F489285
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1061 | 471 | 1036 | 125 |
Family's Representative Sequence
| Representative Sequence | 3300005293|Ga0065715_10021005|Ga0065715_100210053 |
| Length | 151 |
| Sequence | MTNGAFAMRRMPATIDPASGENNMARILIVDDSPSQLMGIRRIVEKLGHEALTAEDGAAGVEVAKRELPDLILMDVVMPNLNGFQATRSISREPTTKHIPVILVTTKDQETDRMWGMRQGAKAYLTKPFSEDELAEAITRHLVAGPSPTAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 3 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 4 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 5 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 6 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 7 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 8 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 9 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 10 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 11 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 12 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 13 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 14 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 15 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 16 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 17 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 18 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 19 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 20 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 21 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 22 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 23 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 24 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 25 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 26 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 27 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 28 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 29 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 30 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 31 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 32 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 33 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 34 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 35 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 36 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 37 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 38 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 39 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 40 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 41 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 42 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 43 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 44 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 45 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 46 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 55 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 56 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 57 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 58 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 59 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 61 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 62 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 63 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 64 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 65 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 67 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 73 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 93 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 94 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 95 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 98 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 103 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 105 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 106 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 107 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 108 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 109 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 110 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 111 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 112 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 113 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 114 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 115 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 116 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 117 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 118 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 120 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 121 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 122 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 123 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 124 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 136 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 137 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 138 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 139 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 140 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 143 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 144 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 145 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 146 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 147 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 148 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 149 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 150 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 151 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 152 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 162 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 163 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 164 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 166 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 170 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 242 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 243 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 244 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 245 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 246 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 247 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 248 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 249 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 250 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 251 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 252 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 253 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 254 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 255 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 256 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 257 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 258 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 259 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 260 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 261 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 262 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 269 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 270 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 272 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 274 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 275 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 278 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 279 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 281 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 282 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 283 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 284 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 285 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 286 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 288 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 289 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 291 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 292 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 293 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 294 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 295 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 296 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 297 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 298 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 299 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 300 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 301 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 302 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 303 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 304 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 305 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 306 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 314 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 315 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 316 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 317 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 318 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 319 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 320 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 321 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 322 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 323 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 324 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 325 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 326 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 327 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 328 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 329 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 392 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 394 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 395 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 396 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 397 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 400 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 401 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 402 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 403 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 404 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 405 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 406 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 407 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 408 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 409 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 410 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 411 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 412 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 413 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 414 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 415 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 416 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 417 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 437 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 438 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 439 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 440 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 441 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 442 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 443 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 444 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 445 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 446 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 450 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 451 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 452 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 453 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 454 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 457 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 458 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 463 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 464 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 465 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 466 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 467 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 468 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 469 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95 |
| Metatranscriptomes | 2.64 |
| Isolates | 2.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 11.03 |
| Nodule | 0 |
| Rhizoplane | 3.68 |
| Rhizosphere | 76.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1494109 | 2162886007 | Bacteria | 2779 |
| 2 | SwRhRL2b_contig_1768253 | 2162886007 | Bacteria | 5364 |
| 3 | SwRhRL2b_contig_2659438 | 2162886007 | Bacteria | 1155 |
| 4 | JGI24741J21665_1001252 | 3300001915 | Bacteria | 7469 |
| 5 | JGI24740J21852_10000143 | 3300001979 | Bacteria | 27545 |
| 6 | JGI24740J21852_10010601 | 3300001979 | Bacteria | 3540 |
| 7 | JGI24740J21852_10037273 | 3300001979 | Bacteria | 1503 |
| 8 | JGI24739J22299_10001460 | 3300001989 | Bacteria | 8910 |
| 9 | JGI24737J22298_10003217 | 3300001990 | Bacteria | 5797 |
| 10 | JGI24735J21928_10257091 | 3300002067 | Bacteria | 509 |
| 11 | JGI24738J21930_10027116 | 3300002075 | Bacteria | 1174 |
| 12 | JGI25162J39368_1002331 | 3300002737 | Bacteria | 7578 |
| 13 | JGI25162J39368_1016462 | 3300002737 | Bacteria | 746 |
| 14 | JGI25157J39369_1001034 | 3300002741 | Bacteria | 12778 |
| 15 | JGI25157J39369_1006315 | 3300002741 | Bacteria | 1818 |
| 16 | JGI25164J39214_1001133 | 3300002772 | Bacteria | 7578 |
| 17 | JGI25152J39213_1000221 | 3300002773 | Bacteria | 38603 |
| 18 | JGI25152J39213_1033312 | 3300002773 | Bacteria | 776 |
| 19 | JGI25150J39212_1000698 | 3300002774 | Bacteria | 12150 |
| 20 | JGI25151J46595_10000107 | 3300003187 | Bacteria | 113288 |
| 21 | JGI25151J46595_10063077 | 3300003187 | Bacteria | 1168 |
| 22 | JGI25165J46597_1003844 | 3300003214 | Bacteria | 3497 |
| 23 | JGI25153J46596_10000078 | 3300003215 | Bacteria | 113288 |
| 24 | JGI25153J46596_10079822 | 3300003215 | Bacteria | 819 |
| 25 | JGI25153J46596_10132516 | 3300003215 | Bacteria | 550 |
| 26 | rootH1_10042964 | 3300003316 | Bacteria | 1000 |
| 27 | rootH2_10035658 | 3300003320 | Bacteria | 6875 |
| 28 | rootL2_10215448 | 3300003322 | Bacteria | 1367 |
| 29 | JGI26145J50221_1002825 | 3300003371 | Bacteria | 1369 |
| 30 | Ga0006556J51387_1035038 | 3300003479 | Bacteria | 504 |
| 31 | Ga0006562J51391_1017586 | 3300003578 | Bacteria | 890 |
| 32 | Ga0055525_1000097 | 3300003759 | Bacteria | 137371 |
| 33 | Ga0055527_1000518 | 3300003760 | Bacteria | 13257 |
| 34 | Ga0055535_1001115 | 3300003761 | Bacteria | 16273 |
| 35 | Ga0055535_1001316 | 3300003761 | Bacteria | 13257 |
| 36 | Ga0055535_1001923 | 3300003761 | Bacteria | 8699 |
| 37 | Ga0055542_1000943 | 3300003762 | Bacteria | 19123 |
| 38 | Ga0055542_1001305 | 3300003762 | Bacteria | 13245 |
| 39 | Ga0055529_1001019 | 3300003763 | Bacteria | 13442 |
| 40 | Ga0055526_1000032 | 3300003771 | Bacteria | 143118 |
| 41 | Ga0055526_1000504 | 3300003771 | Bacteria | 31051 |
| 42 | Ga0055526_1044350 | 3300003771 | Bacteria | 1074 |
| 43 | Ga0055537_1000309 | 3300003773 | Bacteria | 33572 |
| 44 | Ga0055537_1001396 | 3300003773 | Bacteria | 9567 |
| 45 | Ga0055524_1000054 | 3300003775 | Bacteria | 143118 |
| 46 | Ga0055524_1032027 | 3300003775 | Bacteria | 1500 |
| 47 | Ga0055524_1045848 | 3300003775 | Bacteria | 1046 |
| 48 | Ga0055536_1001040 | 3300003781 | Bacteria | 17571 |
| 49 | Ga0055536_1001075 | 3300003781 | Bacteria | 17236 |
| 50 | Ga0055536_1001737 | 3300003781 | Bacteria | 12887 |
| 51 | Ga0055536_1002595 | 3300003781 | Bacteria | 10066 |
| 52 | Ga0055536_1014536 | 3300003781 | Bacteria | 2754 |
| 53 | Ga0055534_1000041 | 3300003784 | Bacteria | 101875 |
| 54 | Ga0055534_1000065 | 3300003784 | Bacteria | 81111 |
| 55 | Ga0055534_1009828 | 3300003784 | Bacteria | 2045 |
| 56 | Ga0055528_1000021 | 3300003790 | Bacteria | 143118 |
| 57 | Ga0055528_1002176 | 3300003790 | Bacteria | 10748 |
| 58 | Ga0055530_10000277 | 3300003791 | Bacteria | 46496 |
| 59 | Ga0055530_10000307 | 3300003791 | Bacteria | 44334 |
| 60 | Ga0055530_10006977 | 3300003791 | Bacteria | 4876 |
| 61 | Ga0055540_1022212 | 3300003792 | Bacteria | 1628 |
| 62 | Ga0055531_10002203 | 3300003794 | Bacteria | 13252 |
| 63 | Ga0055531_10005871 | 3300003794 | Bacteria | 7086 |
| 64 | Ga0055531_10008552 | 3300003794 | Bacteria | 5373 |
| 65 | Ga0055531_10009391 | 3300003794 | Bacteria | 4998 |
| 66 | Ga0055531_10018988 | 3300003794 | Bacteria | 2809 |
| 67 | Ga0055531_10019162 | 3300003794 | Bacteria | 2784 |
| 68 | Ga0055531_10021884 | 3300003794 | Bacteria | 2460 |
| 69 | Ga0058692_1000011 | 3300003856 | Bacteria | 321321 |
| 70 | Ga0058692_1000017 | 3300003856 | Bacteria | 274459 |
| 71 | Ga0055543_1062555 | 3300004625 | Bacteria | 595 |
| 72 | Ga0058863_11884389 | 3300004799 | Bacteria | 1075 |
| 73 | Ga0058861_11804756 | 3300004800 | Bacteria | 1983 |
| 74 | Ga0065165_1001019 | 3300005262 | Bacteria | 34015 |
| 75 | Ga0065165_1022320 | 3300005262 | Bacteria | 2173 |
| 76 | Ga0065704_10000467 | 3300005289 | Bacteria | 20171 |
| 77 | Ga0065704_10090081 | 3300005289 | Bacteria | 2814 |
| 78 | Ga0065704_10174874 | 3300005289 | Bacteria | 1270 |
| 79 | Ga0065704_10373551 | 3300005289 | Bacteria | 782 |
| 80 | Ga0065715_10002797 | 3300005293 | Bacteria | 4788 |
| 81 | Ga0065715_10021005 | 3300005293 | Bacteria | 2217 |
| 82 | Ga0065715_10090105 | 3300005293 | Bacteria | 7659 |
| 83 | Ga0065715_10516657 | 3300005293 | Bacteria | 767 |
| 84 | Ga0070658_10020150 | 3300005327 | Bacteria | 5343 |
| 85 | Ga0070658_10155762 | 3300005327 | Bacteria | 1915 |
| 86 | Ga0070658_10760115 | 3300005327 | Bacteria | 842 |
| 87 | Ga0070658_11401392 | 3300005327 | Bacteria | 606 |
| 88 | Ga0070683_100085656 | 3300005329 | Bacteria | 2954 |
| 89 | Ga0070683_100460603 | 3300005329 | Bacteria | 1213 |
| 90 | Ga0070683_100719787 | 3300005329 | Bacteria | 956 |
| 91 | Ga0070670_100001282 | 3300005331 | Bacteria | 20029 |
| 92 | Ga0070670_100418195 | 3300005331 | Bacteria | 1185 |
| 93 | Ga0070670_100441228 | 3300005331 | Bacteria | 1153 |
| 94 | Ga0070680_100000430 | 3300005336 | Bacteria | 28610 |
| 95 | Ga0070680_100006891 | 3300005336 | Bacteria | 8666 |
| 96 | Ga0070680_100010430 | 3300005336 | Bacteria | 7164 |
| 97 | Ga0070680_100035775 | 3300005336 | Bacteria | 4010 |
| 98 | Ga0070680_100058609 | 3300005336 | Bacteria | 3149 |
| 99 | Ga0070680_100160326 | 3300005336 | Bacteria | 1890 |
| 100 | Ga0070680_100637375 | 3300005336 | Bacteria | 915 |
| 101 | Ga0070682_100002217 | 3300005337 | Bacteria | 10777 |
| 102 | Ga0070682_100014108 | 3300005337 | Bacteria | 4613 |
| 103 | Ga0068868_100234891 | 3300005338 | Bacteria | 1539 |
| 104 | Ga0070660_100050025 | 3300005339 | Bacteria | 3215 |
| 105 | Ga0070660_100053262 | 3300005339 | Bacteria | 3120 |
| 106 | Ga0070660_100412642 | 3300005339 | Bacteria | 1117 |
| 107 | Ga0070660_100455643 | 3300005339 | Bacteria | 1061 |
| 108 | Ga0070660_100494167 | 3300005339 | Bacteria | 1018 |
| 109 | Ga0070660_101580391 | 3300005339 | Bacteria | 558 |
| 110 | Ga0070691_10035507 | 3300005341 | Bacteria | 2347 |
| 111 | Ga0070691_10190274 | 3300005341 | Bacteria | 1073 |
| 112 | Ga0070691_10299132 | 3300005341 | Bacteria | 878 |
| 113 | Ga0070687_100465588 | 3300005343 | Bacteria | 844 |
| 114 | Ga0070661_100073555 | 3300005344 | Bacteria | 2516 |
| 115 | Ga0070661_100083928 | 3300005344 | Bacteria | 2353 |
| 116 | Ga0070661_100136559 | 3300005344 | Bacteria | 1846 |
| 117 | Ga0070692_10002556 | 3300005345 | Bacteria | 7090 |
| 118 | Ga0070692_10038062 | 3300005345 | Bacteria | 2449 |
| 119 | Ga0070692_10041679 | 3300005345 | Bacteria | 2353 |
| 120 | Ga0070692_10401366 | 3300005345 | Bacteria | 865 |
| 121 | Ga0070692_10447553 | 3300005345 | Bacteria | 826 |
| 122 | Ga0070668_100003568 | 3300005347 | Bacteria | 11474 |
| 123 | Ga0070669_100105892 | 3300005353 | Bacteria | 2128 |
| 124 | Ga0070675_100110912 | 3300005354 | Bacteria | 2321 |
| 125 | Ga0070671_100009135 | 3300005355 | Bacteria | 7960 |
| 126 | Ga0070671_100426226 | 3300005355 | Bacteria | 1136 |
| 127 | Ga0070671_100712638 | 3300005355 | Bacteria | 871 |
| 128 | Ga0070674_100044437 | 3300005356 | Bacteria | 3028 |
| 129 | Ga0070673_100659838 | 3300005364 | Bacteria | 958 |
| 130 | Ga0070673_101125850 | 3300005364 | Bacteria | 734 |
| 131 | Ga0070659_100001868 | 3300005366 | Bacteria | 15097 |
| 132 | Ga0070659_100222323 | 3300005366 | Bacteria | 1559 |
| 133 | Ga0070659_100430015 | 3300005366 | Bacteria | 1117 |
| 134 | Ga0070659_101189997 | 3300005366 | Bacteria | 674 |
| 135 | Ga0070667_101082518 | 3300005367 | Bacteria | 749 |
| 136 | Ga0070667_102095477 | 3300005367 | Bacteria | 533 |
| 137 | Ga0070714_100022876 | 3300005435 | Bacteria | 5128 |
| 138 | Ga0070714_100027310 | 3300005435 | Bacteria | 4726 |
| 139 | Ga0070714_100901719 | 3300005435 | Bacteria | 858 |
| 140 | Ga0070713_100559409 | 3300005436 | Bacteria | 1083 |
| 141 | Ga0070710_10078028 | 3300005437 | Bacteria | 1926 |
| 142 | Ga0070663_100005110 | 3300005455 | Bacteria | 7764 |
| 143 | Ga0070663_100047136 | 3300005455 | Bacteria | 3053 |
| 144 | Ga0070663_100056727 | 3300005455 | Bacteria | 2807 |
| 145 | Ga0070663_100116014 | 3300005455 | Bacteria | 2018 |
| 146 | Ga0070663_100186772 | 3300005455 | Bacteria | 1611 |
| 147 | Ga0070663_100435913 | 3300005455 | Bacteria | 1077 |
| 148 | Ga0070663_101054819 | 3300005455 | Bacteria | 709 |
| 149 | Ga0070678_100564622 | 3300005456 | Bacteria | 1012 |
| 150 | Ga0070662_100042379 | 3300005457 | Bacteria | 3251 |
| 151 | Ga0070662_100734210 | 3300005457 | Bacteria | 837 |
| 152 | Ga0070681_10000006 | 3300005458 | Bacteria | 169066 |
| 153 | Ga0070681_10000721 | 3300005458 | Bacteria | 27370 |
| 154 | Ga0070681_10002160 | 3300005458 | Bacteria | 17891 |
| 155 | Ga0070681_10011057 | 3300005458 | Bacteria | 8926 |
| 156 | Ga0070681_10011236 | 3300005458 | Bacteria | 8857 |
| 157 | Ga0070681_10042535 | 3300005458 | Bacteria | 4552 |
| 158 | Ga0070681_10113250 | 3300005458 | Bacteria | 2652 |
| 159 | Ga0070681_10150631 | 3300005458 | Bacteria | 2253 |
| 160 | Ga0070681_10166053 | 3300005458 | Bacteria | 2130 |
| 161 | Ga0070681_10213897 | 3300005458 | Bacteria | 1844 |
| 162 | Ga0070681_10296448 | 3300005458 | Bacteria | 1527 |
| 163 | Ga0068867_100310949 | 3300005459 | Bacteria | 1302 |
| 164 | Ga0070679_100000417 | 3300005530 | Bacteria | 36272 |
| 165 | Ga0070679_100006355 | 3300005530 | Bacteria | 11000 |
| 166 | Ga0070679_100009773 | 3300005530 | Bacteria | 9073 |
| 167 | Ga0070679_100010818 | 3300005530 | Bacteria | 8666 |
| 168 | Ga0070679_100023226 | 3300005530 | Bacteria | 6068 |
| 169 | Ga0070679_100046710 | 3300005530 | Bacteria | 4316 |
| 170 | Ga0070679_100151374 | 3300005530 | Bacteria | 2296 |
| 171 | Ga0070684_100141881 | 3300005535 | Bacteria | 2172 |
| 172 | Ga0070697_100287091 | 3300005536 | Bacteria | 1413 |
| 173 | Ga0068853_100053341 | 3300005539 | Bacteria | 3482 |
| 174 | Ga0068853_100482317 | 3300005539 | Bacteria | 1169 |
| 175 | Ga0068853_100557948 | 3300005539 | Bacteria | 1085 |
| 176 | Ga0070672_100004166 | 3300005543 | Bacteria | 9440 |
| 177 | Ga0070672_100017303 | 3300005543 | Bacteria | 5185 |
| 178 | Ga0070696_100006174 | 3300005546 | Bacteria | 8007 |
| 179 | Ga0070696_100007095 | 3300005546 | Bacteria | 7481 |
| 180 | Ga0070696_100035655 | 3300005546 | Bacteria | 3426 |
| 181 | Ga0070693_100004340 | 3300005547 | Bacteria | 6692 |
| 182 | Ga0070693_100049678 | 3300005547 | Bacteria | 2394 |
| 183 | Ga0070693_100741930 | 3300005547 | Bacteria | 723 |
| 184 | Ga0070665_100093482 | 3300005548 | Bacteria | 3012 |
| 185 | Ga0070665_100222700 | 3300005548 | Bacteria | 1887 |
| 186 | Ga0070665_100297671 | 3300005548 | Bacteria | 1616 |
| 187 | Ga0070665_100320193 | 3300005548 | Bacteria | 1555 |
| 188 | Ga0068855_100015479 | 3300005563 | Bacteria | 9182 |
| 189 | Ga0068855_100032020 | 3300005563 | Bacteria | 6278 |
| 190 | Ga0068855_100168143 | 3300005563 | Bacteria | 2484 |
| 191 | Ga0068855_100655671 | 3300005563 | Bacteria | 1127 |
| 192 | Ga0068855_100965600 | 3300005563 | Bacteria | 897 |
| 193 | Ga0068855_101881591 | 3300005563 | Bacteria | 606 |
| 194 | Ga0070664_100046166 | 3300005564 | Bacteria | 3679 |
| 195 | Ga0070664_100270730 | 3300005564 | Bacteria | 1530 |
| 196 | Ga0070664_101318083 | 3300005564 | Bacteria | 682 |
| 197 | Ga0068857_100001476 | 3300005577 | Bacteria | 18705 |
| 198 | Ga0068857_100059703 | 3300005577 | Bacteria | 3388 |
| 199 | Ga0068857_100125400 | 3300005577 | Bacteria | 2314 |
| 200 | Ga0068854_100001671 | 3300005578 | Bacteria | 13509 |
| 201 | Ga0068854_100001743 | 3300005578 | Bacteria | 13256 |
| 202 | Ga0068854_100354801 | 3300005578 | Bacteria | 1201 |
| 203 | Ga0068854_100910420 | 3300005578 | Bacteria | 773 |
| 204 | Ga0068856_100385280 | 3300005614 | Bacteria | 1421 |
| 205 | Ga0068856_100469816 | 3300005614 | Bacteria | 1278 |
| 206 | Ga0068852_100031648 | 3300005616 | Bacteria | 4369 |
| 207 | Ga0068852_100044930 | 3300005616 | Bacteria | 3755 |
| 208 | Ga0068852_100322097 | 3300005616 | Bacteria | 1501 |
| 209 | Ga0068852_100881383 | 3300005616 | Bacteria | 911 |
| 210 | Ga0068852_101161385 | 3300005616 | Bacteria | 793 |
| 211 | Ga0068852_101516220 | 3300005616 | Bacteria | 693 |
| 212 | Ga0068852_102430073 | 3300005616 | Bacteria | 544 |
| 213 | Ga0068859_101220764 | 3300005617 | Bacteria | 828 |
| 214 | Ga0068861_101341650 | 3300005719 | Bacteria | 697 |
| 215 | Ga0068851_10002109 | 3300005834 | Bacteria | 8748 |
| 216 | Ga0068851_10012619 | 3300005834 | Bacteria | 3987 |
| 217 | Ga0068863_100445831 | 3300005841 | Bacteria | 1270 |
| 218 | Ga0068858_100043017 | 3300005842 | Bacteria | 4189 |
| 219 | Ga0068862_100616280 | 3300005844 | Bacteria | 1044 |
| 220 | Ga0081539_10300300 | 3300005985 | Bacteria | 690 |
| 221 | Ga0075365_10156224 | 3300006038 | Bacteria | 1588 |
| 222 | Ga0075363_100077498 | 3300006048 | Bacteria | 1814 |
| 223 | Ga0075363_100169712 | 3300006048 | Bacteria | 1238 |
| 224 | Ga0075364_10042824 | 3300006051 | Bacteria | 2942 |
| 225 | Ga0075364_10135742 | 3300006051 | Bacteria | 1652 |
| 226 | Ga0075364_10211155 | 3300006051 | Bacteria | 1316 |
| 227 | Ga0075364_10249395 | 3300006051 | Bacteria | 1206 |
| 228 | Ga0075364_11228898 | 3300006051 | Bacteria | 508 |
| 229 | Ga0070716_100565352 | 3300006173 | Bacteria | 850 |
| 230 | Ga0075362_10373701 | 3300006177 | Bacteria | 716 |
| 231 | Ga0075369_10043214 | 3300006186 | Bacteria | 1933 |
| 232 | Ga0075369_10151627 | 3300006186 | Bacteria | 1060 |
| 233 | Ga0075369_10302596 | 3300006186 | Bacteria | 747 |
| 234 | Ga0075369_10590184 | 3300006186 | Bacteria | 531 |
| 235 | Ga0075366_10552632 | 3300006195 | Bacteria | 713 |
| 236 | Ga0075428_102082359 | 3300006844 | Bacteria | 587 |
| 237 | Ga0075436_100361767 | 3300006914 | Bacteria | 1047 |
| 238 | Ga0075436_100638836 | 3300006914 | Bacteria | 786 |
| 239 | Ga0097620_101220884 | 3300006931 | Bacteria | 828 |
| 240 | Ga0105251_10000452 | 3300009011 | Bacteria | 39601 |
| 241 | Ga0105251_10001834 | 3300009011 | Bacteria | 17487 |
| 242 | Ga0105244_10055685 | 3300009036 | Bacteria | 2003 |
| 243 | Ga0105240_10012166 | 3300009093 | Bacteria | 11912 |
| 244 | Ga0105240_10025498 | 3300009093 | Bacteria | 7768 |
| 245 | Ga0105240_10035445 | 3300009093 | Bacteria | 6430 |
| 246 | Ga0105240_10085082 | 3300009093 | Bacteria | 3876 |
| 247 | Ga0105240_10110006 | 3300009093 | Bacteria | 3336 |
| 248 | Ga0105240_10443179 | 3300009093 | Bacteria | 1455 |
| 249 | Ga0105247_10017867 | 3300009101 | Bacteria | 4254 |
| 250 | Ga0105243_10006966 | 3300009148 | Bacteria | 8703 |
| 251 | Ga0105243_10182221 | 3300009148 | Bacteria | 1827 |
| 252 | Ga0105243_11911836 | 3300009148 | Bacteria | 626 |
| 253 | Ga0105243_12237771 | 3300009148 | Bacteria | 584 |
| 254 | Ga0105241_10054272 | 3300009174 | Bacteria | 3067 |
| 255 | Ga0105241_10068360 | 3300009174 | Bacteria | 2752 |
| 256 | Ga0105241_10093319 | 3300009174 | Bacteria | 2378 |
| 257 | Ga0105242_11225772 | 3300009176 | Bacteria | 771 |
| 258 | Ga0105242_11834694 | 3300009176 | Bacteria | 645 |
| 259 | Ga0105248_10792907 | 3300009177 | Bacteria | 1069 |
| 260 | Ga0105237_10233012 | 3300009545 | Bacteria | 1842 |
| 261 | Ga0105237_12008028 | 3300009545 | Bacteria | 587 |
| 262 | Ga0105238_10018845 | 3300009551 | Bacteria | 7025 |
| 263 | Ga0105238_10684057 | 3300009551 | Bacteria | 1037 |
| 264 | Ga0105238_10918336 | 3300009551 | Bacteria | 894 |
| 265 | Ga0105032_100260 | 3300009979 | Bacteria | 5445 |
| 266 | Ga0105147_103760 | 3300009982 | Bacteria | 1273 |
| 267 | Ga0105029_102701 | 3300009984 | Bacteria | 1160 |
| 268 | Ga0105030_103164 | 3300009987 | Bacteria | 1424 |
| 269 | Ga0105028_102644 | 3300009993 | Bacteria | 1877 |
| 270 | Ga0105239_10102409 | 3300010375 | Bacteria | 3169 |
| 271 | Ga0105239_10166696 | 3300010375 | Bacteria | 2463 |
| 272 | Ga0105239_10195481 | 3300010375 | Bacteria | 2265 |
| 273 | Ga0105246_10181214 | 3300011119 | Bacteria | 1622 |
| 274 | Ga0157344_1017903 | 3300012476 | Bacteria | 586 |
| 275 | Ga0157318_1002421 | 3300012482 | Bacteria | 1014 |
| 276 | Ga0157343_1005956 | 3300012488 | Bacteria | 808 |
| 277 | Ga0157345_1027029 | 3300012498 | Bacteria | 621 |
| 278 | Ga0157347_1009209 | 3300012502 | Bacteria | 1017 |
| 279 | Ga0157342_1014254 | 3300012507 | Bacteria | 859 |
| 280 | Ga0157315_1017720 | 3300012508 | Bacteria | 719 |
| 281 | Ga0157315_1032405 | 3300012508 | Bacteria | 621 |
| 282 | Ga0157316_1000676 | 3300012510 | Bacteria | 1870 |
| 283 | Ga0157316_1003631 | 3300012510 | Bacteria | 1125 |
| 284 | Ga0157327_1001178 | 3300012512 | Bacteria | 1589 |
| 285 | Ga0157327_1002389 | 3300012512 | Bacteria | 1289 |
| 286 | Ga0157338_1096244 | 3300012515 | Bacteria | 501 |
| 287 | Ga0154010_113527 | 3300013062 | Bacteria | 1026 |
| 288 | Ga0157373_10020745 | 3300013100 | Bacteria | 4771 |
| 289 | Ga0157373_10133203 | 3300013100 | Bacteria | 1747 |
| 290 | Ga0157373_10154098 | 3300013100 | Bacteria | 1617 |
| 291 | Ga0157373_10190081 | 3300013100 | Bacteria | 1447 |
| 292 | Ga0157373_10382262 | 3300013100 | Bacteria | 1007 |
| 293 | Ga0157373_10447163 | 3300013100 | Bacteria | 930 |
| 294 | Ga0157373_10484721 | 3300013100 | Bacteria | 892 |
| 295 | Ga0157373_11185086 | 3300013100 | Bacteria | 575 |
| 296 | Ga0157371_10001931 | 3300013102 | Bacteria | 20697 |
| 297 | Ga0157371_10045390 | 3300013102 | Bacteria | 3127 |
| 298 | Ga0157371_10054731 | 3300013102 | Bacteria | 2833 |
| 299 | Ga0157371_10055956 | 3300013102 | Bacteria | 2798 |
| 300 | Ga0157371_10145693 | 3300013102 | Bacteria | 1688 |
| 301 | Ga0157371_10183034 | 3300013102 | Bacteria | 1499 |
| 302 | Ga0157371_10229099 | 3300013102 | Bacteria | 1335 |
| 303 | Ga0157371_10277885 | 3300013102 | Bacteria | 1209 |
| 304 | Ga0157371_10315295 | 3300013102 | Bacteria | 1134 |
| 305 | Ga0157371_10340155 | 3300013102 | Bacteria | 1091 |
| 306 | Ga0157371_10559012 | 3300013102 | Bacteria | 849 |
| 307 | Ga0157371_10750448 | 3300013102 | Bacteria | 733 |
| 308 | Ga0157371_10944355 | 3300013102 | Bacteria | 656 |
| 309 | Ga0157370_10003325 | 3300013104 | Bacteria | 18950 |
| 310 | Ga0157370_10003652 | 3300013104 | Bacteria | 17992 |
| 311 | Ga0157370_10033173 | 3300013104 | Bacteria | 5034 |
| 312 | Ga0157370_10036358 | 3300013104 | Bacteria | 4779 |
| 313 | Ga0157370_10044515 | 3300013104 | Bacteria | 4265 |
| 314 | Ga0157370_10046323 | 3300013104 | Bacteria | 4169 |
| 315 | Ga0157370_10048846 | 3300013104 | Bacteria | 4053 |
| 316 | Ga0157370_10064365 | 3300013104 | Bacteria | 3472 |
| 317 | Ga0157370_10143509 | 3300013104 | Bacteria | 2224 |
| 318 | Ga0157370_10151286 | 3300013104 | Bacteria | 2159 |
| 319 | Ga0157370_10526846 | 3300013104 | Bacteria | 1084 |
| 320 | Ga0157370_10530370 | 3300013104 | Bacteria | 1080 |
| 321 | Ga0157370_10664759 | 3300013104 | Bacteria | 952 |
| 322 | Ga0157369_10001292 | 3300013105 | Bacteria | 31120 |
| 323 | Ga0157369_10006527 | 3300013105 | Bacteria | 13515 |
| 324 | Ga0157369_10090465 | 3300013105 | Bacteria | 3267 |
| 325 | Ga0157369_10099266 | 3300013105 | Bacteria | 3104 |
| 326 | Ga0157369_10105504 | 3300013105 | Bacteria | 3000 |
| 327 | Ga0157369_10106052 | 3300013105 | Bacteria | 2991 |
| 328 | Ga0157369_10705786 | 3300013105 | Bacteria | 1039 |
| 329 | Ga0163162_10871887 | 3300013306 | Bacteria | 1014 |
| 330 | Ga0163162_12088368 | 3300013306 | Bacteria | 650 |
| 331 | Ga0157372_10021240 | 3300013307 | Bacteria | 7013 |
| 332 | Ga0157372_10034344 | 3300013307 | Bacteria | 5574 |
| 333 | Ga0157372_10074339 | 3300013307 | Bacteria | 3832 |
| 334 | Ga0157372_10125890 | 3300013307 | Bacteria | 2946 |
| 335 | Ga0157372_10138037 | 3300013307 | Bacteria | 2808 |
| 336 | Ga0157372_10171987 | 3300013307 | Bacteria | 2506 |
| 337 | Ga0157372_10269523 | 3300013307 | Bacteria | 1978 |
| 338 | Ga0157372_10297299 | 3300013307 | Bacteria | 1878 |
| 339 | Ga0157372_10657754 | 3300013307 | Bacteria | 1220 |
| 340 | Ga0157372_10758775 | 3300013307 | Bacteria | 1128 |
| 341 | Ga0157375_10031579 | 3300013308 | Bacteria | 5009 |
| 342 | Ga0157375_12486801 | 3300013308 | Bacteria | 618 |
| 343 | Ga0163163_11191094 | 3300014325 | Bacteria | 824 |
| 344 | Ga0182008_10000150 | 3300014497 | Bacteria | 54361 |
| 345 | Ga0182008_10007538 | 3300014497 | Bacteria | 6002 |
| 346 | Ga0182008_10007676 | 3300014497 | Bacteria | 5945 |
| 347 | Ga0182008_10012691 | 3300014497 | Bacteria | 4443 |
| 348 | Ga0182008_10019810 | 3300014497 | Bacteria | 3469 |
| 349 | Ga0182008_10032898 | 3300014497 | Bacteria | 2603 |
| 350 | Ga0182008_10118165 | 3300014497 | Bacteria | 1316 |
| 351 | Ga0182006_1000074 | 3300015261 | Bacteria | 130403 |
| 352 | Ga0182006_1000613 | 3300015261 | Bacteria | 25728 |
| 353 | Ga0182006_1007534 | 3300015261 | Bacteria | 4975 |
| 354 | Ga0182006_1008997 | 3300015261 | Bacteria | 4498 |
| 355 | Ga0182006_1009303 | 3300015261 | Bacteria | 4410 |
| 356 | Ga0182006_1011383 | 3300015261 | Bacteria | 3917 |
| 357 | Ga0182006_1036605 | 3300015261 | Bacteria | 1950 |
| 358 | Ga0182006_1062998 | 3300015261 | Bacteria | 1394 |
| 359 | Ga0182006_1092917 | 3300015261 | Bacteria | 1082 |
| 360 | Ga0182007_10000593 | 3300015262 | Bacteria | 21185 |
| 361 | Ga0182007_10002107 | 3300015262 | Bacteria | 10185 |
| 362 | Ga0182007_10004902 | 3300015262 | Bacteria | 5976 |
| 363 | Ga0182007_10012917 | 3300015262 | Bacteria | 3201 |
| 364 | Ga0182007_10063115 | 3300015262 | Bacteria | 1214 |
| 365 | Ga0182005_1000034 | 3300015265 | Bacteria | 180998 |
| 366 | Ga0182005_1001301 | 3300015265 | Bacteria | 10255 |
| 367 | Ga0182005_1002601 | 3300015265 | Bacteria | 6379 |
| 368 | Ga0182005_1011780 | 3300015265 | Bacteria | 2484 |
| 369 | Ga0182005_1015576 | 3300015265 | Bacteria | 2119 |
| 370 | Ga0182005_1081212 | 3300015265 | Bacteria | 895 |
| 371 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 372 | Ga0163161_10001446 | 3300017792 | Bacteria | 17559 |
| 373 | Ga0163161_10024367 | 3300017792 | Bacteria | 4274 |
| 374 | Ga0197907_10940396 | 3300020069 | Bacteria | 661 |
| 375 | Ga0206356_10517904 | 3300020070 | Bacteria | 14925 |
| 376 | Ga0206356_11822277 | 3300020070 | Bacteria | 3430 |
| 377 | Ga0206355_1282734 | 3300020076 | Bacteria | 863 |
| 378 | Ga0206351_10169628 | 3300020077 | Bacteria | 3027 |
| 379 | Ga0206350_10952999 | 3300020080 | Bacteria | 2011 |
| 380 | Ga0206354_10418515 | 3300020081 | Bacteria | 3055 |
| 381 | Ga0206354_11023207 | 3300020081 | Bacteria | 1465 |
| 382 | Ga0206353_10062743 | 3300020082 | Bacteria | 1557 |
| 383 | Ga0206353_12055317 | 3300020082 | Bacteria | 1115 |
| 384 | Ga0154015_1481086 | 3300020610 | Bacteria | 9071 |
| 385 | Ga0224712_10040408 | 3300022467 | Bacteria | 1755 |
| 386 | Ga0207425_1000028 | 3300025245 | Bacteria | 286333 |
| 387 | Ga0207425_1004601 | 3300025245 | Bacteria | 4093 |
| 388 | Ga0209129_1000011 | 3300025258 | Bacteria | 568657 |
| 389 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 390 | Ga0209565_1000023 | 3300025263 | Bacteria | 388244 |
| 391 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 392 | Ga0209673_1000308 | 3300025273 | Bacteria | 90538 |
| 393 | Ga0209673_1000853 | 3300025273 | Bacteria | 39621 |
| 394 | Ga0209130_1006582 | 3300025284 | Bacteria | 3749 |
| 395 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 396 | Ga0209675_1000154 | 3300025291 | Bacteria | 89426 |
| 397 | Ga0209676_1000086 | 3300025292 | Bacteria | 264155 |
| 398 | Ga0209676_1000189 | 3300025292 | Bacteria | 141166 |
| 399 | Ga0209676_1000339 | 3300025292 | Bacteria | 89252 |
| 400 | Ga0209676_1000352 | 3300025292 | Bacteria | 87022 |
| 401 | Ga0209676_1000353 | 3300025292 | Bacteria | 86825 |
| 402 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 403 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 404 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 405 | Ga0209564_1000106 | 3300025295 | Bacteria | 216131 |
| 406 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 407 | Ga0209758_1030942 | 3300025297 | Bacteria | 2205 |
| 408 | Ga0209050_1000338 | 3300025298 | Bacteria | 92924 |
| 409 | Ga0209050_1000436 | 3300025298 | Bacteria | 76328 |
| 410 | Ga0209050_1018789 | 3300025298 | Bacteria | 2663 |
| 411 | Ga0209050_1053133 | 3300025298 | Bacteria | 1009 |
| 412 | Ga0209050_1075148 | 3300025298 | Bacteria | 739 |
| 413 | Ga0209050_1101613 | 3300025298 | Bacteria | 568 |
| 414 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 415 | Ga0209256_1001379 | 3300025299 | Bacteria | 25429 |
| 416 | Ga0209256_1011347 | 3300025299 | Bacteria | 3575 |
| 417 | Ga0209051_1001864 | 3300025303 | Bacteria | 16550 |
| 418 | Ga0209257_1000062 | 3300025304 | Bacteria | 362413 |
| 419 | Ga0209257_1000145 | 3300025304 | Bacteria | 195152 |
| 420 | Ga0209257_1000241 | 3300025304 | Bacteria | 127802 |
| 421 | Ga0209257_1000251 | 3300025304 | Bacteria | 123796 |
| 422 | Ga0209257_1005006 | 3300025304 | Bacteria | 9662 |
| 423 | Ga0209257_1005750 | 3300025304 | Bacteria | 8479 |
| 424 | Ga0207656_10121416 | 3300025321 | Bacteria | 1217 |
| 425 | Ga0207713_1000840 | 3300025735 | Bacteria | 28232 |
| 426 | Ga0207713_1004179 | 3300025735 | Bacteria | 9471 |
| 427 | Ga0207688_10214077 | 3300025901 | Bacteria | 1159 |
| 428 | Ga0207647_10001048 | 3300025904 | Bacteria | 21375 |
| 429 | Ga0207647_10001755 | 3300025904 | Bacteria | 16635 |
| 430 | Ga0207643_10439068 | 3300025908 | Bacteria | 829 |
| 431 | Ga0207705_10000247 | 3300025909 | Bacteria | 53248 |
| 432 | Ga0207705_10000564 | 3300025909 | Bacteria | 31096 |
| 433 | Ga0207705_10000852 | 3300025909 | Bacteria | 25000 |
| 434 | Ga0207705_10000941 | 3300025909 | Bacteria | 23777 |
| 435 | Ga0207705_10012701 | 3300025909 | Bacteria | 6076 |
| 436 | Ga0207705_10060610 | 3300025909 | Bacteria | 2733 |
| 437 | Ga0207705_10252829 | 3300025909 | Bacteria | 1344 |
| 438 | Ga0207705_10906234 | 3300025909 | Bacteria | 683 |
| 439 | Ga0207654_10137718 | 3300025911 | Bacteria | 1553 |
| 440 | Ga0207654_10169990 | 3300025911 | Bacteria | 1415 |
| 441 | Ga0207707_10000179 | 3300025912 | Bacteria | 66039 |
| 442 | Ga0207707_10000370 | 3300025912 | Bacteria | 47164 |
| 443 | Ga0207707_10000531 | 3300025912 | Bacteria | 38859 |
| 444 | Ga0207707_10001002 | 3300025912 | Bacteria | 27055 |
| 445 | Ga0207707_10007858 | 3300025912 | Bacteria | 9273 |
| 446 | Ga0207707_10018206 | 3300025912 | Bacteria | 6123 |
| 447 | Ga0207707_10029589 | 3300025912 | Bacteria | 4789 |
| 448 | Ga0207707_10205897 | 3300025912 | Bacteria | 1715 |
| 449 | Ga0207707_11588313 | 3300025912 | Bacteria | 515 |
| 450 | Ga0207695_10000614 | 3300025913 | Bacteria | 71515 |
| 451 | Ga0207695_10002572 | 3300025913 | Bacteria | 26664 |
| 452 | Ga0207695_10002586 | 3300025913 | Bacteria | 26548 |
| 453 | Ga0207695_10008776 | 3300025913 | Bacteria | 12604 |
| 454 | Ga0207660_10001033 | 3300025917 | Bacteria | 18412 |
| 455 | Ga0207660_10004313 | 3300025917 | Bacteria | 9274 |
| 456 | Ga0207660_10006603 | 3300025917 | Bacteria | 7527 |
| 457 | Ga0207660_10012451 | 3300025917 | Bacteria | 5566 |
| 458 | Ga0207660_10044221 | 3300025917 | Bacteria | 3133 |
| 459 | Ga0207660_10048865 | 3300025917 | Bacteria | 2995 |
| 460 | Ga0207660_10148593 | 3300025917 | Bacteria | 1798 |
| 461 | Ga0207660_10187723 | 3300025917 | Bacteria | 1608 |
| 462 | Ga0207660_10438778 | 3300025917 | Bacteria | 1055 |
| 463 | Ga0207657_10068777 | 3300025919 | Bacteria | 3007 |
| 464 | Ga0207657_10073439 | 3300025919 | Bacteria | 2890 |
| 465 | Ga0207649_10003622 | 3300025920 | Bacteria | 8436 |
| 466 | Ga0207649_10023696 | 3300025920 | Bacteria | 3558 |
| 467 | Ga0207649_10026610 | 3300025920 | Bacteria | 3386 |
| 468 | Ga0207649_10035625 | 3300025920 | Bacteria | 2991 |
| 469 | Ga0207649_10238205 | 3300025920 | Bacteria | 1305 |
| 470 | Ga0207652_10000048 | 3300025921 | Bacteria | 124452 |
| 471 | Ga0207652_10000442 | 3300025921 | Bacteria | 42938 |
| 472 | Ga0207652_10001106 | 3300025921 | Bacteria | 24327 |
| 473 | Ga0207652_10006756 | 3300025921 | Bacteria | 9249 |
| 474 | Ga0207652_10015204 | 3300025921 | Bacteria | 6246 |
| 475 | Ga0207652_10069198 | 3300025921 | Bacteria | 3064 |
| 476 | Ga0207652_10399454 | 3300025921 | Bacteria | 1240 |
| 477 | Ga0207694_10040967 | 3300025924 | Bacteria | 3568 |
| 478 | Ga0207650_10005802 | 3300025925 | Bacteria | 8427 |
| 479 | Ga0207650_10023776 | 3300025925 | Bacteria | 4351 |
| 480 | Ga0207650_10232298 | 3300025925 | Bacteria | 1488 |
| 481 | Ga0207650_10291087 | 3300025925 | Bacteria | 1332 |
| 482 | Ga0207650_11638541 | 3300025925 | Bacteria | 546 |
| 483 | Ga0207659_10323083 | 3300025926 | Bacteria | 1274 |
| 484 | Ga0207659_10611570 | 3300025926 | Bacteria | 930 |
| 485 | Ga0207664_10728816 | 3300025929 | Bacteria | 892 |
| 486 | Ga0207644_10640184 | 3300025931 | Bacteria | 884 |
| 487 | Ga0207690_10002129 | 3300025932 | Bacteria | 12124 |
| 488 | Ga0207690_10005343 | 3300025932 | Bacteria | 7569 |
| 489 | Ga0207690_10028095 | 3300025932 | Bacteria | 3562 |
| 490 | Ga0207690_10292869 | 3300025932 | Bacteria | 1271 |
| 491 | Ga0207706_10030079 | 3300025933 | Bacteria | 4846 |
| 492 | Ga0207706_10240444 | 3300025933 | Bacteria | 1583 |
| 493 | Ga0207706_10342421 | 3300025933 | Bacteria | 1300 |
| 494 | Ga0207686_10477831 | 3300025934 | Bacteria | 963 |
| 495 | Ga0207709_10001996 | 3300025935 | Bacteria | 13250 |
| 496 | Ga0207709_10578729 | 3300025935 | Bacteria | 886 |
| 497 | Ga0207669_10427313 | 3300025937 | Bacteria | 1044 |
| 498 | Ga0207691_10004879 | 3300025940 | Bacteria | 12966 |
| 499 | Ga0207661_10005779 | 3300025944 | Bacteria | 8723 |
| 500 | Ga0207661_10146207 | 3300025944 | Bacteria | 2039 |
| 501 | Ga0207661_10465607 | 3300025944 | Bacteria | 1153 |
| 502 | Ga0207661_10717725 | 3300025944 | Bacteria | 920 |
| 503 | Ga0207679_10083104 | 3300025945 | Bacteria | 2453 |
| 504 | Ga0207679_10514759 | 3300025945 | Bacteria | 1069 |
| 505 | Ga0207667_10000985 | 3300025949 | Bacteria | 36427 |
| 506 | Ga0207667_10002428 | 3300025949 | Bacteria | 23335 |
| 507 | Ga0207667_10002908 | 3300025949 | Bacteria | 21271 |
| 508 | Ga0207667_10006102 | 3300025949 | Bacteria | 14648 |
| 509 | Ga0207667_10013249 | 3300025949 | Bacteria | 9451 |
| 510 | Ga0207667_10016617 | 3300025949 | Bacteria | 8308 |
| 511 | Ga0207667_10166301 | 3300025949 | Bacteria | 2268 |
| 512 | Ga0207668_10053167 | 3300025972 | Bacteria | 2805 |
| 513 | Ga0207668_10119756 | 3300025972 | Bacteria | 1991 |
| 514 | Ga0207640_10000400 | 3300025981 | Bacteria | 27544 |
| 515 | Ga0207640_10000522 | 3300025981 | Bacteria | 23181 |
| 516 | Ga0207640_10002030 | 3300025981 | Bacteria | 10938 |
| 517 | Ga0207640_10064046 | 3300025981 | Bacteria | 2446 |
| 518 | Ga0207658_11792212 | 3300025986 | Bacteria | 560 |
| 519 | Ga0207639_10001025 | 3300026041 | Bacteria | 19005 |
| 520 | Ga0207639_10029846 | 3300026041 | Bacteria | 3996 |
| 521 | Ga0207639_10189383 | 3300026041 | Bacteria | 1756 |
| 522 | Ga0207678_10009617 | 3300026067 | Bacteria | 8503 |
| 523 | Ga0207678_10023229 | 3300026067 | Bacteria | 5424 |
| 524 | Ga0207678_10086224 | 3300026067 | Bacteria | 2683 |
| 525 | Ga0207678_10093676 | 3300026067 | Bacteria | 2566 |
| 526 | Ga0207678_10466479 | 3300026067 | Bacteria | 1099 |
| 527 | Ga0207678_10466745 | 3300026067 | Bacteria | 1098 |
| 528 | Ga0207678_11847152 | 3300026067 | Bacteria | 528 |
| 529 | Ga0207702_10001167 | 3300026078 | Bacteria | 26817 |
| 530 | Ga0207702_10092358 | 3300026078 | Bacteria | 2652 |
| 531 | Ga0207702_10101007 | 3300026078 | Bacteria | 2546 |
| 532 | Ga0207641_10207376 | 3300026088 | Bacteria | 1811 |
| 533 | Ga0207648_10126680 | 3300026089 | Bacteria | 2246 |
| 534 | Ga0207674_10002238 | 3300026116 | Bacteria | 24500 |
| 535 | Ga0207674_10104930 | 3300026116 | Bacteria | 2804 |
| 536 | Ga0207674_10112905 | 3300026116 | Bacteria | 2690 |
| 537 | Ga0207675_100459334 | 3300026118 | Bacteria | 1263 |
| 538 | Ga0207683_10108207 | 3300026121 | Bacteria | 2487 |
| 539 | Ga0207683_10629232 | 3300026121 | Bacteria | 994 |
| 540 | Ga0207698_10002102 | 3300026142 | Bacteria | 11748 |
| 541 | Ga0207698_10027686 | 3300026142 | Bacteria | 4028 |
| 542 | Ga0207698_10142823 | 3300026142 | Bacteria | 2065 |
| 543 | Ga0207698_10833091 | 3300026142 | Bacteria | 926 |
| 544 | Ga0207698_11877260 | 3300026142 | Bacteria | 614 |
| 545 | Ga0209371_1000007 | 3300027312 | Bacteria | 1050654 |
| 546 | Ga0209371_1000044 | 3300027312 | Bacteria | 327086 |
| 547 | Ga0209967_1008559 | 3300027364 | Bacteria | 1410 |
| 548 | Ga0209984_1005401 | 3300027424 | Bacteria | 1536 |
| 549 | Ga0209995_1023015 | 3300027471 | Bacteria | 1035 |
| 550 | Ga0209999_1004919 | 3300027543 | Bacteria | 2404 |
| 551 | Ga0209982_1002466 | 3300027552 | Bacteria | 2597 |
| 552 | Ga0209970_1009866 | 3300027614 | Bacteria | 1561 |
| 553 | Ga0209983_1005873 | 3300027665 | Bacteria | 2534 |
| 554 | Ga0209983_1089308 | 3300027665 | Bacteria | 693 |
| 555 | Ga0209971_1003685 | 3300027682 | Bacteria | 3632 |
| 556 | Ga0209974_10004863 | 3300027876 | Bacteria | 4757 |
| 557 | Ga0209974_10018648 | 3300027876 | Bacteria | 2302 |
| 558 | Ga0268266_10091111 | 3300028379 | Bacteria | 2673 |
| 559 | Ga0268266_10154547 | 3300028379 | Bacteria | 2071 |
| 560 | Ga0268266_10407169 | 3300028379 | Bacteria | 1287 |
| 561 | Ga0268266_10427490 | 3300028379 | Bacteria | 1256 |
| 562 | Ga0268265_10575381 | 3300028380 | Bacteria | 1073 |
| 563 | Ga0268256_1000008 | 3300030500 | Bacteria | 1050654 |
| 564 | Ga0268256_1000046 | 3300030500 | Bacteria | 327003 |
| 565 | Ga0316177_1197228 | 3300030731 | Bacteria | 4248 |
| 566 | Ga0316176_1101966 | 3300030732 | Bacteria | 6761 |
| 567 | Ga0316176_1153863 | 3300030732 | Bacteria | 810 |
| 568 | Ga0314311_1141252 | 3300030733 | Bacteria | 1942 |
| 569 | Ga0316183_1000987 | 3300030742 | Bacteria | 2397 |
| 570 | Ga0316181_1021124 | 3300030744 | Bacteria | 725 |
| 571 | Ga0316181_1027782 | 3300030744 | Bacteria | 2321 |
| 572 | Ga0307513_10044300 | 3300031456 | Bacteria | 4875 |
| 573 | Ga0307513_10880804 | 3300031456 | Bacteria | 602 |
| 574 | Ga0307408_100032413 | 3300031548 | Bacteria | 3643 |
| 575 | Ga0307408_100199732 | 3300031548 | Bacteria | 1617 |
| 576 | Ga0307408_101234460 | 3300031548 | Bacteria | 698 |
| 577 | Ga0316575_10361718 | 3300031665 | Bacteria | 619 |
| 578 | Ga0307405_10305111 | 3300031731 | Bacteria | 1209 |
| 579 | Ga0307405_10540365 | 3300031731 | Bacteria | 941 |
| 580 | Ga0307413_10018649 | 3300031824 | Bacteria | 3646 |
| 581 | Ga0307413_10053952 | 3300031824 | Bacteria | 2436 |
| 582 | Ga0307413_10225973 | 3300031824 | Bacteria | 1371 |
| 583 | Ga0307413_10270012 | 3300031824 | Bacteria | 1273 |
| 584 | Ga0307413_10281785 | 3300031824 | Bacteria | 1250 |
| 585 | Ga0307410_10595266 | 3300031852 | Bacteria | 922 |
| 586 | Ga0307406_10000786 | 3300031901 | Bacteria | 17777 |
| 587 | Ga0307406_10425084 | 3300031901 | Bacteria | 1059 |
| 588 | Ga0307406_11210612 | 3300031901 | Bacteria | 656 |
| 589 | Ga0307407_10035669 | 3300031903 | Bacteria | 2734 |
| 590 | Ga0307407_10572923 | 3300031903 | Bacteria | 837 |
| 591 | Ga0307412_10088100 | 3300031911 | Bacteria | 2164 |
| 592 | Ga0307412_10121196 | 3300031911 | Bacteria | 1883 |
| 593 | Ga0307412_10506041 | 3300031911 | Bacteria | 1006 |
| 594 | Ga0307409_100193246 | 3300031995 | Bacteria | 1814 |
| 595 | Ga0307409_100240886 | 3300031995 | Bacteria | 1646 |
| 596 | Ga0307416_101115781 | 3300032002 | Bacteria | 893 |
| 597 | Ga0307414_10003039 | 3300032004 | Bacteria | 8897 |
| 598 | Ga0307414_10018468 | 3300032004 | Bacteria | 4295 |
| 599 | Ga0307414_10019251 | 3300032004 | Bacteria | 4226 |
| 600 | Ga0307414_10020108 | 3300032004 | Bacteria | 4153 |
| 601 | Ga0307414_10027020 | 3300032004 | Bacteria | 3702 |
| 602 | Ga0307414_10029130 | 3300032004 | Bacteria | 3589 |
| 603 | Ga0307414_10043783 | 3300032004 | Bacteria | 3052 |
| 604 | Ga0307414_10388113 | 3300032004 | Bacteria | 1209 |
| 605 | Ga0307414_10823797 | 3300032004 | Bacteria | 847 |
| 606 | Ga0307414_10970266 | 3300032004 | Bacteria | 781 |
| 607 | Ga0307414_11975364 | 3300032004 | Bacteria | 544 |
| 608 | Ga0307411_10081058 | 3300032005 | Bacteria | 2233 |
| 609 | Ga0307411_10225602 | 3300032005 | Bacteria | 1457 |
| 610 | Ga0307411_10260497 | 3300032005 | Bacteria | 1369 |
| 611 | Ga0307411_10643837 | 3300032005 | Bacteria | 917 |
| 612 | Ga0307415_100833881 | 3300032126 | Bacteria | 844 |
| 613 | Ga0316585_10047330 | 3300032137 | Bacteria | 1377 |
| 614 | Ga0316593_10001114 | 3300032168 | Bacteria | 5669 |
| 615 | Ga0316592_1020612 | 3300033524 | Bacteria | 1401 |
| 616 | Ga0316592_1030411 | 3300033524 | Bacteria | 1174 |
| 617 | Ga0316586_1018861 | 3300033527 | Bacteria | 1122 |
| 618 | Ga0316588_1073687 | 3300033528 | Bacteria | 840 |
| 619 | Ga0316587_1009992 | 3300033529 | Bacteria | 1513 |
| 620 | Ga0316587_1071017 | 3300033529 | Unclassified | 652 |
| 621 | Ga0316596_1000045 | 3300033541 | Bacteria | 13494 |
| 622 | Ga0316596_1002151 | 3300033541 | Bacteria | 4166 |
| 623 | Ga0373926_0429009 | 3300035083 | Bacteria | 523 |
| 624 | Ga0373934_0000117 | 3300035086 | Bacteria | 28415 |
| 625 | Ga0373934_0024244 | 3300035086 | Bacteria | 2346 |
| 626 | Ga0373944_0020080 | 3300035089 | Bacteria | 1921 |
| 627 | Ga0373936_0001779 | 3300035113 | Bacteria | 7920 |
| 628 | Ga0373941_0412956 | 3300035115 | Bacteria | 560 |
| 629 | Ga0373945_0045936 | 3300035116 | Bacteria | 1592 |
| 630 | Ga0373953_0002712 | 3300035117 | Bacteria | 5369 |
| 631 | Ga0373953_0009182 | 3300035117 | Bacteria | 3388 |
| 632 | Ga0373954_0001527 | 3300035118 | Bacteria | 9416 |
| 633 | Ga0373954_0001689 | 3300035118 | Bacteria | 9049 |
| 634 | Ga0373954_0127959 | 3300035118 | Bacteria | 1235 |
| 635 | Ga0373956_0000872 | 3300035119 | Bacteria | 12539 |
| 636 | Ga0373956_0008901 | 3300035119 | Bacteria | 4067 |
| 637 | Ga0373943_0091592 | 3300035170 | Bacteria | 1575 |
| 638 | Ga0373943_0996851 | 3300035170 | Bacteria | 502 |
| 639 | Ga0373946_0012699 | 3300035171 | Bacteria | 3156 |
| 640 | Ga0373955_0003035 | 3300035172 | Bacteria | 7351 |
| 641 | Ga0373955_0005998 | 3300035172 | Bacteria | 5511 |
| 642 | Ga0316574_0111585 | 3300035398 | Bacteria | 1753 |
| 643 | Ga0316574_0169261 | 3300035398 | Bacteria | 1407 |
| 644 | Ga0373924_0005478 | 3300035410 | Bacteria | 4497 |
| 645 | Ga0373924_0112916 | 3300035410 | Bacteria | 1175 |
| 646 | Ga0373935_0007864 | 3300035692 | Bacteria | 6396 |
| 647 | Ga0373927_0027435 | 3300035695 | Bacteria | 3718 |
| 648 | Ga0373933_0000538 | 3300035724 | Bacteria | 23511 |
| 649 | Ga0373933_0097423 | 3300035724 | Bacteria | 1821 |
| 650 | Ga0373947_0104939 | 3300035725 | Bacteria | 1780 |
| 651 | Ga0373937_0004252 | 3300036401 | Bacteria | 12134 |
| 652 | Ga0373937_0087499 | 3300036401 | Bacteria | 2883 |
| 653 | Ga0373937_0102007 | 3300036401 | Bacteria | 2663 |
| 654 | Ga0316582_0031233 | 3300036647 | Bacteria | 3254 |
| 655 | Ga0316582_0708410 | 3300036647 | Bacteria | 691 |
| 656 | Ga0316584_0002473 | 3300036712 | Bacteria | 11693 |
| 657 | Ga0316584_0024676 | 3300036712 | Bacteria | 4403 |
| 658 | Ga0373925_0022862 | 3300037068 | Bacteria | 4562 |
| 659 | Ga0395899_0008079 | 3300037312 | Bacteria | 8104 |
| 660 | Ga0395899_0037362 | 3300037312 | Bacteria | 3640 |
| 661 | Ga0395899_0255843 | 3300037312 | Bacteria | 1200 |
| 662 | Ga0395900_0006648 | 3300037418 | Bacteria | 12020 |
| 663 | Ga0395900_0014342 | 3300037418 | Bacteria | 8092 |
| 664 | Ga0395900_0072692 | 3300037418 | Bacteria | 3535 |
| 665 | Ga0395900_0194212 | 3300037418 | Bacteria | 2057 |
| 666 | Ga0395900_0329038 | 3300037418 | Bacteria | 1506 |
| 667 | Ga0395898_0188879 | 3300037466 | Bacteria | 1969 |
| 668 | Ga0395898_0394351 | 3300037466 | Bacteria | 1320 |
| 669 | Ga0395898_0552814 | 3300037466 | Bacteria | 1093 |
| 670 | Ga0395898_1592722 | 3300037466 | Bacteria | 577 |
| 671 | Ga0395905_0002473 | 3300037471 | Bacteria | 20471 |
| 672 | Ga0395905_0024203 | 3300037471 | Bacteria | 5731 |
| 673 | Ga0395905_0051566 | 3300037471 | Bacteria | 3854 |
| 674 | Ga0395905_0342937 | 3300037471 | Bacteria | 1385 |
| 675 | Ga0395905_0993866 | 3300037471 | Bacteria | 742 |
| 676 | Ga0395905_1260485 | 3300037471 | Bacteria | 643 |
| 677 | Ga0395901_0004189 | 3300038443 | Bacteria | 14551 |
| 678 | Ga0395901_0221527 | 3300038443 | Bacteria | 1977 |
| 679 | Ga0395901_0257197 | 3300038443 | Bacteria | 1818 |
| 680 | Ga0237819_00020 | 3300038705 | Bacteria | 55328 |
| 681 | Ga0237819_03480 | 3300038705 | Bacteria | 2777 |
| 682 | Ga0400487_30990 | 3300039110 | Bacteria | 48631 |
| 683 | Ga0237816_00850 | 3300039145 | Bacteria | 2511 |
| 684 | Ga0439436_0020710 | 3300041404 | Bacteria | 1958 |
| 685 | Ga0439439_0007383 | 3300041406 | Bacteria | 2569 |
| 686 | Ga0439447_002680 | 3300041407 | Bacteria | 6449 |
| 687 | Ga0439461_0007523 | 3300041410 | Bacteria | 1933 |
| 688 | Ga0439465_0313078 | 3300041413 | Bacteria | 589 |
| 689 | Ga0451789_0131347 | 3300041443 | Bacteria | 554 |
| 690 | Ga0451791_0561885 | 3300041451 | Bacteria | 1325 |
| 691 | Ga0451791_1462544 | 3300041451 | Bacteria | 1140 |
| 692 | Ga0451791_1793509 | 3300041451 | Bacteria | 1121 |
| 693 | Ga0451793_0336199 | 3300041452 | Bacteria | 556 |
| 694 | Ga0451793_1063530 | 3300041452 | Bacteria | 1357 |
| 695 | Ga0451797_0428518 | 3300041453 | Bacteria | 2120 |
| 696 | Ga0451798_0188667 | 3300041458 | Bacteria | 738 |
| 697 | Ga0451798_0789294 | 3300041458 | Bacteria | 685 |
| 698 | Ga0451800_0006649 | 3300041459 | Bacteria | 6705 |
| 699 | Ga0451800_1174804 | 3300041459 | Bacteria | 1034 |
| 700 | Ga0451802_0967991 | 3300041460 | Bacteria | 1253 |
| 701 | Ga0451806_463085 | 3300041462 | Bacteria | 4527 |
| 702 | Ga0451804_0888890 | 3300041463 | Bacteria | 1662 |
| 703 | Ga0451807_0135036 | 3300041486 | Bacteria | 4432 |
| 704 | Ga0451807_0579398 | 3300041486 | Bacteria | 768 |
| 705 | Ga0451807_2089236 | 3300041486 | Bacteria | 659 |
| 706 | Ga0451837_0413310 | 3300041494 | Bacteria | 848 |
| 707 | Ga0451837_0517197 | 3300041494 | Bacteria | 1440 |
| 708 | Ga0451837_0542531 | 3300041494 | Bacteria | 860 |
| 709 | Ga0451837_1508750 | 3300041494 | Bacteria | 1141 |
| 710 | Ga0451837_1513119 | 3300041494 | Bacteria | 3158 |
| 711 | Ga0451849_0497687 | 3300041505 | Bacteria | 623 |
| 712 | Ga0451843_0822388 | 3300041509 | Bacteria | 1856 |
| 713 | Ga0451843_0831223 | 3300041509 | Bacteria | 1027 |
| 714 | Ga0451843_1160092 | 3300041509 | Bacteria | 585 |
| 715 | Ga0451853_3186346 | 3300041512 | Bacteria | 503 |
| 716 | Ga0439431_0035675 | 3300041997 | Bacteria | 1250 |
| 717 | Ga0439433_0062718 | 3300041999 | Bacteria | 888 |
| 718 | Ga0439433_0157645 | 3300041999 | Bacteria | 587 |
| 719 | Ga0439445_0000440 | 3300042004 | Bacteria | 8406 |
| 720 | Ga0439445_0214150 | 3300042004 | Bacteria | 571 |
| 721 | Ga0439432_019085 | 3300042006 | Bacteria | 2287 |
| 722 | Ga0439432_037299 | 3300042006 | Bacteria | 1552 |
| 723 | Ga0439432_112573 | 3300042006 | Bacteria | 809 |
| 724 | Ga0439449_0000015 | 3300042007 | Bacteria | 49208 |
| 725 | Ga0439449_0003761 | 3300042007 | Bacteria | 5877 |
| 726 | Ga0439449_0004752 | 3300042007 | Bacteria | 5245 |
| 727 | Ga0439457_096599 | 3300042014 | Bacteria | 686 |
| 728 | Ga0439462_0066093 | 3300042015 | Bacteria | 980 |
| 729 | Ga0450906_074826 | 3300042145 | Bacteria | 608 |
| 730 | Ga0450893_0146196 | 3300042532 | Bacteria | 507 |
| 731 | Ga0451577_0005176 | 3300042876 | Bacteria | 13416 |
| 732 | Ga0466965_0112697 | 3300044683 | Bacteria | 1399 |
| 733 | Ga0453684_0001175 | 3300044712 | Bacteria | 81229 |
| 734 | Ga0453684_0004610 | 3300044712 | Bacteria | 28724 |
| 735 | Ga0453684_0468063 | 3300044712 | Bacteria | 1400 |
| 736 | Ga0495627_035709 | 3300046453 | Bacteria | 1548 |
| 737 | Ga0495592_0002813 | 3300046454 | Bacteria | 12334 |
| 738 | Ga0495592_0013393 | 3300046454 | Bacteria | 6241 |
| 739 | Ga0495592_0032201 | 3300046454 | Bacteria | 3958 |
| 740 | Ga0495592_0034920 | 3300046454 | Bacteria | 3789 |
| 741 | Ga0495592_0642476 | 3300046454 | Unclassified | 643 |
| 742 | Ga0495629_0237054 | 3300046459 | Bacteria | 1256 |
| 743 | Ga0495629_1065265 | 3300046459 | Bacteria | 524 |
| 744 | Ga0495638_0008515 | 3300046460 | Bacteria | 7265 |
| 745 | Ga0495638_0091956 | 3300046460 | Bacteria | 1826 |
| 746 | Ga0495638_0269837 | 3300046460 | Bacteria | 929 |
| 747 | Ga0495641_0006131 | 3300046461 | Bacteria | 7873 |
| 748 | Ga0495651_0002284 | 3300046462 | Bacteria | 14794 |
| 749 | Ga0495651_0010479 | 3300046462 | Bacteria | 7124 |
| 750 | Ga0495651_0513908 | 3300046462 | Bacteria | 765 |
| 751 | Ga0495653_0086374 | 3300046463 | Bacteria | 2305 |
| 752 | Ga0495650_0228411 | 3300046471 | Bacteria | 639 |
| 753 | Ga0495580_0039648 | 3300046472 | Bacteria | 3370 |
| 754 | Ga0495582_0015870 | 3300046473 | Bacteria | 4130 |
| 755 | Ga0495639_0017566 | 3300046475 | Bacteria | 3108 |
| 756 | Ga0495662_0004780 | 3300046476 | Bacteria | 6790 |
| 757 | Ga0495664_0010009 | 3300046477 | Bacteria | 5319 |
| 758 | Ga0495594_0566569 | 3300046499 | Bacteria | 644 |
| 759 | Ga0495606_0022384 | 3300046507 | Bacteria | 4605 |
| 760 | Ga0495608_0080853 | 3300046511 | Bacteria | 2112 |
| 761 | Ga0495610_0003267 | 3300046512 | Bacteria | 12788 |
| 762 | Ga0495616_0050442 | 3300046513 | Bacteria | 2081 |
| 763 | Ga0495628_0000826 | 3300046516 | Bacteria | 28697 |
| 764 | Ga0495628_0005867 | 3300046516 | Bacteria | 10753 |
| 765 | Ga0495628_0024743 | 3300046516 | Bacteria | 4911 |
| 766 | Ga0495628_0043350 | 3300046516 | Bacteria | 3585 |
| 767 | Ga0495630_0004871 | 3300046517 | Bacteria | 9427 |
| 768 | Ga0495631_0004302 | 3300046518 | Bacteria | 7596 |
| 769 | Ga0495643_0001578 | 3300046522 | Bacteria | 20243 |
| 770 | Ga0495663_0000179 | 3300046525 | Bacteria | 25304 |
| 771 | Ga0495663_0003376 | 3300046525 | Bacteria | 4614 |
| 772 | Ga0495663_0031559 | 3300046525 | Bacteria | 1574 |
| 773 | Ga0495663_0043173 | 3300046525 | Bacteria | 1376 |
| 774 | Ga0495663_0235502 | 3300046525 | Bacteria | 647 |
| 775 | Ga0495663_0312566 | 3300046525 | Bacteria | 567 |
| 776 | Ga0495666_0069710 | 3300046526 | Bacteria | 1672 |
| 777 | Ga0495652_0003451 | 3300046529 | Bacteria | 15598 |
| 778 | Ga0495652_0080857 | 3300046529 | Bacteria | 2682 |
| 779 | Ga0495652_0086614 | 3300046529 | Bacteria | 2571 |
| 780 | Ga0495665_0011270 | 3300046531 | Bacteria | 4840 |
| 781 | Ga0495640_0008101 | 3300046533 | Bacteria | 8253 |
| 782 | Ga0495586_0010057 | 3300046535 | Bacteria | 5035 |
| 783 | Ga0495586_0148647 | 3300046535 | Bacteria | 1317 |
| 784 | Ga0495587_0004773 | 3300046536 | Bacteria | 8900 |
| 785 | Ga0495598_0011292 | 3300046537 | Bacteria | 2161 |
| 786 | Ga0495621_0000504 | 3300046539 | Bacteria | 9684 |
| 787 | Ga0495621_0054574 | 3300046539 | Bacteria | 1436 |
| 788 | Ga0495645_0000432 | 3300046543 | Bacteria | 28796 |
| 789 | Ga0495622_0049370 | 3300046557 | Bacteria | 1954 |
| 790 | Ga0495633_0007116 | 3300046558 | Bacteria | 6500 |
| 791 | Ga0495633_0096258 | 3300046558 | Bacteria | 1375 |
| 792 | Ga0495633_0104000 | 3300046558 | Bacteria | 1317 |
| 793 | Ga0495633_0116656 | 3300046558 | Bacteria | 1237 |
| 794 | Ga0495667_0042285 | 3300046559 | Bacteria | 3021 |
| 795 | Ga0495667_0063329 | 3300046559 | Bacteria | 2420 |
| 796 | Ga0495656_0001639 | 3300046615 | Bacteria | 7327 |
| 797 | Ga0495656_0168732 | 3300046615 | Bacteria | 1068 |
| 798 | Ga0495668_0002607 | 3300046616 | Bacteria | 14590 |
| 799 | Ga0495668_0203862 | 3300046616 | Bacteria | 1083 |
| 800 | Ga0495634_0026470 | 3300046642 | Bacteria | 4046 |
| 801 | Ga0495625_0084624 | 3300046660 | Bacteria | 2202 |
| 802 | Ga0495625_0248420 | 3300046660 | Bacteria | 1155 |
| 803 | Ga0495635_0010974 | 3300046663 | Bacteria | 6349 |
| 804 | Ga0495659_0160747 | 3300046664 | Bacteria | 907 |
| 805 | Ga0495659_0474862 | 3300046664 | Bacteria | 546 |
| 806 | Ga0495588_0288118 | 3300046674 | Bacteria | 865 |
| 807 | Ga0495588_0385419 | 3300046674 | Bacteria | 736 |
| 808 | Ga0495657_0003487 | 3300046675 | Bacteria | 12830 |
| 809 | Ga0495657_0267171 | 3300046675 | Unclassified | 1026 |
| 810 | Ga0495599_0003066 | 3300046678 | Bacteria | 9725 |
| 811 | Ga0495599_0011508 | 3300046678 | Bacteria | 5438 |
| 812 | Ga0495599_0014519 | 3300046678 | Bacteria | 4877 |
| 813 | Ga0495599_0126221 | 3300046678 | Bacteria | 1590 |
| 814 | Ga0495599_0145896 | 3300046678 | Unclassified | 1467 |
| 815 | Ga0495646_0383630 | 3300046680 | Bacteria | 732 |
| 816 | Ga0495647_0003182 | 3300046681 | Bacteria | 5256 |
| 817 | Ga0495658_0012027 | 3300046683 | Bacteria | 4370 |
| 818 | Ga0495613_0025571 | 3300046689 | Bacteria | 4398 |
| 819 | Ga0495671_0019079 | 3300046692 | Bacteria | 3630 |
| 820 | Ga0495600_0001894 | 3300046809 | Bacteria | 11743 |
| 821 | Ga0495660_0375344 | 3300046810 | Bacteria | 628 |
| 822 | Ga0495581_0180508 | 3300047315 | Bacteria | 1234 |
| 823 | Ga0495604_0030674 | 3300047317 | Bacteria | 4268 |
| 824 | Ga0495636_0044615 | 3300047318 | Bacteria | 1846 |
| 825 | Ga0495636_0090622 | 3300047318 | Bacteria | 1327 |
| 826 | Ga0495674_0008537 | 3300047319 | Bacteria | 9750 |
| 827 | Ga0495672_0000267 | 3300047320 | Bacteria | 72264 |
| 828 | Ga0495672_0070144 | 3300047320 | Bacteria | 1987 |
| 829 | Ga0495680_0238833 | 3300047322 | Unclassified | 1291 |
| 830 | Ga0495680_0881911 | 3300047322 | Bacteria | 579 |
| 831 | Ga0495675_0001900 | 3300047444 | Bacteria | 12443 |
| 832 | Ga0495675_0219543 | 3300047444 | Bacteria | 1151 |
| 833 | Ga0495675_0237328 | 3300047444 | Unclassified | 1098 |
| 834 | Ga0495681_0069534 | 3300047470 | Bacteria | 1599 |
| 835 | Ga0495684_0034944 | 3300047471 | Bacteria | 3856 |
| 836 | Ga0495686_0004264 | 3300047472 | Bacteria | 11856 |
| 837 | Ga0495686_0088491 | 3300047472 | Bacteria | 1882 |
| 838 | Ga0495614_0033592 | 3300048089 | Bacteria | 2207 |
| 839 | Ga0496100_0718289 | 3300048903 | Bacteria | 780 |
| 840 | Ga0496100_0897260 | 3300048903 | Bacteria | 696 |
| 841 | Ga0496101_0045444 | 3300048904 | Bacteria | 3146 |
| 842 | Ga0496101_0074798 | 3300048904 | Bacteria | 2492 |
| 843 | Ga0496101_0156770 | 3300048904 | Bacteria | 1744 |
| 844 | Ga0496102_0475044 | 3300048905 | Bacteria | 1171 |
| 845 | Ga0496103_0125354 | 3300048906 | Bacteria | 1638 |
| 846 | Ga0496103_0556494 | 3300048906 | Bacteria | 732 |
| 847 | Ga0496105_0105422 | 3300048908 | Bacteria | 2327 |
| 848 | Ga0496105_0601993 | 3300048908 | Bacteria | 853 |
| 849 | Ga0496106_0112890 | 3300048909 | Bacteria | 2118 |
| 850 | Ga0496108_0027660 | 3300048911 | Bacteria | 4687 |
| 851 | Ga0496109_0222625 | 3300048912 | Bacteria | 1774 |
| 852 | Ga0496109_0380520 | 3300048912 | Bacteria | 1333 |
| 853 | Ga0496109_0644803 | 3300048912 | Bacteria | 996 |
| 854 | Ga0496110_0026733 | 3300048913 | Bacteria | 4941 |
| 855 | Ga0496111_0018428 | 3300048914 | Bacteria | 4837 |
| 856 | Ga0496112_1027766 | 3300048915 | Bacteria | 743 |
| 857 | Ga0496113_0348687 | 3300048916 | Bacteria | 1187 |
| 858 | Ga0496113_0754656 | 3300048916 | Bacteria | 774 |
| 859 | Ga0496114_0004470 | 3300048917 | Bacteria | 10853 |
| 860 | Ga0496114_0263641 | 3300048917 | Bacteria | 1517 |
| 861 | Ga0496116_0002176 | 3300048919 | Bacteria | 20871 |
| 862 | Ga0496116_0049307 | 3300048919 | Bacteria | 2817 |
| 863 | Ga0496116_0176568 | 3300048919 | Bacteria | 1149 |
| 864 | Ga0496117_0000843 | 3300048920 | Bacteria | 47414 |
| 865 | Ga0496117_0002530 | 3300048920 | Bacteria | 22852 |
| 866 | Ga0496117_0002737 | 3300048920 | Bacteria | 21643 |
| 867 | Ga0496117_0009093 | 3300048920 | Bacteria | 9338 |
| 868 | Ga0496117_0067868 | 3300048920 | Bacteria | 2410 |
| 869 | Ga0496117_0103529 | 3300048920 | Bacteria | 1794 |
| 870 | Ga0496118_0000639 | 3300048921 | Bacteria | 57425 |
| 871 | Ga0496118_0002681 | 3300048921 | Bacteria | 23521 |
| 872 | Ga0496118_0006054 | 3300048921 | Bacteria | 13473 |
| 873 | Ga0496118_0012171 | 3300048921 | Bacteria | 8297 |
| 874 | Ga0496118_0298486 | 3300048921 | Bacteria | 886 |
| 875 | Ga0496119_0001070 | 3300048922 | Bacteria | 34682 |
| 876 | Ga0496119_0001410 | 3300048922 | Bacteria | 29099 |
| 877 | Ga0496120_0000716 | 3300048923 | Bacteria | 48669 |
| 878 | Ga0496120_0001897 | 3300048923 | Bacteria | 23186 |
| 879 | Ga0496121_0004558 | 3300048924 | Bacteria | 18509 |
| 880 | Ga0496121_0007707 | 3300048924 | Bacteria | 12921 |
| 881 | Ga0496121_0011920 | 3300048924 | Bacteria | 9569 |
| 882 | Ga0496121_0019793 | 3300048924 | Bacteria | 6707 |
| 883 | Ga0496122_0001201 | 3300048925 | Bacteria | 44175 |
| 884 | Ga0496122_0001926 | 3300048925 | Bacteria | 31324 |
| 885 | Ga0496122_0003158 | 3300048925 | Bacteria | 22033 |
| 886 | Ga0496122_0021341 | 3300048925 | Bacteria | 5801 |
| 887 | Ga0496122_0023882 | 3300048925 | Bacteria | 5369 |
| 888 | Ga0496122_0024055 | 3300048925 | Bacteria | 5342 |
| 889 | Ga0496122_0050997 | 3300048925 | Bacteria | 3149 |
| 890 | Ga0496122_0140980 | 3300048925 | Bacteria | 1508 |
| 891 | Ga0496123_0000973 | 3300048926 | Bacteria | 44187 |
| 892 | Ga0496123_0001882 | 3300048926 | Bacteria | 27416 |
| 893 | Ga0496123_0010900 | 3300048926 | Bacteria | 7957 |
| 894 | Ga0496123_0027309 | 3300048926 | Bacteria | 4253 |
| 895 | Ga0496124_0000476 | 3300048927 | Bacteria | 68995 |
| 896 | Ga0496124_0000880 | 3300048927 | Bacteria | 48881 |
| 897 | Ga0496124_0001833 | 3300048927 | Bacteria | 29350 |
| 898 | Ga0496124_0004121 | 3300048927 | Bacteria | 17178 |
| 899 | Ga0496124_0011269 | 3300048927 | Bacteria | 8952 |
| 900 | Ga0496124_0018455 | 3300048927 | Bacteria | 6532 |
| 901 | Ga0496124_0121472 | 3300048927 | Bacteria | 2086 |
| 902 | Ga0496124_0297907 | 3300048927 | Bacteria | 1166 |
| 903 | Ga0496124_0325026 | 3300048927 | Bacteria | 1099 |
| 904 | Ga0496124_0352538 | 3300048927 | Bacteria | 1040 |
| 905 | Ga0496125_0003520 | 3300048928 | Bacteria | 18898 |
| 906 | Ga0496125_0019301 | 3300048928 | Bacteria | 6436 |
| 907 | Ga0496125_0043107 | 3300048928 | Bacteria | 3835 |
| 908 | Ga0496125_0053240 | 3300048928 | Bacteria | 3319 |
| 909 | Ga0496125_0057730 | 3300048928 | Bacteria | 3140 |
| 910 | Ga0496125_0103942 | 3300048928 | Bacteria | 2082 |
| 911 | Ga0496125_0255817 | 3300048928 | Bacteria | 1101 |
| 912 | Ga0496126_0026529 | 3300048929 | Bacteria | 5553 |
| 913 | Ga0496126_0033945 | 3300048929 | Bacteria | 4798 |
| 914 | Ga0496126_0055627 | 3300048929 | Bacteria | 3579 |
| 915 | Ga0496126_0430402 | 3300048929 | Bacteria | 1065 |
| 916 | Ga0501290_000410 | 3300049513 | Bacteria | 6836 |
| 917 | Ga0501300_019535 | 3300049523 | Bacteria | 989 |
| 918 | Ga0501031_0158946 | 3300049568 | Bacteria | 1477 |
| 919 | Ga0501031_0929062 | 3300049568 | Bacteria | 557 |
| 920 | Ga0501032_0021060 | 3300049569 | Bacteria | 4535 |
| 921 | Ga0501032_0027782 | 3300049569 | Bacteria | 3888 |
| 922 | Ga0501032_0368018 | 3300049569 | Bacteria | 925 |
| 923 | Ga0501032_0462890 | 3300049569 | Bacteria | 812 |
| 924 | Ga0501033_0020342 | 3300049570 | Bacteria | 5014 |
| 925 | Ga0501033_0046777 | 3300049570 | Bacteria | 3217 |
| 926 | Ga0501033_0059371 | 3300049570 | Bacteria | 2824 |
| 927 | Ga0501034_0000083 | 3300049571 | Bacteria | 169656 |
| 928 | Ga0501034_0008036 | 3300049571 | Bacteria | 11194 |
| 929 | Ga0501034_0037743 | 3300049571 | Bacteria | 4893 |
| 930 | Ga0501034_0071873 | 3300049571 | Bacteria | 3468 |
| 931 | Ga0501034_0148923 | 3300049571 | Bacteria | 2317 |
| 932 | Ga0501034_0249140 | 3300049571 | Bacteria | 1721 |
| 933 | Ga0501034_0398664 | 3300049571 | Bacteria | 1299 |
| 934 | Ga0501036_0018891 | 3300049572 | Bacteria | 5782 |
| 935 | Ga0501036_0323326 | 3300049572 | Bacteria | 1289 |
| 936 | Ga0501036_0669788 | 3300049572 | Bacteria | 858 |
| 937 | Ga0501036_0730804 | 3300049572 | Bacteria | 817 |
| 938 | Ga0501037_0006216 | 3300049573 | Bacteria | 8732 |
| 939 | Ga0501037_0007981 | 3300049573 | Bacteria | 7757 |
| 940 | Ga0501037_0047480 | 3300049573 | Bacteria | 3147 |
| 941 | Ga0501037_0136592 | 3300049573 | Bacteria | 1756 |
| 942 | Ga0501037_0141440 | 3300049573 | Bacteria | 1722 |
| 943 | Ga0501038_0020445 | 3300049574 | Bacteria | 5950 |
| 944 | Ga0501038_0024242 | 3300049574 | Bacteria | 5413 |
| 945 | Ga0501038_0115730 | 3300049574 | Bacteria | 2216 |
| 946 | Ga0501039_0009325 | 3300049575 | Bacteria | 7477 |
| 947 | Ga0501039_0780703 | 3300049575 | Bacteria | 745 |
| 948 | Ga0501043_0024405 | 3300049579 | Bacteria | 4745 |
| 949 | Ga0501043_0139837 | 3300049579 | Bacteria | 1896 |
| 950 | Ga0501043_1121761 | 3300049579 | Bacteria | 555 |
| 951 | Ga0501046_0314857 | 3300049580 | Bacteria | 1141 |
| 952 | Ga0501047_0015358 | 3300049581 | Bacteria | 7295 |
| 953 | Ga0501047_0022111 | 3300049581 | Bacteria | 6110 |
| 954 | Ga0501047_0045305 | 3300049581 | Bacteria | 4253 |
| 955 | Ga0501047_0059497 | 3300049581 | Bacteria | 3688 |
| 956 | Ga0501047_0876939 | 3300049581 | Bacteria | 711 |
| 957 | Ga0501048_0584310 | 3300049582 | Bacteria | 802 |
| 958 | Ga0501068_0018907 | 3300049584 | Bacteria | 3994 |
| 959 | Ga0501069_0000311 | 3300049585 | Bacteria | 22175 |
| 960 | Ga0501069_0010521 | 3300049585 | Bacteria | 4899 |
| 961 | Ga0501069_0015415 | 3300049585 | Bacteria | 4095 |
| 962 | Ga0501070_0000395 | 3300049586 | Bacteria | 40067 |
| 963 | Ga0501070_0000510 | 3300049586 | Bacteria | 35503 |
| 964 | Ga0501070_0009273 | 3300049586 | Bacteria | 8323 |
| 965 | Ga0501070_0013782 | 3300049586 | Bacteria | 6808 |
| 966 | Ga0501070_0016718 | 3300049586 | Bacteria | 6160 |
| 967 | Ga0501070_0027909 | 3300049586 | Bacteria | 4735 |
| 968 | Ga0501070_0035486 | 3300049586 | Bacteria | 4167 |
| 969 | Ga0501070_0082829 | 3300049586 | Bacteria | 2655 |
| 970 | Ga0501070_0126535 | 3300049586 | Bacteria | 2111 |
| 971 | Ga0501070_0613783 | 3300049586 | Bacteria | 866 |
| 972 | Ga0501071_0232394 | 3300049587 | Bacteria | 1389 |
| 973 | Ga0501073_0001504 | 3300049589 | Bacteria | 17253 |
| 974 | Ga0501073_0008164 | 3300049589 | Bacteria | 7765 |
| 975 | Ga0501073_0025286 | 3300049589 | Bacteria | 4260 |
| 976 | Ga0501074_0000121 | 3300049590 | Bacteria | 39707 |
| 977 | Ga0501074_0003813 | 3300049590 | Bacteria | 10721 |
| 978 | Ga0501074_0004124 | 3300049590 | Bacteria | 10371 |
| 979 | Ga0501074_0012482 | 3300049590 | Bacteria | 6176 |
| 980 | Ga0501077_0015834 | 3300049593 | Bacteria | 4749 |
| 981 | Ga0501206_059101 | 3300049653 | Bacteria | 626 |
| 982 | Ga0501209_057393 | 3300049656 | Bacteria | 1078 |
| 983 | Ga0501224_068275 | 3300049664 | Bacteria | 560 |
| 984 | Ga0501242_016204 | 3300049674 | Bacteria | 932 |
| 985 | Ga0501243_036543 | 3300049675 | Bacteria | 852 |
| 986 | Ga0501257_022950 | 3300049686 | Bacteria | 1478 |
| 987 | Ga0501257_031919 | 3300049686 | Bacteria | 1272 |
| 988 | Ga0501257_155599 | 3300049686 | Bacteria | 633 |
| 989 | Ga0501259_016717 | 3300049688 | Bacteria | 1264 |
| 990 | Ga0501221_115248 | 3300049704 | Bacteria | 681 |
| 991 | Ga0501225_0001888 | 3300049705 | Bacteria | 6587 |
| 992 | Ga0501225_0022173 | 3300049705 | Bacteria | 1753 |
| 993 | Ga0501245_117547 | 3300049708 | Bacteria | 557 |
| 994 | Ga0501079_0333085 | 3300049741 | Bacteria | 1189 |
| 995 | Ga0501080_0003043 | 3300049742 | Bacteria | 14798 |
| 996 | Ga0501080_0010556 | 3300049742 | Bacteria | 8460 |
| 997 | Ga0501080_0011265 | 3300049742 | Bacteria | 8185 |
| 998 | Ga0501083_0251145 | 3300049744 | Bacteria | 1151 |
| 999 | Ga0501263_029981 | 3300049760 | Bacteria | 765 |
| 1000 | Ga0501265_022423 | 3300049762 | Bacteria | 862 |
| 1001 | Ga0501266_036291 | 3300049763 | Bacteria | 719 |
| 1002 | Ga0501268_010802 | 3300049765 | Bacteria | 1429 |
| 1003 | Ga0501275_000751 | 3300049772 | Bacteria | 3538 |
| 1004 | Ga0501275_007194 | 3300049772 | Bacteria | 1114 |
| 1005 | Ga0501035_0015565 | 3300049822 | Bacteria | 7015 |
| 1006 | Ga0501035_0024405 | 3300049822 | Bacteria | 5545 |
| 1007 | Ga0501035_0041438 | 3300049822 | Bacteria | 4157 |
| 1008 | Ga0501035_0057419 | 3300049822 | Bacteria | 3470 |
| 1009 | Ga0501035_0061287 | 3300049822 | Bacteria | 3348 |
| 1010 | Ga0501035_0173430 | 3300049822 | Bacteria | 1862 |
| 1011 | Ga0501044_0009836 | 3300049823 | Bacteria | 10396 |
| 1012 | Ga0501044_0042344 | 3300049823 | Bacteria | 4736 |
| 1013 | Ga0501044_0208867 | 3300049823 | Bacteria | 1907 |
| 1014 | Ga0501044_0987714 | 3300049823 | Bacteria | 714 |
| 1015 | nmdc:mga00v17_11713_c1 | 3300050491 | Bacteria | 4824 |
| 1016 | nmdc:mga00v17_119_c1 | 3300050491 | Bacteria | 46532 |
| 1017 | nmdc:mga00v17_183923_c1 | 3300050491 | Bacteria | 1349 |
| 1018 | nmdc:mga00v17_202102_c1 | 3300050491 | Bacteria | 1285 |
| 1019 | nmdc:mga00v17_474586_c1 | 3300050491 | Bacteria | 812 |
| 1020 | nmdc:mga0yw44_553445_c1 | 3300050492 | Bacteria | 781 |
| 1021 | nmdc:mga08x19_183227_c1 | 3300050514 | Bacteria | 1430 |
| 1022 | nmdc:mga08x19_591475_c1 | 3300050514 | Bacteria | 786 |
| 1023 | Ga0495601_0001793 | 3300053077 | Bacteria | 11915 |
| 1024 | Ga0495601_0072320 | 3300053077 | Bacteria | 2203 |
| 1025 | Ga0495595_0001094 | 3300053084 | Bacteria | 10504 |
| 1026 | Ga0495619_0025627 | 3300053085 | Bacteria | 3788 |
| 1027 | Ga0495619_0195861 | 3300053085 | Bacteria | 1399 |
| 1028 | Ga0500646_0051421 | 3300053090 | Bacteria | 1190 |
| 1029 | Ga0500566_0330411 | 3300053094 | Bacteria | 706 |
| 1030 | Ga0500658_0107423 | 3300053134 | Bacteria | 1225 |
| 1031 | Ga0500577_0423918 | 3300053142 | Bacteria | 582 |
| 1032 | Ga0500622_0379294 | 3300053156 | Bacteria | 579 |
| 1033 | Ga0500634_0000345 | 3300053161 | Bacteria | 14835 |
| 1034 | Ga0500565_004105 | 3300053734 | Bacteria | 1208 |
| 1035 | Ga0587078_069306 | 3300059646 | Bacteria | 548 |
| 1036 | Ga0587107_017542 | 3300059652 | Bacteria | 959 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050514 | nmdc:mga08x19_183227_c1 | nmdc:mga08x19_183227_c1_1013_1360 | 113 |
| 2 | iso_pu_bacteria | 2919513703 | 2919514948 | 118 |
| 3 | 3300005536 | Ga0070697_100287091 | Ga0070697_1002870912 | 119 |
| 4 | 3300006173 | Ga0070716_100565352 | Ga0070716_1005653522 | 119 |
| 5 | 3300006914 | Ga0075436_100361767 | Ga0075436_1003617672 | 119 |
| 6 | 3300031665 | Ga0316575_10361718 | Ga0316575_103617182 | 119 |
| 7 | 3300035083 | Ga0373926_0429009 | Ga0373926_0429009_136_501 | 119 |
| 8 | 3300035086 | Ga0373934_0000117 | Ga0373934_0000117_5956_6321 | 119 |
| 9 | 3300035086 | Ga0373934_0024244 | Ga0373934_0024244_854_1219 | 119 |
| 10 | 3300035089 | Ga0373944_0020080 | Ga0373944_0020080_326_691 | 119 |
| 11 | 3300035113 | Ga0373936_0001779 | Ga0373936_0001779_5692_6057 | 119 |
| 12 | 3300035116 | Ga0373945_0045936 | Ga0373945_0045936_701_1066 | 119 |
| 13 | 3300035117 | Ga0373953_0002712 | Ga0373953_0002712_4284_4649 | 119 |
| 14 | 3300035117 | Ga0373953_0009182 | Ga0373953_0009182_787_1152 | 119 |
| 15 | 3300035118 | Ga0373954_0001527 | Ga0373954_0001527_102_467 | 119 |
| 16 | 3300035118 | Ga0373954_0001689 | Ga0373954_0001689_6996_7361 | 119 |
| 17 | 3300035118 | Ga0373954_0127959 | Ga0373954_0127959_846_1211 | 119 |
| 18 | 3300035119 | Ga0373956_0000872 | Ga0373956_0000872_8617_8982 | 119 |
| 19 | 3300035119 | Ga0373956_0008901 | Ga0373956_0008901_2982_3347 | 119 |
| 20 | 3300035170 | Ga0373943_0091592 | Ga0373943_0091592_1070_1435 | 119 |
| 21 | 3300035171 | Ga0373946_0012699 | Ga0373946_0012699_1318_1683 | 119 |
| 22 | 3300035172 | Ga0373955_0003035 | Ga0373955_0003035_4467_4832 | 119 |
| 23 | 3300035172 | Ga0373955_0005998 | Ga0373955_0005998_4965_5330 | 119 |
| 24 | 3300035398 | Ga0316574_0169261 | Ga0316574_0169261_642_1001 | 119 |
| 25 | 3300035410 | Ga0373924_0005478 | Ga0373924_0005478_2681_3046 | 119 |
| 26 | 3300035410 | Ga0373924_0112916 | Ga0373924_0112916_138_503 | 119 |
| 27 | 3300035692 | Ga0373935_0007864 | Ga0373935_0007864_721_1086 | 119 |
| 28 | 3300035695 | Ga0373927_0027435 | Ga0373927_0027435_1351_1716 | 119 |
| 29 | 3300035724 | Ga0373933_0000538 | Ga0373933_0000538_9491_9856 | 119 |
| 30 | 3300035724 | Ga0373933_0097423 | Ga0373933_0097423_313_678 | 119 |
| 31 | 3300035725 | Ga0373947_0104939 | Ga0373947_0104939_498_863 | 119 |
| 32 | 3300036401 | Ga0373937_0004252 | Ga0373937_0004252_8618_8983 | 119 |
| 33 | 3300036401 | Ga0373937_0087499 | Ga0373937_0087499_1867_2232 | 119 |
| 34 | 3300036401 | Ga0373937_0102007 | Ga0373937_0102007_626_991 | 119 |
| 35 | 3300036647 | Ga0316582_0708410 | Ga0316582_0708410_280_639 | 119 |
| 36 | 3300037068 | Ga0373925_0022862 | Ga0373925_0022862_2327_2692 | 119 |
| 37 | 3300046454 | Ga0495592_0002813 | Ga0495592_0002813_4976_5341 | 119 |
| 38 | 3300046454 | Ga0495592_0013393 | Ga0495592_0013393_4596_4961 | 119 |
| 39 | 3300046454 | Ga0495592_0032201 | Ga0495592_0032201_1352_1717 | 119 |
| 40 | 3300046454 | Ga0495592_0034920 | Ga0495592_0034920_3092_3457 | 119 |
| 41 | 3300046454 | Ga0495592_0642476 | Ga0495592_0642476_257_622 | 119 |
| 42 | 3300046459 | Ga0495629_0237054 | Ga0495629_0237054_777_1142 | 119 |
| 43 | 3300046461 | Ga0495641_0006131 | Ga0495641_0006131_5031_5396 | 119 |
| 44 | 3300046462 | Ga0495651_0002284 | Ga0495651_0002284_9213_9578 | 119 |
| 45 | 3300046462 | Ga0495651_0010479 | Ga0495651_0010479_2760_3125 | 119 |
| 46 | 3300046462 | Ga0495651_0513908 | Ga0495651_0513908_18_383 | 119 |
| 47 | 3300046463 | Ga0495653_0086374 | Ga0495653_0086374_1443_1808 | 119 |
| 48 | 3300046472 | Ga0495580_0039648 | Ga0495580_0039648_2219_2584 | 119 |
| 49 | 3300046473 | Ga0495582_0015870 | Ga0495582_0015870_806_1171 | 119 |
| 50 | 3300046475 | Ga0495639_0017566 | Ga0495639_0017566_1224_1589 | 119 |
| 51 | 3300046476 | Ga0495662_0004780 | Ga0495662_0004780_1905_2270 | 119 |
| 52 | 3300046477 | Ga0495664_0010009 | Ga0495664_0010009_4028_4393 | 119 |
| 53 | 3300046499 | Ga0495594_0566569 | Ga0495594_0566569_32_397 | 119 |
| 54 | 3300046511 | Ga0495608_0080853 | Ga0495608_0080853_941_1306 | 119 |
| 55 | 3300046516 | Ga0495628_0000826 | Ga0495628_0000826_23425_23790 | 119 |
| 56 | 3300046516 | Ga0495628_0005867 | Ga0495628_0005867_5631_5996 | 119 |
| 57 | 3300046516 | Ga0495628_0024743 | Ga0495628_0024743_1950_2315 | 119 |
| 58 | 3300046516 | Ga0495628_0043350 | Ga0495628_0043350_1202_1567 | 119 |
| 59 | 3300046517 | Ga0495630_0004871 | Ga0495630_0004871_4386_4751 | 119 |
| 60 | 3300046526 | Ga0495666_0069710 | Ga0495666_0069710_84_449 | 119 |
| 61 | 3300046529 | Ga0495652_0003451 | Ga0495652_0003451_1008_1373 | 119 |
| 62 | 3300046529 | Ga0495652_0080857 | Ga0495652_0080857_720_1085 | 119 |
| 63 | 3300046529 | Ga0495652_0086614 | Ga0495652_0086614_2069_2434 | 119 |
| 64 | 3300046531 | Ga0495665_0011270 | Ga0495665_0011270_2612_2977 | 119 |
| 65 | 3300046533 | Ga0495640_0008101 | Ga0495640_0008101_1787_2152 | 119 |
| 66 | 3300046535 | Ga0495586_0010057 | Ga0495586_0010057_1509_1874 | 119 |
| 67 | 3300046535 | Ga0495586_0148647 | Ga0495586_0148647_940_1305 | 119 |
| 68 | 3300046536 | Ga0495587_0004773 | Ga0495587_0004773_3822_4187 | 119 |
| 69 | 3300046543 | Ga0495645_0000432 | Ga0495645_0000432_2564_2929 | 119 |
| 70 | 3300046557 | Ga0495622_0049370 | Ga0495622_0049370_857_1222 | 119 |
| 71 | 3300046559 | Ga0495667_0042285 | Ga0495667_0042285_1811_2176 | 119 |
| 72 | 3300046559 | Ga0495667_0063329 | Ga0495667_0063329_1128_1493 | 119 |
| 73 | 3300046642 | Ga0495634_0026470 | Ga0495634_0026470_2961_3326 | 119 |
| 74 | 3300046663 | Ga0495635_0010974 | Ga0495635_0010974_2130_2495 | 119 |
| 75 | 3300046675 | Ga0495657_0003487 | Ga0495657_0003487_2970_3335 | 119 |
| 76 | 3300046675 | Ga0495657_0267171 | Ga0495657_0267171_603_968 | 119 |
| 77 | 3300046678 | Ga0495599_0003066 | Ga0495599_0003066_5402_5767 | 119 |
| 78 | 3300046678 | Ga0495599_0011508 | Ga0495599_0011508_4813_5178 | 119 |
| 79 | 3300046678 | Ga0495599_0014519 | Ga0495599_0014519_1880_2245 | 119 |
| 80 | 3300046678 | Ga0495599_0126221 | Ga0495599_0126221_459_824 | 119 |
| 81 | 3300046678 | Ga0495599_0145896 | Ga0495599_0145896_591_956 | 119 |
| 82 | 3300046680 | Ga0495646_0383630 | Ga0495646_0383630_118_483 | 119 |
| 83 | 3300046681 | Ga0495647_0003182 | Ga0495647_0003182_2554_2919 | 119 |
| 84 | 3300046683 | Ga0495658_0012027 | Ga0495658_0012027_2952_3317 | 119 |
| 85 | 3300046689 | Ga0495613_0025571 | Ga0495613_0025571_1179_1544 | 119 |
| 86 | 3300046809 | Ga0495600_0001894 | Ga0495600_0001894_1443_1808 | 119 |
| 87 | 3300047315 | Ga0495581_0180508 | Ga0495581_0180508_573_938 | 119 |
| 88 | 3300047317 | Ga0495604_0030674 | Ga0495604_0030674_1157_1522 | 119 |
| 89 | 3300047319 | Ga0495674_0008537 | Ga0495674_0008537_1256_1621 | 119 |
| 90 | 3300047322 | Ga0495680_0238833 | Ga0495680_0238833_334_699 | 119 |
| 91 | 3300047322 | Ga0495680_0881911 | Ga0495680_0881911_64_429 | 119 |
| 92 | 3300047444 | Ga0495675_0001900 | Ga0495675_0001900_5531_5896 | 119 |
| 93 | 3300047444 | Ga0495675_0219543 | Ga0495675_0219543_37_402 | 119 |
| 94 | 3300047444 | Ga0495675_0237328 | Ga0495675_0237328_213_578 | 119 |
| 95 | 3300047471 | Ga0495684_0034944 | Ga0495684_0034944_1350_1715 | 119 |
| 96 | 3300048089 | Ga0495614_0033592 | Ga0495614_0033592_1701_2066 | 119 |
| 97 | 3300053077 | Ga0495601_0001793 | Ga0495601_0001793_5119_5484 | 119 |
| 98 | 3300053077 | Ga0495601_0072320 | Ga0495601_0072320_591_956 | 119 |
| 99 | 3300053084 | Ga0495595_0001094 | Ga0495595_0001094_5601_5966 | 119 |
| 100 | 3300053085 | Ga0495619_0025627 | Ga0495619_0025627_2200_2565 | 119 |
| 101 | 3300053085 | Ga0495619_0195861 | Ga0495619_0195861_836_1201 | 119 |
| 102 | 3300053094 | Ga0500566_0330411 | Ga0500566_0330411_166_531 | 119 |
| 103 | 3300001915 | JGI24741J21665_1001252 | JGI24741J21665_10012524 | 120 |
| 104 | 3300001979 | JGI24740J21852_10000143 | JGI24740J21852_100001436 | 120 |
| 105 | 3300001979 | JGI24740J21852_10010601 | JGI24740J21852_100106013 | 120 |
| 106 | 3300001979 | JGI24740J21852_10037273 | JGI24740J21852_100372732 | 120 |
| 107 | 3300001989 | JGI24739J22299_10001460 | JGI24739J22299_100014605 | 120 |
| 108 | 3300001990 | JGI24737J22298_10003217 | JGI24737J22298_100032172 | 120 |
| 109 | 3300002067 | JGI24735J21928_10257091 | JGI24735J21928_102570911 | 120 |
| 110 | 3300002075 | JGI24738J21930_10027116 | JGI24738J21930_100271161 | 120 |
| 111 | 3300002737 | JGI25162J39368_1002331 | JGI25162J39368_10023316 | 120 |
| 112 | 3300002737 | JGI25162J39368_1016462 | JGI25162J39368_10164621 | 120 |
| 113 | 3300002741 | JGI25157J39369_1001034 | JGI25157J39369_100103412 | 120 |
| 114 | 3300002741 | JGI25157J39369_1006315 | JGI25157J39369_10063152 | 120 |
| 115 | 3300002772 | JGI25164J39214_1001133 | JGI25164J39214_10011332 | 120 |
| 116 | 3300002773 | JGI25152J39213_1033312 | JGI25152J39213_10333121 | 120 |
| 117 | 3300003187 | JGI25151J46595_10063077 | JGI25151J46595_100630772 | 120 |
| 118 | 3300003214 | JGI25165J46597_1003844 | JGI25165J46597_10038442 | 120 |
| 119 | 3300003215 | JGI25153J46596_10079822 | JGI25153J46596_100798221 | 120 |
| 120 | 3300003215 | JGI25153J46596_10132516 | JGI25153J46596_101325161 | 120 |
| 121 | 3300003316 | rootH1_10042964 | rootH1_100429641 | 120 |
| 122 | 3300003322 | rootL2_10215448 | rootL2_102154481 | 120 |
| 123 | 3300003479 | Ga0006556J51387_1035038 | Ga0006556J51387_10350381 | 120 |
| 124 | 3300003578 | Ga0006562J51391_1017586 | Ga0006562J51391_10175862 | 120 |
| 125 | 3300003759 | Ga0055525_1000097 | Ga0055525_100009790 | 120 |
| 126 | 3300003760 | Ga0055527_1000518 | Ga0055527_10005186 | 120 |
| 127 | 3300003761 | Ga0055535_1001115 | Ga0055535_100111511 | 120 |
| 128 | 3300003761 | Ga0055535_1001316 | Ga0055535_10013166 | 120 |
| 129 | 3300003761 | Ga0055535_1001923 | Ga0055535_10019232 | 120 |
| 130 | 3300003762 | Ga0055542_1000943 | Ga0055542_10009437 | 120 |
| 131 | 3300003762 | Ga0055542_1001305 | Ga0055542_10013056 | 120 |
| 132 | 3300003763 | Ga0055529_1001019 | Ga0055529_10010196 | 120 |
| 133 | 3300003771 | Ga0055526_1044350 | Ga0055526_10443503 | 120 |
| 134 | 3300003781 | Ga0055536_1014536 | Ga0055536_10145362 | 120 |
| 135 | 3300003784 | Ga0055534_1009828 | Ga0055534_10098281 | 120 |
| 136 | 3300003791 | Ga0055530_10006977 | Ga0055530_100069775 | 120 |
| 137 | 3300003794 | Ga0055531_10008552 | Ga0055531_100085524 | 120 |
| 138 | 3300003794 | Ga0055531_10021884 | Ga0055531_100218842 | 120 |
| 139 | 3300004625 | Ga0055543_1062555 | Ga0055543_10625551 | 120 |
| 140 | 3300004799 | Ga0058863_11884389 | Ga0058863_118843892 | 120 |
| 141 | 3300004800 | Ga0058861_11804756 | Ga0058861_118047562 | 120 |
| 142 | 3300005262 | Ga0065165_1001019 | Ga0065165_100101926 | 120 |
| 143 | 3300005262 | Ga0065165_1022320 | Ga0065165_10223201 | 120 |
| 144 | 3300005327 | Ga0070658_10020150 | Ga0070658_100201504 | 120 |
| 145 | 3300005327 | Ga0070658_10155762 | Ga0070658_101557622 | 120 |
| 146 | 3300005327 | Ga0070658_10760115 | Ga0070658_107601152 | 120 |
| 147 | 3300005327 | Ga0070658_11401392 | Ga0070658_114013921 | 120 |
| 148 | 3300005329 | Ga0070683_100085656 | Ga0070683_1000856563 | 120 |
| 149 | 3300005329 | Ga0070683_100460603 | Ga0070683_1004606032 | 120 |
| 150 | 3300005329 | Ga0070683_100719787 | Ga0070683_1007197872 | 120 |
| 151 | 3300005336 | Ga0070680_100000430 | Ga0070680_10000043010 | 120 |
| 152 | 3300005336 | Ga0070680_100006891 | Ga0070680_1000068912 | 120 |
| 153 | 3300005336 | Ga0070680_100010430 | Ga0070680_1000104308 | 120 |
| 154 | 3300005336 | Ga0070680_100035775 | Ga0070680_1000357751 | 120 |
| 155 | 3300005336 | Ga0070680_100058609 | Ga0070680_1000586093 | 120 |
| 156 | 3300005336 | Ga0070680_100160326 | Ga0070680_1001603263 | 120 |
| 157 | 3300005336 | Ga0070680_100637375 | Ga0070680_1006373751 | 120 |
| 158 | 3300005337 | Ga0070682_100002217 | Ga0070682_1000022173 | 120 |
| 159 | 3300005337 | Ga0070682_100014108 | Ga0070682_1000141085 | 120 |
| 160 | 3300005338 | Ga0068868_100234891 | Ga0068868_1002348912 | 120 |
| 161 | 3300005339 | Ga0070660_100050025 | Ga0070660_1000500252 | 120 |
| 162 | 3300005339 | Ga0070660_100053262 | Ga0070660_1000532624 | 120 |
| 163 | 3300005339 | Ga0070660_100412642 | Ga0070660_1004126422 | 120 |
| 164 | 3300005339 | Ga0070660_100455643 | Ga0070660_1004556432 | 120 |
| 165 | 3300005339 | Ga0070660_100494167 | Ga0070660_1004941672 | 120 |
| 166 | 3300005339 | Ga0070660_101580391 | Ga0070660_1015803911 | 120 |
| 167 | 3300005341 | Ga0070691_10035507 | Ga0070691_100355072 | 120 |
| 168 | 3300005341 | Ga0070691_10190274 | Ga0070691_101902742 | 120 |
| 169 | 3300005341 | Ga0070691_10299132 | Ga0070691_102991322 | 120 |
| 170 | 3300005343 | Ga0070687_100465588 | Ga0070687_1004655882 | 120 |
| 171 | 3300005344 | Ga0070661_100073555 | Ga0070661_1000735553 | 120 |
| 172 | 3300005344 | Ga0070661_100083928 | Ga0070661_1000839283 | 120 |
| 173 | 3300005344 | Ga0070661_100136559 | Ga0070661_1001365593 | 120 |
| 174 | 3300005345 | Ga0070692_10002556 | Ga0070692_100025562 | 120 |
| 175 | 3300005345 | Ga0070692_10038062 | Ga0070692_100380622 | 120 |
| 176 | 3300005345 | Ga0070692_10041679 | Ga0070692_100416793 | 120 |
| 177 | 3300005345 | Ga0070692_10401366 | Ga0070692_104013661 | 120 |
| 178 | 3300005345 | Ga0070692_10447553 | Ga0070692_104475532 | 120 |
| 179 | 3300005353 | Ga0070669_100105892 | Ga0070669_1001058922 | 120 |
| 180 | 3300005354 | Ga0070675_100110912 | Ga0070675_1001109122 | 120 |
| 181 | 3300005355 | Ga0070671_100712638 | Ga0070671_1007126382 | 120 |
| 182 | 3300005356 | Ga0070674_100044437 | Ga0070674_1000444374 | 120 |
| 183 | 3300005364 | Ga0070673_100659838 | Ga0070673_1006598382 | 120 |
| 184 | 3300005364 | Ga0070673_101125850 | Ga0070673_1011258501 | 120 |
| 185 | 3300005366 | Ga0070659_100001868 | Ga0070659_1000018684 | 120 |
| 186 | 3300005366 | Ga0070659_100222323 | Ga0070659_1002223232 | 120 |
| 187 | 3300005366 | Ga0070659_100430015 | Ga0070659_1004300152 | 120 |
| 188 | 3300005366 | Ga0070659_101189997 | Ga0070659_1011899972 | 120 |
| 189 | 3300005367 | Ga0070667_101082518 | Ga0070667_1010825181 | 120 |
| 190 | 3300005435 | Ga0070714_100022876 | Ga0070714_1000228764 | 120 |
| 191 | 3300005435 | Ga0070714_100027310 | Ga0070714_1000273102 | 120 |
| 192 | 3300005436 | Ga0070713_100559409 | Ga0070713_1005594092 | 120 |
| 193 | 3300005437 | Ga0070710_10078028 | Ga0070710_100780282 | 120 |
| 194 | 3300005455 | Ga0070663_100005110 | Ga0070663_1000051102 | 120 |
| 195 | 3300005455 | Ga0070663_100047136 | Ga0070663_1000471364 | 120 |
| 196 | 3300005455 | Ga0070663_100056727 | Ga0070663_1000567273 | 120 |
| 197 | 3300005455 | Ga0070663_100116014 | Ga0070663_1001160143 | 120 |
| 198 | 3300005455 | Ga0070663_100186772 | Ga0070663_1001867721 | 120 |
| 199 | 3300005455 | Ga0070663_100435913 | Ga0070663_1004359132 | 120 |
| 200 | 3300005455 | Ga0070663_101054819 | Ga0070663_1010548191 | 120 |
| 201 | 3300005456 | Ga0070678_100564622 | Ga0070678_1005646221 | 120 |
| 202 | 3300005457 | Ga0070662_100042379 | Ga0070662_1000423794 | 120 |
| 203 | 3300005457 | Ga0070662_100734210 | Ga0070662_1007342102 | 120 |
| 204 | 3300005458 | Ga0070681_10000006 | Ga0070681_10000006105 | 120 |
| 205 | 3300005458 | Ga0070681_10000721 | Ga0070681_100007219 | 120 |
| 206 | 3300005458 | Ga0070681_10002160 | Ga0070681_100021609 | 120 |
| 207 | 3300005458 | Ga0070681_10011057 | Ga0070681_100110579 | 120 |
| 208 | 3300005458 | Ga0070681_10011236 | Ga0070681_100112369 | 120 |
| 209 | 3300005458 | Ga0070681_10042535 | Ga0070681_100425354 | 120 |
| 210 | 3300005458 | Ga0070681_10113250 | Ga0070681_101132502 | 120 |
| 211 | 3300005458 | Ga0070681_10150631 | Ga0070681_101506312 | 120 |
| 212 | 3300005458 | Ga0070681_10166053 | Ga0070681_101660532 | 120 |
| 213 | 3300005458 | Ga0070681_10213897 | Ga0070681_102138973 | 120 |
| 214 | 3300005459 | Ga0068867_100310949 | Ga0068867_1003109492 | 120 |
| 215 | 3300005530 | Ga0070679_100000417 | Ga0070679_1000004179 | 120 |
| 216 | 3300005530 | Ga0070679_100006355 | Ga0070679_1000063553 | 120 |
| 217 | 3300005530 | Ga0070679_100009773 | Ga0070679_1000097734 | 120 |
| 218 | 3300005530 | Ga0070679_100010818 | Ga0070679_1000108189 | 120 |
| 219 | 3300005530 | Ga0070679_100023226 | Ga0070679_1000232265 | 120 |
| 220 | 3300005530 | Ga0070679_100046710 | Ga0070679_1000467103 | 120 |
| 221 | 3300005530 | Ga0070679_100151374 | Ga0070679_1001513743 | 120 |
| 222 | 3300005535 | Ga0070684_100141881 | Ga0070684_1001418812 | 120 |
| 223 | 3300005539 | Ga0068853_100053341 | Ga0068853_1000533412 | 120 |
| 224 | 3300005539 | Ga0068853_100482317 | Ga0068853_1004823172 | 120 |
| 225 | 3300005539 | Ga0068853_100557948 | Ga0068853_1005579482 | 120 |
| 226 | 3300005543 | Ga0070672_100004166 | Ga0070672_1000041662 | 120 |
| 227 | 3300005543 | Ga0070672_100017303 | Ga0070672_1000173033 | 120 |
| 228 | 3300005546 | Ga0070696_100006174 | Ga0070696_1000061741 | 120 |
| 229 | 3300005546 | Ga0070696_100007095 | Ga0070696_1000070955 | 120 |
| 230 | 3300005546 | Ga0070696_100035655 | Ga0070696_1000356553 | 120 |
| 231 | 3300005547 | Ga0070693_100004340 | Ga0070693_1000043403 | 120 |
| 232 | 3300005547 | Ga0070693_100049678 | Ga0070693_1000496782 | 120 |
| 233 | 3300005547 | Ga0070693_100741930 | Ga0070693_1007419301 | 120 |
| 234 | 3300005563 | Ga0068855_100015479 | Ga0068855_1000154798 | 120 |
| 235 | 3300005563 | Ga0068855_100032020 | Ga0068855_1000320202 | 120 |
| 236 | 3300005563 | Ga0068855_100168143 | Ga0068855_1001681433 | 120 |
| 237 | 3300005563 | Ga0068855_100655671 | Ga0068855_1006556712 | 120 |
| 238 | 3300005563 | Ga0068855_100965600 | Ga0068855_1009656002 | 120 |
| 239 | 3300005563 | Ga0068855_101881591 | Ga0068855_1018815911 | 120 |
| 240 | 3300005564 | Ga0070664_100046166 | Ga0070664_1000461662 | 120 |
| 241 | 3300005564 | Ga0070664_100270730 | Ga0070664_1002707302 | 120 |
| 242 | 3300005577 | Ga0068857_100001476 | Ga0068857_10000147610 | 120 |
| 243 | 3300005577 | Ga0068857_100059703 | Ga0068857_1000597033 | 120 |
| 244 | 3300005577 | Ga0068857_100125400 | Ga0068857_1001254003 | 120 |
| 245 | 3300005578 | Ga0068854_100001671 | Ga0068854_10000167113 | 120 |
| 246 | 3300005578 | Ga0068854_100001743 | Ga0068854_1000017432 | 120 |
| 247 | 3300005578 | Ga0068854_100354801 | Ga0068854_1003548012 | 120 |
| 248 | 3300005578 | Ga0068854_100910420 | Ga0068854_1009104202 | 120 |
| 249 | 3300005614 | Ga0068856_100385280 | Ga0068856_1003852802 | 120 |
| 250 | 3300005614 | Ga0068856_100469816 | Ga0068856_1004698162 | 120 |
| 251 | 3300005616 | Ga0068852_100031648 | Ga0068852_1000316484 | 120 |
| 252 | 3300005616 | Ga0068852_100044930 | Ga0068852_1000449302 | 120 |
| 253 | 3300005616 | Ga0068852_100322097 | Ga0068852_1003220972 | 120 |
| 254 | 3300005616 | Ga0068852_100881383 | Ga0068852_1008813832 | 120 |
| 255 | 3300005616 | Ga0068852_101161385 | Ga0068852_1011613852 | 120 |
| 256 | 3300005616 | Ga0068852_101516220 | Ga0068852_1015162202 | 120 |
| 257 | 3300005616 | Ga0068852_102430073 | Ga0068852_1024300731 | 120 |
| 258 | 3300005617 | Ga0068859_101220764 | Ga0068859_1012207641 | 120 |
| 259 | 3300005719 | Ga0068861_101341650 | Ga0068861_1013416502 | 120 |
| 260 | 3300005834 | Ga0068851_10002109 | Ga0068851_100021094 | 120 |
| 261 | 3300005834 | Ga0068851_10012619 | Ga0068851_100126193 | 120 |
| 262 | 3300005842 | Ga0068858_100043017 | Ga0068858_1000430173 | 120 |
| 263 | 3300006186 | Ga0075369_10043214 | Ga0075369_100432142 | 120 |
| 264 | 3300006186 | Ga0075369_10302596 | Ga0075369_103025962 | 120 |
| 265 | 3300006186 | Ga0075369_10590184 | Ga0075369_105901841 | 120 |
| 266 | 3300006844 | Ga0075428_102082359 | Ga0075428_1020823591 | 120 |
| 267 | 3300006914 | Ga0075436_100638836 | Ga0075436_1006388362 | 120 |
| 268 | 3300006931 | Ga0097620_101220884 | Ga0097620_1012208842 | 120 |
| 269 | 3300009093 | Ga0105240_10012166 | Ga0105240_100121668 | 120 |
| 270 | 3300009093 | Ga0105240_10025498 | Ga0105240_100254984 | 120 |
| 271 | 3300009093 | Ga0105240_10035445 | Ga0105240_100354452 | 120 |
| 272 | 3300009093 | Ga0105240_10085082 | Ga0105240_100850824 | 120 |
| 273 | 3300009093 | Ga0105240_10110006 | Ga0105240_101100063 | 120 |
| 274 | 3300009093 | Ga0105240_10443179 | Ga0105240_104431793 | 120 |
| 275 | 3300009101 | Ga0105247_10017867 | Ga0105247_100178672 | 120 |
| 276 | 3300009148 | Ga0105243_10182221 | Ga0105243_101822212 | 120 |
| 277 | 3300009148 | Ga0105243_11911836 | Ga0105243_119118362 | 120 |
| 278 | 3300009174 | Ga0105241_10054272 | Ga0105241_100542723 | 120 |
| 279 | 3300009174 | Ga0105241_10068360 | Ga0105241_100683602 | 120 |
| 280 | 3300009174 | Ga0105241_10093319 | Ga0105241_100933193 | 120 |
| 281 | 3300009176 | Ga0105242_11225772 | Ga0105242_112257722 | 120 |
| 282 | 3300009176 | Ga0105242_11834694 | Ga0105242_118346941 | 120 |
| 283 | 3300009177 | Ga0105248_10792907 | Ga0105248_107929071 | 120 |
| 284 | 3300009545 | Ga0105237_10233012 | Ga0105237_102330123 | 120 |
| 285 | 3300009545 | Ga0105237_12008028 | Ga0105237_120080282 | 120 |
| 286 | 3300009551 | Ga0105238_10018845 | Ga0105238_100188453 | 120 |
| 287 | 3300009551 | Ga0105238_10684057 | Ga0105238_106840571 | 120 |
| 288 | 3300009982 | Ga0105147_103760 | Ga0105147_1037601 | 120 |
| 289 | 3300010375 | Ga0105239_10102409 | Ga0105239_101024092 | 120 |
| 290 | 3300010375 | Ga0105239_10166696 | Ga0105239_101666964 | 120 |
| 291 | 3300010375 | Ga0105239_10195481 | Ga0105239_101954812 | 120 |
| 292 | 3300012476 | Ga0157344_1017903 | Ga0157344_10179031 | 120 |
| 293 | 3300012498 | Ga0157345_1027029 | Ga0157345_10270291 | 120 |
| 294 | 3300012502 | Ga0157347_1009209 | Ga0157347_10092092 | 120 |
| 295 | 3300012508 | Ga0157315_1017720 | Ga0157315_10177201 | 120 |
| 296 | 3300012510 | Ga0157316_1003631 | Ga0157316_10036312 | 120 |
| 297 | 3300012512 | Ga0157327_1002389 | Ga0157327_10023892 | 120 |
| 298 | 3300012515 | Ga0157338_1096244 | Ga0157338_10962441 | 120 |
| 299 | 3300013062 | Ga0154010_113527 | Ga0154010_1135272 | 120 |
| 300 | 3300013100 | Ga0157373_10020745 | Ga0157373_100207453 | 120 |
| 301 | 3300013100 | Ga0157373_10133203 | Ga0157373_101332031 | 120 |
| 302 | 3300013100 | Ga0157373_10154098 | Ga0157373_101540981 | 120 |
| 303 | 3300013100 | Ga0157373_10190081 | Ga0157373_101900812 | 120 |
| 304 | 3300013100 | Ga0157373_10447163 | Ga0157373_104471632 | 120 |
| 305 | 3300013100 | Ga0157373_11185086 | Ga0157373_111850862 | 120 |
| 306 | 3300013102 | Ga0157371_10045390 | Ga0157371_100453903 | 120 |
| 307 | 3300013102 | Ga0157371_10054731 | Ga0157371_100547313 | 120 |
| 308 | 3300013102 | Ga0157371_10055956 | Ga0157371_100559562 | 120 |
| 309 | 3300013102 | Ga0157371_10145693 | Ga0157371_101456933 | 120 |
| 310 | 3300013102 | Ga0157371_10183034 | Ga0157371_101830341 | 120 |
| 311 | 3300013102 | Ga0157371_10229099 | Ga0157371_102290993 | 120 |
| 312 | 3300013102 | Ga0157371_10315295 | Ga0157371_103152951 | 120 |
| 313 | 3300013102 | Ga0157371_10750448 | Ga0157371_107504482 | 120 |
| 314 | 3300013102 | Ga0157371_10944355 | Ga0157371_109443552 | 120 |
| 315 | 3300013104 | Ga0157370_10003325 | Ga0157370_100033258 | 120 |
| 316 | 3300013104 | Ga0157370_10033173 | Ga0157370_100331735 | 120 |
| 317 | 3300013104 | Ga0157370_10036358 | Ga0157370_100363585 | 120 |
| 318 | 3300013104 | Ga0157370_10044515 | Ga0157370_100445156 | 120 |
| 319 | 3300013104 | Ga0157370_10048846 | Ga0157370_100488463 | 120 |
| 320 | 3300013104 | Ga0157370_10064365 | Ga0157370_100643655 | 120 |
| 321 | 3300013104 | Ga0157370_10151286 | Ga0157370_101512863 | 120 |
| 322 | 3300013104 | Ga0157370_10526846 | Ga0157370_105268462 | 120 |
| 323 | 3300013104 | Ga0157370_10530370 | Ga0157370_105303702 | 120 |
| 324 | 3300013104 | Ga0157370_10664759 | Ga0157370_106647592 | 120 |
| 325 | 3300013105 | Ga0157369_10001292 | Ga0157369_1000129211 | 120 |
| 326 | 3300013105 | Ga0157369_10006527 | Ga0157369_100065279 | 120 |
| 327 | 3300013105 | Ga0157369_10090465 | Ga0157369_100904653 | 120 |
| 328 | 3300013105 | Ga0157369_10099266 | Ga0157369_100992663 | 120 |
| 329 | 3300013105 | Ga0157369_10105504 | Ga0157369_101055043 | 120 |
| 330 | 3300013105 | Ga0157369_10705786 | Ga0157369_107057862 | 120 |
| 331 | 3300013306 | Ga0163162_10871887 | Ga0163162_108718872 | 120 |
| 332 | 3300013306 | Ga0163162_12088368 | Ga0163162_120883681 | 120 |
| 333 | 3300013307 | Ga0157372_10021240 | Ga0157372_100212404 | 120 |
| 334 | 3300013307 | Ga0157372_10034344 | Ga0157372_100343443 | 120 |
| 335 | 3300013307 | Ga0157372_10074339 | Ga0157372_100743393 | 120 |
| 336 | 3300013307 | Ga0157372_10125890 | Ga0157372_101258903 | 120 |
| 337 | 3300013307 | Ga0157372_10138037 | Ga0157372_101380372 | 120 |
| 338 | 3300013307 | Ga0157372_10171987 | Ga0157372_101719872 | 120 |
| 339 | 3300013307 | Ga0157372_10269523 | Ga0157372_102695232 | 120 |
| 340 | 3300013307 | Ga0157372_10297299 | Ga0157372_102972992 | 120 |
| 341 | 3300013307 | Ga0157372_10657754 | Ga0157372_106577542 | 120 |
| 342 | 3300013307 | Ga0157372_10758775 | Ga0157372_107587752 | 120 |
| 343 | 3300013308 | Ga0157375_10031579 | Ga0157375_100315792 | 120 |
| 344 | 3300013308 | Ga0157375_12486801 | Ga0157375_124868011 | 120 |
| 345 | 3300014325 | Ga0163163_11191094 | Ga0163163_111910942 | 120 |
| 346 | 3300014497 | Ga0182008_10007538 | Ga0182008_100075382 | 120 |
| 347 | 3300014497 | Ga0182008_10007676 | Ga0182008_100076764 | 120 |
| 348 | 3300014497 | Ga0182008_10019810 | Ga0182008_100198102 | 120 |
| 349 | 3300014497 | Ga0182008_10032898 | Ga0182008_100328983 | 120 |
| 350 | 3300015261 | Ga0182006_1000074 | Ga0182006_100007411 | 120 |
| 351 | 3300015261 | Ga0182006_1000613 | Ga0182006_10006136 | 120 |
| 352 | 3300015261 | Ga0182006_1011383 | Ga0182006_10113832 | 120 |
| 353 | 3300015261 | Ga0182006_1092917 | Ga0182006_10929172 | 120 |
| 354 | 3300015262 | Ga0182007_10002107 | Ga0182007_100021074 | 120 |
| 355 | 3300015262 | Ga0182007_10004902 | Ga0182007_100049022 | 120 |
| 356 | 3300015262 | Ga0182007_10012917 | Ga0182007_100129173 | 120 |
| 357 | 3300015262 | Ga0182007_10063115 | Ga0182007_100631152 | 120 |
| 358 | 3300015265 | Ga0182005_1000034 | Ga0182005_100003413 | 120 |
| 359 | 3300015265 | Ga0182005_1002601 | Ga0182005_10026014 | 120 |
| 360 | 3300015265 | Ga0182005_1015576 | Ga0182005_10155762 | 120 |
| 361 | 3300015265 | Ga0182005_1081212 | Ga0182005_10812122 | 120 |
| 362 | 3300020069 | Ga0197907_10940396 | Ga0197907_109403962 | 120 |
| 363 | 3300020070 | Ga0206356_10517904 | Ga0206356_105179044 | 120 |
| 364 | 3300020070 | Ga0206356_11822277 | Ga0206356_118222773 | 120 |
| 365 | 3300020076 | Ga0206355_1282734 | Ga0206355_12827342 | 120 |
| 366 | 3300020077 | Ga0206351_10169628 | Ga0206351_101696283 | 120 |
| 367 | 3300020080 | Ga0206350_10952999 | Ga0206350_109529993 | 120 |
| 368 | 3300020081 | Ga0206354_10418515 | Ga0206354_104185152 | 120 |
| 369 | 3300020081 | Ga0206354_11023207 | Ga0206354_110232072 | 120 |
| 370 | 3300020082 | Ga0206353_10062743 | Ga0206353_100627433 | 120 |
| 371 | 3300020082 | Ga0206353_12055317 | Ga0206353_120553172 | 120 |
| 372 | 3300020610 | Ga0154015_1481086 | Ga0154015_14810863 | 120 |
| 373 | 3300022467 | Ga0224712_10040408 | Ga0224712_100404082 | 120 |
| 374 | 3300025321 | Ga0207656_10121416 | Ga0207656_101214162 | 120 |
| 375 | 3300025901 | Ga0207688_10214077 | Ga0207688_102140772 | 120 |
| 376 | 3300025904 | Ga0207647_10001048 | Ga0207647_100010489 | 120 |
| 377 | 3300025904 | Ga0207647_10001755 | Ga0207647_1000175512 | 120 |
| 378 | 3300025908 | Ga0207643_10439068 | Ga0207643_104390682 | 120 |
| 379 | 3300025909 | Ga0207705_10000247 | Ga0207705_1000024731 | 120 |
| 380 | 3300025909 | Ga0207705_10000564 | Ga0207705_1000056429 | 120 |
| 381 | 3300025909 | Ga0207705_10000852 | Ga0207705_1000085223 | 120 |
| 382 | 3300025909 | Ga0207705_10000941 | Ga0207705_1000094120 | 120 |
| 383 | 3300025909 | Ga0207705_10012701 | Ga0207705_100127014 | 120 |
| 384 | 3300025909 | Ga0207705_10060610 | Ga0207705_100606103 | 120 |
| 385 | 3300025909 | Ga0207705_10252829 | Ga0207705_102528292 | 120 |
| 386 | 3300025909 | Ga0207705_10906234 | Ga0207705_109062342 | 120 |
| 387 | 3300025911 | Ga0207654_10137718 | Ga0207654_101377181 | 120 |
| 388 | 3300025911 | Ga0207654_10169990 | Ga0207654_101699903 | 120 |
| 389 | 3300025912 | Ga0207707_10000179 | Ga0207707_1000017928 | 120 |
| 390 | 3300025912 | Ga0207707_10000370 | Ga0207707_1000037022 | 120 |
| 391 | 3300025912 | Ga0207707_10000531 | Ga0207707_1000053131 | 120 |
| 392 | 3300025912 | Ga0207707_10001002 | Ga0207707_1000100226 | 120 |
| 393 | 3300025912 | Ga0207707_10007858 | Ga0207707_1000785810 | 120 |
| 394 | 3300025912 | Ga0207707_10018206 | Ga0207707_100182063 | 120 |
| 395 | 3300025912 | Ga0207707_10029589 | Ga0207707_100295893 | 120 |
| 396 | 3300025912 | Ga0207707_10205897 | Ga0207707_102058972 | 120 |
| 397 | 3300025913 | Ga0207695_10000614 | Ga0207695_1000061449 | 120 |
| 398 | 3300025913 | Ga0207695_10002572 | Ga0207695_100025724 | 120 |
| 399 | 3300025913 | Ga0207695_10002586 | Ga0207695_1000258622 | 120 |
| 400 | 3300025913 | Ga0207695_10008776 | Ga0207695_100087769 | 120 |
| 401 | 3300025917 | Ga0207660_10001033 | Ga0207660_100010336 | 120 |
| 402 | 3300025917 | Ga0207660_10004313 | Ga0207660_1000431310 | 120 |
| 403 | 3300025917 | Ga0207660_10006603 | Ga0207660_100066033 | 120 |
| 404 | 3300025917 | Ga0207660_10012451 | Ga0207660_100124513 | 120 |
| 405 | 3300025917 | Ga0207660_10044221 | Ga0207660_100442213 | 120 |
| 406 | 3300025917 | Ga0207660_10048865 | Ga0207660_100488653 | 120 |
| 407 | 3300025917 | Ga0207660_10148593 | Ga0207660_101485932 | 120 |
| 408 | 3300025917 | Ga0207660_10187723 | Ga0207660_101877233 | 120 |
| 409 | 3300025917 | Ga0207660_10438778 | Ga0207660_104387782 | 120 |
| 410 | 3300025919 | Ga0207657_10068777 | Ga0207657_100687773 | 120 |
| 411 | 3300025919 | Ga0207657_10073439 | Ga0207657_100734393 | 120 |
| 412 | 3300025920 | Ga0207649_10003622 | Ga0207649_100036228 | 120 |
| 413 | 3300025920 | Ga0207649_10023696 | Ga0207649_100236964 | 120 |
| 414 | 3300025920 | Ga0207649_10026610 | Ga0207649_100266103 | 120 |
| 415 | 3300025920 | Ga0207649_10035625 | Ga0207649_100356253 | 120 |
| 416 | 3300025920 | Ga0207649_10238205 | Ga0207649_102382052 | 120 |
| 417 | 3300025921 | Ga0207652_10000048 | Ga0207652_100000485 | 120 |
| 418 | 3300025921 | Ga0207652_10000442 | Ga0207652_1000044210 | 120 |
| 419 | 3300025921 | Ga0207652_10001106 | Ga0207652_1000110612 | 120 |
| 420 | 3300025921 | Ga0207652_10006756 | Ga0207652_1000675610 | 120 |
| 421 | 3300025921 | Ga0207652_10015204 | Ga0207652_100152047 | 120 |
| 422 | 3300025921 | Ga0207652_10069198 | Ga0207652_100691983 | 120 |
| 423 | 3300025921 | Ga0207652_10399454 | Ga0207652_103994542 | 120 |
| 424 | 3300025924 | Ga0207694_10040967 | Ga0207694_100409671 | 120 |
| 425 | 3300025925 | Ga0207650_10023776 | Ga0207650_100237764 | 120 |
| 426 | 3300025926 | Ga0207659_10611570 | Ga0207659_106115702 | 120 |
| 427 | 3300025931 | Ga0207644_10640184 | Ga0207644_106401842 | 120 |
| 428 | 3300025932 | Ga0207690_10002129 | Ga0207690_1000212912 | 120 |
| 429 | 3300025932 | Ga0207690_10005343 | Ga0207690_100053434 | 120 |
| 430 | 3300025932 | Ga0207690_10028095 | Ga0207690_100280952 | 120 |
| 431 | 3300025932 | Ga0207690_10292869 | Ga0207690_102928692 | 120 |
| 432 | 3300025933 | Ga0207706_10030079 | Ga0207706_100300793 | 120 |
| 433 | 3300025933 | Ga0207706_10240444 | Ga0207706_102404442 | 120 |
| 434 | 3300025933 | Ga0207706_10342421 | Ga0207706_103424211 | 120 |
| 435 | 3300025934 | Ga0207686_10477831 | Ga0207686_104778312 | 120 |
| 436 | 3300025935 | Ga0207709_10578729 | Ga0207709_105787291 | 120 |
| 437 | 3300025937 | Ga0207669_10427313 | Ga0207669_104273132 | 120 |
| 438 | 3300025940 | Ga0207691_10004879 | Ga0207691_100048799 | 120 |
| 439 | 3300025944 | Ga0207661_10005779 | Ga0207661_100057793 | 120 |
| 440 | 3300025944 | Ga0207661_10146207 | Ga0207661_101462072 | 120 |
| 441 | 3300025944 | Ga0207661_10465607 | Ga0207661_104656072 | 120 |
| 442 | 3300025944 | Ga0207661_10717725 | Ga0207661_107177252 | 120 |
| 443 | 3300025945 | Ga0207679_10083104 | Ga0207679_100831043 | 120 |
| 444 | 3300025945 | Ga0207679_10514759 | Ga0207679_105147592 | 120 |
| 445 | 3300025949 | Ga0207667_10000985 | Ga0207667_1000098524 | 120 |
| 446 | 3300025949 | Ga0207667_10002428 | Ga0207667_1000242823 | 120 |
| 447 | 3300025949 | Ga0207667_10002908 | Ga0207667_1000290820 | 120 |
| 448 | 3300025949 | Ga0207667_10006102 | Ga0207667_100061028 | 120 |
| 449 | 3300025949 | Ga0207667_10013249 | Ga0207667_100132493 | 120 |
| 450 | 3300025949 | Ga0207667_10016617 | Ga0207667_100166178 | 120 |
| 451 | 3300025949 | Ga0207667_10166301 | Ga0207667_101663013 | 120 |
| 452 | 3300025981 | Ga0207640_10000400 | Ga0207640_100004004 | 120 |
| 453 | 3300025981 | Ga0207640_10000522 | Ga0207640_1000052211 | 120 |
| 454 | 3300025981 | Ga0207640_10002030 | Ga0207640_100020302 | 120 |
| 455 | 3300025981 | Ga0207640_10064046 | Ga0207640_100640462 | 120 |
| 456 | 3300026041 | Ga0207639_10001025 | Ga0207639_100010255 | 120 |
| 457 | 3300026041 | Ga0207639_10029846 | Ga0207639_100298463 | 120 |
| 458 | 3300026041 | Ga0207639_10189383 | Ga0207639_101893832 | 120 |
| 459 | 3300026067 | Ga0207678_10009617 | Ga0207678_100096177 | 120 |
| 460 | 3300026067 | Ga0207678_10023229 | Ga0207678_100232292 | 120 |
| 461 | 3300026067 | Ga0207678_10086224 | Ga0207678_100862243 | 120 |
| 462 | 3300026067 | Ga0207678_10093676 | Ga0207678_100936763 | 120 |
| 463 | 3300026067 | Ga0207678_10466479 | Ga0207678_104664792 | 120 |
| 464 | 3300026067 | Ga0207678_10466745 | Ga0207678_104667452 | 120 |
| 465 | 3300026067 | Ga0207678_11847152 | Ga0207678_118471521 | 120 |
| 466 | 3300026078 | Ga0207702_10001167 | Ga0207702_100011673 | 120 |
| 467 | 3300026078 | Ga0207702_10092358 | Ga0207702_100923582 | 120 |
| 468 | 3300026078 | Ga0207702_10101007 | Ga0207702_101010073 | 120 |
| 469 | 3300026089 | Ga0207648_10126680 | Ga0207648_101266802 | 120 |
| 470 | 3300026116 | Ga0207674_10002238 | Ga0207674_100022388 | 120 |
| 471 | 3300026116 | Ga0207674_10104930 | Ga0207674_101049303 | 120 |
| 472 | 3300026116 | Ga0207674_10112905 | Ga0207674_101129053 | 120 |
| 473 | 3300026121 | Ga0207683_10629232 | Ga0207683_106292322 | 120 |
| 474 | 3300026142 | Ga0207698_10002102 | Ga0207698_100021029 | 120 |
| 475 | 3300026142 | Ga0207698_10027686 | Ga0207698_100276862 | 120 |
| 476 | 3300026142 | Ga0207698_10142823 | Ga0207698_101428233 | 120 |
| 477 | 3300026142 | Ga0207698_10833091 | Ga0207698_108330912 | 120 |
| 478 | 3300026142 | Ga0207698_11877260 | Ga0207698_118772601 | 120 |
| 479 | 3300030744 | Ga0316181_1021124 | Ga0316181_10211241 | 120 |
| 480 | 3300031824 | Ga0307413_10281785 | Ga0307413_102817852 | 120 |
| 481 | 3300031901 | Ga0307406_11210612 | Ga0307406_112106122 | 120 |
| 482 | 3300032005 | Ga0307411_10643837 | Ga0307411_106438372 | 120 |
| 483 | 3300032137 | Ga0316585_10047330 | Ga0316585_100473303 | 120 |
| 484 | 3300032168 | Ga0316593_10001114 | Ga0316593_100011145 | 120 |
| 485 | 3300033524 | Ga0316592_1020612 | Ga0316592_10206122 | 120 |
| 486 | 3300033524 | Ga0316592_1030411 | Ga0316592_10304112 | 120 |
| 487 | 3300033527 | Ga0316586_1018861 | Ga0316586_10188612 | 120 |
| 488 | 3300033528 | Ga0316588_1073687 | Ga0316588_10736871 | 120 |
| 489 | 3300033529 | Ga0316587_1009992 | Ga0316587_10099922 | 120 |
| 490 | 3300033529 | Ga0316587_1071017 | Ga0316587_10710172 | 120 |
| 491 | 3300033541 | Ga0316596_1000045 | Ga0316596_10000457 | 120 |
| 492 | 3300033541 | Ga0316596_1002151 | Ga0316596_10021512 | 120 |
| 493 | 3300035398 | Ga0316574_0111585 | Ga0316574_0111585_905_1270 | 120 |
| 494 | 3300036647 | Ga0316582_0031233 | Ga0316582_0031233_277_645 | 120 |
| 495 | 3300036712 | Ga0316584_0002473 | Ga0316584_0002473_7611_7979 | 120 |
| 496 | 3300036712 | Ga0316584_0024676 | Ga0316584_0024676_1953_2321 | 120 |
| 497 | 3300037312 | Ga0395899_0037362 | Ga0395899_0037362_129_500 | 120 |
| 498 | 3300037312 | Ga0395899_0255843 | Ga0395899_0255843_553_921 | 120 |
| 499 | 3300037418 | Ga0395900_0006648 | Ga0395900_0006648_8530_8901 | 120 |
| 500 | 3300037418 | Ga0395900_0072692 | Ga0395900_0072692_1052_1423 | 120 |
| 501 | 3300037418 | Ga0395900_0194212 | Ga0395900_0194212_1592_1960 | 120 |
| 502 | 3300037418 | Ga0395900_0329038 | Ga0395900_0329038_898_1269 | 120 |
| 503 | 3300037466 | Ga0395898_0188879 | Ga0395898_0188879_1124_1492 | 120 |
| 504 | 3300037466 | Ga0395898_1592722 | Ga0395898_1592722_76_447 | 120 |
| 505 | 3300037471 | Ga0395905_0024203 | Ga0395905_0024203_2631_3011 | 120 |
| 506 | 3300037471 | Ga0395905_0342937 | Ga0395905_0342937_498_866 | 120 |
| 507 | 3300037471 | Ga0395905_0993866 | Ga0395905_0993866_87_455 | 120 |
| 508 | 3300038443 | Ga0395901_0221527 | Ga0395901_0221527_1260_1631 | 120 |
| 509 | 3300039110 | Ga0400487_30990 | Ga0400487_30990_20073_20438 | 120 |
| 510 | 3300042876 | Ga0451577_0005176 | Ga0451577_0005176_3757_4128 | 120 |
| 511 | 3300044712 | Ga0453684_0001175 | Ga0453684_0001175_55682_56044 | 120 |
| 512 | 3300044712 | Ga0453684_0004610 | Ga0453684_0004610_877_1239 | 120 |
| 513 | 3300044712 | Ga0453684_0468063 | Ga0453684_0468063_439_810 | 120 |
| 514 | 3300046459 | Ga0495629_1065265 | Ga0495629_1065265_113_502 | 120 |
| 515 | 3300046525 | Ga0495663_0312566 | Ga0495663_0312566_148_516 | 120 |
| 516 | 3300046537 | Ga0495598_0011292 | Ga0495598_0011292_558_926 | 120 |
| 517 | 3300046539 | Ga0495621_0054574 | Ga0495621_0054574_269_637 | 120 |
| 518 | 3300046664 | Ga0495659_0474862 | Ga0495659_0474862_92_460 | 120 |
| 519 | 3300046674 | Ga0495588_0288118 | Ga0495588_0288118_192_581 | 120 |
| 520 | 3300048912 | Ga0496109_0380520 | Ga0496109_0380520_446_814 | 120 |
| 521 | 3300049513 | Ga0501290_000410 | Ga0501290_000410_6409_6780 | 120 |
| 522 | 3300049523 | Ga0501300_019535 | Ga0501300_019535_352_723 | 120 |
| 523 | 3300049568 | Ga0501031_0929062 | Ga0501031_0929062_38_409 | 120 |
| 524 | 3300049569 | Ga0501032_0462890 | Ga0501032_0462890_60_431 | 120 |
| 525 | 3300049570 | Ga0501033_0020342 | Ga0501033_0020342_2909_3280 | 120 |
| 526 | 3300049571 | Ga0501034_0398664 | Ga0501034_0398664_283_654 | 120 |
| 527 | 3300049572 | Ga0501036_0323326 | Ga0501036_0323326_358_729 | 120 |
| 528 | 3300049572 | Ga0501036_0730804 | Ga0501036_0730804_204_575 | 120 |
| 529 | 3300049573 | Ga0501037_0006216 | Ga0501037_0006216_5728_6099 | 120 |
| 530 | 3300049573 | Ga0501037_0047480 | Ga0501037_0047480_232_603 | 120 |
| 531 | 3300049573 | Ga0501037_0136592 | Ga0501037_0136592_29_400 | 120 |
| 532 | 3300049574 | Ga0501038_0024242 | Ga0501038_0024242_3401_3772 | 120 |
| 533 | 3300049579 | Ga0501043_1121761 | Ga0501043_1121761_22_393 | 120 |
| 534 | 3300049580 | Ga0501046_0314857 | Ga0501046_0314857_147_518 | 120 |
| 535 | 3300049581 | Ga0501047_0015358 | Ga0501047_0015358_5051_5422 | 120 |
| 536 | 3300049581 | Ga0501047_0022111 | Ga0501047_0022111_3945_4316 | 120 |
| 537 | 3300049581 | Ga0501047_0045305 | Ga0501047_0045305_3317_3688 | 120 |
| 538 | 3300049582 | Ga0501048_0584310 | Ga0501048_0584310_141_512 | 120 |
| 539 | 3300049585 | Ga0501069_0000311 | Ga0501069_0000311_18169_18540 | 120 |
| 540 | 3300049585 | Ga0501069_0010521 | Ga0501069_0010521_2015_2386 | 120 |
| 541 | 3300049585 | Ga0501069_0015415 | Ga0501069_0015415_2057_2428 | 120 |
| 542 | 3300049586 | Ga0501070_0000395 | Ga0501070_0000395_31979_32350 | 120 |
| 543 | 3300049586 | Ga0501070_0000510 | Ga0501070_0000510_32669_33040 | 120 |
| 544 | 3300049586 | Ga0501070_0009273 | Ga0501070_0009273_3967_4338 | 120 |
| 545 | 3300049586 | Ga0501070_0013782 | Ga0501070_0013782_2482_2853 | 120 |
| 546 | 3300049586 | Ga0501070_0016718 | Ga0501070_0016718_4445_4816 | 120 |
| 547 | 3300049586 | Ga0501070_0082829 | Ga0501070_0082829_1385_1753 | 120 |
| 548 | 3300049586 | Ga0501070_0126535 | Ga0501070_0126535_1186_1557 | 120 |
| 549 | 3300049586 | Ga0501070_0613783 | Ga0501070_0613783_464_835 | 120 |
| 550 | 3300049589 | Ga0501073_0001504 | Ga0501073_0001504_6088_6459 | 120 |
| 551 | 3300049589 | Ga0501073_0025286 | Ga0501073_0025286_1609_1980 | 120 |
| 552 | 3300049590 | Ga0501074_0000121 | Ga0501074_0000121_38157_38528 | 120 |
| 553 | 3300049590 | Ga0501074_0003813 | Ga0501074_0003813_5773_6144 | 120 |
| 554 | 3300049590 | Ga0501074_0004124 | Ga0501074_0004124_60_431 | 120 |
| 555 | 3300049590 | Ga0501074_0012482 | Ga0501074_0012482_504_875 | 120 |
| 556 | 3300049593 | Ga0501077_0015834 | Ga0501077_0015834_2604_2975 | 120 |
| 557 | 3300049653 | Ga0501206_059101 | Ga0501206_059101_80_451 | 120 |
| 558 | 3300049686 | Ga0501257_031919 | Ga0501257_031919_124_495 | 120 |
| 559 | 3300049686 | Ga0501257_155599 | Ga0501257_155599_115_486 | 120 |
| 560 | 3300049688 | Ga0501259_016717 | Ga0501259_016717_353_724 | 120 |
| 561 | 3300049742 | Ga0501080_0003043 | Ga0501080_0003043_3152_3523 | 120 |
| 562 | 3300049742 | Ga0501080_0010556 | Ga0501080_0010556_2293_2664 | 120 |
| 563 | 3300049742 | Ga0501080_0011265 | Ga0501080_0011265_5833_6204 | 120 |
| 564 | 3300049744 | Ga0501083_0251145 | Ga0501083_0251145_53_424 | 120 |
| 565 | 3300049760 | Ga0501263_029981 | Ga0501263_029981_27_398 | 120 |
| 566 | 3300049762 | Ga0501265_022423 | Ga0501265_022423_309_680 | 120 |
| 567 | 3300049772 | Ga0501275_000751 | Ga0501275_000751_761_1132 | 120 |
| 568 | 3300049822 | Ga0501035_0015565 | Ga0501035_0015565_407_778 | 120 |
| 569 | 3300049822 | Ga0501035_0041438 | Ga0501035_0041438_405_776 | 120 |
| 570 | 3300049822 | Ga0501035_0057419 | Ga0501035_0057419_1848_2219 | 120 |
| 571 | 3300049822 | Ga0501035_0173430 | Ga0501035_0173430_238_609 | 120 |
| 572 | 3300049823 | Ga0501044_0042344 | Ga0501044_0042344_335_706 | 120 |
| 573 | 3300050514 | nmdc:mga08x19_591475_c1 | nmdc:mga08x19_591475_c1_131_547 | 120 |
| 574 | 3300059646 | Ga0587078_069306 | Ga0587078_069306_49_420 | 120 |
| 575 | 3300059652 | Ga0587107_017542 | Ga0587107_017542_52_423 | 120 |
| 576 | 3300003771 | Ga0055526_1000032 | Ga0055526_100003254 | 121 |
| 577 | 3300003773 | Ga0055537_1000309 | Ga0055537_100030920 | 121 |
| 578 | 3300003775 | Ga0055524_1000054 | Ga0055524_100005454 | 121 |
| 579 | 3300003784 | Ga0055534_1000041 | Ga0055534_100004161 | 121 |
| 580 | 3300003790 | Ga0055528_1000021 | Ga0055528_100002161 | 121 |
| 581 | 3300005458 | Ga0070681_10296448 | Ga0070681_102964481 | 121 |
| 582 | 3300014497 | Ga0182008_10118165 | Ga0182008_101181651 | 121 |
| 583 | 3300015689 | Ga0183360_10001 | Ga0183360_100011699 | 121 |
| 584 | 3300025245 | Ga0207425_1004601 | Ga0207425_10046012 | 121 |
| 585 | 3300025263 | Ga0209565_1000001 | Ga0209565_10000012115 | 121 |
| 586 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000012115 | 121 |
| 587 | 3300025291 | Ga0209675_1000001 | Ga0209675_1000001417 | 121 |
| 588 | 3300025294 | Ga0209025_1000005 | Ga0209025_1000005569 | 121 |
| 589 | 3300025295 | Ga0209564_1000001 | Ga0209564_1000001579 | 121 |
| 590 | 3300025297 | Ga0209758_1030942 | Ga0209758_10309423 | 121 |
| 591 | 3300025299 | Ga0209256_1000002 | Ga0209256_1000002973 | 121 |
| 592 | 3300025912 | Ga0207707_11588313 | Ga0207707_115883131 | 121 |
| 593 | 3300031548 | Ga0307408_100032413 | Ga0307408_1000324132 | 121 |
| 594 | 3300031901 | Ga0307406_10000786 | Ga0307406_100007869 | 121 |
| 595 | 3300032005 | Ga0307411_10225602 | Ga0307411_102256022 | 121 |
| 596 | 3300035170 | Ga0373943_0996851 | Ga0373943_0996851_11_394 | 121 |
| 597 | 3300041404 | Ga0439436_0020710 | Ga0439436_0020710_372_743 | 121 |
| 598 | 3300041406 | Ga0439439_0007383 | Ga0439439_0007383_2019_2390 | 121 |
| 599 | 3300041407 | Ga0439447_002680 | Ga0439447_002680_3147_3518 | 121 |
| 600 | 3300046525 | Ga0495663_0043173 | Ga0495663_0043173_826_1197 | 121 |
| 601 | 3300046616 | Ga0495668_0002607 | Ga0495668_0002607_11427_11798 | 121 |
| 602 | 3300048924 | Ga0496121_0004558 | Ga0496121_0004558_15264_15635 | 121 |
| 603 | iso_pu_bacteria | 2576861471 | 2578457415 | 121 |
| 604 | iso_pu_bacteria | 2643221579 | 2643907877 | 121 |
| 605 | iso_pu_bacteria | 2643221581 | 2643915911 | 121 |
| 606 | iso_pu_bacteria | 2747842501 | 2748017064 | 121 |
| 607 | iso_pu_bacteria | 2818991457 | 2819660455 | 121 |
| 608 | iso_pu_bacteria | 2842780639 | 2842783808 | 121 |
| 609 | iso_pu_bacteria | 2852649853 | 2852652526 | 121 |
| 610 | iso_pu_bacteria | 2852684882 | 2852689006 | 121 |
| 611 | iso_pu_bacteria | 2857442823 | 2857444788 | 121 |
| 612 | iso_pu_bacteria | 2895498888 | 2895500754 | 121 |
| 613 | iso_pu_bacteria | 2895511927 | 2895516376 | 121 |
| 614 | iso_pu_bacteria | 2895522137 | 2895523705 | 121 |
| 615 | iso_pu_bacteria | 2895525241 | 2895526714 | 121 |
| 616 | iso_pu_bacteria | 2919130084 | 2919130271 | 121 |
| 617 | iso_pu_bacteria | 2923516293 | 2923518556 | 121 |
| 618 | iso_pu_bacteria | 2929195423 | 2929198734 | 121 |
| 619 | iso_pu_bacteria | 2939589442 | 2939591314 | 121 |
| 620 | iso_pu_bacteria | 2939622612 | 2939625821 | 121 |
| 621 | iso_pu_bacteria | 2941475908 | 2941476816 | 121 |
| 622 | iso_pu_bacteria | 2974307012 | 2974308039 | 121 |
| 623 | iso_pu_bacteria | 2977247770 | 2977248772 | 121 |
| 624 | iso_pu_bacteria | 2984514374 | 2984516754 | 121 |
| 625 | iso_pu_bacteria | 2987605356 | 2987608355 | 121 |
| 626 | iso_pu_bacteria | 8002869464 | 8002871917 | 121 |
| 627 | 3300003371 | JGI26145J50221_1002825 | JGI26145J50221_10028252 | 122 |
| 628 | 3300005293 | Ga0065715_10002797 | Ga0065715_100027976 | 122 |
| 629 | 3300005293 | Ga0065715_10021005 | Ga0065715_100210053 | 122 |
| 630 | 3300005293 | Ga0065715_10090105 | Ga0065715_100901055 | 122 |
| 631 | 3300005293 | Ga0065715_10516657 | Ga0065715_105166571 | 122 |
| 632 | 3300005331 | Ga0070670_100418195 | Ga0070670_1004181952 | 122 |
| 633 | 3300005331 | Ga0070670_100441228 | Ga0070670_1004412282 | 122 |
| 634 | 3300005355 | Ga0070671_100009135 | Ga0070671_1000091359 | 122 |
| 635 | 3300005355 | Ga0070671_100426226 | Ga0070671_1004262262 | 122 |
| 636 | 3300005367 | Ga0070667_102095477 | Ga0070667_1020954771 | 122 |
| 637 | 3300005564 | Ga0070664_101318083 | Ga0070664_1013180831 | 122 |
| 638 | 3300005841 | Ga0068863_100445831 | Ga0068863_1004458312 | 122 |
| 639 | 3300005844 | Ga0068862_100616280 | Ga0068862_1006162802 | 122 |
| 640 | 3300006051 | Ga0075364_10211155 | Ga0075364_102111552 | 122 |
| 641 | 3300009551 | Ga0105238_10918336 | Ga0105238_109183362 | 122 |
| 642 | 3300012482 | Ga0157318_1002421 | Ga0157318_10024211 | 122 |
| 643 | 3300012488 | Ga0157343_1005956 | Ga0157343_10059562 | 122 |
| 644 | 3300012507 | Ga0157342_1014254 | Ga0157342_10142542 | 122 |
| 645 | 3300012508 | Ga0157315_1032405 | Ga0157315_10324051 | 122 |
| 646 | 3300012510 | Ga0157316_1000676 | Ga0157316_10006762 | 122 |
| 647 | 3300012512 | Ga0157327_1001178 | Ga0157327_10011782 | 122 |
| 648 | 3300025925 | Ga0207650_10232298 | Ga0207650_102322982 | 122 |
| 649 | 3300025925 | Ga0207650_10291087 | Ga0207650_102910872 | 122 |
| 650 | 3300025925 | Ga0207650_11638541 | Ga0207650_116385411 | 122 |
| 651 | 3300025926 | Ga0207659_10323083 | Ga0207659_103230831 | 122 |
| 652 | 3300025986 | Ga0207658_11792212 | Ga0207658_117922121 | 122 |
| 653 | 3300026088 | Ga0207641_10207376 | Ga0207641_102073763 | 122 |
| 654 | 3300026118 | Ga0207675_100459334 | Ga0207675_1004593343 | 122 |
| 655 | 3300027364 | Ga0209967_1008559 | Ga0209967_10085592 | 122 |
| 656 | 3300027424 | Ga0209984_1005401 | Ga0209984_10054012 | 122 |
| 657 | 3300027471 | Ga0209995_1023015 | Ga0209995_10230152 | 122 |
| 658 | 3300027543 | Ga0209999_1004919 | Ga0209999_10049193 | 122 |
| 659 | 3300027552 | Ga0209982_1002466 | Ga0209982_10024662 | 122 |
| 660 | 3300027614 | Ga0209970_1009866 | Ga0209970_10098662 | 122 |
| 661 | 3300027665 | Ga0209983_1005873 | Ga0209983_10058732 | 122 |
| 662 | 3300027665 | Ga0209983_1089308 | Ga0209983_10893081 | 122 |
| 663 | 3300027682 | Ga0209971_1003685 | Ga0209971_10036851 | 122 |
| 664 | 3300027876 | Ga0209974_10004863 | Ga0209974_100048636 | 122 |
| 665 | 3300027876 | Ga0209974_10018648 | Ga0209974_100186483 | 122 |
| 666 | 3300028380 | Ga0268265_10575381 | Ga0268265_105753812 | 122 |
| 667 | 3300031548 | Ga0307408_100199732 | Ga0307408_1001997322 | 122 |
| 668 | 3300031548 | Ga0307408_101234460 | Ga0307408_1012344601 | 122 |
| 669 | 3300031731 | Ga0307405_10305111 | Ga0307405_103051112 | 122 |
| 670 | 3300031824 | Ga0307413_10018649 | Ga0307413_100186495 | 122 |
| 671 | 3300031824 | Ga0307413_10225973 | Ga0307413_102259732 | 122 |
| 672 | 3300031824 | Ga0307413_10270012 | Ga0307413_102700122 | 122 |
| 673 | 3300031901 | Ga0307406_10425084 | Ga0307406_104250842 | 122 |
| 674 | 3300031903 | Ga0307407_10035669 | Ga0307407_100356693 | 122 |
| 675 | 3300031911 | Ga0307412_10506041 | Ga0307412_105060412 | 122 |
| 676 | 3300031995 | Ga0307409_100193246 | Ga0307409_1001932463 | 122 |
| 677 | 3300031995 | Ga0307409_100240886 | Ga0307409_1002408862 | 122 |
| 678 | 3300032002 | Ga0307416_101115781 | Ga0307416_1011157812 | 122 |
| 679 | 3300032004 | Ga0307414_10020108 | Ga0307414_100201084 | 122 |
| 680 | 3300032005 | Ga0307411_10081058 | Ga0307411_100810583 | 122 |
| 681 | 3300032126 | Ga0307415_100833881 | Ga0307415_1008338812 | 122 |
| 682 | 3300035115 | Ga0373941_0412956 | Ga0373941_0412956_18_476 | 122 |
| 683 | 3300037312 | Ga0395899_0008079 | Ga0395899_0008079_2965_3360 | 122 |
| 684 | 3300037418 | Ga0395900_0014342 | Ga0395900_0014342_2053_2448 | 122 |
| 685 | 3300037466 | Ga0395898_0394351 | Ga0395898_0394351_811_1206 | 122 |
| 686 | 3300037466 | Ga0395898_0552814 | Ga0395898_0552814_552_947 | 122 |
| 687 | 3300037471 | Ga0395905_0002473 | Ga0395905_0002473_15381_15776 | 122 |
| 688 | 3300037471 | Ga0395905_0051566 | Ga0395905_0051566_543_938 | 122 |
| 689 | 3300037471 | Ga0395905_1260485 | Ga0395905_1260485_88_483 | 122 |
| 690 | 3300038443 | Ga0395901_0004189 | Ga0395901_0004189_6147_6542 | 122 |
| 691 | 3300038443 | Ga0395901_0257197 | Ga0395901_0257197_1086_1481 | 122 |
| 692 | 3300041494 | Ga0451837_1513119 | Ga0451837_1513119_2150_2545 | 122 |
| 693 | 3300046525 | Ga0495663_0235502 | Ga0495663_0235502_197_592 | 122 |
| 694 | 3300046539 | Ga0495621_0000504 | Ga0495621_0000504_2417_2821 | 122 |
| 695 | 3300046615 | Ga0495656_0001639 | Ga0495656_0001639_536_940 | 122 |
| 696 | 3300046615 | Ga0495656_0168732 | Ga0495656_0168732_302_706 | 122 |
| 697 | 3300046616 | Ga0495668_0203862 | Ga0495668_0203862_544_939 | 122 |
| 698 | 3300046664 | Ga0495659_0160747 | Ga0495659_0160747_222_626 | 122 |
| 699 | 3300047318 | Ga0495636_0044615 | Ga0495636_0044615_614_1018 | 122 |
| 700 | 3300047318 | Ga0495636_0090622 | Ga0495636_0090622_796_1200 | 122 |
| 701 | 3300048903 | Ga0496100_0718289 | Ga0496100_0718289_23_418 | 122 |
| 702 | 3300048903 | Ga0496100_0897260 | Ga0496100_0897260_12_416 | 122 |
| 703 | 3300048904 | Ga0496101_0045444 | Ga0496101_0045444_737_1141 | 122 |
| 704 | 3300048904 | Ga0496101_0074798 | Ga0496101_0074798_1729_2124 | 122 |
| 705 | 3300048905 | Ga0496102_0475044 | Ga0496102_0475044_347_751 | 122 |
| 706 | 3300048906 | Ga0496103_0125354 | Ga0496103_0125354_146_550 | 122 |
| 707 | 3300048908 | Ga0496105_0601993 | Ga0496105_0601993_64_468 | 122 |
| 708 | 3300048909 | Ga0496106_0112890 | Ga0496106_0112890_1518_1922 | 122 |
| 709 | 3300048911 | Ga0496108_0027660 | Ga0496108_0027660_3692_4087 | 122 |
| 710 | 3300048912 | Ga0496109_0222625 | Ga0496109_0222625_693_1097 | 122 |
| 711 | 3300048912 | Ga0496109_0644803 | Ga0496109_0644803_178_573 | 122 |
| 712 | 3300048913 | Ga0496110_0026733 | Ga0496110_0026733_2850_3254 | 122 |
| 713 | 3300048914 | Ga0496111_0018428 | Ga0496111_0018428_1796_2200 | 122 |
| 714 | 3300048915 | Ga0496112_1027766 | Ga0496112_1027766_51_446 | 122 |
| 715 | 3300048916 | Ga0496113_0348687 | Ga0496113_0348687_480_878 | 122 |
| 716 | 3300048916 | Ga0496113_0754656 | Ga0496113_0754656_277_672 | 122 |
| 717 | 3300048917 | Ga0496114_0263641 | Ga0496114_0263641_654_1058 | 122 |
| 718 | 3300048927 | Ga0496124_0121472 | Ga0496124_0121472_1262_1666 | 122 |
| 719 | 3300049568 | Ga0501031_0158946 | Ga0501031_0158946_510_899 | 122 |
| 720 | 3300049569 | Ga0501032_0027782 | Ga0501032_0027782_22_411 | 122 |
| 721 | 3300049570 | Ga0501033_0059371 | Ga0501033_0059371_1604_1993 | 122 |
| 722 | 3300049571 | Ga0501034_0037743 | Ga0501034_0037743_1332_1721 | 122 |
| 723 | 3300049572 | Ga0501036_0669788 | Ga0501036_0669788_268_657 | 122 |
| 724 | 3300049573 | Ga0501037_0141440 | Ga0501037_0141440_140_529 | 122 |
| 725 | 3300049574 | Ga0501038_0115730 | Ga0501038_0115730_286_675 | 122 |
| 726 | 3300049575 | Ga0501039_0780703 | Ga0501039_0780703_185_574 | 122 |
| 727 | 3300049579 | Ga0501043_0139837 | Ga0501043_0139837_106_495 | 122 |
| 728 | 3300049581 | Ga0501047_0059497 | Ga0501047_0059497_331_720 | 122 |
| 729 | 3300049586 | Ga0501070_0027909 | Ga0501070_0027909_2793_3182 | 122 |
| 730 | 3300049656 | Ga0501209_057393 | Ga0501209_057393_481_876 | 122 |
| 731 | 3300049664 | Ga0501224_068275 | Ga0501224_068275_147_542 | 122 |
| 732 | 3300049674 | Ga0501242_016204 | Ga0501242_016204_251_646 | 122 |
| 733 | 3300049675 | Ga0501243_036543 | Ga0501243_036543_314_709 | 122 |
| 734 | 3300049686 | Ga0501257_022950 | Ga0501257_022950_423_818 | 122 |
| 735 | 3300049704 | Ga0501221_115248 | Ga0501221_115248_186_581 | 122 |
| 736 | 3300049705 | Ga0501225_0022173 | Ga0501225_0022173_900_1295 | 122 |
| 737 | 3300049708 | Ga0501245_117547 | Ga0501245_117547_146_541 | 122 |
| 738 | 3300049763 | Ga0501266_036291 | Ga0501266_036291_175_570 | 122 |
| 739 | 3300049765 | Ga0501268_010802 | Ga0501268_010802_710_1105 | 122 |
| 740 | 3300049772 | Ga0501275_007194 | Ga0501275_007194_571_966 | 122 |
| 741 | 3300049822 | Ga0501035_0061287 | Ga0501035_0061287_109_498 | 122 |
| 742 | 3300049823 | Ga0501044_0208867 | Ga0501044_0208867_1164_1553 | 122 |
| 743 | 3300050491 | nmdc:mga00v17_11713_c1 | nmdc:mga00v17_11713_c1_2627_3010 | 122 |
| 744 | 3300050491 | nmdc:mga00v17_183923_c1 | nmdc:mga00v17_183923_c1_885_1274 | 122 |
| 745 | 3300050491 | nmdc:mga00v17_202102_c1 | nmdc:mga00v17_202102_c1_12_401 | 122 |
| 746 | 3300003320 | rootH2_10035658 | rootH2_100356584 | 123 |
| 747 | 3300003781 | Ga0055536_1001737 | Ga0055536_100173715 | 123 |
| 748 | 3300003856 | Ga0058692_1000011 | Ga0058692_1000011169 | 123 |
| 749 | 3300005347 | Ga0070668_100003568 | Ga0070668_1000035683 | 123 |
| 750 | 3300005548 | Ga0070665_100222700 | Ga0070665_1002227003 | 123 |
| 751 | 3300005985 | Ga0081539_10300300 | Ga0081539_103003002 | 123 |
| 752 | 3300006051 | Ga0075364_10249395 | Ga0075364_102493952 | 123 |
| 753 | 3300006186 | Ga0075369_10151627 | Ga0075369_101516272 | 123 |
| 754 | 3300009036 | Ga0105244_10055685 | Ga0105244_100556851 | 123 |
| 755 | 3300009148 | Ga0105243_12237771 | Ga0105243_122377711 | 123 |
| 756 | 3300009979 | Ga0105032_100260 | Ga0105032_1002602 | 123 |
| 757 | 3300009987 | Ga0105030_103164 | Ga0105030_1031642 | 123 |
| 758 | 3300013100 | Ga0157373_10382262 | Ga0157373_103822621 | 123 |
| 759 | 3300013100 | Ga0157373_10484721 | Ga0157373_104847212 | 123 |
| 760 | 3300013102 | Ga0157371_10277885 | Ga0157371_102778852 | 123 |
| 761 | 3300013102 | Ga0157371_10340155 | Ga0157371_103401551 | 123 |
| 762 | 3300013104 | Ga0157370_10046323 | Ga0157370_100463234 | 123 |
| 763 | 3300013105 | Ga0157369_10106052 | Ga0157369_101060524 | 123 |
| 764 | 3300015261 | Ga0182006_1007534 | Ga0182006_10075343 | 123 |
| 765 | 3300025292 | Ga0209676_1000353 | Ga0209676_100035326 | 123 |
| 766 | 3300025298 | Ga0209050_1018789 | Ga0209050_10187892 | 123 |
| 767 | 3300025972 | Ga0207668_10053167 | Ga0207668_100531672 | 123 |
| 768 | 3300025972 | Ga0207668_10119756 | Ga0207668_101197563 | 123 |
| 769 | 3300026121 | Ga0207683_10108207 | Ga0207683_101082071 | 123 |
| 770 | 3300027312 | Ga0209371_1000007 | Ga0209371_1000007565 | 123 |
| 771 | 3300028379 | Ga0268266_10091111 | Ga0268266_100911113 | 123 |
| 772 | 3300030500 | Ga0268256_1000008 | Ga0268256_1000008385 | 123 |
| 773 | 3300031903 | Ga0307407_10572923 | Ga0307407_105729232 | 123 |
| 774 | 3300031911 | Ga0307412_10088100 | Ga0307412_100881003 | 123 |
| 775 | 3300032004 | Ga0307414_10029130 | Ga0307414_100291304 | 123 |
| 776 | 3300032004 | Ga0307414_10970266 | Ga0307414_109702662 | 123 |
| 777 | 3300038705 | Ga0237819_03480 | Ga0237819_03480_706_1077 | 123 |
| 778 | 3300041486 | Ga0451807_2089236 | Ga0451807_2089236_181_561 | 123 |
| 779 | 3300041505 | Ga0451849_0497687 | Ga0451849_0497687_54_434 | 123 |
| 780 | 3300041509 | Ga0451843_1160092 | Ga0451843_1160092_114_494 | 123 |
| 781 | 3300046558 | Ga0495633_0007116 | Ga0495633_0007116_6115_6486 | 123 |
| 782 | 3300047472 | Ga0495686_0088491 | Ga0495686_0088491_561_932 | 123 |
| 783 | 3300048904 | Ga0496101_0156770 | Ga0496101_0156770_525_923 | 123 |
| 784 | 3300048906 | Ga0496103_0556494 | Ga0496103_0556494_77_475 | 123 |
| 785 | 3300048919 | Ga0496116_0002176 | Ga0496116_0002176_2723_3106 | 123 |
| 786 | 3300048924 | Ga0496121_0011920 | Ga0496121_0011920_7656_8027 | 123 |
| 787 | 3300048927 | Ga0496124_0352538 | Ga0496124_0352538_512_895 | 123 |
| 788 | 3300006051 | Ga0075364_10042824 | Ga0075364_100428242 | 124 |
| 789 | 3300049569 | Ga0501032_0021060 | Ga0501032_0021060_1653_2036 | 124 |
| 790 | 3300049569 | Ga0501032_0368018 | Ga0501032_0368018_345_728 | 124 |
| 791 | 3300049570 | Ga0501033_0046777 | Ga0501033_0046777_1387_1770 | 124 |
| 792 | 3300049571 | Ga0501034_0008036 | Ga0501034_0008036_5747_6130 | 124 |
| 793 | 3300049571 | Ga0501034_0071873 | Ga0501034_0071873_1468_1851 | 124 |
| 794 | 3300049571 | Ga0501034_0148923 | Ga0501034_0148923_1146_1535 | 124 |
| 795 | 3300049571 | Ga0501034_0249140 | Ga0501034_0249140_1244_1627 | 124 |
| 796 | 3300049572 | Ga0501036_0018891 | Ga0501036_0018891_4414_4797 | 124 |
| 797 | 3300049573 | Ga0501037_0007981 | Ga0501037_0007981_4110_4493 | 124 |
| 798 | 3300049574 | Ga0501038_0020445 | Ga0501038_0020445_2517_2900 | 124 |
| 799 | 3300049575 | Ga0501039_0009325 | Ga0501039_0009325_4595_4978 | 124 |
| 800 | 3300049579 | Ga0501043_0024405 | Ga0501043_0024405_1359_1742 | 124 |
| 801 | 3300049581 | Ga0501047_0876939 | Ga0501047_0876939_208_591 | 124 |
| 802 | 3300049584 | Ga0501068_0018907 | Ga0501068_0018907_2382_2765 | 124 |
| 803 | 3300049586 | Ga0501070_0035486 | Ga0501070_0035486_1945_2328 | 124 |
| 804 | 3300049587 | Ga0501071_0232394 | Ga0501071_0232394_26_409 | 124 |
| 805 | 3300049589 | Ga0501073_0008164 | Ga0501073_0008164_3493_3876 | 124 |
| 806 | 3300049741 | Ga0501079_0333085 | Ga0501079_0333085_66_449 | 124 |
| 807 | 3300049822 | Ga0501035_0024405 | Ga0501035_0024405_2639_3022 | 124 |
| 808 | 3300049823 | Ga0501044_0009836 | Ga0501044_0009836_8137_8520 | 124 |
| 809 | 3300049823 | Ga0501044_0987714 | Ga0501044_0987714_258_641 | 124 |
| 810 | 3300050491 | nmdc:mga00v17_119_c1 | nmdc:mga00v17_119_c1_42697_43086 | 124 |
| 811 | 2162886007 | SwRhRL2b_contig_1494109 | SwRhRL2b_0296.00004950 | 125 |
| 812 | 2162886007 | SwRhRL2b_contig_1768253 | SwRhRL2b_0924.00004880 | 125 |
| 813 | 2162886007 | SwRhRL2b_contig_2659438 | SwRhRL2b_0318.00001630 | 125 |
| 814 | 3300002773 | JGI25152J39213_1000221 | JGI25152J39213_100022117 | 125 |
| 815 | 3300002774 | JGI25150J39212_1000698 | JGI25150J39212_10006988 | 125 |
| 816 | 3300003187 | JGI25151J46595_10000107 | JGI25151J46595_1000010763 | 125 |
| 817 | 3300003215 | JGI25153J46596_10000078 | JGI25153J46596_1000007863 | 125 |
| 818 | 3300003771 | Ga0055526_1000504 | Ga0055526_100050418 | 125 |
| 819 | 3300003773 | Ga0055537_1001396 | Ga0055537_100139610 | 125 |
| 820 | 3300003775 | Ga0055524_1032027 | Ga0055524_10320272 | 125 |
| 821 | 3300003775 | Ga0055524_1045848 | Ga0055524_10458482 | 125 |
| 822 | 3300003781 | Ga0055536_1001040 | Ga0055536_100104010 | 125 |
| 823 | 3300003781 | Ga0055536_1001075 | Ga0055536_100107511 | 125 |
| 824 | 3300003781 | Ga0055536_1002595 | Ga0055536_10025951 | 125 |
| 825 | 3300003784 | Ga0055534_1000065 | Ga0055534_100006539 | 125 |
| 826 | 3300003790 | Ga0055528_1002176 | Ga0055528_10021767 | 125 |
| 827 | 3300003791 | Ga0055530_10000277 | Ga0055530_1000027730 | 125 |
| 828 | 3300003791 | Ga0055530_10000307 | Ga0055530_1000030726 | 125 |
| 829 | 3300003792 | Ga0055540_1022212 | Ga0055540_10222122 | 125 |
| 830 | 3300003794 | Ga0055531_10002203 | Ga0055531_100022038 | 125 |
| 831 | 3300003794 | Ga0055531_10005871 | Ga0055531_100058717 | 125 |
| 832 | 3300003794 | Ga0055531_10009391 | Ga0055531_100093916 | 125 |
| 833 | 3300003794 | Ga0055531_10018988 | Ga0055531_100189882 | 125 |
| 834 | 3300003794 | Ga0055531_10019162 | Ga0055531_100191624 | 125 |
| 835 | 3300003856 | Ga0058692_1000017 | Ga0058692_100001761 | 125 |
| 836 | 3300005289 | Ga0065704_10000467 | Ga0065704_1000046718 | 125 |
| 837 | 3300005289 | Ga0065704_10090081 | Ga0065704_100900813 | 125 |
| 838 | 3300005289 | Ga0065704_10174874 | Ga0065704_101748743 | 125 |
| 839 | 3300005289 | Ga0065704_10373551 | Ga0065704_103735511 | 125 |
| 840 | 3300005331 | Ga0070670_100001282 | Ga0070670_10000128214 | 125 |
| 841 | 3300005435 | Ga0070714_100901719 | Ga0070714_1009017192 | 125 |
| 842 | 3300005548 | Ga0070665_100093482 | Ga0070665_1000934824 | 125 |
| 843 | 3300005548 | Ga0070665_100297671 | Ga0070665_1002976712 | 125 |
| 844 | 3300005548 | Ga0070665_100320193 | Ga0070665_1003201932 | 125 |
| 845 | 3300006038 | Ga0075365_10156224 | Ga0075365_101562242 | 125 |
| 846 | 3300006048 | Ga0075363_100077498 | Ga0075363_1000774982 | 125 |
| 847 | 3300006048 | Ga0075363_100169712 | Ga0075363_1001697122 | 125 |
| 848 | 3300006051 | Ga0075364_10135742 | Ga0075364_101357422 | 125 |
| 849 | 3300006051 | Ga0075364_11228898 | Ga0075364_112288982 | 125 |
| 850 | 3300006177 | Ga0075362_10373701 | Ga0075362_103737012 | 125 |
| 851 | 3300006195 | Ga0075366_10552632 | Ga0075366_105526321 | 125 |
| 852 | 3300009011 | Ga0105251_10000452 | Ga0105251_1000045212 | 125 |
| 853 | 3300009011 | Ga0105251_10001834 | Ga0105251_1000183411 | 125 |
| 854 | 3300009148 | Ga0105243_10006966 | Ga0105243_100069663 | 125 |
| 855 | 3300009984 | Ga0105029_102701 | Ga0105029_1027012 | 125 |
| 856 | 3300009993 | Ga0105028_102644 | Ga0105028_1026441 | 125 |
| 857 | 3300011119 | Ga0105246_10181214 | Ga0105246_101812142 | 125 |
| 858 | 3300013102 | Ga0157371_10001931 | Ga0157371_100019316 | 125 |
| 859 | 3300013102 | Ga0157371_10559012 | Ga0157371_105590121 | 125 |
| 860 | 3300013104 | Ga0157370_10003652 | Ga0157370_100036523 | 125 |
| 861 | 3300013104 | Ga0157370_10143509 | Ga0157370_101435092 | 125 |
| 862 | 3300014497 | Ga0182008_10000150 | Ga0182008_1000015033 | 125 |
| 863 | 3300014497 | Ga0182008_10012691 | Ga0182008_100126912 | 125 |
| 864 | 3300015261 | Ga0182006_1008997 | Ga0182006_10089972 | 125 |
| 865 | 3300015261 | Ga0182006_1009303 | Ga0182006_10093033 | 125 |
| 866 | 3300015261 | Ga0182006_1036605 | Ga0182006_10366052 | 125 |
| 867 | 3300015261 | Ga0182006_1062998 | Ga0182006_10629982 | 125 |
| 868 | 3300015262 | Ga0182007_10000593 | Ga0182007_1000059310 | 125 |
| 869 | 3300015265 | Ga0182005_1001301 | Ga0182005_10013016 | 125 |
| 870 | 3300015265 | Ga0182005_1011780 | Ga0182005_10117801 | 125 |
| 871 | 3300017792 | Ga0163161_10001446 | Ga0163161_1000144611 | 125 |
| 872 | 3300017792 | Ga0163161_10024367 | Ga0163161_100243674 | 125 |
| 873 | 3300025245 | Ga0207425_1000028 | Ga0207425_100002848 | 125 |
| 874 | 3300025258 | Ga0209129_1000011 | Ga0209129_1000011574 | 125 |
| 875 | 3300025263 | Ga0209565_1000023 | Ga0209565_1000023295 | 125 |
| 876 | 3300025273 | Ga0209673_1000308 | Ga0209673_100030847 | 125 |
| 877 | 3300025273 | Ga0209673_1000853 | Ga0209673_100085326 | 125 |
| 878 | 3300025284 | Ga0209130_1006582 | Ga0209130_10065825 | 125 |
| 879 | 3300025291 | Ga0209675_1000154 | Ga0209675_10001549 | 125 |
| 880 | 3300025292 | Ga0209676_1000086 | Ga0209676_100008684 | 125 |
| 881 | 3300025292 | Ga0209676_1000189 | Ga0209676_100018914 | 125 |
| 882 | 3300025292 | Ga0209676_1000339 | Ga0209676_10003395 | 125 |
| 883 | 3300025292 | Ga0209676_1000352 | Ga0209676_100035266 | 125 |
| 884 | 3300025294 | Ga0209025_1000002 | Ga0209025_1000002224 | 125 |
| 885 | 3300025295 | Ga0209564_1000106 | Ga0209564_100010694 | 125 |
| 886 | 3300025297 | Ga0209758_1000003 | Ga0209758_1000003231 | 125 |
| 887 | 3300025298 | Ga0209050_1000338 | Ga0209050_100033867 | 125 |
| 888 | 3300025298 | Ga0209050_1000436 | Ga0209050_100043653 | 125 |
| 889 | 3300025298 | Ga0209050_1053133 | Ga0209050_10531331 | 125 |
| 890 | 3300025298 | Ga0209050_1075148 | Ga0209050_10751482 | 125 |
| 891 | 3300025298 | Ga0209050_1101613 | Ga0209050_11016131 | 125 |
| 892 | 3300025299 | Ga0209256_1001379 | Ga0209256_100137918 | 125 |
| 893 | 3300025299 | Ga0209256_1011347 | Ga0209256_10113472 | 125 |
| 894 | 3300025303 | Ga0209051_1001864 | Ga0209051_100186410 | 125 |
| 895 | 3300025304 | Ga0209257_1000062 | Ga0209257_1000062222 | 125 |
| 896 | 3300025304 | Ga0209257_1000145 | Ga0209257_100014519 | 125 |
| 897 | 3300025304 | Ga0209257_1000241 | Ga0209257_100024195 | 125 |
| 898 | 3300025304 | Ga0209257_1000251 | Ga0209257_100025180 | 125 |
| 899 | 3300025304 | Ga0209257_1005006 | Ga0209257_10050064 | 125 |
| 900 | 3300025304 | Ga0209257_1005750 | Ga0209257_10057506 | 125 |
| 901 | 3300025735 | Ga0207713_1000840 | Ga0207713_100084017 | 125 |
| 902 | 3300025735 | Ga0207713_1004179 | Ga0207713_10041797 | 125 |
| 903 | 3300025925 | Ga0207650_10005802 | Ga0207650_100058026 | 125 |
| 904 | 3300025929 | Ga0207664_10728816 | Ga0207664_107288161 | 125 |
| 905 | 3300025935 | Ga0207709_10001996 | Ga0207709_100019967 | 125 |
| 906 | 3300027312 | Ga0209371_1000044 | Ga0209371_1000044120 | 125 |
| 907 | 3300028379 | Ga0268266_10154547 | Ga0268266_101545472 | 125 |
| 908 | 3300028379 | Ga0268266_10407169 | Ga0268266_104071692 | 125 |
| 909 | 3300028379 | Ga0268266_10427490 | Ga0268266_104274902 | 125 |
| 910 | 3300030500 | Ga0268256_1000046 | Ga0268256_1000046120 | 125 |
| 911 | 3300030731 | Ga0316177_1197228 | Ga0316177_11972282 | 125 |
| 912 | 3300030732 | Ga0316176_1101966 | Ga0316176_11019665 | 125 |
| 913 | 3300030732 | Ga0316176_1153863 | Ga0316176_11538632 | 125 |
| 914 | 3300030733 | Ga0314311_1141252 | Ga0314311_11412522 | 125 |
| 915 | 3300030742 | Ga0316183_1000987 | Ga0316183_10009872 | 125 |
| 916 | 3300030744 | Ga0316181_1027782 | Ga0316181_10277822 | 125 |
| 917 | 3300031456 | Ga0307513_10044300 | Ga0307513_100443004 | 125 |
| 918 | 3300031456 | Ga0307513_10880804 | Ga0307513_108808041 | 125 |
| 919 | 3300031731 | Ga0307405_10540365 | Ga0307405_105403652 | 125 |
| 920 | 3300031824 | Ga0307413_10053952 | Ga0307413_100539523 | 125 |
| 921 | 3300031852 | Ga0307410_10595266 | Ga0307410_105952662 | 125 |
| 922 | 3300031911 | Ga0307412_10121196 | Ga0307412_101211962 | 125 |
| 923 | 3300032004 | Ga0307414_10003039 | Ga0307414_100030391 | 125 |
| 924 | 3300032004 | Ga0307414_10018468 | Ga0307414_100184684 | 125 |
| 925 | 3300032004 | Ga0307414_10019251 | Ga0307414_100192514 | 125 |
| 926 | 3300032004 | Ga0307414_10027020 | Ga0307414_100270205 | 125 |
| 927 | 3300032004 | Ga0307414_10043783 | Ga0307414_100437835 | 125 |
| 928 | 3300032004 | Ga0307414_10388113 | Ga0307414_103881132 | 125 |
| 929 | 3300032004 | Ga0307414_10823797 | Ga0307414_108237972 | 125 |
| 930 | 3300032004 | Ga0307414_11975364 | Ga0307414_119753642 | 125 |
| 931 | 3300032005 | Ga0307411_10260497 | Ga0307411_102604972 | 125 |
| 932 | 3300038705 | Ga0237819_00020 | Ga0237819_00020_9958_10344 | 125 |
| 933 | 3300039145 | Ga0237816_00850 | Ga0237816_00850_1905_2297 | 125 |
| 934 | 3300041410 | Ga0439461_0007523 | Ga0439461_0007523_1444_1836 | 125 |
| 935 | 3300041413 | Ga0439465_0313078 | Ga0439465_0313078_128_511 | 125 |
| 936 | 3300041443 | Ga0451789_0131347 | Ga0451789_0131347_72_455 | 125 |
| 937 | 3300041451 | Ga0451791_0561885 | Ga0451791_0561885_602_994 | 125 |
| 938 | 3300041451 | Ga0451791_1462544 | Ga0451791_1462544_163_555 | 125 |
| 939 | 3300041451 | Ga0451791_1793509 | Ga0451791_1793509_109_501 | 125 |
| 940 | 3300041452 | Ga0451793_0336199 | Ga0451793_0336199_40_432 | 125 |
| 941 | 3300041452 | Ga0451793_1063530 | Ga0451793_1063530_145_537 | 125 |
| 942 | 3300041453 | Ga0451797_0428518 | Ga0451797_0428518_502_894 | 125 |
| 943 | 3300041458 | Ga0451798_0188667 | Ga0451798_0188667_250_642 | 125 |
| 944 | 3300041458 | Ga0451798_0789294 | Ga0451798_0789294_127_510 | 125 |
| 945 | 3300041459 | Ga0451800_0006649 | Ga0451800_0006649_2897_3280 | 125 |
| 946 | 3300041459 | Ga0451800_1174804 | Ga0451800_1174804_257_649 | 125 |
| 947 | 3300041460 | Ga0451802_0967991 | Ga0451802_0967991_643_1035 | 125 |
| 948 | 3300041462 | Ga0451806_463085 | Ga0451806_463085_719_1102 | 125 |
| 949 | 3300041463 | Ga0451804_0888890 | Ga0451804_0888890_708_1091 | 125 |
| 950 | 3300041486 | Ga0451807_0135036 | Ga0451807_0135036_3363_3746 | 125 |
| 951 | 3300041486 | Ga0451807_0579398 | Ga0451807_0579398_36_419 | 125 |
| 952 | 3300041494 | Ga0451837_0413310 | Ga0451837_0413310_196_627 | 125 |
| 953 | 3300041494 | Ga0451837_0517197 | Ga0451837_0517197_865_1263 | 125 |
| 954 | 3300041494 | Ga0451837_0542531 | Ga0451837_0542531_106_498 | 125 |
| 955 | 3300041494 | Ga0451837_1508750 | Ga0451837_1508750_250_642 | 125 |
| 956 | 3300041509 | Ga0451843_0822388 | Ga0451843_0822388_526_918 | 125 |
| 957 | 3300041509 | Ga0451843_0831223 | Ga0451843_0831223_340_732 | 125 |
| 958 | 3300041512 | Ga0451853_3186346 | Ga0451853_3186346_52_444 | 125 |
| 959 | 3300041997 | Ga0439431_0035675 | Ga0439431_0035675_78_470 | 125 |
| 960 | 3300041999 | Ga0439433_0062718 | Ga0439433_0062718_263_655 | 125 |
| 961 | 3300041999 | Ga0439433_0157645 | Ga0439433_0157645_116_499 | 125 |
| 962 | 3300042004 | Ga0439445_0000440 | Ga0439445_0000440_780_1172 | 125 |
| 963 | 3300042004 | Ga0439445_0214150 | Ga0439445_0214150_71_454 | 125 |
| 964 | 3300042006 | Ga0439432_019085 | Ga0439432_019085_1477_1860 | 125 |
| 965 | 3300042006 | Ga0439432_037299 | Ga0439432_037299_728_1132 | 125 |
| 966 | 3300042006 | Ga0439432_112573 | Ga0439432_112573_60_443 | 125 |
| 967 | 3300042007 | Ga0439449_0000015 | Ga0439449_0000015_36774_37166 | 125 |
| 968 | 3300042007 | Ga0439449_0003761 | Ga0439449_0003761_4490_4873 | 125 |
| 969 | 3300042007 | Ga0439449_0004752 | Ga0439449_0004752_720_1112 | 125 |
| 970 | 3300042014 | Ga0439457_096599 | Ga0439457_096599_10_402 | 125 |
| 971 | 3300042015 | Ga0439462_0066093 | Ga0439462_0066093_453_845 | 125 |
| 972 | 3300042145 | Ga0450906_074826 | Ga0450906_074826_187_570 | 125 |
| 973 | 3300042532 | Ga0450893_0146196 | Ga0450893_0146196_109_492 | 125 |
| 974 | 3300044683 | Ga0466965_0112697 | Ga0466965_0112697_389_775 | 125 |
| 975 | 3300046453 | Ga0495627_035709 | Ga0495627_035709_386_769 | 125 |
| 976 | 3300046460 | Ga0495638_0008515 | Ga0495638_0008515_4187_4570 | 125 |
| 977 | 3300046460 | Ga0495638_0091956 | Ga0495638_0091956_545_928 | 125 |
| 978 | 3300046460 | Ga0495638_0269837 | Ga0495638_0269837_361_747 | 125 |
| 979 | 3300046471 | Ga0495650_0228411 | Ga0495650_0228411_36_425 | 125 |
| 980 | 3300046507 | Ga0495606_0022384 | Ga0495606_0022384_3943_4332 | 125 |
| 981 | 3300046512 | Ga0495610_0003267 | Ga0495610_0003267_1849_2244 | 125 |
| 982 | 3300046513 | Ga0495616_0050442 | Ga0495616_0050442_962_1345 | 125 |
| 983 | 3300046518 | Ga0495631_0004302 | Ga0495631_0004302_3318_3713 | 125 |
| 984 | 3300046522 | Ga0495643_0001578 | Ga0495643_0001578_16332_16715 | 125 |
| 985 | 3300046525 | Ga0495663_0000179 | Ga0495663_0000179_2807_3199 | 125 |
| 986 | 3300046525 | Ga0495663_0003376 | Ga0495663_0003376_2674_3057 | 125 |
| 987 | 3300046525 | Ga0495663_0031559 | Ga0495663_0031559_1158_1541 | 125 |
| 988 | 3300046558 | Ga0495633_0096258 | Ga0495633_0096258_921_1310 | 125 |
| 989 | 3300046558 | Ga0495633_0104000 | Ga0495633_0104000_216_665 | 125 |
| 990 | 3300046558 | Ga0495633_0116656 | Ga0495633_0116656_770_1153 | 125 |
| 991 | 3300046660 | Ga0495625_0084624 | Ga0495625_0084624_291_674 | 125 |
| 992 | 3300046660 | Ga0495625_0248420 | Ga0495625_0248420_291_674 | 125 |
| 993 | 3300046674 | Ga0495588_0385419 | Ga0495588_0385419_253_651 | 125 |
| 994 | 3300046692 | Ga0495671_0019079 | Ga0495671_0019079_2969_3361 | 125 |
| 995 | 3300046810 | Ga0495660_0375344 | Ga0495660_0375344_179_568 | 125 |
| 996 | 3300047320 | Ga0495672_0000267 | Ga0495672_0000267_68194_68577 | 125 |
| 997 | 3300047320 | Ga0495672_0070144 | Ga0495672_0070144_1463_1858 | 125 |
| 998 | 3300047470 | Ga0495681_0069534 | Ga0495681_0069534_949_1338 | 125 |
| 999 | 3300047472 | Ga0495686_0004264 | Ga0495686_0004264_1516_1899 | 125 |
| 1000 | 3300048908 | Ga0496105_0105422 | Ga0496105_0105422_1743_2126 | 125 |
| 1001 | 3300048917 | Ga0496114_0004470 | Ga0496114_0004470_2314_2706 | 125 |
| 1002 | 3300048919 | Ga0496116_0049307 | Ga0496116_0049307_188_571 | 125 |
| 1003 | 3300048919 | Ga0496116_0176568 | Ga0496116_0176568_153_536 | 125 |
| 1004 | 3300048920 | Ga0496117_0000843 | Ga0496117_0000843_4007_4390 | 125 |
| 1005 | 3300048920 | Ga0496117_0002530 | Ga0496117_0002530_18145_18522 | 125 |
| 1006 | 3300048920 | Ga0496117_0002737 | Ga0496117_0002737_17006_17389 | 125 |
| 1007 | 3300048920 | Ga0496117_0009093 | Ga0496117_0009093_7660_8088 | 125 |
| 1008 | 3300048920 | Ga0496117_0067868 | Ga0496117_0067868_1324_1707 | 125 |
| 1009 | 3300048920 | Ga0496117_0103529 | Ga0496117_0103529_366_749 | 125 |
| 1010 | 3300048921 | Ga0496118_0000639 | Ga0496118_0000639_53012_53395 | 125 |
| 1011 | 3300048921 | Ga0496118_0002681 | Ga0496118_0002681_18866_19249 | 125 |
| 1012 | 3300048921 | Ga0496118_0006054 | Ga0496118_0006054_3561_3944 | 125 |
| 1013 | 3300048921 | Ga0496118_0012171 | Ga0496118_0012171_6238_6666 | 125 |
| 1014 | 3300048921 | Ga0496118_0298486 | Ga0496118_0298486_47_430 | 125 |
| 1015 | 3300048922 | Ga0496119_0001070 | Ga0496119_0001070_25868_26251 | 125 |
| 1016 | 3300048922 | Ga0496119_0001410 | Ga0496119_0001410_4090_4467 | 125 |
| 1017 | 3300048923 | Ga0496120_0000716 | Ga0496120_0000716_44169_44552 | 125 |
| 1018 | 3300048923 | Ga0496120_0001897 | Ga0496120_0001897_18480_18857 | 125 |
| 1019 | 3300048924 | Ga0496121_0007707 | Ga0496121_0007707_4093_4476 | 125 |
| 1020 | 3300048924 | Ga0496121_0019793 | Ga0496121_0019793_827_1210 | 125 |
| 1021 | 3300048925 | Ga0496122_0001201 | Ga0496122_0001201_39486_39863 | 125 |
| 1022 | 3300048925 | Ga0496122_0001926 | Ga0496122_0001926_12698_13081 | 125 |
| 1023 | 3300048925 | Ga0496122_0003158 | Ga0496122_0003158_2580_2969 | 125 |
| 1024 | 3300048925 | Ga0496122_0021341 | Ga0496122_0021341_3097_3480 | 125 |
| 1025 | 3300048925 | Ga0496122_0023882 | Ga0496122_0023882_2714_3106 | 125 |
| 1026 | 3300048925 | Ga0496122_0024055 | Ga0496122_0024055_3689_4072 | 125 |
| 1027 | 3300048925 | Ga0496122_0050997 | Ga0496122_0050997_1271_1654 | 125 |
| 1028 | 3300048925 | Ga0496122_0140980 | Ga0496122_0140980_404_787 | 125 |
| 1029 | 3300048926 | Ga0496123_0000973 | Ga0496123_0000973_4325_4702 | 125 |
| 1030 | 3300048926 | Ga0496123_0001882 | Ga0496123_0001882_18253_18636 | 125 |
| 1031 | 3300048926 | Ga0496123_0010900 | Ga0496123_0010900_4512_4901 | 125 |
| 1032 | 3300048926 | Ga0496123_0027309 | Ga0496123_0027309_1751_2134 | 125 |
| 1033 | 3300048927 | Ga0496124_0000476 | Ga0496124_0000476_3551_3934 | 125 |
| 1034 | 3300048927 | Ga0496124_0000880 | Ga0496124_0000880_45257_45646 | 125 |
| 1035 | 3300048927 | Ga0496124_0001833 | Ga0496124_0001833_24757_25134 | 125 |
| 1036 | 3300048927 | Ga0496124_0004121 | Ga0496124_0004121_551_934 | 125 |
| 1037 | 3300048927 | Ga0496124_0011269 | Ga0496124_0011269_4825_5208 | 125 |
| 1038 | 3300048927 | Ga0496124_0018455 | Ga0496124_0018455_5092_5475 | 125 |
| 1039 | 3300048927 | Ga0496124_0297907 | Ga0496124_0297907_245_628 | 125 |
| 1040 | 3300048927 | Ga0496124_0325026 | Ga0496124_0325026_255_683 | 125 |
| 1041 | 3300048928 | Ga0496125_0003520 | Ga0496125_0003520_14489_14872 | 125 |
| 1042 | 3300048928 | Ga0496125_0019301 | Ga0496125_0019301_896_1279 | 125 |
| 1043 | 3300048928 | Ga0496125_0043107 | Ga0496125_0043107_3267_3650 | 125 |
| 1044 | 3300048928 | Ga0496125_0053240 | Ga0496125_0053240_1030_1413 | 125 |
| 1045 | 3300048928 | Ga0496125_0057730 | Ga0496125_0057730_895_1278 | 125 |
| 1046 | 3300048928 | Ga0496125_0103942 | Ga0496125_0103942_1647_2030 | 125 |
| 1047 | 3300048928 | Ga0496125_0255817 | Ga0496125_0255817_515_910 | 125 |
| 1048 | 3300048929 | Ga0496126_0026529 | Ga0496126_0026529_4038_4421 | 125 |
| 1049 | 3300048929 | Ga0496126_0033945 | Ga0496126_0033945_1173_1562 | 125 |
| 1050 | 3300048929 | Ga0496126_0055627 | Ga0496126_0055627_2227_2619 | 125 |
| 1051 | 3300048929 | Ga0496126_0430402 | Ga0496126_0430402_157_540 | 125 |
| 1052 | 3300049571 | Ga0501034_0000083 | Ga0501034_0000083_137437_137829 | 125 |
| 1053 | 3300049705 | Ga0501225_0001888 | Ga0501225_0001888_2033_2425 | 125 |
| 1054 | 3300050491 | nmdc:mga00v17_474586_c1 | nmdc:mga00v17_474586_c1_199_582 | 125 |
| 1055 | 3300050492 | nmdc:mga0yw44_553445_c1 | nmdc:mga0yw44_553445_c1_76_459 | 125 |
| 1056 | 3300053090 | Ga0500646_0051421 | Ga0500646_0051421_87_479 | 125 |
| 1057 | 3300053134 | Ga0500658_0107423 | Ga0500658_0107423_159_551 | 125 |
| 1058 | 3300053142 | Ga0500577_0423918 | Ga0500577_0423918_50_442 | 125 |
| 1059 | 3300053156 | Ga0500622_0379294 | Ga0500622_0379294_150_539 | 125 |
| 1060 | 3300053161 | Ga0500634_0000345 | Ga0500634_0000345_11837_12220 | 125 |
| 1061 | 3300053734 | Ga0500565_004105 | Ga0500565_004105_653_1036 | 125 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3to5-assembly1.cif.gz_A | high resolution structure of chey3 from vibrio cholerae | 0.9741 | 2 | 119 |
| 4lx8-assembly1.cif.gz_A | crystal structure (2.2a) of mg2+ bound chey3 of vibrio cholerae | 0.9732 | 2 | 119 |
| 2b1j-assembly1.cif.gz_A | crystal structure of unphosphorylated chey bound to the n-terminus of flim | 0.972 | 3 | 121 |
| 4hnq-assembly1.cif.gz_A | crystal structure of the mutant q97a of vibrio cholerae chey3 | 0.9717 | 2 | 119 |
| 1udr-assembly1.cif.gz_C | chey mutant with lys 91 replaced by asp, lys 92 replaced by ala, ile 96 replaced by lys and ala 98 replaced by leu (stabilizing mutations in helix 4) | 0.961 | 1 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4jp1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9683 | 1 | 119 | 3.40.50.2300 |
| af_I1NCE1_621_722_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.966 | 3 | 69 | 3.40.50.2300 |
| af_P30855_946_1081_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9619 | 2 | 118 | 3.40.50.2300 |
| af_O14283_368_529_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9556 | 3 | 121 | 3.40.50.2300 |
| 4ja2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9537 | 1 | 120 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-M5CQ13-F1-model_v4 | deleted | 1.003 | 1 | 122 |
|
| AF-A0A1A6XS30-F1-model_v4 | Two-component system response regulator | 1.001 | 1 | 121 |
GO:0000160
|
| AF-A0A847FVA7-F1-model_v4 | Response regulator transcription factor | 0.9963 | 1 | 111 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7W3V166-F1-model_v4 | merged | 0.9957 | 1 | 120 |
|
| AF-A0A831RKW3-F1-model_v4 | Response regulator | 0.9948 | 2 | 120 |
GO:0000160
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar