3300005471 Bacteria 14664
107 Ga0070698_100023430 3300005471 Bacteria 6455
108 Ga0070698_100047461 3300005471 Unclassified 4389
109 Ga0070698_100048921 3300005471 Bacteria 4319
110 Ga0070698_100054317 3300005471 Unclassified 4067
111 Ga0070698_100063492 3300005471 Bacteria 3724
112 Ga0070698_100078994 3300005471 Unclassified 3287
113 Ga0070698_100106743 3300005471 Bacteria 2769
114 Ga0070698_100128866 3300005471 Bacteria 2486
115 Ga0070698_100169437 3300005471 Bacteria 2125
116 Ga0070698_100285628 3300005471 Unclassified 1581
117 Ga0070698_100306172 3300005471 Bacteria 1520
118 Ga0070699_100001393 3300005518 Bacteria 22220
119 Ga0070699_100017628 3300005518 Bacteria 6130
120 Ga0070699_100035425 3300005518 Bacteria 4315
121 Ga0070699_100386048 3300005518 Unclassified 1265
122 Ga0070679_100279964 3300005530 Bacteria 1621
123 Ga0070679_100705210 3300005530 Unclassified 952
124 Ga0070684_100013071 3300005535 Bacteria 6681
125 Ga0070684_100021280 3300005535 Bacteria 5394
126 Ga0070684_100044362 3300005535 Bacteria 3846
127 Ga0070684_100251078 3300005535 Bacteria 1617
128 Ga0070697_100047108 3300005536 Bacteria 3496
129 Ga0070697_100063907 3300005536 Bacteria 3006
130 Ga0068853_100023449 3300005539 Bacteria 5167
131 Ga0070686_100033047 3300005544 Bacteria 3176
132 Ga0070695_100033414 3300005545 Bacteria 3218
133 Ga0070695_100109668 3300005545 Bacteria 1871
134 Ga0070693_100014606 3300005547 Bacteria 4027
135 Ga0070665_100152693 3300005548 Unclassified 2312
136 Ga0070704_100025909 3300005549 Unclassified 3866
137 Ga0070704_100127325 3300005549 Bacteria 1967
138 Ga0070704_100219037 3300005549 Bacteria 1546
139 Ga0070704_100324057 3300005549 Bacteria 1292
140 Ga0068855_100170763 3300005563 Bacteria 2463
141 Ga0068855_100456238 3300005563 Bacteria 1394
142 Ga0068855_100719510 3300005563 Bacteria 1067
143 Ga0070664_100089036 3300005564 Bacteria 2670
144 Ga0068857_100012182 3300005577 Bacteria 7479
145 Ga0068857_100047229 3300005577 Bacteria 3822
146 Ga0068857_100136943 3300005577 Bacteria 2211
147 Ga0068857_100146642 3300005577 Bacteria 2135
148 Ga0068854_100249383 3300005578 Bacteria 1417
149 Ga0068856_100008570 3300005614 Bacteria 9941
150 Ga0068856_100093626 3300005614 Bacteria 2990
151 Ga0068856_100154674 3300005614 Bacteria 2303
152 Ga0068856_100459260 3300005614 Bacteria 1294
153 Ga0068856_100521932 3300005614 Bacteria 1209
154 Ga0070702_100029371 3300005615 Bacteria 2989
155 Ga0070702_100066630 3300005615 Bacteria 2112
156 Ga0068852_100147377 3300005616 Bacteria 2185
157 Ga0068852_100239563 3300005616 Bacteria 1733
158 Ga0068852_100521273 3300005616 Bacteria 1186
159 Ga0068859_100135213 3300005617 Unclassified 2538
160 Ga0068859_100176563 3300005617 Bacteria 2218
161 Ga0068859_100228649 3300005617 Unclassified 1948
162 Ga0068859_100323170 3300005617 Bacteria 1637
163 Ga0068859_100386100 3300005617 Unclassified 1496
164 Ga0068864_100040044 3300005618 Unclassified 4008
165 Ga0068864_100057065 3300005618 Bacteria 3373
166 Ga0068866_10018127 3300005718 Bacteria 3179
167 Ga0068866_10155721 3300005718 Bacteria 1328
168 Ga0068861_100028205 3300005719 Bacteria 4096
169 Ga0068861_100261811 3300005719 Bacteria 1481
170 Ga0068861_100431161 3300005719 Bacteria 1177
171 Ga0068861_100618789 3300005719 Bacteria 996
172 Ga0068870_10124351 3300005840 Bacteria 1490
173 Ga0068863_100048931 3300005841 Bacteria 4008
174 Ga0068863_100223278 3300005841 Bacteria 1815
175 Ga0068858_100017789 3300005842 Bacteria 6655
176 Ga0068858_100493276 3300005842 Unclassified 1183
177 Ga0068860_100044534 3300005843 Bacteria 4229
178 Ga0068860_100082290 3300005843 Bacteria 3062
179 Ga0068862_100213665 3300005844 Bacteria 1744
180 Ga0081455_10001196 3300005937 Bacteria 32499
181 Ga0081455_10001884 3300005937 Bacteria 25242
182 Ga0081455_10012456 3300005937 Bacteria 8486
183 Ga0081455_10018256 3300005937 Bacteria 6691
184 Ga0081455_10028069 3300005937 Bacteria 5146
185 Ga0081455_10083346 3300005937 Bacteria 2613
186 Ga0081455_10093872 3300005937 Bacteria 2425
187 Ga0081455_10110766 3300005937 Bacteria 2182
188 Ga0081455_10112369 3300005937 Bacteria 2162
189 Ga0081538_10000439 3300005981 Bacteria 46752
190 Ga0081538_10001065 3300005981 Bacteria 29204
191 Ga0081538_10001354 3300005981 Bacteria 25218
192 Ga0081538_10011651 3300005981 Bacteria 7109
193 Ga0081538_10015961 3300005981 Bacteria 5785
194 Ga0081540_1000548 3300005983 Bacteria 36395
195 Ga0081540_1001646 3300005983 Bacteria 19006
196 Ga0081540_1004092 3300005983 Bacteria 11272
197 Ga0081539_10002659 3300005985 Bacteria 24348
198 Ga0081539_10007525 3300005985 Bacteria 9874
199 Ga0081539_10015493 3300005985 Bacteria 5535
200 Ga0081539_10040406 3300005985 Bacteria 2738
201 Ga0081539_10083931 3300005985 Bacteria 1666
202 Ga0070717_10005187 3300006028 Bacteria 9494
203 Ga0070717_10020265 3300006028 Bacteria 5226
204 Ga0070717_10023959 3300006028 Bacteria 4842
205 Ga0070717_10066162 3300006028 Bacteria 3005
206 Ga0070717_10084658 3300006028 Bacteria 2668
207 Ga0070717_10139646 3300006028 Bacteria 2089
208 Ga0070717_10177239 3300006028 Bacteria 1856
209 Ga0070717_10203592 3300006028 Bacteria 1734
210 Ga0070717_10392219 3300006028 Bacteria 1246
211 Ga0075432_10000582 3300006058 Bacteria 11034
212 Ga0075432_10009306 3300006058 Bacteria 3345
213 Ga0075432_10014210 3300006058 Bacteria 2711
214 Ga0075432_10112641 3300006058 Bacteria 1015
215 Ga0070715_10018496 3300006163 Bacteria 2656
216 Ga0070715_10024955 3300006163 Bacteria 2363
217 Ga0070715_10041051 3300006163 Bacteria 1937
218 Ga0070715_10078330 3300006163 Bacteria 1494
219 Ga0070716_100009210 3300006173 Bacteria 4917
220 Ga0070716_100010044 3300006173 Bacteria 4736
221 Ga0070716_100131084 3300006173 Unclassified 1585
222 Ga0070712_100001569 3300006175 Bacteria 13979
223 Ga0070712_100050373 3300006175 Bacteria 2897
224 Ga0070712_100140132 3300006175 Bacteria 1844
225 Ga0097621_100043256 3300006237 Bacteria 3631
226 Ga0097621_100678527 3300006237 Bacteria 947
227 Ga0068871_100065716 3300006358 Bacteria 2971
228 Ga0068871_100116068 3300006358 Bacteria 2257
229 Ga0075428_100007986 3300006844 Bacteria 11738
230 Ga0075428_100008346 3300006844 Bacteria 11486
231 Ga0075428_100009860 3300006844 Bacteria 10615
232 Ga0075428_100016309 3300006844 Bacteria 8211
233 Ga0075428_100038679 3300006844 Bacteria 5250
234 Ga0075428_100042899 3300006844 Bacteria 4973
235 Ga0075428_100048687 3300006844 Bacteria 4652
236 Ga0075428_100085874 3300006844 Bacteria 3432
237 Ga0075428_100146659 3300006844 Bacteria 2565
238 Ga0075428_100639506 3300006844 Bacteria 1135
239 Ga0075430_100015845 3300006846 Bacteria 6420
240 Ga0075430_100023142 3300006846 Bacteria 5284
241 Ga0075430_100071533 3300006846 Bacteria 2910
242 Ga0075430_100131707 3300006846 Bacteria 2084
243 Ga0075430_100139107 3300006846 Bacteria 2022
244 Ga0075430_100387034 3300006846 Bacteria 1154
245 Ga0075431_100000655 3300006847 Bacteria 29411
246 Ga0075431_100022463 3300006847 Bacteria 6449
247 Ga0075431_100032343 3300006847 Bacteria 5391
248 Ga0075431_100033074 3300006847 Bacteria 5329
249 Ga0075431_100037463 3300006847 Bacteria 4995
250 Ga0075431_100061596 3300006847 Bacteria 3872
251 Ga0075433_10003360 3300006852 Bacteria 12371
252 Ga0075433_10003786 3300006852 Bacteria 11716
253 Ga0075433_10023330 3300006852 Bacteria 5206
254 Ga0075433_10034761 3300006852 Bacteria 4331
255 Ga0075433_10142843 3300006852 Bacteria 2128
256 Ga0075434_100001264 3300006871 Bacteria 21084
257 Ga0075434_100001550 3300006871 Bacteria 19467
258 Ga0075434_100107566 3300006871 Bacteria 2799
259 Ga0075434_100146637 3300006871 Bacteria 2380
260 Ga0075434_100269903 3300006871 Bacteria 1721
261 Ga0075429_100008172 3300006880 Bacteria 9094
262 Ga0075429_100008208 3300006880 Bacteria 9078
263 Ga0075429_100018033 3300006880 Bacteria 6105
264 Ga0075429_100166692 3300006880 Bacteria 1930
265 Ga0068865_100031722 3300006881 Bacteria 3524
266 Ga0068865_100038579 3300006881 Bacteria 3235
267 Ga0068865_100194569 3300006881 Bacteria 1571
268 Ga0075436_100006661 3300006914 Bacteria 7910
269 Ga0075436_100045437 3300006914 Bacteria 3029
270 Ga0075436_100165604 3300006914 Unclassified 1559
271 Ga0075436_100333801 3300006914 Bacteria 1091
272 Ga0097620_100135201 3300006931 Unclassified 2538
273 Ga0097620_100176573 3300006931 Bacteria 2218
274 Ga0097620_100228643 3300006931 Unclassified 1948
275 Ga0097620_100323215 3300006931 Bacteria 1637
276 Ga0097620_100386092 3300006931 Unclassified 1496
277 Ga0075435_100009058 3300007076 Bacteria 7181
278 Ga0075435_100011330 3300007076 Bacteria 6554
279 Ga0075435_100017976 3300007076 Bacteria 5361
280 Ga0075435_100051730 3300007076 Bacteria 3309
281 Ga0075435_100103768 3300007076 Bacteria 2358
282 Ga0075435_100139160 3300007076 Unclassified 2036
283 Ga0099794_10028699 3300007265 Bacteria 2588
284 Ga0105251_10036355 3300009011 Bacteria 2424
285 Ga0105250_10122292 3300009092 Unclassified 1071
286 Ga0105240_10129005 3300009093 Bacteria 3035
287 Ga0105240_10500448 3300009093 Bacteria 1351
288 Ga0111539_10013335 3300009094 Bacteria 10269
289 Ga0111539_10016681 3300009094 Bacteria 9103
290 Ga0111539_10022795 3300009094 Bacteria 7691
291 Ga0111539_10049222 3300009094 Bacteria 5027
292 Ga0111539_10123155 3300009094 Bacteria 3039
293 Ga0111539_10746873 3300009094 Bacteria 1139
294 Ga0105245_10064523 3300009098 Bacteria 3309
295 Ga0105245_10091645 3300009098 Bacteria 2797
296 Ga0105245_10115806 3300009098 Bacteria 2498
297 Ga0105245_10252344 3300009098 Bacteria 1714
298 Ga0105247_10047818 3300009101 Bacteria 2628
299 Ga0105247_10061923 3300009101 Bacteria 2321
300 Ga0114129_10000001 3300009147 Bacteria 292978
301 Ga0114129_10014817 3300009147 Bacteria 11110
302 Ga0114129_10020866 3300009147 Bacteria 9306
303 Ga0114129_10057681 3300009147 Bacteria 5432
304 Ga0114129_10061210 3300009147 Bacteria 5261
305 Ga0114129_10128003 3300009147 Bacteria 3490
306 Ga0114129_10175588 3300009147 Bacteria 2918
307 Ga0114129_10439754 3300009147 Bacteria 1712
308 Ga0114129_10466871 3300009147 Unclassified 1653
309 Ga0114129_10548149 3300009147 Bacteria 1504
310 Ga0114129_10635947 3300009147 Bacteria 1379
311 Ga0114129_11074077 3300009147 Unclassified 1009
312 Ga0105243_10029951 3300009148 Bacteria 4188
313 Ga0105243_10061693 3300009148 Bacteria 2999
314 Ga0105243_10200834 3300009148 Unclassified 1748
315 Ga0105243_10269413 3300009148 Bacteria 1528
316 Ga0105243_10300372 3300009148 Unclassified 1455
317 Ga0105243_10423931 3300009148 Bacteria 1242
318 Ga0105241_10334586 3300009174 Bacteria 1310
319 Ga0105242_10062568 3300009176 Bacteria 3063
320 Ga0105242_10063619 3300009176 Bacteria 3038
321 Ga0105242_10231475 3300009176 Bacteria 1656
322 Ga0105248_10048664 3300009177 Bacteria 4755
323 Ga0105237_10082395 3300009545 Bacteria 3208
324 Ga0105237_10147209 3300009545 Bacteria 2350
325 Ga0105237_10841571 3300009545 Unclassified 924
326 Ga0105238_10192416 3300009551 Bacteria 2016
327 Ga0105238_10327346 3300009551 Bacteria 1519
328 Ga0105249_10011082 3300009553 Bacteria 7922
329 Ga0105249_10016717 3300009553 Bacteria 6511
330 Ga0105249_10101795 3300009553 Bacteria 2702
331 Ga0105249_10128128 3300009553 Bacteria 2419
332 Ga0105249_10181487 3300009553 Bacteria 2048
333 Ga0105249_10286900 3300009553 Bacteria 1646
334 Ga0105249_10581335 3300009553 Bacteria 1173
335 Ga0105239_10041362 3300010375 Bacteria 5052
336 Ga0105239_10105558 3300010375 Bacteria 3120
337 Ga0105239_10333823 3300010375 Bacteria 1710
338 Ga0105239_10857719 3300010375 Bacteria 1042
339 Ga0105246_10029979 3300011119 Bacteria 3588
340 Ga0105246_10081269 3300011119 Bacteria 2309
341 Ga0105246_10131506 3300011119 Bacteria 1870
342 Ga0105246_10256181 3300011119 Bacteria 1391
343 Ga0157342_1001407 3300012507 Bacteria 1774
344 Ga0157371_10047334 3300013102 Bacteria 3057
345 Ga0157370_10030431 3300013104 Bacteria 5289
346 Ga0157370_10031855 3300013104 Bacteria 5154
347 Ga0157369_10104551 3300013105 Bacteria 3015
348 Ga0157369_10283506 3300013105 Bacteria 1725
349 Ga0157369_10311175 3300013105 Bacteria 1638
350 Ga0157374_10204473 3300013296 Bacteria 1935
351 Ga0157378_10066752 3300013297 Bacteria 3223
352 Ga0163162_10037844 3300013306 Bacteria 4815
353 Ga0163162_10061652 3300013306 Bacteria 3788
354 Ga0163162_10336865 3300013306 Bacteria 1641
355 Ga0157372_10107151 3300013307 Bacteria 3197
356 Ga0157372_10346051 3300013307 Bacteria 1732
357 Ga0157372_10346404 3300013307 Bacteria 1731
358 Ga0157372_10752836 3300013307 Unclassified 1133
359 Ga0157375_10024766 3300013308 Bacteria 5561
360 Ga0157375_10061677 3300013308 Bacteria 3724
361 Ga0157375_10453848 3300013308 Unclassified 1447
362 Ga0157375_10505561 3300013308 Unclassified 1372
363 Ga0163163_10039330 3300014325 Bacteria 4616
364 Ga0157380_10039401 3300014326 Bacteria 3674
365 Ga0157380_10519153 3300014326 Bacteria 1161
366 Ga0157377_10030312 3300014745 Bacteria 2929
367 Ga0157377_10348536 3300014745 Unclassified 993
368 Ga0157379_10006261 3300014968 Bacteria 10247
369 Ga0157376_10056136 3300014969 Bacteria 3288
370 Ga0157376_10273349 3300014969 Bacteria 1588
371 Ga0163161_10034708 3300017792 Bacteria 3609
372 Ga0163161_10499746 3300017792 Bacteria 990
373 Ga0197907_10225339 3300020069 Bacteria 1898
374 Ga0197907_10277679 3300020069 Unclassified 1192
375 Ga0197907_10470509 3300020069 Bacteria 3082
376 Ga0197907_10902623 3300020069 Bacteria 1641
377 Ga0197907_10984839 3300020069 Bacteria 1412
378 Ga0197907_11257832 3300020069 Bacteria 1324
379 Ga0206356_10106052 3300020070 Bacteria 3240
380 Ga0206356_10216668 3300020070 Unclassified 1166
381 Ga0206356_10369112 3300020070 Bacteria 1566
382 Ga0206356_11428032 3300020070 Bacteria 1391
383 Ga0206356_11705868 3300020070 Bacteria 1575
384 Ga0206349_1134039 3300020075 Unclassified 2305
385 Ga0206349_1818514 3300020075 Bacteria 2418
386 Ga0206349_1860141 3300020075 Bacteria 983
387 Ga0206355_1105940 3300020076 Bacteria 1915
388 Ga0206355_1206412 3300020076 Unclassified 1225
389 Ga0206351_10249285 3300020077 Unclassified 2795
390 Ga0206352_10264739 3300020078 Unclassified 1098
391 Ga0206352_10356421 3300020078 Bacteria 1497
392 Ga0206352_11336596 3300020078 Bacteria 2059
393 Ga0206350_10060753 3300020080 Unclassified 1700
394 Ga0206350_11219577 3300020080 Bacteria 1449
395 Ga0206350_11605962 3300020080 Bacteria 1394
396 Ga0206354_10160929 3300020081 Bacteria 1671
397 Ga0206354_10370402 3300020081 Bacteria 2428
398 Ga0206354_10745353 3300020081 Bacteria 3216
399 Ga0206354_10799651 3300020081 Bacteria 1070
400 Ga0206354_10812046 3300020081 Bacteria 4298
401 Ga0206353_10443559 3300020082 Bacteria 1617
402 Ga0206353_11296763 3300020082 Bacteria 6061
403 Ga0206353_11527532 3300020082 Bacteria 3426
404 Ga0224712_10002553 3300022467 Bacteria 4522
405 Ga0224712_10038090 3300022467 Bacteria 1794
406 Ga0224712_10050539 3300022467 Bacteria 1615
407 Ga0224712_10050926 3300022467 Bacteria 1610
408 Ga0224712_10124253 3300022467 Bacteria 1121
409 Ga0224712_10182993 3300022467 Bacteria 945
410 Ga0207653_10002312 3300025885 Bacteria 6083
411 Ga0207692_10004841 3300025898 Bacteria 5357
412 Ga0207692_10008731 3300025898 Bacteria 4207
413 Ga0207692_10123019 3300025898 Bacteria 1455
414 Ga0207642_10036679 3300025899 Bacteria 2106
415 Ga0207642_10108366 3300025899 Bacteria 1409
416 Ga0207710_10023890 3300025900 Bacteria 2629
417 Ga0207710_10098798 3300025900 Bacteria 1374
418 Ga0207688_10008232 3300025901 Bacteria 5667
419 Ga0207688_10010597 3300025901 Bacteria 5012
420 Ga0207647_10029303 3300025904 Bacteria 3564
421 Ga0207647_10092248 3300025904 Unclassified 1806
422 Ga0207685_10019314 3300025905 Bacteria 2244
423 Ga0207685_10105909 3300025905 Bacteria 1211
424 Ga0207699_10000555 3300025906 Bacteria 18421
425 Ga0207699_10000761 3300025906 Bacteria 15434
426 Ga0207699_10013524 3300025906 Bacteria 4181
427 Ga0207643_10021911 3300025908 Bacteria 3515
428 Ga0207705_10127895 3300025909 Bacteria 1889
429 Ga0207684_10000599 3300025910 Bacteria 43115
430 Ga0207684_10000967 3300025910 Bacteria 32207
431 Ga0207684_10004345 3300025910 Bacteria 13386
432 Ga0207684_10005872 3300025910 Bacteria 11241
433 Ga0207684_10029194 3300025910 Bacteria 4698
434 Ga0207684_10040664 3300025910 Archaea 3941
435 Ga0207684_10052390 3300025910 Bacteria 3463
436 Ga0207684_10072216 3300025910 Bacteria 2931
437 Ga0207684_10151658 3300025910 Bacteria 1994
438 Ga0207684_10193035 3300025910 Unclassified 1756
439 Ga0207654_10284717 3300025911 Bacteria 1119
440 Ga0207707_10229702 3300025912 Bacteria 1614
441 Ga0207693_10003808 3300025915 Bacteria 12843
442 Ga0207693_10004257 3300025915 Bacteria 12135
443 Ga0207693_10033975 3300025915 Bacteria 4023
444 Ga0207663_10007144 3300025916 Bacteria 5772
445 Ga0207660_10080792 3300025917 Unclassified 2388
446 Ga0207660_10447139 3300025917 Bacteria 1045
447 Ga0207662_10018897 3300025918 Bacteria 3915
448 Ga0207657_10015063 3300025919 Bacteria 7510
449 Ga0207652_10163623 3300025921 Bacteria 1995
450 Ga0207652_10401552 3300025921 Unclassified 1237
451 Ga0207646_10000811 3300025922 Bacteria 40685
452 Ga0207646_10001035 3300025922 Bacteria 35522
453 Ga0207646_10005172 3300025922 Bacteria 13799
454 Ga0207646_10011107 3300025922 Bacteria 8743
455 Ga0207646_10018172 3300025922 Bacteria 6563
456 Ga0207646_10033193 3300025922 Bacteria 4670
457 Ga0207646_10082229 3300025922 Bacteria 2880
458 Ga0207646_10451654 3300025922 Bacteria 1160
459 Ga0207694_10531306 3300025924 Bacteria 986
460 Ga0207687_10057200 3300025927 Bacteria 2739
461 Ga0207687_10057371 3300025927 Bacteria 2736
462 Ga0207687_10182847 3300025927 Bacteria 1625
463 Ga0207687_10333491 3300025927 Bacteria 1231
464 Ga0207700_10000558 3300025928 Bacteria 21900
465 Ga0207700_10001918 3300025928 Bacteria 11831
466 Ga0207700_10015157 3300025928 Bacteria 5073
467 Ga0207700_10028862 3300025928 Bacteria 3909
468 Ga0207700_10159812 3300025928 Bacteria 1870
469 Ga0207700_10191567 3300025928 Unclassified 1718
470 Ga0207664_10000706 3300025929 Bacteria 22745
471 Ga0207664_10001977 3300025929 Bacteria 13492
472 Ga0207664_10060803 3300025929 Bacteria 3012
473 Ga0207664_10071738 3300025929 Bacteria 2791
474 Ga0207664_10403723 3300025929 Unclassified 1216
475 Ga0207644_10378990 3300025931 Bacteria 1153
476 Ga0207690_10026581 3300025932 Bacteria 3645
477 Ga0207706_10003790 3300025933 Bacteria 14412
478 Ga0207706_10106062 3300025933 Bacteria 2472
479 Ga0207686_10471239 3300025934 Unclassified 969
480 Ga0207709_10122771 3300025935 Bacteria 1757
481 Ga0207709_10267893 3300025935 Bacteria 1256
482 Ga0207709_10357011 3300025935 Unclassified 1105
483 Ga0207670_10173436 3300025936 Bacteria 1619
484 Ga0207704_10022983 3300025938 Bacteria 3352
485 Ga0207704_10144409 3300025938 Bacteria 1669
486 Ga0207665_10014174 3300025939 Bacteria 5244
487 Ga0207665_10015571 3300025939 Bacteria 4990
488 Ga0207665_10030098 3300025939 Bacteria 3588
489 Ga0207711_10188364 3300025941 Bacteria 1879
490 Ga0207689_10116786 3300025942 Bacteria 2193
491 Ga0207661_10071498 3300025944 Bacteria 2835
492 Ga0207661_10181619 3300025944 Bacteria 1838
493 Ga0207661_10291623 3300025944 Bacteria 1460
494 Ga0207679_10069465 3300025945 Bacteria 2651
495 Ga0207667_10176433 3300025949 Bacteria 2195
496 Ga0207651_10406415 3300025960 Bacteria 1159
497 Ga0207712_10032779 3300025961 Bacteria 3508
498 Ga0207668_10100897 3300025972 Bacteria 2144
499 Ga0207640_10123158 3300025981 Unclassified 1862
500 Ga0207703_10066359 3300026035 Bacteria 2968
501 Ga0207703_10504975 3300026035 Bacteria 1135
502 Ga0207639_10028967 3300026041 Bacteria 4049
503 Ga0207639_10048520 3300026041 Bacteria 3214
504 Ga0207678_10010009 3300026067 Bacteria 8321
505 Ga0207708_10140368 3300026075 Bacteria 1895
506 Ga0207708_10156618 3300026075 Bacteria 1796
507 Ga0207702_10013876 3300026078 Bacteria 6692
508 Ga0207702_10042023 3300026078 Bacteria 3834
509 Ga0207702_10203834 3300026078 Unclassified 1835
510 Ga0207702_10599964 3300026078 Bacteria 1080
511 Ga0207641_10039866 3300026088 Bacteria 3930
512 Ga0207641_10074128 3300026088 Bacteria 2935
513 Ga0207648_10050017 3300026089 Bacteria 3656
514 Ga0207676_10026997 3300026095 Bacteria 4273
515 Ga0207676_10202150 3300026095 Bacteria 1756
516 Ga0207674_10000027 3300026116 Bacteria 150200
517 Ga0207674_10031858 3300026116 Bacteria 5534
518 Ga0207674_10148676 3300026116 Bacteria 2300
519 Ga0207674_10573973 3300026116 Bacteria 1089
520 Ga0207675_100022932 3300026118 Bacteria 5806
521 Ga0207675_100035155 3300026118 Bacteria 4674
522 Ga0207675_100055459 3300026118 Bacteria 3697
523 Ga0207675_100072240 3300026118 Bacteria 3227
524 Ga0207675_100334795 3300026118 Bacteria 1480
525 Ga0207675_100533719 3300026118 Unclassified 1171
526 Ga0207683_10003345 3300026121 Bacteria 13979
527 Ga0207683_10075214 3300026121 Bacteria 2989
528 Ga0207683_10242210 3300026121 Bacteria 1645
529 Ga0207698_10443139 3300026142 Bacteria 1252
530 Ga0207428_10004650 3300027907 Bacteria 13003
531 Ga0207428_10004915 3300027907 Bacteria 12600
532 Ga0207428_10008457 3300027907 Bacteria 9292
533 Ga0207428_10131306 3300027907 Bacteria 1916
534 Ga0268266_10374255 3300028379 Bacteria 1342
535 Ga0268265_10139413 3300028380 Bacteria 2028
536 Ga0268265_10194679 3300028380 Bacteria 1754
537 Ga0268264_10094623 3300028381 Bacteria 2583
538 Ga0268264_10398409 3300028381 Bacteria 1322
539 Ga0268264_10399007 3300028381 Bacteria 1321
540 Ga0265318_10043065 3300028577 Unclassified 1711
541 Ga0265338_10213949 3300028800 Unclassified 1445
542 Ga0265330_10113409 3300031235 Unclassified 1157
543 Ga0265320_10027982 3300031240 Unclassified 2932
544 Ga0265320_10114764 3300031240 Unclassified 1232
545 Ga0307509_10143914 3300031507 Bacteria 2314
546 Ga0307408_100062499 3300031548 Bacteria 2721
547 Ga0307408_100223902 3300031548 Bacteria 1536
548 Ga0307408_100381496 3300031548 Bacteria 1205
549 Ga0307516_10122094 3300031730 Bacteria 2393
550 Ga0307405_10162603 3300031731 Bacteria 1583
551 Ga0307405_10269931 3300031731 Unclassified 1275
552 Ga0307413_10152232 3300031824 Bacteria 1613
553 Ga0307413_10271995 3300031824 Unclassified 1269
554 Ga0307410_10001030 3300031852 Bacteria 12093
555 Ga0307410_10115410 3300031852 Bacteria 1949
556 Ga0307410_10247219 3300031852 Unclassified 1385
557 Ga0307406_10022836 3300031901 Bacteria 3715
558 Ga0307406_10097344 3300031901 Bacteria 1995
559 Ga0307406_10150211 3300031901 Bacteria 1661
560 Ga0307406_10237307 3300031901 Bacteria 1365
561 Ga0307407_10003918 3300031903 Bacteria 6213
562 Ga0307412_10029424 3300031911 Bacteria 3447
563 Ga0307412_10185573 3300031911 Bacteria 1568
564 Ga0307409_100001173 3300031995 Bacteria 12513
565 Ga0307409_100010612 3300031995 Bacteria 5741
566 Ga0307409_100101217 3300031995 Bacteria 2390
567 Ga0307409_100133967 3300031995 Bacteria 2122
568 Ga0307409_100197084 3300031995 Unclassified 1798
569 Ga0307409_100419197 3300031995 Bacteria 1284
570 Ga0307416_100012514 3300032002 Bacteria 5719
571 Ga0307416_100037944 3300032002 Bacteria 3712
572 Ga0307416_100085840 3300032002 Bacteria 2680
573 Ga0307416_100095823 3300032002 Bacteria 2564
574 Ga0307416_100245547 3300032002 Bacteria 1738
575 Ga0307416_100458081 3300032002 Bacteria 1330
576 Ga0307416_100933001 3300032002 Unclassified 969
577 Ga0307414_10039403 3300032004 Bacteria 3182
578 Ga0307414_10492283 3300032004 Unclassified 1083
579 Ga0307411_10002120 3300032005 Bacteria 8578
580 Ga0307411_10035200 3300032005 Bacteria 3124
581 Ga0307411_10043543 3300032005 Bacteria 2872
582 Ga0307411_10327393 3300032005 Bacteria 1240
583 Ga0307411_10373579 3300032005 Unclassified 1170
584 Ga0307411_10438531 3300032005 Bacteria 1089
585 Ga0307415_100000052 3300032126 Bacteria 50285
586 Ga0307415_100009472 3300032126 Bacteria 5463
587 Ga0307415_100011962 3300032126 Bacteria 4996
588 Ga0307415_100025582 3300032126 Bacteria 3707
589 Ga0307415_100032717 3300032126 Bacteria 3367
590 Ga0307415_100073483 3300032126 Bacteria 2413
591 Ga0307415_100116849 3300032126 Bacteria 1991
592 Ga0307415_100148397 3300032126 Bacteria 1801
593 Ga0307415_100220930 3300032126 Unclassified 1519
594 Ga0373948_0026830 3300034817 Bacteria 1137
595 Ga0373950_0010229 3300034818 Bacteria 1512
596 Ga0373958_0008183 3300034819 Bacteria 1688
597 Ga0373959_0006166 3300034820 Bacteria 1984
598 Ga0373938_0020211 3300034957 Bacteria 1339
599 Ga0373926_0015314 3300035083 Bacteria 2614
600 Ga0373928_0008617 3300035084 Bacteria 1982
601 Ga0373929_0012525 3300035085 Bacteria 1613
602 Ga0373934_0002560 3300035086 Bacteria 6689
603 Ga0373934_0008140 3300035086 Bacteria 3904
604 Ga0373934_0029791 3300035086 Bacteria 2133
605 Ga0373934_0103309 3300035086 Unclassified 1152
606 Ga0373951_0030540 3300035091 Bacteria 1268
607 Ga0373952_0004407 3300035092 Bacteria 2554
608 Ga0373923_0001781 3300035111 Bacteria 6347
609 Ga0373923_0037537 3300035111 Bacteria 1982
610 Ga0373932_0052797 3300035112 Bacteria 1211
611 Ga0373936_0006172 3300035113 Bacteria 4516
612 Ga0373936_0058738 3300035113 Bacteria 1566
613 Ga0373941_0021950 3300035115 Bacteria 1807
614 Ga0373945_0020919 3300035116 Bacteria 2244
615 Ga0373945_0149810 3300035116 Bacteria 945
616 Ga0373953_0000098 3300035117 Bacteria 21032
617 Ga0373953_0003311 3300035117 Bacteria 5001
618 Ga0373953_0026809 3300035117 Bacteria 2210
619 Ga0373953_0029025 3300035117 Bacteria 2137
620 Ga0373954_0008625 3300035118 Bacteria 4482
621 Ga0373954_0040016 3300035118 Bacteria 2183
622 Ga0373956_0000476 3300035119 Bacteria 16441
623 Ga0373956_0002164 3300035119 Bacteria 8113
624 Ga0373956_0024982 3300035119 Bacteria 2579
625 Ga0373957_0001091 3300035120 Bacteria 7175
626 Ga0373957_0004904 3300035120 Bacteria 4110
627 Ga0373957_0007936 3300035120 Bacteria 3417
628 Ga0373943_0067404 3300035170 Bacteria 1805
629 Ga0373943_0097553 3300035170 Bacteria 1531
630 Ga0373946_0021191 3300035171 Bacteria 2518
631 Ga0373946_0055198 3300035171 Bacteria 1674
632 Ga0373955_0000004 3300035172 Bacteria 108650
633 Ga0373955_0125453 3300035172 Bacteria 1495
634 Ga0373942_0024833 3300035207 Bacteria 1540
635 Ga0373962_0055601 3300035242 Unclassified 1150
636 Ga0373924_0003964 3300035410 Bacteria 5137
637 Ga0373924_0010887 3300035410 Bacteria 3367
638 Ga0373924_0074021 3300035410 Unclassified 1440
639 Ga0373931_0030843 3300035691 Bacteria 2762
640 Ga0373931_0128112 3300035691 Bacteria 1458
641 Ga0373935_0009714 3300035692 Bacteria 5760
642 Ga0373935_0148967 3300035692 Bacteria 1586
643 Ga0373935_0297995 3300035692 Bacteria 1139
644 Ga0373927_0000061 3300035695 Bacteria 77622
645 Ga0373927_0266894 3300035695 Bacteria 1125
646 Ga0373933_0000005 3300035724 Bacteria 128820
647 Ga0373933_0010757 3300035724 Bacteria 5021
648 Ga0373933_0010966 3300035724 Bacteria 4977
649 Ga0373933_0030598 3300035724 Bacteria 3117
650 Ga0373933_0074812 3300035724 Bacteria 2066
651 Ga0373933_0371032 3300035724 Unclassified 931
652 Ga0373947_0005352 3300035725 Bacteria 7493
653 Ga0373937_0000077 3300036401 Bacteria 89075
654 Ga0373937_0062752 3300036401 Bacteria 3416
655 Ga0372808_021105 3300036459 Bacteria 936
656 Ga0373925_0035401 3300037068 Bacteria 3683
657 Ga0373925_0043894 3300037068 Bacteria 3319
658 Ga0373925_0250765 3300037068 Bacteria 1419
659 Ga0395899_0219818 3300037312 Bacteria 1316
660 Ga0395900_0012521 3300037418 Bacteria 8677
661 Ga0395900_0022271 3300037418 Bacteria 6483
662 Ga0395900_0116288 3300037418 Bacteria 2744
663 Ga0395900_0144950 3300037418 Bacteria 2429
664 Ga0395900_0330553 3300037418 Bacteria 1502
665 Ga0395898_0004897 3300037466 Bacteria 14537
666 Ga0395898_0020617 3300037466 Bacteria 6695
667 Ga0395898_0122546 3300037466 Bacteria 2491
668 Ga0395905_0008839 3300037471 Bacteria 9899
669 Ga0395905_0298067 3300037471 Bacteria 1499
670 Ga0395901_0009032 3300038443 Bacteria 10091
671 Ga0395901_0017821 3300038443 Bacteria 7247
672 Ga0395901_0187229 3300038443 Bacteria 2171
673 Ga0395901_0239075 3300038443 Bacteria 1894
674 Ga0395901_0595696 3300038443 Bacteria 1115
675 Ga0436363_0245620 3300039450 Bacteria 1084
676 Ga0436363_0566087 3300039450 Bacteria 2328
677 Ga0439448_0000420 3300042005 Bacteria 9732
678 Ga0439450_000073 3300042008 Bacteria 9571
679 Ga0439454_004566 3300042011 Bacteria 1605
680 Ga0439456_029928 3300042013 Bacteria 1164
681 Ga0439463_000652 3300042016 Bacteria 9616
682 Ga0450914_004130 3300042118 Bacteria 1160
683 Ga0450888_001556 3300042126 Bacteria 2211
684 Ga0439435_0101769 3300042436 Bacteria 884
685 Ga0439444_0001306 3300042437 Bacteria 3185
686 Ga0439444_0001934 3300042437 Bacteria 2763
687 Ga0439464_0000078 3300042439 Bacteria 13860
688 Ga0439460_0007933 3300042461 Bacteria 2670
689 Ga0451577_0052117 3300042876 Bacteria 3654
690 Ga0451577_0199628 3300042876 Bacteria 1806
691 Ga0451577_0326283 3300042876 Unclassified 1392
692 Ga0451577_0330864 3300042876 Bacteria 1382
693 Ga0439440_0039097 3300042993 Bacteria 1150
694 Ga0453683_0207644 3300044673 Unclassified 1244
695 Ga0466961_0164049 3300044693 Bacteria 1384
696 Ga0466961_0349016 3300044693 Bacteria 901
697 Ga0466963_0027594 3300044694 Bacteria 3637
698 Ga0453684_0207338 3300044712 Unclassified 2281
699 Ga0453684_0356054 3300044712 Unclassified 1649
700 Ga0453684_0514272 3300044712 Bacteria 1324
701 Ga0453684_0610058 3300044712 Unclassified 1195
702 Ga0466970_0085077 3300044765 Bacteria 1713
703 Ga0466959_0175496 3300045049 Bacteria 1501
704 Ga0466959_0186267 3300045049 Bacteria 1450
705 Ga0451576_0011082 3300045051 Bacteria 10287
706 Ga0451576_0015589 3300045051 Bacteria 8413
707 Ga0451576_0054154 3300045051 Bacteria 4201
708 Ga0451576_0074520 3300045051 Unclassified 3532
709 Ga0451576_0115489 3300045051 Bacteria 2794
710 Ga0451576_0264004 3300045051 Bacteria 1800
711 Ga0451576_0328892 3300045051 Unclassified 1600
712 Ga0466958_0137352 3300045836 Bacteria 1538
713 Ga0466967_0001185 3300045976 Bacteria 14632
714 Ga0466967_0051801 3300045976 Bacteria 3600
715 Ga0466967_0071945 3300045976 Bacteria 3097
716 Ga0466967_0297014 3300045976 Bacteria 1553
717 Ga0466967_0331795 3300045976 Bacteria 1469
718 Ga0495592_0000010 3300046454 Bacteria 157001
719 Ga0495592_0022313 3300046454 Bacteria 4816
720 Ga0495592_0109044 3300046454 Bacteria 1961
721 Ga0495603_0036108 3300046455 Bacteria 2967
722 Ga0495603_0058610 3300046455 Bacteria 2276
723 Ga0495603_0066310 3300046455 Bacteria 2126
724 Ga0495603_0095813 3300046455 Bacteria 1734
725 Ga0495629_0005227 3300046459 Bacteria 9711
726 Ga0495629_0023800 3300046459 Bacteria 4361
727 Ga0495629_0023848 3300046459 Bacteria 4357
728 Ga0495629_0102857 3300046459 Unclassified 1993
729 Ga0495629_0139002 3300046459 Bacteria 1690
730 Ga0495641_0022914 3300046461 Bacteria 3114
731 Ga0495641_0048509 3300046461 Bacteria 1947
732 Ga0495641_0056206 3300046461 Unclassified 1784
733 Ga0495651_0000006 3300046462 Bacteria 171575
734 Ga0495651_0003311 3300046462 Bacteria 12370
735 Ga0495651_0004959 3300046462 Bacteria 10167
736 Ga0495651_0108273 3300046462 Bacteria 2058
737 Ga0495651_0276371 3300046462 Unclassified 1136
738 Ga0495653_0022085 3300046463 Bacteria 5150
739 Ga0495653_0071377 3300046463 Bacteria 2596
740 Ga0495653_0160410 3300046463 Bacteria 1561
741 Ga0495653_0230527 3300046463 Bacteria 1239
742 Ga0495580_0100704 3300046472 Bacteria 2009
743 Ga0495580_0113108 3300046472 Bacteria 1885
744 Ga0495580_0224057 3300046472 Bacteria 1292
745 Ga0495582_0000075 3300046473 Bacteria 49940
746 Ga0495582_0005715 3300046473 Bacteria 6927
747 Ga0495582_0026321 3300046473 Bacteria 3188
748 Ga0495639_0037234 3300046475 Bacteria 2181
749 Ga0495662_0004456 3300046476 Bacteria 7035
750 Ga0495662_0229823 3300046476 Bacteria 914
751 Ga0495664_0007101 3300046477 Bacteria 6206
752 Ga0495664_0051937 3300046477 Bacteria 2434
753 Ga0495584_0114510 3300046491 Bacteria 1365
754 Ga0495594_0016704 3300046499 Bacteria 3869
755 Ga0495594_0100761 3300046499 Bacteria 1625
756 Ga0495608_0000161 3300046511 Bacteria 47857
757 Ga0495608_0007761 3300046511 Bacteria 7556
758 Ga0495608_0090608 3300046511 Bacteria 1978
759 Ga0495618_0010485 3300046514 Bacteria 5606
760 Ga0495618_0058612 3300046514 Bacteria 2439
761 Ga0495618_0345693 3300046514 Unclassified 917
762 Ga0495620_0070415 3300046515 Unclassified 1433
763 Ga0495628_0002479 3300046516 Bacteria 16630
764 Ga0495628_0010850 3300046516 Bacteria 7712
765 Ga0495628_0116122 3300046516 Bacteria 2055
766 Ga0495630_0030823 3300046517 Bacteria 3991
767 Ga0495630_0045709 3300046517 Bacteria 3272
768 Ga0495630_0048035 3300046517 Bacteria 3194
769 Ga0495666_0061732 3300046526 Bacteria 1790
770 Ga0495666_0064110 3300046526 Bacteria 1754
771 Ga0495652_0004827 3300046529 Bacteria 12820
772 Ga0495652_0076582 3300046529 Bacteria 2774
773 Ga0495652_0189261 3300046529 Bacteria 1572
774 Ga0495652_0197524 3300046529 Bacteria 1529
775 Ga0495652_0254179 3300046529 Bacteria 1300
776 Ga0495665_0009457 3300046531 Bacteria 5275
777 Ga0495665_0012829 3300046531 Bacteria 4534
778 Ga0495665_0108488 3300046531 Bacteria 1456
779 Ga0495640_0044173 3300046533 Bacteria 3099
780 Ga0495640_0061905 3300046533 Bacteria 2540
781 Ga0495640_0067221 3300046533 Bacteria 2414
782 Ga0495586_0005637 3300046535 Bacteria 6690
783 Ga0495586_0034500 3300046535 Bacteria 2718
784 Ga0495587_0000152 3300046536 Bacteria 51432
785 Ga0495587_0010554 3300046536 Bacteria 5875
786 Ga0495587_0026240 3300046536 Bacteria 3553
787 Ga0495587_0061439 3300046536 Bacteria 2201
788 Ga0495645_0019648 3300046543 Bacteria 4866
789 Ga0495645_0043638 3300046543 Unclassified 3271
790 Ga0495645_0073189 3300046543 Bacteria 2468
791 Ga0495645_0089401 3300046543 Bacteria 2202
792 Ga0495645_0113648 3300046543 Bacteria 1914
793 Ga0495645_0151838 3300046543 Unclassified 1608
794 Ga0495645_0241303 3300046543 Bacteria 1205
795 Ga0495667_0000153 3300046559 Bacteria 46974
796 Ga0495667_0056349 3300046559 Bacteria 2584
797 Ga0495667_0143278 3300046559 Bacteria 1539
798 Ga0495656_0080269 3300046615 Bacteria 1471
799 Ga0495634_0010474 3300046642 Bacteria 6789
800 Ga0495634_0017510 3300046642 Bacteria 5110
801 Ga0495635_0036979 3300046663 Bacteria 3380
802 Ga0495635_0204788 3300046663 Bacteria 1337
803 Ga0495588_0182083 3300046674 Bacteria 1110
804 Ga0495657_0000082 3300046675 Bacteria 85101
805 Ga0495657_0032663 3300046675 Bacteria 3630
806 Ga0495657_0074997 3300046675 Bacteria 2199
807 Ga0495657_0089187 3300046675 Bacteria 1981
808 Ga0495599_0000028 3300046678 Bacteria 113952
809 Ga0495599_0021886 3300046678 Bacteria 3991
810 Ga0495599_0034288 3300046678 Bacteria 3189
811 Ga0495599_0062366 3300046678 Bacteria 2329
812 Ga0495599_0064579 3300046678 Bacteria 2286
813 Ga0495599_0071552 3300046678 Bacteria 2164
814 Ga0495599_0307269 3300046678 Bacteria 956
815 Ga0495623_0000746 3300046679 Bacteria 21773
816 Ga0495623_0005272 3300046679 Bacteria 8478
817 Ga0495623_0060886 3300046679 Bacteria 2368
818 Ga0495623_0093124 3300046679 Bacteria 1845
819 Ga0495646_0057430 3300046680 Unclassified 2329
820 Ga0495658_0015036 3300046683 Bacteria 3965
821 Ga0495658_0050485 3300046683 Bacteria 2353
822 Ga0495658_0292659 3300046683 Unclassified 1029
823 Ga0495613_0001013 3300046689 Bacteria 21355
824 Ga0495613_0006937 3300046689 Bacteria 8448
825 Ga0495613_0013623 3300046689 Bacteria 6034
826 Ga0495624_0074233 3300046690 Bacteria 2113
827 Ga0495600_0002836 3300046809 Bacteria 10086
828 Ga0495600_0098398 3300046809 Bacteria 1907
829 Ga0495581_0003536 3300047315 Bacteria 8971
830 Ga0495581_0005979 3300047315 Bacteria 7049
831 Ga0495581_0009543 3300047315 Bacteria 5614
832 Ga0495581_0159117 3300047315 Bacteria 1320
833 Ga0495604_0000086 3300047317 Bacteria 79200
834 Ga0495604_0024493 3300047317 Bacteria 4815
835 Ga0495604_0055756 3300047317 Bacteria 3045
836 Ga0495604_0229052 3300047317 Unclassified 1276
837 Ga0495674_0013693 3300047319 Bacteria 7619
838 Ga0495674_0021036 3300047319 Bacteria 6036
839 Ga0495674_0074816 3300047319 Bacteria 2915
840 Ga0495674_0228738 3300047319 Bacteria 1535
841 Ga0495676_0045576 3300047321 Bacteria 3568
842 Ga0495676_0076641 3300047321 Bacteria 2552
843 Ga0495676_0123021 3300047321 Bacteria 1884
844 Ga0495676_0416093 3300047321 Bacteria 890
845 Ga0495680_0000326 3300047322 Bacteria 53618
846 Ga0495680_0013668 3300047322 Bacteria 7069
847 Ga0495680_0039779 3300047322 Bacteria 3748
848 Ga0495680_0040098 3300047322 Bacteria 3731
849 Ga0495680_0092747 3300047322 Bacteria 2261
850 Ga0495680_0235874 3300047322 Unclassified 1301
851 Ga0495680_0359910 3300047322 Bacteria 1011
852 Ga0495675_0000729 3300047444 Bacteria 20553
853 Ga0495684_0013926 3300047471 Bacteria 6186
854 Ga0495684_0068630 3300047471 Bacteria 2695
855 Ga0495684_0163466 3300047471 Bacteria 1659
856 Ga0495593_0033570 3300047673 Bacteria 2794
857 Ga0495593_0060384 3300047673 Bacteria 1985
858 Ga0495593_0185628 3300047673 Bacteria 1047
859 Ga0495602_0000049 3300048088 Bacteria 114354
860 Ga0495602_0039169 3300048088 Bacteria 4369
861 Ga0495602_0045785 3300048088 Bacteria 3956
862 Ga0495602_0074995 3300048088 Bacteria 2872
863 Ga0495602_0093104 3300048088 Bacteria 2494
864 Ga0495614_0106050 3300048089 Bacteria 1231
865 Ga0496100_0023654 3300048903 Bacteria 3736
866 Ga0496101_0063467 3300048904 Bacteria 2689
867 Ga0496101_0072935 3300048904 Bacteria 2521
868 Ga0496102_0018211 3300048905 Bacteria 6165
869 Ga0496102_0057409 3300048905 Bacteria 3554
870 Ga0496102_0127986 3300048905 Bacteria 2375
871 Ga0496102_0287069 3300048905 Bacteria 1551
872 Ga0496103_0086085 3300048906 Bacteria 1981
873 Ga0496104_0036122 3300048907 Bacteria 4616
874 Ga0496104_0049958 3300048907 Bacteria 3945
875 Ga0496104_0091645 3300048907 Bacteria 2905
876 Ga0496104_0285699 3300048907 Bacteria 1562
877 Ga0496104_0429882 3300048907 Bacteria 1232
878 Ga0496104_0644838 3300048907 Unclassified 968
879 Ga0496105_0023215 3300048908 Bacteria 5029
880 Ga0496105_0023575 3300048908 Bacteria 4992
881 Ga0496105_0044132 3300048908 Bacteria 3676
882 Ga0496105_0061917 3300048908 Bacteria 3088
883 Ga0496105_0208557 3300048908 Bacteria 1593
884 Ga0496106_0033861 3300048909 Bacteria 3814
885 Ga0496106_0058693 3300048909 Bacteria 2913
886 Ga0496106_0126675 3300048909 Bacteria 2000
887 Ga0496107_0145002 3300048910 Bacteria 1755
888 Ga0496107_0201846 3300048910 Archaea 1478
889 Ga0496107_0206463 3300048910 Bacteria 1460
890 Ga0496108_0005432 3300048911 Bacteria 10297
891 Ga0496108_0011312 3300048911 Bacteria 7250
892 Ga0496108_0126741 3300048911 Bacteria 2192
893 Ga0496108_0139883 3300048911 Bacteria 2085
894 Ga0496108_0207297 3300048911 Bacteria 1701
895 Ga0496108_0266118 3300048911 Bacteria 1492
896 Ga0496108_0496762 3300048911 Bacteria 1066
897 Ga0496109_0010090 3300048912 Bacteria 8059
898 Ga0496109_0048774 3300048912 Bacteria 3853
899 Ga0496109_0072750 3300048912 Bacteria 3158
900 Ga0496109_0079396 3300048912 Bacteria 3023
901 Ga0496109_0681885 3300048912 Bacteria 965
902 Ga0496110_0011780 3300048913 Bacteria 7177
903 Ga0496110_0054322 3300048913 Bacteria 3523
904 Ga0496110_0068664 3300048913 Bacteria 3137
905 Ga0496111_0059657 3300048914 Bacteria 2765
906 Ga0496111_0082646 3300048914 Bacteria 2346
907 Ga0496111_0113804 3300048914 Bacteria 1994
908 Ga0496111_0334266 3300048914 Bacteria 1122
909 Ga0496112_0126662 3300048915 Bacteria 2524
910 Ga0496112_0132518 3300048915 Bacteria 2463
911 Ga0496112_0142403 3300048915 Bacteria 2367
912 Ga0496113_0016990 3300048916 Bacteria 5039
913 Ga0496113_0150093 3300048916 Bacteria 1838
914 Ga0496114_0103750 3300048917 Bacteria 2430
915 Ga0496114_0141329 3300048917 Bacteria 2084
916 Ga0496114_0181643 3300048917 Bacteria 1837
917 Ga0496114_0507769 3300048917 Bacteria 1066
918 Ga0496114_0852040 3300048917 Bacteria 791
919 Ga0496115_0135775 3300048918 Unclassified 2028
920 Ga0501295_025811 3300049518 Bacteria 1119
921 Ga0501031_0021321 3300049568 Bacteria 4224
922 Ga0501033_0009856 3300049570 Bacteria 7330
923 Ga0501033_0225950 3300049570 Bacteria 1331
924 Ga0501033_0313913 3300049570 Bacteria 1102
925 Ga0501034_0652088 3300049571 Bacteria 954
926 Ga0501036_0035944 3300049572 Bacteria 4191
927 Ga0501037_0085037 3300049573 Bacteria 2290
928 Ga0501038_0204184 3300049574 Bacteria 1584
929 Ga0501038_0310504 3300049574 Bacteria 1236
930 Ga0501039_0003928 3300049575 Bacteria 11173
931 Ga0501039_0009195 3300049575 Bacteria 7531
932 Ga0501039_0117136 3300049575 Bacteria 2086
933 Ga0501039_0275628 3300049575 Bacteria 1322
934 Ga0501040_0015709 3300049576 Bacteria 5005
935 Ga0501041_0002972 3300049577 Bacteria 9718
936 Ga0501041_0026412 3300049577 Bacteria 3493
937 Ga0501041_0030083 3300049577 Bacteria 3278
938 Ga0501042_0006227 3300049578 Bacteria 7746
939 Ga0501042_0008873 3300049578 Bacteria 6667
940 Ga0501042_0013030 3300049578 Bacteria 5650
941 Ga0501042_0106391 3300049578 Bacteria 2019
942 Ga0501043_0069772 3300049579 Bacteria 2761
943 Ga0501043_0214738 3300049579 Bacteria 1490
944 Ga0501046_0008266 3300049580 Bacteria 9086
945 Ga0501046_0188519 3300049580 Bacteria 1539
946 Ga0501046_0260620 3300049580 Bacteria 1274
947 Ga0501048_0038046 3300049582 Bacteria 3454
948 Ga0501048_0372955 3300049582 Unclassified 1018
949 Ga0501067_0002075 3300049583 Bacteria 11034
950 Ga0501067_0016570 3300049583 Bacteria 4073
951 Ga0501069_0042478 3300049585 Bacteria 2515
952 Ga0501071_0037174 3300049587 Bacteria 3475
953 Ga0501071_0100107 3300049587 Bacteria 2136
954 Ga0501071_0192926 3300049587 Unclassified 1528
955 Ga0501072_0085838 3300049588 Bacteria 2497
956 Ga0501072_0173323 3300049588 Unclassified 1721
957 Ga0501074_0021979 3300049590 Bacteria 4633
958 Ga0501074_0023931 3300049590 Bacteria 4438
959 Ga0501074_0061309 3300049590 Unclassified 2710
960 Ga0501075_0004135 3300049591 Bacteria 9799
961 Ga0501075_0022583 3300049591 Bacteria 4597
962 Ga0501075_0179931 3300049591 Bacteria 1613
963 Ga0501075_0291399 3300049591 Bacteria 1243
964 Ga0501075_0401379 3300049591 Bacteria 1045
965 Ga0501075_0414866 3300049591 Unclassified 1027
966 Ga0501075_0721674 3300049591 Unclassified 759
967 Ga0501076_0004501 3300049592 Bacteria 9927
968 Ga0501076_0053147 3300049592 Bacteria 3209
969 Ga0501076_0164957 3300049592 Bacteria 1805
970 Ga0501076_0196903 3300049592 Bacteria 1645
971 Ga0501076_0265452 3300049592 Unclassified 1406
972 Ga0501077_0012346 3300049593 Bacteria 5351
973 Ga0501077_0284660 3300049593 Unclassified 1052
974 Ga0501243_003069 3300049675 Bacteria 2465
975 Ga0501079_0015229 3300049741 Bacteria 5866
976 Ga0501079_0021616 3300049741 Bacteria 4922
977 Ga0501079_0091515 3300049741 Bacteria 2357
978 Ga0501080_0105263 3300049742 Unclassified 2616
979 Ga0501081_0011034 3300049743 Bacteria 5907
980 Ga0501081_0036702 3300049743 Bacteria 3342
981 Ga0501081_0335965 3300049743 Unclassified 1112
982 Ga0501083_0248931 3300049744 Unclassified 1157
983 Ga0501035_0021576 3300049822 Bacteria 5922
984 Ga0501045_0005664 3300049824 Bacteria 8643
985 Ga0501045_0103538 3300049824 Unclassified 2108
986 Ga0501045_0165412 3300049824 Bacteria 1647
987 Ga0501045_0213297 3300049824 Bacteria 1438
988 Ga0501212_000772 3300049851 Bacteria 3313
989 nmdc:mga05p37_1141_c1 3300050507 Bacteria 30525
990 nmdc:mga05p37_118154_c1 3300050507 Bacteria 3258
991 nmdc:mga05p37_161942_c1 3300050507 Bacteria 2732
992 nmdc:mga05p37_16928_c1 3300050507 Bacteria 8790
993 nmdc:mga05p37_1964_c1 3300050507 Bacteria 23980
994 nmdc:mga05p37_277885_c1 3300050507 Unclassified 1998
995 nmdc:mga05p37_349435_c1 3300050507 Bacteria 1741
996 nmdc:mga05p37_41228_c1 3300050507 Bacteria 5669
997 nmdc:mga05p37_49456_c1 3300050507 Bacteria 5171
998 nmdc:mga05p37_5653_c1 3300050507 Bacteria 14704
999 nmdc:mga05p37_8148_c1 3300050507 Bacteria 12387
1000 nmdc:mga09592_11509_c1 3300050508 Bacteria 7199
1001 nmdc:mga09592_1637_c1 3300050508 Bacteria 18036
1002 nmdc:mga09592_174141_c1 3300050508 Bacteria 1861
1003 nmdc:mga09592_18743_c1 3300050508 Bacteria 5676
1004 nmdc:mga09592_333926_c1 3300050508 Bacteria 1312
1005 nmdc:mga09592_892_c1 3300050508 Bacteria 23407
1006 nmdc:mga0qj67_16_c1 3300050509 Bacteria 124323
1007 nmdc:mga0qj67_21564_c1 3300050509 Bacteria 4942
1008 nmdc:mga0qj67_266485_c1 3300050509 Bacteria 1389
1009 nmdc:mga0qj67_380671_c1 3300050509 Unclassified 1140
1010 nmdc:mga0qj67_63181_c1 3300050509 Bacteria 2944
1011 nmdc:mga06r32_155048_c1 3300050510 Bacteria 2271
1012 nmdc:mga06r32_161227_c1 3300050510 Bacteria 2225
1013 nmdc:mga06r32_26628_c1 3300050510 Bacteria 5394
1014 nmdc:mga06r32_316681_c1 3300050510 Bacteria 1546
1015 nmdc:mga06r32_38_c2 3300050510 Bacteria 21664
1016 nmdc:mga06r32_493497_c1 3300050510 Unclassified 1202
1017 nmdc:mga06r32_8283_c1 3300050510 Bacteria 9359
1018 nmdc:mga06r32_828_c1 3300050510 Bacteria 27433
1019 nmdc:mga08y16_6021_c1 3300050511 Bacteria 12712
1020 nmdc:mga08y16_620152_c1 3300050511 Bacteria 1089
1021 nmdc:mga0n895_20705_c1 3300050512 Bacteria 6140
1022 nmdc:mga0n895_210487_c1 3300050512 Bacteria 1975
1023 nmdc:mga0n895_401947_c1 3300050512 Bacteria 1385
1024 nmdc:mga0n895_51309_c1 3300050512 Bacteria 4047
1025 nmdc:mga0n895_885976_c1 3300050512 Bacteria 878
1026 nmdc:mga0rr50_130417_c1 3300050513 Unclassified 2012
1027 nmdc:mga0rr50_161109_c1 3300050513 Unclassified 1821
1028 nmdc:mga0rr50_26502_c1 3300050513 Bacteria 4046
1029 nmdc:mga0rr50_38257_c1 3300050513 Bacteria 3470
1030 nmdc:mga0rr50_9311_c1 3300050513 Bacteria 6170
1031 nmdc:mga08x19_194782_c1 3300050514 Unclassified 1388
1032 nmdc:mga08x19_27306_c1 3300050514 Bacteria 3569
1033 nmdc:mga08x19_302478_c1 3300050514 Bacteria 1111
1034 nmdc:mga08x19_307007_c1 3300050514 Bacteria 1103
1035 nmdc:mga0a205_224749_c1 3300050515 Unclassified 1762
1036 nmdc:mga0a205_2978_c1 3300050515 Bacteria 13608
1037 nmdc:mga0a205_33385_c1 3300050515 Bacteria 4935
1038 nmdc:mga0a205_55318_c1 3300050515 Bacteria 3833
1039 nmdc:mga0a205_6264_c1 3300050515 Bacteria 10741
1040 nmdc:mga0a205_85851_c1 3300050515 Bacteria 3039
1041 nmdc:mga0a205_96495_c1 3300050515 Bacteria 2855
1042 Ga0495601_0007082 3300053077 Bacteria 6570
1043 Ga0495601_0008037 3300053077 Bacteria 6217
1044 Ga0495601_0020008 3300053077 Bacteria 4085
1045 Ga0495601_0047598 3300053077 Bacteria 2700
1046 Ga0495601_0155869 3300053077 Bacteria 1491
1047 Ga0495595_0000194 3300053084 Bacteria 24737
1048 Ga0495595_0009026 3300053084 Bacteria 4117
1049 Ga0495619_0000751 3300053085 Bacteria 21143
1050 Ga0495619_0013119 3300053085 Bacteria 5222
1051 Ga0500579_108774 3300053143 Bacteria 1406
1052 Ga0501084_0007637 3300054114 Bacteria 8918
1053 Ga0501084_0055143 3300054114 Bacteria 3325
1054 Ga0501084_0621063 3300054114 Unclassified 913
1055 Ga0587083_0046077 3300059505 Bacteria 933
1056 Ga0587094_012693 3300059513 Bacteria 1128
1057 Ga0501082_0007351 3300060353 Bacteria 9504
1058 Ga0501082_0115459 3300060353 Bacteria 2325
1059 Ga0530510_0046728 3300061734 Bacteria 3127
1060 Ga0530510_0237721 3300061734 Bacteria 1356
1061 Ga0530510_0241243 3300061734 Unclassified 1345
1062 2808873971 2808606365 Bacteria 4301966
1063 2816424897 2816332119 Bacteria 8120218
1064 Ga0501048_0127641
1065 SwRhRL3b_contig_3218519
1066 SwRhRL2b_contig_1162259
1067 JGI24740J21852_10023551
1068 JGI24737J22298_10012008
1069 rootH1_10019379
1070 JGI25407J50210_10011208
1071 JGI25407J50210_10014099
1072 JGI25405J52794_10036385
1073 Ga0058859_11127628
1074 Ga0058859_11245634
1075 Ga0058863_10065652
1076 Ga0058863_11873860
1077 Ga0058860_11876494
1078 Ga0058860_12191030
1079 Ga0058862_10044071
1080 Ga0058862_12728235
1081 Ga0065704_10000443
1082 Ga0065704_10167379
1083 Ga0065715_10342035
1084 Ga0065707_10042627
1085 Ga0065707_10082128
1086 Ga0065707_10084513
1087 Ga0065707_10378474
1088 Ga0070658_10172574
1089 Ga0070683_100001463
1090 Ga0070683_100038145
1091 Ga0070683_100058981
1092 Ga0070683_100148479
1093 Ga0070690_100203160
1094 Ga0068869_100066263
1095 Ga0070666_10080692
1096 Ga0070680_100351199
1097 Ga0070680_100399281
1098 Ga0070682_100053961
1099 Ga0068868_100085535
1100 Ga0068868_100086786
1101 Ga0070660_100109482
1102 Ga0070691_10003974
1103 Ga0070691_10220315
1104 Ga0070687_100048363
1105 Ga0070661_100373922
1106 Ga0070692_10135552
1107 Ga0070692_10141485
1108 Ga0070668_100016228
1109 Ga0070668_100032036
1110 Ga0070668_100166430
1111 Ga0070674_100039737
1112 Ga0070673_100335295
1113 Ga0070673_100444409
1114 Ga0070659_100073205
1115 Ga0070667_100131393
1116 Ga0070703_10021242
1117 Ga0070703_10043785
1118 Ga0070709_10001473
1119 Ga0070709_10099741
1120 Ga0070709_10290597
1121 Ga0070714_100054899
1122 Ga0070714_100093225
1123 Ga0070713_100002567
1124 Ga0070713_100003245
1125 Ga0070713_100050234
1126 Ga0070713_100080951
1127 Ga0070710_10011620
1128 Ga0070710_10013826
1129 Ga0070710_10070994
1130 Ga0070701_10147901
1131 Ga0070711_100020123
1132 Ga0070705_100085368
1133 Ga0070705_100216461
1134 Ga0070705_100559881
1135 Ga0070700_100061066
1136 Ga0070700_100106135
1137 Ga0070700_100449571
1138 Ga0070694_100015334
1139 Ga0070694_100118132
1140 Ga0070708_100001090
1141 Ga0070708_100038294
1142 Ga0070708_100091089
1143 Ga0070663_100292785
1144 Ga0070678_100002797
1145 Ga0070678_100039449
1146 Ga0070662_100018037
1147 Ga0070662_100027333
1148 Ga0068867_100586713
1149 Ga0070706_100000133
1150 Ga0070706_100001026
1151 Ga0070706_100002668
1152 Ga0070706_100004689
1153 Ga0070706_100005186
1154 Ga0070706_100005303
1155 Ga0070706_100011788
1156 Ga0070706_100016224
1157 Ga0070706_100041377
1158 Ga0070706_100098838
1159 Ga0070706_100246921
1160 Ga0070707_100000176
1161 Ga0070707_100000482
1162 Ga0070707_100002121
1163 Ga0070707_100044337
1164 Ga0070707_100050312
1165 Ga0070707_100284807
1166 Ga0070707_100328884
1167 Ga0070698_100000504
1168 Ga0070698_100001605
1169 Ga0070698_100004911
1170 Ga0070698_100023430
1171 Ga0070698_100047461
1172 Ga0070698_100048921
1173 Ga0070698_100054317
1174 Ga0070698_100063492
1175 Ga0070698_100078994
1176 Ga0070698_100106743
1177 Ga0070698_100128866
1178 Ga0070698_100169437
1179 Ga0070698_100285628
1180 Ga0070698_100306172
1181 Ga0070699_100001393
1182 Ga0070699_100017628
1183 Ga0070699_100035425
1184 Ga0070699_100386048
1185 Ga0070679_100279964
1186 Ga0070679_100705210
1187 Ga0070684_100013071
1188 Ga0070684_100021280
1189 Ga0070684_100044362
1190 Ga0070684_100251078
1191 Ga0070697_100047108
1192 Ga0070697_100063907
1193 Ga0068853_100023449
1194 Ga0070686_100033047
1195 Ga0070695_100033414
1196 Ga0070695_100109668
1197 Ga0070693_100014606
1198 Ga0070665_100152693
1199 Ga0070704_100025909
1200 Ga0070704_100127325
1201 Ga0070704_100219037
1202 Ga0070704_100324057
1203 Ga0068855_100170763
1204 Ga0068855_100456238
1205 Ga0068855_100719510
1206 Ga0070664_100089036
1207 Ga0068857_100012182
1208 Ga0068857_100047229
1209 Ga0068857_100136943
1210 Ga0068857_100146642
1211 Ga0068854_100249383
1212 Ga0068856_100008570
1213 Ga0068856_100093626
1214 Ga0068856_100154674
1215 Ga0068856_100459260
1216 Ga0068856_100521932
1217 Ga0070702_100029371
1218 Ga0070702_100066630
1219 Ga0068852_100147377
1220 Ga0068852_100239563
1221 Ga0068852_100521273
1222 Ga0068859_100135213
1223 Ga0068859_100176563
1224 Ga0068859_100228649
1225 Ga0068859_100323170
1226 Ga0068859_100386100
1227 Ga0068864_100040044
1228 Ga0068864_100057065
1229 Ga0068866_10018127
1230 Ga0068866_10155721
1231 Ga0068861_100028205
1232 Ga0068861_100261811
1233 Ga0068861_100431161
1234 Ga0068861_100618789
1235 Ga0068870_10124351
1236 Ga0068863_100048931
1237 Ga0068863_100223278
1238 Ga0068858_100017789
1239 Ga0068858_100493276
1240 Ga0068860_100044534
1241 Ga0068860_100082290
1242 Ga0068862_100213665
1243 Ga0081455_10001196
1244 Ga0081455_10001884
1245 Ga0081455_10012456
1246 Ga0081455_10018256
1247 Ga0081455_10028069
1248 Ga0081455_10083346
1249 Ga0081455_10093872
1250 Ga0081455_10110766
1251 Ga0081455_10112369
1252 Ga0081538_10000439
1253 Ga0081538_10001065
1254 Ga0081538_10001354
1255 Ga0081538_10011651
1256 Ga0081538_10015961
1257 Ga0081540_1000548
1258 Ga0081540_1001646
1259 Ga0081540_1004092
1260 Ga0081539_10002659
1261 Ga0081539_10007525
1262 Ga0081539_10015493
1263 Ga0081539_10040406
1264 Ga0081539_10083931
1265 Ga0070717_10005187
1266 Ga0070717_10020265
1267 Ga0070717_10023959
1268 Ga0070717_10066162
1269 Ga0070717_10084658
1270 Ga0070717_10139646
1271 Ga0070717_10177239
1272 Ga0070717_10203592
1273 Ga0070717_10392219
1274 Ga0075432_10000582
1275 Ga0075432_10009306
1276 Ga0075432_10014210
1277 Ga0075432_10112641
1278 Ga0070715_10018496
1279 Ga0070715_10024955
1280 Ga0070715_10041051
1281 Ga0070715_10078330
1282 Ga0070716_100009210
1283 Ga0070716_100010044
1284 Ga0070716_100131084
1285 Ga0070712_100001569
1286 Ga0070712_100050373
1287 Ga0070712_100140132
1288 Ga0097621_100043256
1289 Ga0097621_100678527
1290 Ga0068871_100065716
1291 Ga0068871_100116068
1292 Ga0075428_100007986
1293 Ga0075428_100008346
1294 Ga0075428_100009860
1295 Ga0075428_100016309
1296 Ga0075428_100038679
1297 Ga0075428_100042899
1298 Ga0075428_100048687
1299 Ga0075428_100085874
1300 Ga0075428_100146659
1301 Ga0075428_100639506
1302 Ga0075430_100015845
1303 Ga0075430_100023142
1304 Ga0075430_100071533
1305 Ga0075430_100131707
1306 Ga0075430_100139107
1307 Ga0075430_100387034
1308 Ga0075431_100000655
1309 Ga0075431_100022463
1310 Ga0075431_100032343
1311 Ga0075431_100033074
1312 Ga0075431_100037463
1313 Ga0075431_100061596
1314 Ga0075433_10003360
1315 Ga0075433_10003786
1316 Ga0075433_10023330
1317 Ga0075433_10034761
1318 Ga0075433_10142843
1319 Ga0075434_100001264
1320 Ga0075434_100001550
1321 Ga0075434_100107566
1322 Ga0075434_100146637
1323 Ga0075434_100269903
1324 Ga0075429_100008172
1325 Ga0075429_100008208
1326 Ga0075429_100018033
1327 Ga0075429_100166692
1328 Ga0068865_100031722
1329 Ga0068865_100038579
1330 Ga0068865_100194569
1331 Ga0075436_100006661
1332 Ga0075436_100045437
1333 Ga0075436_100165604
1334 Ga0075436_100333801
1335 Ga0097620_100135201
1336 Ga0097620_100176573
1337 Ga0097620_100228643
1338 Ga0097620_100323215
1339 Ga0097620_100386092
1340 Ga0075435_100009058
1341 Ga0075435_100011330
1342 Ga0075435_100017976
1343 Ga0075435_100051730
1344 Ga0075435_100103768
1345 Ga0075435_100139160
1346 Ga0099794_10028699
1347 Ga0105251_10036355
1348 Ga0105250_10122292
1349 Ga0105240_10129005
1350 Ga0105240_10500448
1351 Ga0111539_10013335
1352 Ga0111539_10016681
1353 Ga0111539_10022795
1354 Ga0111539_10049222
1355 Ga0111539_10123155
1356 Ga0111539_10746873
1357 Ga0105245_10064523
1358 Ga0105245_10091645
1359 Ga0105245_10115806
1360 Ga0105245_10252344
1361 Ga0105247_10047818
1362 Ga0105247_10061923
1363 Ga0114129_10000001
1364 Ga0114129_10014817
1365 Ga0114129_10020866
1366 Ga0114129_10057681
1367 Ga0114129_10061210
1368 Ga0114129_10128003
1369 Ga0114129_10175588
1370 Ga0114129_10439754
1371 Ga0114129_10466871
1372 Ga0114129_10548149
1373 Ga0114129_10635947
1374 Ga0114129_11074077
1375 Ga0105243_10029951
1376 Ga0105243_10061693
1377 Ga0105243_10200834
1378 Ga0105243_10269413
1379 Ga0105243_10300372
1380 Ga0105243_10423931
1381 Ga0105241_10334586
1382 Ga0105242_10062568
1383 Ga0105242_10063619
1384 Ga0105242_10231475
1385 Ga0105248_10048664
1386 Ga0105237_10082395
1387 Ga0105237_10147209
1388 Ga0105237_10841571
1389 Ga0105238_10192416
1390 Ga0105238_10327346
1391 Ga0105249_10011082
1392 Ga0105249_10016717
1393 Ga0105249_10101795
1394 Ga0105249_10128128
1395 Ga0105249_10181487
1396 Ga0105249_10286900
1397 Ga0105249_10581335
1398 Ga0105239_10041362
1399 Ga0105239_10105558
1400 Ga0105239_10333823
1401 Ga0105239_10857719
1402 Ga0105246_10029979
1403 Ga0105246_10081269
1404 Ga0105246_10131506
1405 Ga0105246_10256181
1406 Ga0157342_1001407
1407 Ga0157371_10047334
1408 Ga0157370_10030431
1409 Ga0157370_10031855
1410 Ga0157369_10104551
1411 Ga0157369_10283506
1412 Ga0157369_10311175
1413 Ga0157374_10204473
1414 Ga0157378_10066752
1415 Ga0163162_10037844
1416 Ga0163162_10061652
1417 Ga0163162_10336865
1418 Ga0157372_10107151
1419 Ga0157372_10346051
1420 Ga0157372_10346404
1421 Ga0157372_10752836
1422 Ga0157375_10024766
1423 Ga0157375_10061677
1424 Ga0157375_10453848
1425 Ga0157375_10505561
1426 Ga0163163_10039330
1427 Ga0157380_10039401
1428 Ga0157380_10519153
1429 Ga0157377_10030312
1430 Ga0157377_10348536
1431 Ga0157379_10006261
1432 Ga0157376_10056136
1433 Ga0157376_10273349
1434 Ga0163161_10034708
1435 Ga0163161_10499746
1436 Ga0197907_10225339
1437 Ga0197907_10277679
1438 Ga0197907_10470509
1439 Ga0197907_10902623
1440 Ga0197907_10984839
1441 Ga0197907_11257832
1442 Ga0206356_10106052
1443 Ga0206356_10216668
1444 Ga0206356_10369112
1445 Ga0206356_11428032
1446 Ga0206356_11705868
1447 Ga0206349_1134039
1448 Ga0206349_1818514
1449 Ga0206349_1860141
1450 Ga0206355_1105940
1451 Ga0206355_1206412
1452 Ga0206351_10249285
1453 Ga0206352_10264739
1454 Ga0206352_10356421
1455 Ga0206352_11336596
1456 Ga0206350_10060753
1457 Ga0206350_11219577
1458 Ga0206350_11605962
1459 Ga0206354_10160929
1460 Ga0206354_10370402
1461 Ga0206354_10745353
1462 Ga0206354_10799651
1463 Ga0206354_10812046
1464 Ga0206353_10443559
1465 Ga0206353_11296763
1466 Ga0206353_11527532
1467 Ga0224712_10002553
1468 Ga0224712_10038090
1469 Ga0224712_10050539
1470 Ga0224712_10050926
1471 Ga0224712_10124253
1472 Ga0224712_10182993
1473 Ga0207653_10002312
1474 Ga0207692_10004841
1475 Ga0207692_10008731
1476 Ga0207692_10123019
1477 Ga0207642_10036679
1478 Ga0207642_10108366
1479 Ga0207710_10023890
1480 Ga0207710_10098798
1481 Ga0207688_10008232
1482 Ga0207688_10010597
1483 Ga0207647_10029303
1484 Ga0207647_10092248
1485 Ga0207685_10019314
1486 Ga0207685_10105909
1487 Ga0207699_10000555
1488 Ga0207699_10000761
1489 Ga0207699_10013524
1490 Ga0207643_10021911
1491 Ga0207705_10127895
1492 Ga0207684_10000599
1493 Ga0207684_10000967
1494 Ga0207684_10004345
1495 Ga0207684_10005872
1496 Ga0207684_10029194
1497 Ga0207684_10040664
1498 Ga0207684_10052390
1499 Ga0207684_10072216
1500 Ga0207684_10151658
1501 Ga0207684_10193035
1502 Ga0207654_10284717
1503 Ga0207707_10229702
1504 Ga0207693_10003808
1505 Ga0207693_10004257
1506 Ga0207693_10033975
1507 Ga0207663_10007144
1508 Ga0207660_10080792
1509 Ga0207660_10447139
1510 Ga0207662_10018897
1511 Ga0207657_10015063
1512 Ga0207652_10163623
1513 Ga0207652_10401552
1514 Ga0207646_10000811
1515 Ga0207646_10001035
1516 Ga0207646_10005172
1517 Ga0207646_10011107
1518 Ga0207646_10018172
1519 Ga0207646_10033193
1520 Ga0207646_10082229
1521 Ga0207646_10451654
1522 Ga0207694_10531306
1523 Ga0207687_10057200
1524 Ga0207687_10057371
1525 Ga0207687_10182847
1526 Ga0207687_10333491
1527 Ga0207700_10000558
1528 Ga0207700_10001918
1529 Ga0207700_10015157
1530 Ga0207700_10028862
1531 Ga0207700_10159812
1532 Ga0207700_10191567
1533 Ga0207664_10000706
1534 Ga0207664_10001977
1535 Ga0207664_10060803
1536 Ga0207664_10071738
1537 Ga0207664_10403723
1538 Ga0207644_10378990
1539 Ga0207690_10026581
1540 Ga0207706_10003790
1541 Ga0207706_10106062
1542 Ga0207686_10471239
1543 Ga0207709_10122771
1544 Ga0207709_10267893
1545 Ga0207709_10357011
1546 Ga0207670_10173436
1547 Ga0207704_10022983
1548 Ga0207704_10144409
1549 Ga0207665_10014174
1550 Ga0207665_10015571
1551 Ga0207665_10030098
1552 Ga0207711_10188364
1553 Ga0207689_10116786
1554 Ga0207661_10071498
1555 Ga0207661_10181619
1556 Ga0207661_10291623
1557 Ga0207679_10069465
1558 Ga0207667_10176433
1559 Ga0207651_10406415
1560 Ga0207712_10032779
1561 Ga0207668_10100897
1562 Ga0207640_10123158
1563 Ga0207703_10066359
1564 Ga0207703_10504975
1565 Ga0207639_10028967
1566 Ga0207639_10048520
1567 Ga0207678_10010009
1568 Ga0207708_10140368
1569 Ga0207708_10156618
1570 Ga0207702_10013876
1571 Ga0207702_10042023
1572 Ga0207702_10203834
1573 Ga0207702_10599964
1574 Ga0207641_10039866
1575 Ga0207641_10074128
1576 Ga0207648_10050017
1577 Ga0207676_10026997
1578 Ga0207676_10202150
1579 Ga0207674_10000027
1580 Ga0207674_10031858
1581 Ga0207674_10148676
1582 Ga0207674_10573973
1583 Ga0207675_100022932
1584 Ga0207675_100035155
1585 Ga0207675_100055459
1586 Ga0207675_100072240
1587 Ga0207675_100334795
1588 Ga0207675_100533719
1589 Ga0207683_10003345
1590 Ga0207683_10075214
1591 Ga0207683_10242210
1592 Ga0207698_10443139
1593 Ga0207428_10004650
1594 Ga0207428_10004915
1595 Ga0207428_10008457
1596 Ga0207428_10131306
1597 Ga0268266_10374255
1598 Ga0268265_10139413
1599 Ga0268265_10194679
1600 Ga0268264_10094623
1601 Ga0268264_10398409
1602 Ga0268264_10399007
1603 Ga0265318_10043065
1604 Ga0265338_10213949
1605 Ga0265330_10113409
1606 Ga0265320_10027982
1607 Ga0265320_10114764
1608 Ga0307509_10143914
1609 Ga0307408_100062499
1610 Ga0307408_100223902
1611 Ga0307408_100381496
1612 Ga0307516_10122094
1613 Ga0307405_10162603
1614 Ga0307405_10269931
1615 Ga0307413_10152232
1616 Ga0307413_10271995
1617 Ga0307410_10001030
1618 Ga0307410_10115410
1619 Ga0307410_10247219
1620 Ga0307406_10022836
1621 Ga0307406_10097344
1622 Ga0307406_10150211
1623 Ga0307406_10237307
1624 Ga0307407_10003918
1625 Ga0307412_10029424
1626 Ga0307412_10185573
1627 Ga0307409_100001173
1628 Ga0307409_100010612
1629 Ga0307409_100101217
1630 Ga0307409_100133967
1631 Ga0307409_100197084
1632 Ga0307409_100419197
1633 Ga0307416_100012514
1634 Ga0307416_100037944
1635 Ga0307416_100085840
1636 Ga0307416_100095823
1637 Ga0307416_100245547
1638 Ga0307416_100458081
1639 Ga0307416_100933001
1640 Ga0307414_10039403
1641 Ga0307414_10492283
1642 Ga0307411_10002120
1643 Ga0307411_10035200
1644 Ga0307411_10043543
1645 Ga0307411_10327393
1646 Ga0307411_10373579
1647 Ga0307411_10438531
1648 Ga0307415_100000052
1649 Ga0307415_100009472
1650 Ga0307415_100011962
1651 Ga0307415_100025582
1652 Ga0307415_100032717
1653 Ga0307415_100073483
1654 Ga0307415_100116849
1655 Ga0307415_100148397
1656 Ga0307415_100220930
1657 Ga0373948_0026830
1658 Ga0373950_0010229
1659 Ga0373958_0008183
1660 Ga0373959_0006166
1661 Ga0373938_0020211
1662 Ga0373926_0015314
1663 Ga0373928_0008617
1664 Ga0373929_0012525
1665 Ga0373934_0002560
1666 Ga0373934_0008140
1667 Ga0373934_0029791
1668 Ga0373934_0103309
1669 Ga0373951_0030540
1670 Ga0373952_0004407
1671 Ga0373923_0001781
1672 Ga0373923_0037537
1673 Ga0373932_0052797
1674 Ga0373936_0006172
1675 Ga0373936_0058738
1676 Ga0373941_0021950
1677 Ga0373945_0020919
1678 Ga0373945_0149810
1679 Ga0373953_0000098
1680 Ga0373953_0003311
1681 Ga0373953_0026809
1682 Ga0373953_0029025
1683 Ga0373954_0008625
1684 Ga0373954_0040016
1685 Ga0373956_0000476
1686 Ga0373956_0002164
1687 Ga0373956_0024982
1688 Ga0373957_0001091
1689 Ga0373957_0004904
1690 Ga0373957_0007936
1691 Ga0373943_0067404
1692 Ga0373943_0097553
1693 Ga0373946_0021191
1694 Ga0373946_0055198
1695 Ga0373955_0000004
1696 Ga0373955_0125453
1697 Ga0373942_0024833
1698 Ga0373962_0055601
1699 Ga0373924_0003964
1700 Ga0373924_0010887
1701 Ga0373924_0074021
1702 Ga0373931_0030843
1703 Ga0373931_0128112
1704 Ga0373935_0009714
1705 Ga0373935_0148967
1706 Ga0373935_0297995
1707 Ga0373927_0000061
1708 Ga0373927_0266894
1709 Ga0373933_0000005
1710 Ga0373933_0010757
1711 Ga0373933_0010966
1712 Ga0373933_0030598
1713 Ga0373933_0074812
1714 Ga0373933_0371032
1715 Ga0373947_0005352
1716 Ga0373937_0000077
1717 Ga0373937_0062752
1718 Ga0372808_021105
1719 Ga0373925_0035401
1720 Ga0373925_0043894
1721 Ga0373925_0250765
1722 Ga0395899_0219818
1723 Ga0395900_0012521
1724 Ga0395900_0022271
1725 Ga0395900_0116288
1726 Ga0395900_0144950
1727 Ga0395900_0330553
1728 Ga0395898_0004897
1729 Ga0395898_0020617
1730 Ga0395898_0122546
1731 Ga0395905_0008839
1732 Ga0395905_0298067
1733 Ga0395901_0009032
1734 Ga0395901_0017821
1735 Ga0395901_0187229
1736 Ga0395901_0239075
1737 Ga0395901_0595696
1738 Ga0436363_0245620
1739 Ga0436363_0566087
1740 Ga0439448_0000420
1741 Ga0439450_000073
1742 Ga0439454_004566
1743 Ga0439456_029928
1744 Ga0439463_000652
1745 Ga0450914_004130
1746 Ga0450888_001556
1747 Ga0439435_0101769
1748 Ga0439444_0001306
1749 Ga0439444_0001934
1750 Ga0439464_0000078
1751 Ga0439460_0007933
1752 Ga0451577_0052117
1753 Ga0451577_0199628
1754 Ga0451577_0326283
1755 Ga0451577_0330864
1756 Ga0439440_0039097
1757 Ga0453683_0207644
1758 Ga0466961_0164049
1759 Ga0466961_0349016
1760 Ga0466963_0027594
1761 Ga0453684_0207338
1762 Ga0453684_0356054
1763 Ga0453684_0514272
1764 Ga0453684_0610058
1765 Ga0466970_0085077
1766 Ga0466959_0175496
1767 Ga0466959_0186267
1768 Ga0451576_0011082
1769 Ga0451576_0015589
1770 Ga0451576_0054154
1771 Ga0451576_0074520
1772 Ga0451576_0115489
1773 Ga0451576_0264004
1774 Ga0451576_0328892
1775 Ga0466958_0137352
1776 Ga0466967_0001185
1777 Ga0466967_0051801
1778 Ga0466967_0071945
1779 Ga0466967_0297014
1780 Ga0466967_0331795
1781 Ga0495592_0000010
1782 Ga0495592_0022313
1783 Ga0495592_0109044
1784 Ga0495603_0036108
1785 Ga0495603_0058610
1786 Ga0495603_0066310
1787 Ga0495603_0095813
1788 Ga0495629_0005227
1789 Ga0495629_0023800
1790 Ga0495629_0023848
1791 Ga0495629_0102857
1792 Ga0495629_0139002
1793 Ga0495641_0022914
1794 Ga0495641_0048509
1795 Ga0495641_0056206
1796 Ga0495651_0000006
1797 Ga0495651_0003311
1798 Ga0495651_0004959
1799 Ga0495651_0108273
1800 Ga0495651_0276371
1801 Ga0495653_0022085
1802 Ga0495653_0071377
1803 Ga0495653_0160410
1804 Ga0495653_0230527
1805 Ga0495580_0100704
1806 Ga0495580_0113108
1807 Ga0495580_0224057
1808 Ga0495582_0000075
1809 Ga0495582_0005715
1810 Ga0495582_0026321
1811 Ga0495639_0037234
1812 Ga0495662_0004456
1813 Ga0495662_0229823
1814 Ga0495664_0007101
1815 Ga0495664_0051937
1816 Ga0495584_0114510
1817 Ga0495594_0016704
1818 Ga0495594_0100761
1819 Ga0495608_0000161
1820 Ga0495608_0007761
1821 Ga0495608_0090608
1822 Ga0495618_0010485
1823 Ga0495618_0058612
1824 Ga0495618_0345693
1825 Ga0495620_0070415
1826 Ga0495628_0002479
1827 Ga0495628_0010850
1828 Ga0495628_0116122
1829 Ga0495630_0030823
1830 Ga0495630_0045709
1831 Ga0495630_0048035
1832 Ga0495666_0061732
1833 Ga0495666_0064110
1834 Ga0495652_0004827
1835 Ga0495652_0076582
1836 Ga0495652_0189261
1837 Ga0495652_0197524
1838 Ga0495652_0254179
1839 Ga0495665_0009457
1840 Ga0495665_0012829
1841 Ga0495665_0108488
1842 Ga0495640_0044173
1843 Ga0495640_0061905
1844 Ga0495640_0067221
1845 Ga0495586_0005637
1846 Ga0495586_0034500
1847 Ga0495587_0000152
1848 Ga0495587_0010554
1849 Ga0495587_0026240
1850 Ga0495587_0061439
1851 Ga0495645_0019648
1852 Ga0495645_0043638
1853 Ga0495645_0073189
1854 Ga0495645_0089401
1855 Ga0495645_0113648
1856 Ga0495645_0151838
1857 Ga0495645_0241303
1858 Ga0495667_0000153
1859 Ga0495667_0056349
1860 Ga0495667_0143278
1861 Ga0495656_0080269
1862 Ga0495634_0010474
1863 Ga0495634_0017510
1864 Ga0495635_0036979
1865 Ga0495635_0204788
1866 Ga0495588_0182083
1867 Ga0495657_0000082
1868 Ga0495657_0032663
1869 Ga0495657_0074997
1870 Ga0495657_0089187
1871 Ga0495599_0000028
1872 Ga0495599_0021886
1873 Ga0495599_0034288
1874 Ga0495599_0062366
1875 Ga0495599_0064579
1876 Ga0495599_0071552
1877 Ga0495599_0307269
1878 Ga0495623_0000746
1879 Ga0495623_0005272
1880 Ga0495623_0060886
1881 Ga0495623_0093124
1882 Ga0495646_0057430
1883 Ga0495658_0015036
1884 Ga0495658_0050485
1885 Ga0495658_0292659
1886 Ga0495613_0001013
1887 Ga0495613_0006937
1888 Ga0495613_0013623
1889 Ga0495624_0074233
1890 Ga0495600_0002836
1891 Ga0495600_0098398
1892 Ga0495581_0003536
1893 Ga0495581_0005979
1894 Ga0495581_0009543
1895 Ga0495581_0159117
1896 Ga0495604_0000086
1897 Ga0495604_0024493
1898 Ga0495604_0055756
1899 Ga0495604_0229052
1900 Ga0495674_0013693
1901 Ga0495674_0021036
1902 Ga0495674_0074816
1903 Ga0495674_0228738
1904 Ga0495676_0045576
1905 Ga0495676_0076641
1906 Ga0495676_0123021
1907 Ga0495676_0416093
1908 Ga0495680_0000326
1909 Ga0495680_0013668
1910 Ga0495680_0039779
1911 Ga0495680_0040098
1912 Ga0495680_0092747
1913 Ga0495680_0235874
1914 Ga0495680_0359910
1915 Ga0495675_0000729
1916 Ga0495684_0013926
1917 Ga0495684_0068630
1918 Ga0495684_0163466
1919 Ga0495593_0033570
1920 Ga0495593_0060384
1921 Ga0495593_0185628
1922 Ga0495602_0000049
1923 Ga0495602_0039169
1924 Ga0495602_0045785
1925 Ga0495602_0074995
1926 Ga0495602_0093104
1927 Ga0495614_0106050
1928 Ga0496100_0023654
1929 Ga0496101_0063467
1930 Ga0496101_0072935
1931 Ga0496102_0018211
1932 Ga0496102_0057409
1933 Ga0496102_0127986
1934 Ga0496102_0287069
1935 Ga0496103_0086085
1936 Ga0496104_0036122
1937 Ga0496104_0049958
1938 Ga0496104_0091645
1939 Ga0496104_0285699
1940 Ga0496104_0429882
1941 Ga0496104_0644838
1942 Ga0496105_0023215
1943 Ga0496105_0023575
1944 Ga0496105_0044132
1945 Ga0496105_0061917
1946 Ga0496105_0208557
1947 Ga0496106_0033861
1948 Ga0496106_0058693
1949 Ga0496106_0126675
1950 Ga0496107_0145002
1951 Ga0496107_0201846
1952 Ga0496107_0206463
1953 Ga0496108_0005432
1954 Ga0496108_0011312
1955 Ga0496108_0126741
1956 Ga0496108_0139883
1957 Ga0496108_0207297
1958 Ga0496108_0266118
1959 Ga0496108_0496762
1960 Ga0496109_0010090
1961 Ga0496109_0048774
1962 Ga0496109_0072750
1963 Ga0496109_0079396
1964 Ga0496109_0681885
1965 Ga0496110_0011780
1966 Ga0496110_0054322
1967 Ga0496110_0068664
1968 Ga0496111_0059657
1969 Ga0496111_0082646
1970 Ga0496111_0113804
1971 Ga0496111_0334266
1972 Ga0496112_0126662
1973 Ga0496112_0132518
1974 Ga0496112_0142403
1975 Ga0496113_0016990
1976 Ga0496113_0150093
1977 Ga0496114_0103750
1978 Ga0496114_0141329
1979 Ga0496114_0181643
1980 Ga0496114_0507769
1981 Ga0496114_0852040
1982 Ga0496115_0135775
1983 Ga0501295_025811
1984 Ga0501031_0021321
1985 Ga0501033_0009856
1986 Ga0501033_0225950
1987 Ga0501033_0313913
1988 Ga0501034_0652088
1989 Ga0501036_0035944
1990 Ga0501037_0085037
1991 Ga0501038_0204184
1992 Ga0501038_0310504
1993 Ga0501039_0003928
1994 Ga0501039_0009195
1995 Ga0501039_0117136
1996 Ga0501039_0275628
1997 Ga0501040_0015709
1998 Ga0501041_0002972
1999 Ga0501041_0026412
2000 Ga0501041_0030083
2001 Ga0501042_0006227
2002 Ga0501042_0008873
2003 Ga0501042_0013030
2004 Ga0501042_0106391
2005 Ga0501043_0069772
2006 Ga0501043_0214738
2007 Ga0501046_0008266
2008 Ga0501046_0188519
2009 Ga0501046_0260620
2010 Ga0501048_0038046
2011 Ga0501048_0372955
2012 Ga0501067_0002075
2013 Ga0501067_0016570
2014 Ga0501069_0042478
2015 Ga0501071_0037174
2016 Ga0501071_0100107
2017 Ga0501071_0192926
2018 Ga0501072_0085838
2019 Ga0501072_0173323
2020 Ga0501074_0021979
2021 Ga0501074_0023931
2022 Ga0501074_0061309
2023 Ga0501075_0004135
2024 Ga0501075_0022583
2025 Ga0501075_0179931
2026 Ga0501075_0291399
2027 Ga0501075_0401379
2028 Ga0501075_0414866
2029 Ga0501075_0721674
2030 Ga0501076_0004501
2031 Ga0501076_0053147
2032 Ga0501076_0164957
2033 Ga0501076_0196903
2034 Ga0501076_0265452
2035 Ga0501077_0012346
2036 Ga0501077_0284660
2037 Ga0501243_003069
2038 Ga0501079_0015229
2039 Ga0501079_0021616
2040 Ga0501079_0091515
2041 Ga0501080_0105263
2042 Ga0501081_0011034
2043 Ga0501081_0036702
2044 Ga0501081_0335965
2045 Ga0501083_0248931
2046 Ga0501035_0021576
2047 Ga0501045_0005664
2048 Ga0501045_0103538
2049 Ga0501045_0165412
2050 Ga0501045_0213297
2051 Ga0501212_000772
2052 nmdc:mga05p37_1141_c1
2053 nmdc:mga05p37_118154_c1
2054 nmdc:mga05p37_161942_c1
2055 nmdc:mga05p37_16928_c1
2056 nmdc:mga05p37_1964_c1
2057 nmdc:mga05p37_277885_c1
2058 nmdc:mga05p37_349435_c1
2059 nmdc:mga05p37_41228_c1
2060 nmdc:mga05p37_49456_c1
2061 nmdc:mga05p37_5653_c1
2062 nmdc:mga05p37_8148_c1
2063 nmdc:mga09592_11509_c1
2064 nmdc:mga09592_1637_c1
2065 nmdc:mga09592_174141_c1
2066 nmdc:mga09592_18743_c1
2067 nmdc:mga09592_333926_c1
2068 nmdc:mga09592_892_c1
2069 nmdc:mga0qj67_16_c1
2070 nmdc:mga0qj67_21564_c1
2071 nmdc:mga0qj67_266485_c1
2072 nmdc:mga0qj67_380671_c1
2073 nmdc:mga0qj67_63181_c1
2074 nmdc:mga06r32_155048_c1
2075 nmdc:mga06r32_161227_c1
2076 nmdc:mga06r32_26628_c1
2077 nmdc:mga06r32_316681_c1
2078 nmdc:mga06r32_38_c2
2079 nmdc:mga06r32_493497_c1
2080 nmdc:mga06r32_8283_c1
2081 nmdc:mga06r32_828_c1
2082 nmdc:mga08y16_6021_c1
2083 nmdc:mga08y16_620152_c1
2084 nmdc:mga0n895_20705_c1
2085 nmdc:mga0n895_210487_c1
2086 nmdc:mga0n895_401947_c1
2087 nmdc:mga0n895_51309_c1
2088 nmdc:mga0n895_885976_c1
2089 nmdc:mga0rr50_130417_c1
2090 nmdc:mga0rr50_161109_c1
2091 nmdc:mga0rr50_26502_c1
2092 nmdc:mga0rr50_38257_c1
2093 nmdc:mga0rr50_9311_c1
2094 nmdc:mga08x19_194782_c1
2095 nmdc:mga08x19_27306_c1
2096 nmdc:mga08x19_302478_c1
2097 nmdc:mga08x19_307007_c1
2098 nmdc:mga0a205_224749_c1
2099 nmdc:mga0a205_2978_c1
2100 nmdc:mga0a205_33385_c1
2101 nmdc:mga0a205_55318_c1
2102 nmdc:mga0a205_6264_c1
2103 nmdc:mga0a205_85851_c1
2104 nmdc:mga0a205_96495_c1
2105 Ga0495601_0007082
2106 Ga0495601_0008037
2107 Ga0495601_0020008
2108 Ga0495601_0047598
2109 Ga0495601_0155869
2110 Ga0495595_0000194
2111 Ga0495595_0009026
2112 Ga0495619_0000751
2113 Ga0495619_0013119
2114 Ga0500579_108774
2115 Ga0501084_0007637
2116 Ga0501084_0055143
2117 Ga0501084_0621063
2118 Ga0587083_0046077
2119 Ga0587094_012693
2120 Ga0501082_0007351
2121 Ga0501082_0115459
2122 Ga0530510_0046728
2123 Ga0530510_0237721
2124 Ga0530510_0241243
2125 2808873971
2126 2816424897

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11716

MDMPI_N

Mycothiol maleylpyruvate isomerase N-terminal domain

63

206

0.84

PF12867

DinB_2

DinB superfamily

62

196

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cqv-assembly1.cif.gz_B crystal structure of uncharacterized protein q8dwv2 from streptococcus agalactiae 0.8114 1 116
5cog-assembly1.cif.gz_A crystal structure of yeast irc4 0.8074 2 152
5cof-assembly1.cif.gz_A crystal structure of uncharacterised protein q1r1x2 from escherichia coli uti89 0.8026 6 159
7mtl-assembly1.cif.gz_B crystal structure of colibactin self-resistance protein clbs in complex with a dsdna 0.7949 6 157
5civ-assembly1.cif.gz_A sibling lethal factor precursor - dfsb 0.7866 2 160
ID Description Score Start End Superfamily
5cqvB01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8113 1 116 1.20.120.450
5cogA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8074 2 152 1.20.120.450
5civA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7725 2 160 1.20.120.450
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7717 6 151 1.20.120.450
af_Q9VB10_297_412_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.7651 183 258 3.30.1050.10
ID Description Score Start End GO Terms
AF-A0A3D2MMI7-F1-model_v4 Mycothiol-dependent maleylpyruvate isomerase metal-binding domain-containing protein 1.001 1 140 GO:0046872
AF-A0A536MH37-F1-model_v4 Mycothiol-dependent maleylpyruvate isomerase metal-binding domain-containing protein 0.9876 1 154 GO:0046872
AF-A0A3B9KA84-F1-model_v4 Mycothiol-dependent maleylpyruvate isomerase metal-binding domain-containing protein 0.9846 1 261 GO:0046872
AF-A0A3B9KA84-F1-model_v4 Mycothiol-dependent maleylpyruvate isomerase metal-binding domain-containing protein 0.9734 1 261 GO:0046872
AF-A0A535ZUC1-F1-model_v4 Mycothiol-dependent maleylpyruvate isomerase metal-binding domain-containing protein 0.9721 1 263 GO:0046872

Map