F489252
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1059 | 432 | 987 | 348 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0000033|Ga0395899_0000033_33867_35015 |
| Length | 382 |
| Sequence | MSLRGGTTKQPHRVQYQSDEIATLSLEMTQSTNETMFSINNIIRKNIANLTPYSSARDEFQGEASVYLDANENAFGSPLEQQYNRYPDPLQYKVKKRLSEIKGVPPRNIFLGNGSDEAIDILFRSFCNPGVDNVILVPPTYGMYEVSANINDIQIKKVKLTEEYQLNLEGIAEAIDEHTKMIFVCSPNNPTGNSINRDDIETLLANFNGLIVIDEAYINFSRQKSFIQELTEYANLVVLQTLSKAWGLAGLRVGMAFASEEIIEVMNKVKPPYNINEASQDLALKALENVDQVNQWIREILNQRDRLVLTLKNFDFVQDIYPSDANFILVKTTAPKDIYNFLVDKGIIVRDRSKVDLCEGCLRITVGTPAENDVLLEALGKF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 3 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 4 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 5 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 6 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 7 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 8 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 9 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 10 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 11 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 12 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 13 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 14 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 15 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 16 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 17 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 18 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 19 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 20 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 21 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 22 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 23 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 24 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 25 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 26 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 27 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 28 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 29 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 30 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 31 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 32 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 33 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 34 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 35 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 36 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 37 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 38 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 39 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 40 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 41 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 42 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 43 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 44 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 45 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 46 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 47 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 48 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 49 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 50 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 51 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 52 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 53 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 54 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 55 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 56 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 57 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 58 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 59 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 60 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 61 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 62 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 63 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 64 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 65 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 66 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 67 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 68 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 69 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 70 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 71 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 72 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 73 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 74 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 75 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 76 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 77 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 78 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 79 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 80 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 81 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 82 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 83 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 84 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 85 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 86 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 87 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 88 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 89 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 90 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 91 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 92 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 93 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 94 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 95 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 96 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 100 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 103 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 105 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 106 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 107 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 116 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 122 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 123 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 124 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 125 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 126 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 127 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 129 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 132 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 134 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 135 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 136 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 137 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 138 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 139 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 140 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 141 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 142 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 143 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 144 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 145 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 146 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 147 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 148 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 149 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 151 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 152 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 153 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 154 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 155 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 156 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 158 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 159 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 186 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 189 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 190 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 191 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 193 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 198 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 199 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 203 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 261 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 265 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 270 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 271 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 272 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 273 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 274 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 275 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 276 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 277 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 278 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 279 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 280 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 281 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 282 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 283 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 284 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 285 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 286 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 287 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 288 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 289 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 290 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 291 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 292 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 293 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 294 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 295 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 296 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 297 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 298 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 299 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 300 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 301 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 302 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 303 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 304 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 305 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 306 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 307 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 308 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 309 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 310 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 311 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 312 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 313 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 314 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 315 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 316 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 317 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 318 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 319 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 320 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 321 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 322 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 323 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 360 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 361 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 362 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 363 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 364 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 365 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 366 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 367 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 368 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 387 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 388 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 389 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 390 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 391 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 392 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 393 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 394 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 395 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 396 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 397 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 399 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 400 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 403 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 404 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 408 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 410 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 411 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 412 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 413 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 414 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 415 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 416 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 417 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 418 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 419 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 420 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 421 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 422 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 423 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 425 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 426 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 427 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 428 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 429 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 430 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
| 431 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 432 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.01 |
| Metatranscriptomes | 0.09 |
| Isolates | 6.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.04 |
| Nodule | 0.38 |
| Rhizoplane | 0.57 |
| Rhizosphere | 84.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_787417 | 2162886007 | Bacteria | 8367 |
| 2 | JGI24736J21556_1003139 | 3300001904 | Bacteria | 2878 |
| 3 | JGI24740J21852_10020774 | 3300001979 | Bacteria | 2284 |
| 4 | JGI24737J22298_10007120 | 3300001990 | Bacteria | 3790 |
| 5 | JGI24735J21928_10000004 | 3300002067 | Bacteria | 381713 |
| 6 | JGI25162J39368_1000011 | 3300002737 | Bacteria | 379156 |
| 7 | JGI25162J39368_1000614 | 3300002737 | Bacteria | 25616 |
| 8 | JGI25154J39366_1000040 | 3300002738 | Bacteria | 147410 |
| 9 | JGI25157J39369_1003731 | 3300002741 | Bacteria | 3001 |
| 10 | JGI25157J39369_1004254 | 3300002741 | Bacteria | 2655 |
| 11 | JGI25164J39214_1003371 | 3300002772 | Bacteria | 2048 |
| 12 | JGI25152J39213_1000143 | 3300002773 | Bacteria | 48715 |
| 13 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 14 | JGI25151J46595_10000001 | 3300003187 | Bacteria | 887211 |
| 15 | JGI25165J46597_1000985 | 3300003214 | Bacteria | 19074 |
| 16 | JGI25153J46596_10000001 | 3300003215 | Bacteria | 748985 |
| 17 | JGI25153J46596_10003346 | 3300003215 | Bacteria | 9003 |
| 18 | rootH1_10024829 | 3300003316 | Bacteria | 25564 |
| 19 | rootH1_10063239 | 3300003316 | Bacteria | 6361 |
| 20 | rootH1_10140822 | 3300003316 | Bacteria | 2510 |
| 21 | rootH2_10001891 | 3300003320 | Bacteria | 464318 |
| 22 | rootH2_10003679 | 3300003320 | Bacteria | 27278 |
| 23 | rootH2_10013742 | 3300003320 | Bacteria | 11980 |
| 24 | rootH2_10053227 | 3300003320 | Bacteria | 9083 |
| 25 | rootH2_10090920 | 3300003320 | Bacteria | 6366 |
| 26 | rootH2_10184838 | 3300003320 | Bacteria | 1249 |
| 27 | rootL2_10017790 | 3300003322 | Bacteria | 3190 |
| 28 | rootL2_10028141 | 3300003322 | Bacteria | 3723 |
| 29 | rootL2_10030620 | 3300003322 | Bacteria | 1870 |
| 30 | rootL2_10058669 | 3300003322 | Bacteria | 5201 |
| 31 | rootL2_10107720 | 3300003322 | Bacteria | 5516 |
| 32 | rootL2_10223865 | 3300003322 | Bacteria | 3144 |
| 33 | rootL2_10315621 | 3300003322 | Bacteria | 2427 |
| 34 | rootH1_10000019 | 3300003316 | Bacteria | 18606 |
| 35 | rootH1_10000019 | 3300003323 | Bacteria | 34919 |
| 36 | rootH1_10008801 | 3300003323 | Bacteria | 13652 |
| 37 | rootH1_10035284 | 3300003323 | Bacteria | 47456 |
| 38 | rootH1_10054491 | 3300003323 | Bacteria | 2542 |
| 39 | rootH1_10163486 | 3300003323 | Bacteria | 2011 |
| 40 | rootH1_10178453 | 3300003323 | Bacteria | 2808 |
| 41 | rootH1_10298335 | 3300003323 | Unclassified | 3330 |
| 42 | JGI25160J50197_1006644 | 3300003354 | Bacteria | 4654 |
| 43 | Ga0006562J51391_1016454 | 3300003578 | Bacteria | 2028 |
| 44 | Ga0055536_1000001 | 3300003781 | Bacteria | 630663 |
| 45 | Ga0055530_10004772 | 3300003791 | Bacteria | 6816 |
| 46 | Ga0055531_10000131 | 3300003794 | Bacteria | 85257 |
| 47 | Ga0065165_1000300 | 3300005262 | Bacteria | 83016 |
| 48 | Ga0065714_10003545 | 3300005288 | Bacteria | 7328 |
| 49 | Ga0065714_10004089 | 3300005288 | Bacteria | 9774 |
| 50 | Ga0065714_10010706 | 3300005288 | Bacteria | 2645 |
| 51 | Ga0065714_10064863 | 3300005288 | Bacteria | 16719 |
| 52 | Ga0065714_10067358 | 3300005288 | Bacteria | 5607 |
| 53 | Ga0065714_10099861 | 3300005288 | Bacteria | 1665 |
| 54 | Ga0065714_10107284 | 3300005288 | Bacteria | 1534 |
| 55 | Ga0065714_10109461 | 3300005288 | Bacteria | 1500 |
| 56 | Ga0065704_10000210 | 3300005289 | Bacteria | 93612 |
| 57 | Ga0065704_10083999 | 3300005289 | Bacteria | 3388 |
| 58 | Ga0065712_10008583 | 3300005290 | Bacteria | 3168 |
| 59 | Ga0065712_10124654 | 3300005290 | Bacteria | 1616 |
| 60 | Ga0065715_10004221 | 3300005293 | Bacteria | 4062 |
| 61 | Ga0070658_10000049 | 3300005327 | Bacteria | 119985 |
| 62 | Ga0070658_10031135 | 3300005327 | Bacteria | 4284 |
| 63 | Ga0070658_10101229 | 3300005327 | Bacteria | 2382 |
| 64 | Ga0070676_10000336 | 3300005328 | Bacteria | 21357 |
| 65 | Ga0070676_10026339 | 3300005328 | Bacteria | 3292 |
| 66 | Ga0070683_100030965 | 3300005329 | Bacteria | 4862 |
| 67 | Ga0070683_100032467 | 3300005329 | Bacteria | 4755 |
| 68 | Ga0070683_100067205 | 3300005329 | Bacteria | 3339 |
| 69 | Ga0070690_100012862 | 3300005330 | Bacteria | 4931 |
| 70 | Ga0070670_100033933 | 3300005331 | Bacteria | 4393 |
| 71 | Ga0070670_100034230 | 3300005331 | Bacteria | 4372 |
| 72 | Ga0070670_100086541 | 3300005331 | Bacteria | 2693 |
| 73 | Ga0070670_100181544 | 3300005331 | Bacteria | 1827 |
| 74 | Ga0070670_100435816 | 3300005331 | Unclassified | 1160 |
| 75 | Ga0070677_10014143 | 3300005333 | Bacteria | 2803 |
| 76 | Ga0068869_100039400 | 3300005334 | Bacteria | 3373 |
| 77 | Ga0070666_10002847 | 3300005335 | Bacteria | 10454 |
| 78 | Ga0070666_10056865 | 3300005335 | Unclassified | 2643 |
| 79 | Ga0070680_100015517 | 3300005336 | Bacteria | 5975 |
| 80 | Ga0070680_100171020 | 3300005336 | Unclassified | 1828 |
| 81 | Ga0070682_100001275 | 3300005337 | Bacteria | 14290 |
| 82 | Ga0070682_100119478 | 3300005337 | Unclassified | 1767 |
| 83 | Ga0070682_100241275 | 3300005337 | Bacteria | 1297 |
| 84 | Ga0068868_100004138 | 3300005338 | Bacteria | 10140 |
| 85 | Ga0068868_100008530 | 3300005338 | Bacteria | 7338 |
| 86 | Ga0068868_100011418 | 3300005338 | Bacteria | 6469 |
| 87 | Ga0068868_100015143 | 3300005338 | Bacteria | 5698 |
| 88 | Ga0068868_100020344 | 3300005338 | Bacteria | 4985 |
| 89 | Ga0070660_100027944 | 3300005339 | Bacteria | 4216 |
| 90 | Ga0070660_100043577 | 3300005339 | Bacteria | 3430 |
| 91 | Ga0070660_100171259 | 3300005339 | Bacteria | 1754 |
| 92 | Ga0070691_10004326 | 3300005341 | Bacteria | 6456 |
| 93 | Ga0070661_100023944 | 3300005344 | Bacteria | 4380 |
| 94 | Ga0070661_100043909 | 3300005344 | Unclassified | 3265 |
| 95 | Ga0070668_100004446 | 3300005347 | Bacteria | 10401 |
| 96 | Ga0070669_100018155 | 3300005353 | Bacteria | 5025 |
| 97 | Ga0070675_100015326 | 3300005354 | Bacteria | 6059 |
| 98 | Ga0070675_100016332 | 3300005354 | Bacteria | 5890 |
| 99 | Ga0070675_100027340 | 3300005354 | Bacteria | 4582 |
| 100 | Ga0070675_100044109 | 3300005354 | Bacteria | 3647 |
| 101 | Ga0070675_100268887 | 3300005354 | Bacteria | 1495 |
| 102 | Ga0070671_100046891 | 3300005355 | Bacteria | 3594 |
| 103 | Ga0070671_100159729 | 3300005355 | Unclassified | 1905 |
| 104 | Ga0070673_100004993 | 3300005364 | Bacteria | 8460 |
| 105 | Ga0070673_100016856 | 3300005364 | Bacteria | 5179 |
| 106 | Ga0070673_100026479 | 3300005364 | Bacteria | 4283 |
| 107 | Ga0070673_100035251 | 3300005364 | Bacteria | 3793 |
| 108 | Ga0070688_100001700 | 3300005365 | Bacteria | 10987 |
| 109 | Ga0070659_100006699 | 3300005366 | Bacteria | 8329 |
| 110 | Ga0070659_100047474 | 3300005366 | Bacteria | 3368 |
| 111 | Ga0070659_100069713 | 3300005366 | Bacteria | 2791 |
| 112 | Ga0070659_100244848 | 3300005366 | Unclassified | 1485 |
| 113 | Ga0070667_100000492 | 3300005367 | Bacteria | 40164 |
| 114 | Ga0070667_100001349 | 3300005367 | Bacteria | 22023 |
| 115 | Ga0070667_100048526 | 3300005367 | Bacteria | 3574 |
| 116 | Ga0070663_100001195 | 3300005455 | Bacteria | 14271 |
| 117 | Ga0070663_100081084 | 3300005455 | Unclassified | 2384 |
| 118 | Ga0070663_100271155 | 3300005455 | Bacteria | 1349 |
| 119 | Ga0070678_100001813 | 3300005456 | Bacteria | 11512 |
| 120 | Ga0070678_100107493 | 3300005456 | Unclassified | 2176 |
| 121 | Ga0070662_100000045 | 3300005457 | Bacteria | 67900 |
| 122 | Ga0070662_100025109 | 3300005457 | Bacteria | 4112 |
| 123 | Ga0070662_100096983 | 3300005457 | Bacteria | 2225 |
| 124 | Ga0070681_10018316 | 3300005458 | Bacteria | 6999 |
| 125 | Ga0070681_10029313 | 3300005458 | Bacteria | 5526 |
| 126 | Ga0070681_10040763 | 3300005458 | Bacteria | 4652 |
| 127 | Ga0068867_100004573 | 3300005459 | Bacteria | 9730 |
| 128 | Ga0068867_100036004 | 3300005459 | Bacteria | 3591 |
| 129 | Ga0068867_100060265 | 3300005459 | Unclassified | 2815 |
| 130 | Ga0068867_100333504 | 3300005459 | Unclassified | 1260 |
| 131 | Ga0070685_10002206 | 3300005466 | Bacteria | 10050 |
| 132 | Ga0070685_10005910 | 3300005466 | Bacteria | 6227 |
| 133 | Ga0070685_10027809 | 3300005466 | Bacteria | 3129 |
| 134 | Ga0070685_10077516 | 3300005466 | Bacteria | 1984 |
| 135 | Ga0070679_100004536 | 3300005530 | Bacteria | 12825 |
| 136 | Ga0070679_100006277 | 3300005530 | Bacteria | 11066 |
| 137 | Ga0070679_100008873 | 3300005530 | Bacteria | 9490 |
| 138 | Ga0070679_100127028 | 3300005530 | Bacteria | 2532 |
| 139 | Ga0070684_100035368 | 3300005535 | Bacteria | 4275 |
| 140 | Ga0070684_100042359 | 3300005535 | Bacteria | 3930 |
| 141 | Ga0070684_100127303 | 3300005535 | Bacteria | 2295 |
| 142 | Ga0070684_100132672 | 3300005535 | Unclassified | 2247 |
| 143 | Ga0068853_100003018 | 3300005539 | Bacteria | 12852 |
| 144 | Ga0068853_100008065 | 3300005539 | Bacteria | 8446 |
| 145 | Ga0068853_100008667 | 3300005539 | Bacteria | 8178 |
| 146 | Ga0068853_100013120 | 3300005539 | Bacteria | 6761 |
| 147 | Ga0068853_100022472 | 3300005539 | Bacteria | 5268 |
| 148 | Ga0068853_100057348 | 3300005539 | Bacteria | 3361 |
| 149 | Ga0068853_100139186 | 3300005539 | Bacteria | 2178 |
| 150 | Ga0068853_100301937 | 3300005539 | Bacteria | 1480 |
| 151 | Ga0070672_100001489 | 3300005543 | Bacteria | 14544 |
| 152 | Ga0070672_100055232 | 3300005543 | Bacteria | 3111 |
| 153 | Ga0070672_100083317 | 3300005543 | Bacteria | 2566 |
| 154 | Ga0070672_100090358 | 3300005543 | Unclassified | 2469 |
| 155 | Ga0070672_100156349 | 3300005543 | Bacteria | 1889 |
| 156 | Ga0070686_100032891 | 3300005544 | Bacteria | 3183 |
| 157 | Ga0070686_100073191 | 3300005544 | Unclassified | 2249 |
| 158 | Ga0070686_100280374 | 3300005544 | Bacteria | 1229 |
| 159 | Ga0070693_100003483 | 3300005547 | Bacteria | 7347 |
| 160 | Ga0070693_100179055 | 3300005547 | Bacteria | 1364 |
| 161 | Ga0070665_100000020 | 3300005548 | Bacteria | 389687 |
| 162 | Ga0070665_100016967 | 3300005548 | Bacteria | 7300 |
| 163 | Ga0070665_100043231 | 3300005548 | Bacteria | 4528 |
| 164 | Ga0068855_100000240 | 3300005563 | Bacteria | 69408 |
| 165 | Ga0068855_100000346 | 3300005563 | Bacteria | 57719 |
| 166 | Ga0068855_100005837 | 3300005563 | Bacteria | 15028 |
| 167 | Ga0068855_100008169 | 3300005563 | Bacteria | 12653 |
| 168 | Ga0068855_100022866 | 3300005563 | Bacteria | 7493 |
| 169 | Ga0068855_100024060 | 3300005563 | Bacteria | 7292 |
| 170 | Ga0068855_100026080 | 3300005563 | Bacteria | 6991 |
| 171 | Ga0068855_100032308 | 3300005563 | Bacteria | 6251 |
| 172 | Ga0068855_100035811 | 3300005563 | Bacteria | 5911 |
| 173 | Ga0068855_100047040 | 3300005563 | Bacteria | 5098 |
| 174 | Ga0068855_100062842 | 3300005563 | Bacteria | 4334 |
| 175 | Ga0068855_100070659 | 3300005563 | Bacteria | 4061 |
| 176 | Ga0068855_100071810 | 3300005563 | Bacteria | 4024 |
| 177 | Ga0070664_100192898 | 3300005564 | Unclassified | 1815 |
| 178 | Ga0070664_100244621 | 3300005564 | Unclassified | 1611 |
| 179 | Ga0068857_100007822 | 3300005577 | Bacteria | 9217 |
| 180 | Ga0068857_100008143 | 3300005577 | Bacteria | 9051 |
| 181 | Ga0068857_100019055 | 3300005577 | Bacteria | 6022 |
| 182 | Ga0068857_100037750 | 3300005577 | Bacteria | 4280 |
| 183 | Ga0068857_100209964 | 3300005577 | Bacteria | 1776 |
| 184 | Ga0068854_100036735 | 3300005578 | Bacteria | 3436 |
| 185 | Ga0068854_100051761 | 3300005578 | Bacteria | 2943 |
| 186 | Ga0068854_100184752 | 3300005578 | Unclassified | 1630 |
| 187 | Ga0068856_100000835 | 3300005614 | Bacteria | 33215 |
| 188 | Ga0068856_100010959 | 3300005614 | Bacteria | 8800 |
| 189 | Ga0068856_100017673 | 3300005614 | Bacteria | 6914 |
| 190 | Ga0068856_100041561 | 3300005614 | Bacteria | 4519 |
| 191 | Ga0068856_100050057 | 3300005614 | Bacteria | 4118 |
| 192 | Ga0068856_100072662 | 3300005614 | Bacteria | 3405 |
| 193 | Ga0068856_100207105 | 3300005614 | Bacteria | 1976 |
| 194 | Ga0068852_100001345 | 3300005616 | Bacteria | 16491 |
| 195 | Ga0068852_100003445 | 3300005616 | Bacteria | 11058 |
| 196 | Ga0068852_100083617 | 3300005616 | Bacteria | 2838 |
| 197 | Ga0068852_100151779 | 3300005616 | Bacteria | 2155 |
| 198 | Ga0068852_100227662 | 3300005616 | Unclassified | 1776 |
| 199 | Ga0068852_100362436 | 3300005616 | Bacteria | 1418 |
| 200 | Ga0068859_100019039 | 3300005617 | Bacteria | 6894 |
| 201 | Ga0068859_100222016 | 3300005617 | Unclassified | 1977 |
| 202 | Ga0068864_100005800 | 3300005618 | Bacteria | 10131 |
| 203 | Ga0068866_10011575 | 3300005718 | Bacteria | 3821 |
| 204 | Ga0068861_100276800 | 3300005719 | Bacteria | 1443 |
| 205 | Ga0068851_10015604 | 3300005834 | Bacteria | 3621 |
| 206 | Ga0068851_10047333 | 3300005834 | Unclassified | 2178 |
| 207 | Ga0068870_10028107 | 3300005840 | Bacteria | 2820 |
| 208 | Ga0068870_10142332 | 3300005840 | Bacteria | 1404 |
| 209 | Ga0068863_100000412 | 3300005841 | Bacteria | 43521 |
| 210 | Ga0068863_100032411 | 3300005841 | Bacteria | 4981 |
| 211 | Ga0068863_100077889 | 3300005841 | Bacteria | 3138 |
| 212 | Ga0068863_100089741 | 3300005841 | Bacteria | 2915 |
| 213 | Ga0068858_100342504 | 3300005842 | Bacteria | 1431 |
| 214 | Ga0068860_100000916 | 3300005843 | Bacteria | 32698 |
| 215 | Ga0068860_100081090 | 3300005843 | Bacteria | 3085 |
| 216 | Ga0068860_100186633 | 3300005843 | Bacteria | 2005 |
| 217 | Ga0068862_100155708 | 3300005844 | Bacteria | 2037 |
| 218 | Ga0068862_100377924 | 3300005844 | Bacteria | 1321 |
| 219 | Ga0081540_1037226 | 3300005983 | Bacteria | 2582 |
| 220 | Ga0075366_10005218 | 3300006195 | Bacteria | 7031 |
| 221 | Ga0075366_10006027 | 3300006195 | Bacteria | 6604 |
| 222 | Ga0075366_10019255 | 3300006195 | Bacteria | 3946 |
| 223 | Ga0075366_10020069 | 3300006195 | Bacteria | 3875 |
| 224 | Ga0075366_10074534 | 3300006195 | Bacteria | 2024 |
| 225 | Ga0097621_100002086 | 3300006237 | Bacteria | 13691 |
| 226 | Ga0097621_100018421 | 3300006237 | Bacteria | 5333 |
| 227 | Ga0097621_100022179 | 3300006237 | Bacteria | 4926 |
| 228 | Ga0097621_100051361 | 3300006237 | Unclassified | 3355 |
| 229 | Ga0097621_100093559 | 3300006237 | Unclassified | 2519 |
| 230 | Ga0097621_100164744 | 3300006237 | Unclassified | 1908 |
| 231 | Ga0068871_100000100 | 3300006358 | Bacteria | 51253 |
| 232 | Ga0068871_100312735 | 3300006358 | Bacteria | 1381 |
| 233 | Ga0075428_100017721 | 3300006844 | Bacteria | 7870 |
| 234 | Ga0075428_100050469 | 3300006844 | Bacteria | 4562 |
| 235 | Ga0075431_100030371 | 3300006847 | Bacteria | 5566 |
| 236 | Ga0075431_100118749 | 3300006847 | Unclassified | 2729 |
| 237 | Ga0075434_100105830 | 3300006871 | Bacteria | 2823 |
| 238 | Ga0075429_100018092 | 3300006880 | Bacteria | 6097 |
| 239 | Ga0068865_100000174 | 3300006881 | Bacteria | 35630 |
| 240 | Ga0068865_100003461 | 3300006881 | Bacteria | 9457 |
| 241 | Ga0068865_100028117 | 3300006881 | Bacteria | 3721 |
| 242 | Ga0068865_100077970 | 3300006881 | Bacteria | 2369 |
| 243 | Ga0068865_100103533 | 3300006881 | Unclassified | 2088 |
| 244 | Ga0097620_100019038 | 3300006931 | Bacteria | 6894 |
| 245 | Ga0097620_100222010 | 3300006931 | Unclassified | 1977 |
| 246 | Ga0079104_1000005 | 3300006946 | Bacteria | 407099 |
| 247 | Ga0099826_10126639 | 3300006948 | Bacteria | 1496 |
| 248 | Ga0105251_10086058 | 3300009011 | Unclassified | 1448 |
| 249 | Ga0105244_10000063 | 3300009036 | Bacteria | 122746 |
| 250 | Ga0105244_10098006 | 3300009036 | Bacteria | 1436 |
| 251 | Ga0105250_10040141 | 3300009092 | Bacteria | 1877 |
| 252 | Ga0105240_10000074 | 3300009093 | Bacteria | 199611 |
| 253 | Ga0105240_10000237 | 3300009093 | Bacteria | 109895 |
| 254 | Ga0105240_10000598 | 3300009093 | Bacteria | 67006 |
| 255 | Ga0105240_10000626 | 3300009093 | Bacteria | 65179 |
| 256 | Ga0105240_10001351 | 3300009093 | Bacteria | 42091 |
| 257 | Ga0105240_10001595 | 3300009093 | Bacteria | 38516 |
| 258 | Ga0105240_10007062 | 3300009093 | Bacteria | 16373 |
| 259 | Ga0105240_10008151 | 3300009093 | Bacteria | 15026 |
| 260 | Ga0105240_10022028 | 3300009093 | Bacteria | 8460 |
| 261 | Ga0105240_10045715 | 3300009093 | Bacteria | 5553 |
| 262 | Ga0105240_10066229 | 3300009093 | Bacteria | 4482 |
| 263 | Ga0105240_10084727 | 3300009093 | Bacteria | 3886 |
| 264 | Ga0105240_10096537 | 3300009093 | Bacteria | 3602 |
| 265 | Ga0105240_10108377 | 3300009093 | Bacteria | 3365 |
| 266 | Ga0105240_10126815 | 3300009093 | Bacteria | 3066 |
| 267 | Ga0105240_10261192 | 3300009093 | Bacteria | 1997 |
| 268 | Ga0105240_10349622 | 3300009093 | Unclassified | 1677 |
| 269 | Ga0111539_10034093 | 3300009094 | Bacteria | 6176 |
| 270 | Ga0105245_10114265 | 3300009098 | Bacteria | 2514 |
| 271 | Ga0114129_10033962 | 3300009147 | Bacteria | 7205 |
| 272 | Ga0105241_10000086 | 3300009174 | Bacteria | 69935 |
| 273 | Ga0105241_10000659 | 3300009174 | Bacteria | 25872 |
| 274 | Ga0105241_10005221 | 3300009174 | Bacteria | 9592 |
| 275 | Ga0105241_10042948 | 3300009174 | Bacteria | 3423 |
| 276 | Ga0105241_10057228 | 3300009174 | Bacteria | 2990 |
| 277 | Ga0105241_10170979 | 3300009174 | Bacteria | 1795 |
| 278 | Ga0105241_10284031 | 3300009174 | Bacteria | 1414 |
| 279 | Ga0105242_10009407 | 3300009176 | Bacteria | 7494 |
| 280 | Ga0105242_10015906 | 3300009176 | Bacteria | 5846 |
| 281 | Ga0105242_10066597 | 3300009176 | Bacteria | 2975 |
| 282 | Ga0105248_10570485 | 3300009177 | Unclassified | 1277 |
| 283 | Ga0105237_10000224 | 3300009545 | Bacteria | 79854 |
| 284 | Ga0105237_10001565 | 3300009545 | Bacteria | 29826 |
| 285 | Ga0105237_10003647 | 3300009545 | Bacteria | 18154 |
| 286 | Ga0105237_10004072 | 3300009545 | Bacteria | 17045 |
| 287 | Ga0105237_10009395 | 3300009545 | Bacteria | 10472 |
| 288 | Ga0105237_10018293 | 3300009545 | Bacteria | 7252 |
| 289 | Ga0105237_10028286 | 3300009545 | Bacteria | 5712 |
| 290 | Ga0105237_10036976 | 3300009545 | Bacteria | 4937 |
| 291 | Ga0105237_10057618 | 3300009545 | Bacteria | 3887 |
| 292 | Ga0105237_10059488 | 3300009545 | Bacteria | 3822 |
| 293 | Ga0105237_10067260 | 3300009545 | Bacteria | 3577 |
| 294 | Ga0105237_10140408 | 3300009545 | Bacteria | 2410 |
| 295 | Ga0105237_10193118 | 3300009545 | Bacteria | 2036 |
| 296 | Ga0105237_10196753 | 3300009545 | Bacteria | 2016 |
| 297 | Ga0105237_10264291 | 3300009545 | Bacteria | 1724 |
| 298 | Ga0105237_10285413 | 3300009545 | Unclassified | 1653 |
| 299 | Ga0105237_10397595 | 3300009545 | Bacteria | 1383 |
| 300 | Ga0105238_10001132 | 3300009551 | Bacteria | 26885 |
| 301 | Ga0105238_10052663 | 3300009551 | Bacteria | 4091 |
| 302 | Ga0105238_10097033 | 3300009551 | Bacteria | 2934 |
| 303 | Ga0105249_10005103 | 3300009553 | Bacteria | 11318 |
| 304 | Ga0105249_10005252 | 3300009553 | Bacteria | 11181 |
| 305 | Ga0105249_10008737 | 3300009553 | Bacteria | 8837 |
| 306 | Ga0105249_10055248 | 3300009553 | Unclassified | 3632 |
| 307 | Ga0105249_10079798 | 3300009553 | Bacteria | 3039 |
| 308 | Ga0105249_10148121 | 3300009553 | Bacteria | 2257 |
| 309 | Ga0105249_10203305 | 3300009553 | Bacteria | 1939 |
| 310 | Ga0105249_10461435 | 3300009553 | Bacteria | 1310 |
| 311 | Ga0105239_10000002 | 3300010375 | Bacteria | 610298 |
| 312 | Ga0105239_10000048 | 3300010375 | Bacteria | 177855 |
| 313 | Ga0105239_10000758 | 3300010375 | Bacteria | 45640 |
| 314 | Ga0105239_10001789 | 3300010375 | Bacteria | 28284 |
| 315 | Ga0105239_10001948 | 3300010375 | Bacteria | 26930 |
| 316 | Ga0105239_10002090 | 3300010375 | Bacteria | 25893 |
| 317 | Ga0105239_10002752 | 3300010375 | Bacteria | 22079 |
| 318 | Ga0105239_10005094 | 3300010375 | Bacteria | 15518 |
| 319 | Ga0105239_10008918 | 3300010375 | Bacteria | 11347 |
| 320 | Ga0105239_10016195 | 3300010375 | Bacteria | 8248 |
| 321 | Ga0105239_10024710 | 3300010375 | Bacteria | 6618 |
| 322 | Ga0105239_10039298 | 3300010375 | Bacteria | 5184 |
| 323 | Ga0105239_10045406 | 3300010375 | Bacteria | 4815 |
| 324 | Ga0105239_10078015 | 3300010375 | Bacteria | 3645 |
| 325 | Ga0105239_10087796 | 3300010375 | Bacteria | 3429 |
| 326 | Ga0105239_10121599 | 3300010375 | Unclassified | 2900 |
| 327 | Ga0105239_10166914 | 3300010375 | Unclassified | 2462 |
| 328 | Ga0105246_10028028 | 3300011119 | Bacteria | 3697 |
| 329 | Ga0105246_10053815 | 3300011119 | Bacteria | 2771 |
| 330 | Ga0105246_10249830 | 3300011119 | Bacteria | 1407 |
| 331 | Ga0157373_10000002 | 3300013100 | Bacteria | 750094 |
| 332 | Ga0157373_10000821 | 3300013100 | Bacteria | 24074 |
| 333 | Ga0157373_10002581 | 3300013100 | Bacteria | 13752 |
| 334 | Ga0157373_10019401 | 3300013100 | Bacteria | 4948 |
| 335 | Ga0157373_10020933 | 3300013100 | Bacteria | 4749 |
| 336 | Ga0157373_10092748 | 3300013100 | Bacteria | 2127 |
| 337 | Ga0157373_10097891 | 3300013100 | Bacteria | 2065 |
| 338 | Ga0157371_10000016 | 3300013102 | Bacteria | 330495 |
| 339 | Ga0157371_10000135 | 3300013102 | Bacteria | 107607 |
| 340 | Ga0157371_10000563 | 3300013102 | Bacteria | 43940 |
| 341 | Ga0157371_10001161 | 3300013102 | Bacteria | 28350 |
| 342 | Ga0157371_10001915 | 3300013102 | Bacteria | 20795 |
| 343 | Ga0157371_10003683 | 3300013102 | Bacteria | 13759 |
| 344 | Ga0157371_10005312 | 3300013102 | Bacteria | 10902 |
| 345 | Ga0157371_10009984 | 3300013102 | Bacteria | 7430 |
| 346 | Ga0157371_10018424 | 3300013102 | Bacteria | 5163 |
| 347 | Ga0157371_10034813 | 3300013102 | Bacteria | 3611 |
| 348 | Ga0157371_10077958 | 3300013102 | Bacteria | 2347 |
| 349 | Ga0157370_10000500 | 3300013104 | Bacteria | 48866 |
| 350 | Ga0157370_10001022 | 3300013104 | Bacteria | 35238 |
| 351 | Ga0157370_10001166 | 3300013104 | Bacteria | 32718 |
| 352 | Ga0157370_10005338 | 3300013104 | Bacteria | 14435 |
| 353 | Ga0157370_10006435 | 3300013104 | Bacteria | 12959 |
| 354 | Ga0157370_10007484 | 3300013104 | Bacteria | 11861 |
| 355 | Ga0157370_10010727 | 3300013104 | Bacteria | 9634 |
| 356 | Ga0157370_10014206 | 3300013104 | Bacteria | 8159 |
| 357 | Ga0157370_10014665 | 3300013104 | Bacteria | 8007 |
| 358 | Ga0157370_10017596 | 3300013104 | Bacteria | 7210 |
| 359 | Ga0157370_10031451 | 3300013104 | Bacteria | 5191 |
| 360 | Ga0157370_10036413 | 3300013104 | Bacteria | 4774 |
| 361 | Ga0157370_10039822 | 3300013104 | Bacteria | 4539 |
| 362 | Ga0157370_10262108 | 3300013104 | Bacteria | 1597 |
| 363 | Ga0157369_10000475 | 3300013105 | Bacteria | 53219 |
| 364 | Ga0157369_10001138 | 3300013105 | Bacteria | 33208 |
| 365 | Ga0157369_10046098 | 3300013105 | Bacteria | 4739 |
| 366 | Ga0157369_10051032 | 3300013105 | Bacteria | 4478 |
| 367 | Ga0157369_10057127 | 3300013105 | Bacteria | 4211 |
| 368 | Ga0157369_10081875 | 3300013105 | Bacteria | 3454 |
| 369 | Ga0157369_10086419 | 3300013105 | Bacteria | 3349 |
| 370 | Ga0157369_10117845 | 3300013105 | Bacteria | 2818 |
| 371 | Ga0157369_10159155 | 3300013105 | Bacteria | 2384 |
| 372 | Ga0157369_10231674 | 3300013105 | Bacteria | 1931 |
| 373 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 374 | Ga0157374_10000128 | 3300013296 | Bacteria | 69753 |
| 375 | Ga0157374_10000202 | 3300013296 | Bacteria | 54739 |
| 376 | Ga0157374_10004614 | 3300013296 | Bacteria | 11557 |
| 377 | Ga0157374_10028575 | 3300013296 | Bacteria | 5039 |
| 378 | Ga0157374_10034089 | 3300013296 | Bacteria | 4648 |
| 379 | Ga0157374_10051367 | 3300013296 | Bacteria | 3836 |
| 380 | Ga0157374_10054818 | 3300013296 | Bacteria | 3720 |
| 381 | Ga0157374_10099620 | 3300013296 | Bacteria | 2784 |
| 382 | Ga0157374_10297505 | 3300013296 | Bacteria | 1596 |
| 383 | Ga0157374_10492119 | 3300013296 | Bacteria | 1230 |
| 384 | Ga0157378_10005717 | 3300013297 | Bacteria | 10884 |
| 385 | Ga0157378_10005849 | 3300013297 | Bacteria | 10778 |
| 386 | Ga0157378_10010586 | 3300013297 | Bacteria | 8059 |
| 387 | Ga0157378_10043948 | 3300013297 | Bacteria | 3966 |
| 388 | Ga0157378_10107269 | 3300013297 | Bacteria | 2556 |
| 389 | Ga0157378_10260343 | 3300013297 | Bacteria | 1664 |
| 390 | Ga0157378_10290658 | 3300013297 | Bacteria | 1579 |
| 391 | Ga0163162_10000032 | 3300013306 | Bacteria | 156609 |
| 392 | Ga0163162_10000152 | 3300013306 | Bacteria | 64273 |
| 393 | Ga0163162_10009046 | 3300013306 | Bacteria | 9683 |
| 394 | Ga0163162_10011763 | 3300013306 | Bacteria | 8536 |
| 395 | Ga0163162_10015657 | 3300013306 | Bacteria | 7411 |
| 396 | Ga0163162_10016026 | 3300013306 | Bacteria | 7325 |
| 397 | Ga0163162_10029333 | 3300013306 | Bacteria | 5444 |
| 398 | Ga0163162_10052936 | 3300013306 | Bacteria | 4079 |
| 399 | Ga0163162_10054110 | 3300013306 | Bacteria | 4036 |
| 400 | Ga0163162_10095248 | 3300013306 | Unclassified | 3063 |
| 401 | Ga0163162_10295516 | 3300013306 | Bacteria | 1752 |
| 402 | Ga0163162_10459650 | 3300013306 | Bacteria | 1404 |
| 403 | Ga0157372_10000017 | 3300013307 | Bacteria | 219543 |
| 404 | Ga0157372_10000061 | 3300013307 | Bacteria | 119814 |
| 405 | Ga0157372_10000921 | 3300013307 | Bacteria | 32008 |
| 406 | Ga0157372_10003385 | 3300013307 | Bacteria | 17204 |
| 407 | Ga0157372_10004228 | 3300013307 | Bacteria | 15351 |
| 408 | Ga0157372_10018588 | 3300013307 | Bacteria | 7477 |
| 409 | Ga0157372_10020418 | 3300013307 | Bacteria | 7146 |
| 410 | Ga0157372_10142889 | 3300013307 | Bacteria | 2759 |
| 411 | Ga0157372_10151540 | 3300013307 | Bacteria | 2677 |
| 412 | Ga0157372_10166690 | 3300013307 | Bacteria | 2548 |
| 413 | Ga0157372_10207727 | 3300013307 | Bacteria | 2269 |
| 414 | Ga0157375_10037080 | 3300013308 | Bacteria | 4668 |
| 415 | Ga0157375_10040512 | 3300013308 | Bacteria | 4490 |
| 416 | Ga0157375_10045096 | 3300013308 | Unclassified | 4290 |
| 417 | Ga0157375_10045413 | 3300013308 | Bacteria | 4275 |
| 418 | Ga0157375_10123056 | 3300013308 | Unclassified | 2706 |
| 419 | Ga0157375_10174141 | 3300013308 | Bacteria | 2301 |
| 420 | Ga0157375_10202478 | 3300013308 | Bacteria | 2141 |
| 421 | Ga0157375_10205722 | 3300013308 | Bacteria | 2124 |
| 422 | Ga0157375_10480579 | 3300013308 | Bacteria | 1407 |
| 423 | Ga0157375_10578419 | 3300013308 | Bacteria | 1283 |
| 424 | Ga0163163_10000653 | 3300014325 | Bacteria | 29691 |
| 425 | Ga0163163_10195869 | 3300014325 | Bacteria | 2069 |
| 426 | Ga0163163_10403595 | 3300014325 | Unclassified | 1425 |
| 427 | Ga0157380_10162904 | 3300014326 | Bacteria | 1940 |
| 428 | Ga0157380_10168749 | 3300014326 | Bacteria | 1909 |
| 429 | Ga0157380_10234046 | 3300014326 | Bacteria | 1652 |
| 430 | Ga0182008_10000006 | 3300014497 | Bacteria | 378521 |
| 431 | Ga0182008_10000818 | 3300014497 | Bacteria | 21712 |
| 432 | Ga0182008_10001192 | 3300014497 | Bacteria | 17914 |
| 433 | Ga0157379_10001301 | 3300014968 | Bacteria | 20316 |
| 434 | Ga0157379_10180015 | 3300014968 | Unclassified | 1910 |
| 435 | Ga0157379_10206039 | 3300014968 | Unclassified | 1779 |
| 436 | Ga0157376_10000721 | 3300014969 | Bacteria | 21396 |
| 437 | Ga0157376_10001279 | 3300014969 | Bacteria | 16546 |
| 438 | Ga0157376_10008360 | 3300014969 | Bacteria | 7464 |
| 439 | Ga0157376_10025181 | 3300014969 | Bacteria | 4683 |
| 440 | Ga0157376_10037767 | 3300014969 | Bacteria | 3925 |
| 441 | Ga0157376_10055030 | 3300014969 | Bacteria | 3319 |
| 442 | Ga0157376_10067496 | 3300014969 | Unclassified | 3025 |
| 443 | Ga0182006_1000011 | 3300015261 | Bacteria | 408647 |
| 444 | Ga0182006_1000068 | 3300015261 | Bacteria | 144823 |
| 445 | Ga0182006_1000869 | 3300015261 | Bacteria | 20275 |
| 446 | Ga0182006_1001882 | 3300015261 | Bacteria | 11983 |
| 447 | Ga0182006_1003367 | 3300015261 | Bacteria | 8215 |
| 448 | Ga0182007_10000003 | 3300015262 | Bacteria | 548244 |
| 449 | Ga0183373_1001 | 3300015682 | Bacteria | 1410374 |
| 450 | Ga0163161_10000012 | 3300017792 | Bacteria | 264639 |
| 451 | Ga0163161_10000074 | 3300017792 | Bacteria | 101784 |
| 452 | Ga0163161_10015370 | 3300017792 | Bacteria | 5336 |
| 453 | Ga0163161_10016813 | 3300017792 | Bacteria | 5115 |
| 454 | Ga0163161_10020644 | 3300017792 | Bacteria | 4625 |
| 455 | Ga0163161_10067138 | 3300017792 | Unclassified | 2619 |
| 456 | Ga0163161_10171589 | 3300017792 | Bacteria | 1659 |
| 457 | Ga0213872_10009314 | 3300021361 | Bacteria | 4715 |
| 458 | Ga0209436_103157 | 3300025208 | Bacteria | 4514 |
| 459 | Ga0207427_100103 | 3300025231 | Bacteria | 119618 |
| 460 | Ga0209437_100017 | 3300025233 | Bacteria | 694471 |
| 461 | Ga0209437_100101 | 3300025233 | Bacteria | 226668 |
| 462 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 463 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 464 | Ga0209646_1000745 | 3300025246 | Bacteria | 11381 |
| 465 | Ga0209026_1000434 | 3300025250 | Bacteria | 34861 |
| 466 | Ga0209026_1006913 | 3300025250 | Bacteria | 2666 |
| 467 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 468 | Ga0209233_1000124 | 3300025261 | Bacteria | 226743 |
| 469 | Ga0209130_1005416 | 3300025284 | Bacteria | 4431 |
| 470 | Ga0209675_1000033 | 3300025291 | Bacteria | 271576 |
| 471 | Ga0209676_1000008 | 3300025292 | Bacteria | 991778 |
| 472 | Ga0209676_1000425 | 3300025292 | Bacteria | 74151 |
| 473 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 474 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 475 | Ga0209758_1003065 | 3300025297 | Bacteria | 15894 |
| 476 | Ga0209050_1000045 | 3300025298 | Bacteria | 388022 |
| 477 | Ga0207426_1000002 | 3300025302 | Bacteria | 1249660 |
| 478 | Ga0207426_1000051 | 3300025302 | Bacteria | 391700 |
| 479 | Ga0207426_1000497 | 3300025302 | Bacteria | 58506 |
| 480 | Ga0209257_1000001 | 3300025304 | Bacteria | 2274655 |
| 481 | Ga0207656_10017547 | 3300025321 | Unclassified | 2806 |
| 482 | Ga0207682_10010357 | 3300025893 | Bacteria | 3654 |
| 483 | Ga0207710_10008558 | 3300025900 | Bacteria | 4313 |
| 484 | Ga0207688_10009386 | 3300025901 | Bacteria | 5328 |
| 485 | Ga0207680_10015585 | 3300025903 | Bacteria | 3970 |
| 486 | Ga0207680_10023544 | 3300025903 | Bacteria | 3365 |
| 487 | Ga0207680_10052159 | 3300025903 | Bacteria | 2449 |
| 488 | Ga0207647_10000105 | 3300025904 | Bacteria | 65502 |
| 489 | Ga0207647_10000511 | 3300025904 | Bacteria | 30935 |
| 490 | Ga0207647_10007406 | 3300025904 | Bacteria | 7930 |
| 491 | Ga0207647_10016870 | 3300025904 | Bacteria | 4974 |
| 492 | Ga0207647_10022172 | 3300025904 | Unclassified | 4224 |
| 493 | Ga0207647_10098536 | 3300025904 | Unclassified | 1737 |
| 494 | Ga0207645_10000622 | 3300025907 | Bacteria | 29378 |
| 495 | Ga0207645_10001210 | 3300025907 | Bacteria | 21312 |
| 496 | Ga0207645_10003591 | 3300025907 | Bacteria | 11736 |
| 497 | Ga0207645_10004714 | 3300025907 | Bacteria | 10031 |
| 498 | Ga0207643_10023368 | 3300025908 | Bacteria | 3408 |
| 499 | Ga0207643_10126218 | 3300025908 | Bacteria | 1519 |
| 500 | Ga0207705_10000079 | 3300025909 | Bacteria | 119999 |
| 501 | Ga0207705_10017692 | 3300025909 | Bacteria | 5099 |
| 502 | Ga0207705_10045764 | 3300025909 | Bacteria | 3144 |
| 503 | Ga0207705_10189042 | 3300025909 | Bacteria | 1556 |
| 504 | Ga0207654_10016294 | 3300025911 | Bacteria | 3868 |
| 505 | Ga0207654_10047242 | 3300025911 | Bacteria | 2459 |
| 506 | Ga0207707_10000051 | 3300025912 | Bacteria | 117204 |
| 507 | Ga0207707_10021406 | 3300025912 | Bacteria | 5653 |
| 508 | Ga0207707_10193606 | 3300025912 | Unclassified | 1773 |
| 509 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 510 | Ga0207695_10000084 | 3300025913 | Bacteria | 282392 |
| 511 | Ga0207695_10000323 | 3300025913 | Bacteria | 114265 |
| 512 | Ga0207695_10001232 | 3300025913 | Bacteria | 43800 |
| 513 | Ga0207695_10004447 | 3300025913 | Bacteria | 19105 |
| 514 | Ga0207695_10007846 | 3300025913 | Bacteria | 13492 |
| 515 | Ga0207695_10009118 | 3300025913 | Bacteria | 12316 |
| 516 | Ga0207695_10015643 | 3300025913 | Bacteria | 8923 |
| 517 | Ga0207695_10122675 | 3300025913 | Bacteria | 2564 |
| 518 | Ga0207695_10189847 | 3300025913 | Unclassified | 1972 |
| 519 | Ga0207695_10234174 | 3300025913 | Bacteria | 1740 |
| 520 | Ga0207671_10000272 | 3300025914 | Bacteria | 77080 |
| 521 | Ga0207671_10001497 | 3300025914 | Bacteria | 26937 |
| 522 | Ga0207671_10002907 | 3300025914 | Bacteria | 17690 |
| 523 | Ga0207671_10005889 | 3300025914 | Bacteria | 11125 |
| 524 | Ga0207671_10009491 | 3300025914 | Bacteria | 8127 |
| 525 | Ga0207671_10012189 | 3300025914 | Bacteria | 6935 |
| 526 | Ga0207671_10014622 | 3300025914 | Bacteria | 6192 |
| 527 | Ga0207671_10036318 | 3300025914 | Bacteria | 3654 |
| 528 | Ga0207671_10042678 | 3300025914 | Bacteria | 3356 |
| 529 | Ga0207671_10103071 | 3300025914 | Bacteria | 2163 |
| 530 | Ga0207671_10121560 | 3300025914 | Bacteria | 1996 |
| 531 | Ga0207671_10220780 | 3300025914 | Bacteria | 1485 |
| 532 | Ga0207671_10335001 | 3300025914 | Bacteria | 1198 |
| 533 | Ga0207660_10009778 | 3300025917 | Bacteria | 6208 |
| 534 | Ga0207662_10016297 | 3300025918 | Bacteria | 4192 |
| 535 | Ga0207662_10019350 | 3300025918 | Bacteria | 3873 |
| 536 | Ga0207657_10059750 | 3300025919 | Bacteria | 3273 |
| 537 | Ga0207657_10082590 | 3300025919 | Bacteria | 2697 |
| 538 | Ga0207657_10350426 | 3300025919 | Unclassified | 1164 |
| 539 | Ga0207649_10017077 | 3300025920 | Bacteria | 4108 |
| 540 | Ga0207652_10000384 | 3300025921 | Bacteria | 46082 |
| 541 | Ga0207652_10001696 | 3300025921 | Bacteria | 19285 |
| 542 | Ga0207652_10014179 | 3300025921 | Bacteria | 6454 |
| 543 | Ga0207652_10015091 | 3300025921 | Bacteria | 6268 |
| 544 | Ga0207694_10077795 | 3300025924 | Bacteria | 2600 |
| 545 | Ga0207694_10094692 | 3300025924 | Bacteria | 2360 |
| 546 | Ga0207694_10195493 | 3300025924 | Bacteria | 1644 |
| 547 | Ga0207694_10247457 | 3300025924 | Unclassified | 1458 |
| 548 | Ga0207650_10019073 | 3300025925 | Bacteria | 4820 |
| 549 | Ga0207650_10042343 | 3300025925 | Bacteria | 3341 |
| 550 | Ga0207650_10070695 | 3300025925 | Bacteria | 2624 |
| 551 | Ga0207659_10008155 | 3300025926 | Bacteria | 6484 |
| 552 | Ga0207659_10037371 | 3300025926 | Unclassified | 3371 |
| 553 | Ga0207659_10053334 | 3300025926 | Bacteria | 2884 |
| 554 | Ga0207659_10163272 | 3300025926 | Unclassified | 1751 |
| 555 | Ga0207687_10106215 | 3300025927 | Bacteria | 2075 |
| 556 | Ga0207644_10120271 | 3300025931 | Unclassified | 1999 |
| 557 | Ga0207644_10168342 | 3300025931 | Bacteria | 1709 |
| 558 | Ga0207690_10000318 | 3300025932 | Bacteria | 32496 |
| 559 | Ga0207690_10013661 | 3300025932 | Bacteria | 4885 |
| 560 | Ga0207690_10160203 | 3300025932 | Bacteria | 1677 |
| 561 | Ga0207706_10000120 | 3300025933 | Bacteria | 84222 |
| 562 | Ga0207706_10029817 | 3300025933 | Bacteria | 4869 |
| 563 | Ga0207706_10049670 | 3300025933 | Bacteria | 3706 |
| 564 | Ga0207706_10099200 | 3300025933 | Unclassified | 2562 |
| 565 | Ga0207706_10211759 | 3300025933 | Bacteria | 1699 |
| 566 | Ga0207686_10024502 | 3300025934 | Bacteria | 3498 |
| 567 | Ga0207670_10107261 | 3300025936 | Bacteria | 2005 |
| 568 | Ga0207670_10126200 | 3300025936 | Bacteria | 1868 |
| 569 | Ga0207704_10000099 | 3300025938 | Bacteria | 48088 |
| 570 | Ga0207704_10028986 | 3300025938 | Bacteria | 3080 |
| 571 | Ga0207704_10073370 | 3300025938 | Bacteria | 2179 |
| 572 | Ga0207704_10212037 | 3300025938 | Unclassified | 1426 |
| 573 | Ga0207691_10002527 | 3300025940 | Bacteria | 17886 |
| 574 | Ga0207691_10023686 | 3300025940 | Bacteria | 5780 |
| 575 | Ga0207691_10027226 | 3300025940 | Bacteria | 5363 |
| 576 | Ga0207691_10042760 | 3300025940 | Unclassified | 4175 |
| 577 | Ga0207691_10052586 | 3300025940 | Bacteria | 3720 |
| 578 | Ga0207691_10066643 | 3300025940 | Bacteria | 3257 |
| 579 | Ga0207691_10194754 | 3300025940 | Unclassified | 1766 |
| 580 | Ga0207689_10003051 | 3300025942 | Bacteria | 15431 |
| 581 | Ga0207689_10008841 | 3300025942 | Bacteria | 8746 |
| 582 | Ga0207689_10077529 | 3300025942 | Bacteria | 2731 |
| 583 | Ga0207689_10107260 | 3300025942 | Unclassified | 2295 |
| 584 | Ga0207689_10125004 | 3300025942 | Bacteria | 2116 |
| 585 | Ga0207689_10157763 | 3300025942 | Bacteria | 1870 |
| 586 | Ga0207689_10234984 | 3300025942 | Bacteria | 1515 |
| 587 | Ga0207661_10033412 | 3300025944 | Unclassified | 3992 |
| 588 | Ga0207661_10055683 | 3300025944 | Bacteria | 3173 |
| 589 | Ga0207661_10119674 | 3300025944 | Bacteria | 2240 |
| 590 | Ga0207661_10250394 | 3300025944 | Unclassified | 1574 |
| 591 | Ga0207679_10007258 | 3300025945 | Bacteria | 7021 |
| 592 | Ga0207679_10026046 | 3300025945 | Bacteria | 4029 |
| 593 | Ga0207667_10000037 | 3300025949 | Bacteria | 297252 |
| 594 | Ga0207667_10000135 | 3300025949 | Bacteria | 111565 |
| 595 | Ga0207667_10007957 | 3300025949 | Bacteria | 12648 |
| 596 | Ga0207667_10011669 | 3300025949 | Bacteria | 10195 |
| 597 | Ga0207667_10017914 | 3300025949 | Bacteria | 7961 |
| 598 | Ga0207667_10028059 | 3300025949 | Bacteria | 6116 |
| 599 | Ga0207667_10028127 | 3300025949 | Bacteria | 6107 |
| 600 | Ga0207667_10038231 | 3300025949 | Bacteria | 5127 |
| 601 | Ga0207667_10048612 | 3300025949 | Bacteria | 4485 |
| 602 | Ga0207667_10164208 | 3300025949 | Bacteria | 2283 |
| 603 | Ga0207667_10209178 | 3300025949 | Bacteria | 2000 |
| 604 | Ga0207667_10345220 | 3300025949 | Bacteria | 1518 |
| 605 | Ga0207667_10533199 | 3300025949 | Unclassified | 1188 |
| 606 | Ga0207651_10005116 | 3300025960 | Bacteria | 6696 |
| 607 | Ga0207651_10124360 | 3300025960 | Bacteria | 1962 |
| 608 | Ga0207651_10144307 | 3300025960 | Bacteria | 1843 |
| 609 | Ga0207651_10156626 | 3300025960 | Unclassified | 1780 |
| 610 | Ga0207712_10007103 | 3300025961 | Bacteria | 7062 |
| 611 | Ga0207712_10355651 | 3300025961 | Unclassified | 1219 |
| 612 | Ga0207668_10000540 | 3300025972 | Bacteria | 23750 |
| 613 | Ga0207668_10118577 | 3300025972 | Bacteria | 2000 |
| 614 | Ga0207668_10250364 | 3300025972 | Bacteria | 1438 |
| 615 | Ga0207640_10052155 | 3300025981 | Bacteria | 2663 |
| 616 | Ga0207658_10039183 | 3300025986 | Bacteria | 3418 |
| 617 | Ga0207658_10049171 | 3300025986 | Bacteria | 3097 |
| 618 | Ga0207658_10181257 | 3300025986 | Bacteria | 1743 |
| 619 | Ga0207677_10004313 | 3300026023 | Bacteria | 7617 |
| 620 | Ga0207677_10014691 | 3300026023 | Bacteria | 4581 |
| 621 | Ga0207677_10019806 | 3300026023 | Bacteria | 4072 |
| 622 | Ga0207677_10059201 | 3300026023 | Bacteria | 2641 |
| 623 | Ga0207677_10074545 | 3300026023 | Bacteria | 2408 |
| 624 | Ga0207677_10253314 | 3300026023 | Unclassified | 1431 |
| 625 | Ga0207703_10001644 | 3300026035 | Bacteria | 20118 |
| 626 | Ga0207703_10201182 | 3300026035 | Unclassified | 1770 |
| 627 | Ga0207639_10001126 | 3300026041 | Bacteria | 18166 |
| 628 | Ga0207639_10016182 | 3300026041 | Bacteria | 5271 |
| 629 | Ga0207639_10119624 | 3300026041 | Bacteria | 2162 |
| 630 | Ga0207639_10140418 | 3300026041 | Bacteria | 2012 |
| 631 | Ga0207639_10149561 | 3300026041 | Unclassified | 1954 |
| 632 | Ga0207639_10210951 | 3300026041 | Bacteria | 1672 |
| 633 | Ga0207639_10285933 | 3300026041 | Bacteria | 1452 |
| 634 | Ga0207678_10038074 | 3300026067 | Bacteria | 4181 |
| 635 | Ga0207678_10068160 | 3300026067 | Bacteria | 3053 |
| 636 | Ga0207678_10224546 | 3300026067 | Bacteria | 1608 |
| 637 | Ga0207708_10160493 | 3300026075 | Bacteria | 1775 |
| 638 | Ga0207702_10000196 | 3300026078 | Bacteria | 71703 |
| 639 | Ga0207702_10057179 | 3300026078 | Bacteria | 3315 |
| 640 | Ga0207702_10074879 | 3300026078 | Bacteria | 2923 |
| 641 | Ga0207702_10093576 | 3300026078 | Bacteria | 2636 |
| 642 | Ga0207702_10104078 | 3300026078 | Bacteria | 2511 |
| 643 | Ga0207702_10447303 | 3300026078 | Bacteria | 1253 |
| 644 | Ga0207641_10000253 | 3300026088 | Bacteria | 67848 |
| 645 | Ga0207641_10018015 | 3300026088 | Bacteria | 5787 |
| 646 | Ga0207641_10052914 | 3300026088 | Bacteria | 3440 |
| 647 | Ga0207641_10111008 | 3300026088 | Bacteria | 2431 |
| 648 | Ga0207641_10153753 | 3300026088 | Unclassified | 2086 |
| 649 | Ga0207648_10002506 | 3300026089 | Bacteria | 19710 |
| 650 | Ga0207648_10004019 | 3300026089 | Bacteria | 15269 |
| 651 | Ga0207648_10018210 | 3300026089 | Bacteria | 6362 |
| 652 | Ga0207648_10034323 | 3300026089 | Bacteria | 4472 |
| 653 | Ga0207648_10036449 | 3300026089 | Unclassified | 4332 |
| 654 | Ga0207648_10042309 | 3300026089 | Bacteria | 3999 |
| 655 | Ga0207676_10063266 | 3300026095 | Bacteria | 2938 |
| 656 | Ga0207676_10223176 | 3300026095 | Bacteria | 1679 |
| 657 | Ga0207676_10348413 | 3300026095 | Bacteria | 1369 |
| 658 | Ga0207676_10355882 | 3300026095 | Unclassified | 1355 |
| 659 | Ga0207674_10000672 | 3300026116 | Bacteria | 44419 |
| 660 | Ga0207674_10006740 | 3300026116 | Bacteria | 13484 |
| 661 | Ga0207674_10114299 | 3300026116 | Bacteria | 2672 |
| 662 | Ga0207674_10160935 | 3300026116 | Bacteria | 2199 |
| 663 | Ga0207674_10178043 | 3300026116 | Bacteria | 2078 |
| 664 | Ga0207675_100014435 | 3300026118 | Bacteria | 7364 |
| 665 | Ga0207675_100066138 | 3300026118 | Bacteria | 3378 |
| 666 | Ga0207675_100134293 | 3300026118 | Bacteria | 2347 |
| 667 | Ga0207683_10003712 | 3300026121 | Bacteria | 13255 |
| 668 | Ga0207683_10005010 | 3300026121 | Bacteria | 11378 |
| 669 | Ga0207683_10057036 | 3300026121 | Bacteria | 3428 |
| 670 | Ga0207683_10065629 | 3300026121 | Unclassified | 3200 |
| 671 | Ga0207683_10117716 | 3300026121 | Bacteria | 2382 |
| 672 | Ga0207698_10001082 | 3300026142 | Bacteria | 15843 |
| 673 | Ga0207698_10011290 | 3300026142 | Bacteria | 5783 |
| 674 | Ga0207698_10055732 | 3300026142 | Bacteria | 3049 |
| 675 | Ga0209281_1000094 | 3300027111 | Bacteria | 238155 |
| 676 | Ga0209995_1001337 | 3300027471 | Bacteria | 3795 |
| 677 | Ga0209968_1002355 | 3300027526 | Bacteria | 2857 |
| 678 | Ga0210002_1001420 | 3300027617 | Bacteria | 3370 |
| 679 | Ga0209282_1106414 | 3300027666 | Bacteria | 1433 |
| 680 | Ga0209974_10017789 | 3300027876 | Bacteria | 2356 |
| 681 | Ga0268266_10000018 | 3300028379 | Bacteria | 569141 |
| 682 | Ga0268266_10085801 | 3300028379 | Unclassified | 2751 |
| 683 | Ga0268266_10090778 | 3300028379 | Unclassified | 2678 |
| 684 | Ga0268265_10014622 | 3300028380 | Bacteria | 5351 |
| 685 | Ga0268265_10099403 | 3300028380 | Bacteria | 2346 |
| 686 | Ga0268264_10001720 | 3300028381 | Bacteria | 20153 |
| 687 | Ga0268264_10009362 | 3300028381 | Bacteria | 8107 |
| 688 | Ga0268264_10047708 | 3300028381 | Bacteria | 3561 |
| 689 | Ga0307517_10002048 | 3300028786 | Bacteria | 32795 |
| 690 | Ga0307517_10004683 | 3300028786 | Bacteria | 20955 |
| 691 | Ga0307515_10000681 | 3300028794 | Bacteria | 78150 |
| 692 | Ga0307515_10001752 | 3300028794 | Bacteria | 48338 |
| 693 | Ga0307515_10002910 | 3300028794 | Bacteria | 36374 |
| 694 | Ga0307515_10014453 | 3300028794 | Bacteria | 14631 |
| 695 | Ga0307515_10081729 | 3300028794 | Bacteria | 4192 |
| 696 | Ga0307515_10093645 | 3300028794 | Bacteria | 3722 |
| 697 | Ga0307515_10229784 | 3300028794 | Bacteria | 1651 |
| 698 | Ga0265338_10001687 | 3300028800 | Bacteria | 35089 |
| 699 | Ga0316177_1198244 | 3300030731 | Bacteria | 7343 |
| 700 | Ga0316176_1050137 | 3300030732 | Bacteria | 14004 |
| 701 | Ga0316183_1065995 | 3300030742 | Bacteria | 27909 |
| 702 | Ga0316181_1148726 | 3300030744 | Bacteria | 7875 |
| 703 | Ga0265327_10000010 | 3300031251 | Bacteria | 566817 |
| 704 | Ga0307513_10156292 | 3300031456 | Bacteria | 2180 |
| 705 | Ga0307509_10048545 | 3300031507 | Bacteria | 4557 |
| 706 | Ga0307408_100002250 | 3300031548 | Bacteria | 13771 |
| 707 | Ga0307508_10002100 | 3300031616 | Bacteria | 21430 |
| 708 | Ga0316576_10075969 | 3300031727 | Bacteria | 2485 |
| 709 | Ga0316578_10057826 | 3300031728 | Bacteria | 2279 |
| 710 | Ga0307516_10003117 | 3300031730 | Bacteria | 21573 |
| 711 | Ga0307405_10000003 | 3300031731 | Bacteria | 569064 |
| 712 | Ga0307405_10014179 | 3300031731 | Bacteria | 4277 |
| 713 | Ga0307405_10059446 | 3300031731 | Bacteria | 2409 |
| 714 | Ga0307413_10115686 | 3300031824 | Bacteria | 1805 |
| 715 | Ga0307413_10143113 | 3300031824 | Bacteria | 1655 |
| 716 | Ga0307413_10178076 | 3300031824 | Unclassified | 1513 |
| 717 | Ga0307410_10000067 | 3300031852 | Bacteria | 37092 |
| 718 | Ga0307410_10194020 | 3300031852 | Bacteria | 1546 |
| 719 | Ga0307406_10000035 | 3300031901 | Bacteria | 82953 |
| 720 | Ga0307406_10117919 | 3300031901 | Bacteria | 1840 |
| 721 | Ga0307407_10000008 | 3300031903 | Bacteria | 191228 |
| 722 | Ga0307407_10063361 | 3300031903 | Bacteria | 2168 |
| 723 | Ga0307412_10000427 | 3300031911 | Bacteria | 25500 |
| 724 | Ga0307412_10037619 | 3300031911 | Bacteria | 3111 |
| 725 | Ga0307409_100008566 | 3300031995 | Bacteria | 6218 |
| 726 | Ga0307416_100000009 | 3300032002 | Bacteria | 374271 |
| 727 | Ga0307416_100000639 | 3300032002 | Bacteria | 18075 |
| 728 | Ga0307416_100113426 | 3300032002 | Bacteria | 2395 |
| 729 | Ga0307414_10000009 | 3300032004 | Bacteria | 359782 |
| 730 | Ga0307414_10000038 | 3300032004 | Bacteria | 150774 |
| 731 | Ga0307414_10000063 | 3300032004 | Bacteria | 107710 |
| 732 | Ga0307414_10002879 | 3300032004 | Bacteria | 9086 |
| 733 | Ga0307414_10004631 | 3300032004 | Bacteria | 7486 |
| 734 | Ga0307414_10008231 | 3300032004 | Bacteria | 5899 |
| 735 | Ga0307414_10012334 | 3300032004 | Bacteria | 5049 |
| 736 | Ga0307414_10034651 | 3300032004 | Bacteria | 3350 |
| 737 | Ga0307414_10105314 | 3300032004 | Bacteria | 2132 |
| 738 | Ga0307414_10242776 | 3300032004 | Unclassified | 1492 |
| 739 | Ga0307411_10000001 | 3300032005 | Bacteria | 931810 |
| 740 | Ga0307507_10000064 | 3300033179 | Bacteria | 161226 |
| 741 | Ga0307510_10002860 | 3300033180 | Bacteria | 19841 |
| 742 | Ga0307510_10041880 | 3300033180 | Bacteria | 4999 |
| 743 | Ga0373927_0005849 | 3300035695 | Bacteria | 8433 |
| 744 | Ga0373927_0037163 | 3300035695 | Bacteria | 3166 |
| 745 | Ga0373937_0023482 | 3300036401 | Bacteria | 5553 |
| 746 | Ga0373937_0152899 | 3300036401 | Bacteria | 2162 |
| 747 | Ga0373937_0250410 | 3300036401 | Bacteria | 1670 |
| 748 | Ga0316582_0060474 | 3300036647 | Bacteria | 2429 |
| 749 | Ga0316584_0027245 | 3300036712 | Bacteria | 4205 |
| 750 | Ga0316584_0122674 | 3300036712 | Bacteria | 1941 |
| 751 | Ga0373925_0104333 | 3300037068 | Bacteria | 2183 |
| 752 | Ga0395899_0000025 | 3300037312 | Bacteria | 350927 |
| 753 | Ga0395899_0000033 | 3300037312 | Bacteria | 306589 |
| 754 | Ga0395899_0000493 | 3300037312 | Bacteria | 44066 |
| 755 | Ga0395899_0000629 | 3300037312 | Bacteria | 36706 |
| 756 | Ga0395899_0001884 | 3300037312 | Bacteria | 17312 |
| 757 | Ga0395899_0029186 | 3300037312 | Bacteria | 4149 |
| 758 | Ga0395899_0029721 | 3300037312 | Bacteria | 4111 |
| 759 | Ga0395899_0041383 | 3300037312 | Bacteria | 3443 |
| 760 | Ga0395899_0066951 | 3300037312 | Bacteria | 2636 |
| 761 | Ga0395899_0133975 | 3300037312 | Unclassified | 1767 |
| 762 | Ga0395900_0000480 | 3300037418 | Bacteria | 56578 |
| 763 | Ga0395900_0000506 | 3300037418 | Bacteria | 54890 |
| 764 | Ga0395900_0006601 | 3300037418 | Bacteria | 12073 |
| 765 | Ga0395900_0009920 | 3300037418 | Bacteria | 9750 |
| 766 | Ga0395900_0012177 | 3300037418 | Bacteria | 8793 |
| 767 | Ga0395900_0108003 | 3300037418 | Bacteria | 2859 |
| 768 | Ga0395900_0175354 | 3300037418 | Unclassified | 2180 |
| 769 | Ga0395900_0179537 | 3300037418 | Unclassified | 2152 |
| 770 | Ga0395898_0001651 | 3300037466 | Bacteria | 30118 |
| 771 | Ga0395898_0032624 | 3300037466 | Bacteria | 5199 |
| 772 | Ga0395898_0041094 | 3300037466 | Bacteria | 4569 |
| 773 | Ga0395898_0056108 | 3300037466 | Bacteria | 3841 |
| 774 | Ga0395905_0000254 | 3300037471 | Bacteria | 79953 |
| 775 | Ga0395905_0000738 | 3300037471 | Bacteria | 43061 |
| 776 | Ga0395905_0001166 | 3300037471 | Bacteria | 32800 |
| 777 | Ga0395905_0006569 | 3300037471 | Bacteria | 11683 |
| 778 | Ga0395901_0000853 | 3300038443 | Bacteria | 33521 |
| 779 | Ga0395901_0004350 | 3300038443 | Bacteria | 14289 |
| 780 | Ga0395901_0010578 | 3300038443 | Bacteria | 9348 |
| 781 | Ga0395901_0059253 | 3300038443 | Bacteria | 3983 |
| 782 | Ga0395901_0067844 | 3300038443 | Bacteria | 3715 |
| 783 | Ga0395901_0081109 | 3300038443 | Bacteria | 3388 |
| 784 | Ga0395901_0119295 | 3300038443 | Bacteria | 2772 |
| 785 | Ga0436361_0021149 | 3300039447 | Bacteria | 8615 |
| 786 | Ga0439447_011193 | 3300041407 | Bacteria | 2629 |
| 787 | Ga0439466_0001850 | 3300041411 | Bacteria | 8310 |
| 788 | Ga0439448_0022307 | 3300042005 | Bacteria | 1967 |
| 789 | Ga0439449_0000697 | 3300042007 | Bacteria | 12827 |
| 790 | Ga0451577_0000010 | 3300042876 | Bacteria | 616686 |
| 791 | Ga0451577_0011492 | 3300042876 | Bacteria | 8368 |
| 792 | Ga0451577_0068138 | 3300042876 | Bacteria | 3174 |
| 793 | Ga0451577_0097018 | 3300042876 | Bacteria | 2632 |
| 794 | Ga0451577_0214216 | 3300042876 | Bacteria | 1740 |
| 795 | Ga0451577_0370719 | 3300042876 | Bacteria | 1299 |
| 796 | Ga0466969_0000912 | 3300044656 | Bacteria | 15928 |
| 797 | Ga0466969_0053439 | 3300044656 | Bacteria | 1982 |
| 798 | Ga0466969_0098395 | 3300044656 | Bacteria | 1379 |
| 799 | Ga0466972_0000013 | 3300044658 | Bacteria | 229345 |
| 800 | Ga0466972_0005607 | 3300044658 | Bacteria | 6290 |
| 801 | Ga0453683_0000031 | 3300044673 | Bacteria | 241998 |
| 802 | Ga0453683_0001482 | 3300044673 | Bacteria | 20102 |
| 803 | Ga0453683_0085783 | 3300044673 | Bacteria | 1973 |
| 804 | Ga0466966_0000045 | 3300044684 | Bacteria | 92504 |
| 805 | Ga0466966_0053935 | 3300044684 | Bacteria | 2549 |
| 806 | Ga0466961_0066482 | 3300044693 | Bacteria | 2290 |
| 807 | Ga0466961_0088177 | 3300044693 | Bacteria | 1960 |
| 808 | Ga0453684_0000191 | 3300044712 | Bacteria | 267816 |
| 809 | Ga0453684_0009766 | 3300044712 | Bacteria | 16663 |
| 810 | Ga0453684_0072910 | 3300044712 | Bacteria | 4332 |
| 811 | Ga0453684_0097891 | 3300044712 | Bacteria | 3599 |
| 812 | Ga0453684_0178992 | 3300044712 | Bacteria | 2491 |
| 813 | Ga0453684_0192947 | 3300044712 | Bacteria | 2381 |
| 814 | Ga0453684_0311331 | 3300044712 | Bacteria | 1786 |
| 815 | Ga0453684_0442253 | 3300044712 | Bacteria | 1449 |
| 816 | Ga0466968_0089549 | 3300044735 | Bacteria | 1362 |
| 817 | Ga0466970_0018485 | 3300044765 | Bacteria | 3609 |
| 818 | Ga0466970_0069434 | 3300044765 | Bacteria | 1894 |
| 819 | Ga0466957_0003333 | 3300044842 | Bacteria | 8805 |
| 820 | Ga0466957_0152139 | 3300044842 | Bacteria | 1497 |
| 821 | Ga0466959_0000023 | 3300045049 | Bacteria | 124545 |
| 822 | Ga0466959_0083862 | 3300045049 | Bacteria | 2294 |
| 823 | Ga0451576_0000088 | 3300045051 | Bacteria | 234139 |
| 824 | Ga0451576_0007064 | 3300045051 | Bacteria | 13567 |
| 825 | Ga0451576_0027120 | 3300045051 | Bacteria | 6156 |
| 826 | Ga0451576_0040329 | 3300045051 | Bacteria | 4943 |
| 827 | Ga0451576_0204986 | 3300045051 | Bacteria | 2059 |
| 828 | Ga0495629_0035357 | 3300046459 | Bacteria | 3531 |
| 829 | Ga0495638_0049677 | 3300046460 | Bacteria | 2622 |
| 830 | Ga0495651_0090903 | 3300046462 | Bacteria | 2289 |
| 831 | Ga0495650_0000087 | 3300046471 | Bacteria | 234870 |
| 832 | Ga0495585_0000286 | 3300046492 | Bacteria | 50524 |
| 833 | Ga0495585_0001651 | 3300046492 | Bacteria | 17060 |
| 834 | Ga0495583_0094765 | 3300046506 | Bacteria | 1281 |
| 835 | Ga0495606_0000052 | 3300046507 | Bacteria | 201529 |
| 836 | Ga0495606_0014847 | 3300046507 | Bacteria | 6048 |
| 837 | Ga0495610_0000001 | 3300046512 | Bacteria | 1620061 |
| 838 | Ga0495610_0000903 | 3300046512 | Bacteria | 27607 |
| 839 | Ga0495610_0006770 | 3300046512 | Bacteria | 7778 |
| 840 | Ga0495610_0010020 | 3300046512 | Bacteria | 5922 |
| 841 | Ga0495616_0005196 | 3300046513 | Bacteria | 8053 |
| 842 | Ga0495618_0007268 | 3300046514 | Bacteria | 6701 |
| 843 | Ga0495628_0017891 | 3300046516 | Bacteria | 5883 |
| 844 | Ga0495630_0049633 | 3300046517 | Bacteria | 3140 |
| 845 | Ga0495630_0116104 | 3300046517 | Bacteria | 2029 |
| 846 | Ga0495631_0027708 | 3300046518 | Bacteria | 2590 |
| 847 | Ga0495644_0007188 | 3300046523 | Bacteria | 4303 |
| 848 | Ga0495648_0077885 | 3300046524 | Bacteria | 1898 |
| 849 | Ga0495640_0061455 | 3300046533 | Unclassified | 2552 |
| 850 | Ga0495598_0027721 | 3300046537 | Bacteria | 1565 |
| 851 | Ga0495633_0000080 | 3300046558 | Bacteria | 127703 |
| 852 | Ga0495633_0000081 | 3300046558 | Bacteria | 125903 |
| 853 | Ga0495633_0072173 | 3300046558 | Bacteria | 1610 |
| 854 | Ga0495668_0000012 | 3300046616 | Bacteria | 458817 |
| 855 | Ga0495634_0069334 | 3300046642 | Bacteria | 2327 |
| 856 | Ga0495625_0000036 | 3300046660 | Bacteria | 221680 |
| 857 | Ga0495625_0002289 | 3300046660 | Bacteria | 20991 |
| 858 | Ga0495625_0010136 | 3300046660 | Bacteria | 7829 |
| 859 | Ga0495625_0014574 | 3300046660 | Bacteria | 6267 |
| 860 | Ga0495625_0021139 | 3300046660 | Bacteria | 5014 |
| 861 | Ga0495625_0043637 | 3300046660 | Bacteria | 3251 |
| 862 | Ga0495625_0091239 | 3300046660 | Bacteria | 2106 |
| 863 | Ga0495625_0233913 | 3300046660 | Bacteria | 1199 |
| 864 | Ga0495661_0003611 | 3300046665 | Bacteria | 11391 |
| 865 | Ga0495661_0092978 | 3300046665 | Bacteria | 1712 |
| 866 | Ga0495646_0058441 | 3300046680 | Bacteria | 2306 |
| 867 | Ga0495658_0017216 | 3300046683 | Bacteria | 3731 |
| 868 | Ga0495658_0020389 | 3300046683 | Unclassified | 3477 |
| 869 | Ga0495669_0058397 | 3300046684 | Bacteria | 1741 |
| 870 | Ga0495613_0161327 | 3300046689 | Unclassified | 1595 |
| 871 | Ga0495649_0000017 | 3300046694 | Bacteria | 221685 |
| 872 | Ga0495589_0123181 | 3300046794 | Bacteria | 1248 |
| 873 | Ga0495660_0013731 | 3300046810 | Bacteria | 4694 |
| 874 | Ga0495674_0018467 | 3300047319 | Bacteria | 6490 |
| 875 | Ga0495683_0023732 | 3300047323 | Bacteria | 3152 |
| 876 | Ga0495687_055425 | 3300047443 | Bacteria | 1657 |
| 877 | Ga0495673_0068477 | 3300047469 | Bacteria | 1500 |
| 878 | Ga0495684_0161177 | 3300047471 | Bacteria | 1673 |
| 879 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 880 | Ga0495686_0000582 | 3300047472 | Bacteria | 51799 |
| 881 | Ga0495686_0005494 | 3300047472 | Bacteria | 9975 |
| 882 | Ga0495686_0020028 | 3300047472 | Bacteria | 4464 |
| 883 | Ga0496109_0054915 | 3300048912 | Bacteria | 3633 |
| 884 | Ga0496114_0000594 | 3300048917 | Bacteria | 26726 |
| 885 | Ga0496114_0369263 | 3300048917 | Unclassified | 1270 |
| 886 | Ga0496115_0007421 | 3300048918 | Bacteria | 8067 |
| 887 | Ga0496115_0045415 | 3300048918 | Bacteria | 3507 |
| 888 | Ga0496116_0000032 | 3300048919 | Bacteria | 419997 |
| 889 | Ga0496121_0091005 | 3300048924 | Bacteria | 2383 |
| 890 | Ga0496122_0001208 | 3300048925 | Bacteria | 43998 |
| 891 | Ga0496123_0008537 | 3300048926 | Bacteria | 9392 |
| 892 | Ga0496124_0111474 | 3300048927 | Bacteria | 2201 |
| 893 | Ga0496124_0126449 | 3300048927 | Bacteria | 2035 |
| 894 | Ga0496125_0000059 | 3300048928 | Bacteria | 264149 |
| 895 | Ga0496125_0011341 | 3300048928 | Bacteria | 8925 |
| 896 | Ga0496126_0008790 | 3300048929 | Bacteria | 10843 |
| 897 | Ga0496126_0022457 | 3300048929 | Bacteria | 6139 |
| 898 | Ga0496126_0212279 | 3300048929 | Bacteria | 1629 |
| 899 | Ga0495678_014851 | 3300049459 | Bacteria | 3607 |
| 900 | Ga0501031_0003605 | 3300049568 | Bacteria | 9955 |
| 901 | Ga0501032_0091050 | 3300049569 | Bacteria | 2024 |
| 902 | Ga0501033_0010675 | 3300049570 | Bacteria | 7038 |
| 903 | Ga0501034_0004012 | 3300049571 | Bacteria | 16517 |
| 904 | Ga0501034_0016530 | 3300049571 | Bacteria | 7567 |
| 905 | Ga0501034_0025459 | 3300049571 | Bacteria | 6024 |
| 906 | Ga0501034_0027052 | 3300049571 | Bacteria | 5835 |
| 907 | Ga0501034_0146271 | 3300049571 | Bacteria | 2340 |
| 908 | Ga0501034_0330791 | 3300049571 | Unclassified | 1455 |
| 909 | Ga0501036_0041913 | 3300049572 | Bacteria | 3874 |
| 910 | Ga0501037_0039086 | 3300049573 | Bacteria | 3494 |
| 911 | Ga0501038_0012291 | 3300049574 | Bacteria | 7820 |
| 912 | Ga0501039_0022501 | 3300049575 | Bacteria | 4838 |
| 913 | Ga0501043_0009607 | 3300049579 | Bacteria | 7578 |
| 914 | Ga0501043_0024314 | 3300049579 | Bacteria | 4754 |
| 915 | Ga0501043_0028424 | 3300049579 | Bacteria | 4390 |
| 916 | Ga0501046_0024666 | 3300049580 | Bacteria | 4928 |
| 917 | Ga0501046_0045170 | 3300049580 | Bacteria | 3501 |
| 918 | Ga0501046_0239907 | 3300049580 | Bacteria | 1337 |
| 919 | Ga0501047_0021075 | 3300049581 | Bacteria | 6258 |
| 920 | Ga0501047_0027231 | 3300049581 | Bacteria | 5506 |
| 921 | Ga0501047_0066956 | 3300049581 | Bacteria | 3462 |
| 922 | Ga0501047_0072959 | 3300049581 | Bacteria | 3304 |
| 923 | Ga0501047_0332711 | 3300049581 | Unclassified | 1357 |
| 924 | Ga0501048_0043141 | 3300049582 | Bacteria | 3229 |
| 925 | Ga0501067_0095409 | 3300049583 | Bacteria | 1651 |
| 926 | Ga0501068_0153904 | 3300049584 | Unclassified | 1446 |
| 927 | Ga0501069_0081356 | 3300049585 | Unclassified | 1824 |
| 928 | Ga0501073_0019693 | 3300049589 | Bacteria | 4870 |
| 929 | Ga0501074_0062516 | 3300049590 | Bacteria | 2681 |
| 930 | Ga0501198_002157 | 3300049649 | Unclassified | 2629 |
| 931 | Ga0501202_002208 | 3300049652 | Unclassified | 3247 |
| 932 | Ga0501217_000620 | 3300049661 | Bacteria | 5983 |
| 933 | Ga0501217_022688 | 3300049661 | Bacteria | 1491 |
| 934 | Ga0501233_010478 | 3300049668 | Unclassified | 1827 |
| 935 | Ga0501243_008416 | 3300049675 | Bacteria | 1589 |
| 936 | Ga0501249_000037 | 3300049679 | Bacteria | 63492 |
| 937 | Ga0501249_008390 | 3300049679 | Bacteria | 2145 |
| 938 | Ga0501249_008602 | 3300049679 | Bacteria | 2118 |
| 939 | Ga0501249_009305 | 3300049679 | Bacteria | 2044 |
| 940 | Ga0501257_016312 | 3300049686 | Bacteria | 1722 |
| 941 | Ga0501219_000052 | 3300049703 | Bacteria | 18661 |
| 942 | Ga0501221_000044 | 3300049704 | Bacteria | 12905 |
| 943 | Ga0501225_0001739 | 3300049705 | Bacteria | 6824 |
| 944 | Ga0501225_0013111 | 3300049705 | Unclassified | 2321 |
| 945 | Ga0501245_002249 | 3300049708 | Unclassified | 2571 |
| 946 | Ga0501080_0057861 | 3300049742 | Bacteria | 3608 |
| 947 | Ga0501080_0123580 | 3300049742 | Bacteria | 2398 |
| 948 | Ga0501241_000031 | 3300049758 | Bacteria | 52001 |
| 949 | Ga0501266_000011 | 3300049763 | Bacteria | 197280 |
| 950 | Ga0501035_0015438 | 3300049822 | Bacteria | 7045 |
| 951 | Ga0501035_0027505 | 3300049822 | Bacteria | 5198 |
| 952 | Ga0501044_0009636 | 3300049823 | Bacteria | 10510 |
| 953 | Ga0501044_0017840 | 3300049823 | Bacteria | 7614 |
| 954 | Ga0501044_0028924 | 3300049823 | Bacteria | 5845 |
| 955 | Ga0501044_0052694 | 3300049823 | Bacteria | 4191 |
| 956 | Ga0501284_00029 | 3300050005 | Bacteria | 74818 |
| 957 | nmdc:mga0k408_3518_c1 | 3300050493 | Bacteria | 8279 |
| 958 | nmdc:mga0k408_41458_c1 | 3300050493 | Bacteria | 2232 |
| 959 | nmdc:mga0k408_749_c1 | 3300050493 | Bacteria | 17824 |
| 960 | nmdc:mga0k408_821_c1 | 3300050493 | Bacteria | 17147 |
| 961 | nmdc:mga05p37_13616_c1 | 3300050507 | Bacteria | 9747 |
| 962 | nmdc:mga09592_983_c1 | 3300050508 | Bacteria | 22557 |
| 963 | nmdc:mga0qj67_97741_c1 | 3300050509 | Bacteria | 2365 |
| 964 | Ga0500635_0002671 | 3300053080 | Bacteria | 4424 |
| 965 | Ga0495619_0170484 | 3300053085 | Bacteria | 1505 |
| 966 | Ga0500578_0004418 | 3300053086 | Bacteria | 9905 |
| 967 | Ga0500646_0001428 | 3300053090 | Bacteria | 6341 |
| 968 | Ga0500646_0004317 | 3300053090 | Bacteria | 3602 |
| 969 | Ga0500583_0000108 | 3300053092 | Bacteria | 41760 |
| 970 | Ga0500651_0000084 | 3300053093 | Bacteria | 60127 |
| 971 | Ga0500651_0064350 | 3300053093 | Bacteria | 2287 |
| 972 | Ga0500641_0000017 | 3300053096 | Bacteria | 132678 |
| 973 | Ga0500641_0002621 | 3300053096 | Bacteria | 6345 |
| 974 | Ga0500594_0003311 | 3300053118 | Bacteria | 3528 |
| 975 | Ga0500608_016279 | 3300053122 | Bacteria | 3356 |
| 976 | Ga0500618_000002 | 3300053125 | Bacteria | 370822 |
| 977 | Ga0500652_037526 | 3300053131 | Bacteria | 1934 |
| 978 | Ga0500658_0000003 | 3300053134 | Bacteria | 512506 |
| 979 | Ga0500589_003337 | 3300053147 | Bacteria | 5739 |
| 980 | Ga0500616_0145895 | 3300053153 | Bacteria | 1101 |
| 981 | Ga0500622_0000777 | 3300053156 | Bacteria | 27709 |
| 982 | Ga0500622_0004557 | 3300053156 | Bacteria | 8641 |
| 983 | Ga0500624_000271 | 3300053157 | Bacteria | 17926 |
| 984 | Ga0500636_0044658 | 3300053177 | Bacteria | 2613 |
| 985 | Ga0500584_014924 | 3300053726 | Bacteria | 3565 |
| 986 | Ga0500611_000022 | 3300053727 | Bacteria | 102349 |
| 987 | Ga0466962_0023524 | 3300061719 | Bacteria | 2961 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009092 | Ga0105250_10040141 | Ga0105250_100401411 | 285 |
| 2 | 3300042007 | Ga0439449_0000697 | Ga0439449_0000697_249_1172 | 292 |
| 3 | 3300042876 | Ga0451577_0011492 | Ga0451577_0011492_2550_3614 | 300 |
| 4 | 3300042876 | Ga0451577_0370719 | Ga0451577_0370719_185_1249 | 309 |
| 5 | 3300049580 | Ga0501046_0024666 | Ga0501046_0024666_3324_4367 | 309 |
| 6 | 3300049823 | Ga0501044_0009636 | Ga0501044_0009636_1257_2300 | 309 |
| 7 | 3300025938 | Ga0207704_10000099 | Ga0207704_1000009913 | 312 |
| 8 | 3300006946 | Ga0079104_1000005 | Ga0079104_10000059 | 314 |
| 9 | 3300027111 | Ga0209281_1000094 | Ga0209281_100009410 | 314 |
| 10 | 3300026088 | Ga0207641_10153753 | Ga0207641_101537532 | 316 |
| 11 | 3300006237 | Ga0097621_100164744 | Ga0097621_1001647442 | 317 |
| 12 | 3300003322 | rootL2_10058669 | rootL2_100586694 | 319 |
| 13 | 3300005614 | Ga0068856_100207105 | Ga0068856_1002071052 | 319 |
| 14 | 3300025911 | Ga0207654_10047242 | Ga0207654_100472422 | 319 |
| 15 | 3300025914 | Ga0207671_10002907 | Ga0207671_100029075 | 319 |
| 16 | 3300026078 | Ga0207702_10074879 | Ga0207702_100748792 | 319 |
| 17 | 3300013102 | Ga0157371_10001161 | Ga0157371_100011619 | 320 |
| 18 | 3300013104 | Ga0157370_10017596 | Ga0157370_100175964 | 320 |
| 19 | 3300013105 | Ga0157369_10086419 | Ga0157369_100864192 | 320 |
| 20 | 3300032004 | Ga0307414_10000009 | Ga0307414_10000009164 | 322 |
| 21 | iso_pu_bacteria | 2523533629 | 2524004500 | 326 |
| 22 | 3300017792 | Ga0163161_10020644 | Ga0163161_100206445 | 327 |
| 23 | 3300037312 | Ga0395899_0000025 | Ga0395899_0000025_225669_226733 | 327 |
| 24 | 3300037418 | Ga0395900_0108003 | Ga0395900_0108003_1418_2482 | 327 |
| 25 | 3300042876 | Ga0451577_0214216 | Ga0451577_0214216_523_1554 | 327 |
| 26 | 3300044712 | Ga0453684_0009766 | Ga0453684_0009766_2827_3858 | 327 |
| 27 | 3300045051 | Ga0451576_0007064 | Ga0451576_0007064_11080_12111 | 327 |
| 28 | 3300050493 | nmdc:mga0k408_41458_c1 | nmdc:mga0k408_41458_c1_12_1043 | 327 |
| 29 | iso_pu_bacteria | 2511231000 | 2511234750 | 327 |
| 30 | iso_pu_bacteria | 2582581281 | 2585158508 | 327 |
| 31 | iso_pu_bacteria | 2582581282 | 2585162854 | 327 |
| 32 | 3300003323 | rootH1_10035284 | rootH1_1003528414 | 328 |
| 33 | 3300005289 | Ga0065704_10083999 | Ga0065704_100839992 | 328 |
| 34 | 3300005329 | Ga0070683_100030965 | Ga0070683_1000309655 | 328 |
| 35 | 3300015261 | Ga0182006_1000011 | Ga0182006_1000011243 | 328 |
| 36 | 3300025291 | Ga0209675_1000033 | Ga0209675_100003313 | 328 |
| 37 | 3300027876 | Ga0209974_10017789 | Ga0209974_100177892 | 328 |
| 38 | 3300046512 | Ga0495610_0000001 | Ga0495610_0000001_1448439_1449470 | 328 |
| 39 | 3300046660 | Ga0495625_0043637 | Ga0495625_0043637_1461_2597 | 328 |
| 40 | iso_pu_bacteria | 2513020052 | 2513235060 | 328 |
| 41 | iso_pu_bacteria | 2643221600 | 2644013061 | 328 |
| 42 | iso_pu_bacteria | 2643221667 | 2644372379 | 328 |
| 43 | iso_pu_bacteria | 2643221725 | 2644684851 | 328 |
| 44 | iso_pu_bacteria | 2738541279 | 2738732463 | 328 |
| 45 | iso_pu_bacteria | 2738541285 | 2738765028 | 328 |
| 46 | iso_pu_bacteria | 2738543007 | 2739214043 | 328 |
| 47 | iso_pu_bacteria | 2739367857 | 2740001323 | 328 |
| 48 | iso_pu_bacteria | 2739367858 | 2740006139 | 328 |
| 49 | iso_pu_bacteria | 2802428842 | 2802653773 | 328 |
| 50 | iso_pu_bacteria | 2881359912 | 2881363107 | 328 |
| 51 | iso_pu_bacteria | 2919683626 | 2919685973 | 328 |
| 52 | iso_pu_bacteria | 2929150217 | 2929153564 | 328 |
| 53 | iso_pu_bacteria | 2977268062 | 2977270228 | 328 |
| 54 | 3300048918 | Ga0496115_0007421 | Ga0496115_0007421_2267_3298 | 329 |
| 55 | iso_pu_bacteria | 2519899754 | 2520879408 | 329 |
| 56 | iso_pu_bacteria | 2585427687 | 2586210050 | 329 |
| 57 | iso_pu_bacteria | 2643221716 | 2644642605 | 329 |
| 58 | iso_pu_bacteria | 2738541283 | 2738757065 | 329 |
| 59 | iso_pu_bacteria | 2738541284 | 2738760402 | 329 |
| 60 | iso_pu_bacteria | 2738541302 | 2738851781 | 329 |
| 61 | iso_pu_bacteria | 2738543023 | 2739302549 | 329 |
| 62 | iso_pu_bacteria | 2739367651 | 2739590671 | 329 |
| 63 | iso_pu_bacteria | 2739367656 | 2739617093 | 329 |
| 64 | iso_pu_bacteria | 2739367663 | 2739647398 | 329 |
| 65 | iso_pu_bacteria | 2775506987 | 2776612453 | 329 |
| 66 | iso_pu_bacteria | 2816332280 | 2817416276 | 329 |
| 67 | iso_pu_bacteria | 2818991437 | 2819546345 | 329 |
| 68 | iso_pu_bacteria | 2842722452 | 2842725022 | 329 |
| 69 | iso_pu_bacteria | 2842909656 | 2842914186 | 329 |
| 70 | iso_pu_bacteria | 2849281842 | 2849286580 | 329 |
| 71 | iso_pu_bacteria | 2852627209 | 2852630368 | 329 |
| 72 | iso_pu_bacteria | 2857613821 | 2857614954 | 329 |
| 73 | iso_pu_bacteria | 2857618242 | 2857618658 | 329 |
| 74 | iso_pu_bacteria | 2857627736 | 2857630290 | 329 |
| 75 | iso_pu_bacteria | 2903895155 | 2903896890 | 329 |
| 76 | iso_pu_bacteria | 2904419702 | 2904422793 | 329 |
| 77 | iso_pu_bacteria | 2904445276 | 2904448666 | 329 |
| 78 | iso_pu_bacteria | 2904555929 | 2904557071 | 329 |
| 79 | iso_pu_bacteria | 2919186247 | 2919189655 | 329 |
| 80 | iso_pu_bacteria | 2919191525 | 2919195305 | 329 |
| 81 | iso_pu_bacteria | 2939664404 | 2939667881 | 329 |
| 82 | iso_pu_bacteria | 2945997725 | 2946001964 | 329 |
| 83 | iso_pu_bacteria | 2954016120 | 2954018848 | 329 |
| 84 | iso_pu_bacteria | 2958458903 | 2958461118 | 329 |
| 85 | iso_pu_bacteria | 8054307821 | 8054310082 | 329 |
| 86 | iso_pu_bacteria | 8055419101 | 8055421935 | 329 |
| 87 | iso_pu_bacteria | 8055592153 | 8055593425 | 329 |
| 88 | iso_pu_bacteria | 8056440228 | 8056443836 | 329 |
| 89 | 3300003323 | rootH1_10298335 | rootH1_102983353 | 330 |
| 90 | 3300003578 | Ga0006562J51391_1016454 | Ga0006562J51391_10164542 | 330 |
| 91 | 3300005288 | Ga0065714_10107284 | Ga0065714_101072841 | 330 |
| 92 | 3300005288 | Ga0065714_10109461 | Ga0065714_101094611 | 330 |
| 93 | 3300006948 | Ga0099826_10126639 | Ga0099826_101266391 | 330 |
| 94 | 3300009036 | Ga0105244_10000063 | Ga0105244_1000006322 | 330 |
| 95 | 3300013100 | Ga0157373_10000002 | Ga0157373_10000002528 | 330 |
| 96 | 3300013102 | Ga0157371_10005312 | Ga0157371_100053128 | 330 |
| 97 | 3300013104 | Ga0157370_10006435 | Ga0157370_100064353 | 330 |
| 98 | 3300013104 | Ga0157370_10007484 | Ga0157370_100074846 | 330 |
| 99 | 3300013104 | Ga0157370_10014665 | Ga0157370_100146653 | 330 |
| 100 | 3300013105 | Ga0157369_10001138 | Ga0157369_1000113818 | 330 |
| 101 | 3300015261 | Ga0182006_1001882 | Ga0182006_10018827 | 330 |
| 102 | 3300017792 | Ga0163161_10000012 | Ga0163161_1000001247 | 330 |
| 103 | 3300027471 | Ga0209995_1001337 | Ga0209995_10013374 | 330 |
| 104 | 3300027526 | Ga0209968_1002355 | Ga0209968_10023553 | 330 |
| 105 | 3300027617 | Ga0210002_1001420 | Ga0210002_10014202 | 330 |
| 106 | 3300027666 | Ga0209282_1106414 | Ga0209282_11064142 | 330 |
| 107 | 3300031548 | Ga0307408_100002250 | Ga0307408_1000022507 | 330 |
| 108 | 3300031824 | Ga0307413_10115686 | Ga0307413_101156863 | 330 |
| 109 | 3300031824 | Ga0307413_10143113 | Ga0307413_101431132 | 330 |
| 110 | 3300031852 | Ga0307410_10000067 | Ga0307410_100000675 | 330 |
| 111 | 3300031901 | Ga0307406_10000035 | Ga0307406_1000003545 | 330 |
| 112 | 3300031903 | Ga0307407_10063361 | Ga0307407_100633612 | 330 |
| 113 | 3300032002 | Ga0307416_100000639 | Ga0307416_1000006394 | 330 |
| 114 | 3300032004 | Ga0307414_10000063 | Ga0307414_1000006331 | 330 |
| 115 | 3300032004 | Ga0307414_10004631 | Ga0307414_100046314 | 330 |
| 116 | 3300032004 | Ga0307414_10008231 | Ga0307414_100082317 | 330 |
| 117 | 3300032005 | Ga0307411_10000001 | Ga0307411_10000001449 | 330 |
| 118 | 3300033180 | Ga0307510_10041880 | Ga0307510_100418803 | 330 |
| 119 | 3300041407 | Ga0439447_011193 | Ga0439447_011193_725_1771 | 330 |
| 120 | 3300041411 | Ga0439466_0001850 | Ga0439466_0001850_1774_2823 | 330 |
| 121 | 3300044712 | Ga0453684_0072910 | Ga0453684_0072910_1717_2787 | 330 |
| 122 | 3300048919 | Ga0496116_0000032 | Ga0496116_0000032_144151_145197 | 330 |
| 123 | 3300048924 | Ga0496121_0091005 | Ga0496121_0091005_105_1151 | 330 |
| 124 | 3300048927 | Ga0496124_0126449 | Ga0496124_0126449_197_1243 | 330 |
| 125 | 3300048928 | Ga0496125_0000059 | Ga0496125_0000059_143133_144182 | 330 |
| 126 | 3300048929 | Ga0496126_0008790 | Ga0496126_0008790_7189_8232 | 330 |
| 127 | 3300049679 | Ga0501249_000037 | Ga0501249_000037_34818_35864 | 330 |
| 128 | 3300049679 | Ga0501249_008602 | Ga0501249_008602_642_1688 | 330 |
| 129 | 3300049763 | Ga0501266_000011 | Ga0501266_000011_185778_186824 | 330 |
| 130 | 3300053090 | Ga0500646_0004317 | Ga0500646_0004317_2400_3446 | 330 |
| 131 | 3300053096 | Ga0500641_0000017 | Ga0500641_0000017_113452_114498 | 330 |
| 132 | 3300053096 | Ga0500641_0002621 | Ga0500641_0002621_2861_3907 | 330 |
| 133 | 3300053118 | Ga0500594_0003311 | Ga0500594_0003311_205_1251 | 330 |
| 134 | 3300053134 | Ga0500658_0000003 | Ga0500658_0000003_165562_166611 | 330 |
| 135 | 3300053726 | Ga0500584_014924 | Ga0500584_014924_1975_3021 | 330 |
| 136 | iso_pu_bacteria | 2599185184 | 2599478340 | 330 |
| 137 | iso_pu_bacteria | 2818991444 | 2819588775 | 330 |
| 138 | iso_pu_bacteria | 2833640130 | 2833643626 | 330 |
| 139 | iso_pu_bacteria | 2852623160 | 2852623164 | 330 |
| 140 | iso_pu_bacteria | 2884791551 | 2884795632 | 330 |
| 141 | iso_pu_bacteria | 2884933994 | 2884937971 | 330 |
| 142 | iso_pu_bacteria | 2919437846 | 2919440792 | 330 |
| 143 | iso_pu_bacteria | 2928078545 | 2928080610 | 330 |
| 144 | iso_pu_bacteria | 2928147474 | 2928150835 | 330 |
| 145 | iso_pu_bacteria | 2929177148 | 2929178797 | 330 |
| 146 | iso_pu_bacteria | 2932082852 | 2932083005 | 330 |
| 147 | iso_pu_bacteria | 2945977869 | 2945981199 | 330 |
| 148 | iso_pu_bacteria | 2946013367 | 2946019399 | 330 |
| 149 | iso_pu_bacteria | 2977232053 | 2977232530 | 330 |
| 150 | iso_pu_bacteria | 8003151029 | 8003153679 | 330 |
| 151 | 3300028800 | Ga0265338_10001687 | Ga0265338_100016879 | 331 |
| 152 | 3300042876 | Ga0451577_0097018 | Ga0451577_0097018_1151_2188 | 331 |
| 153 | 3300044712 | Ga0453684_0097891 | Ga0453684_0097891_1090_2124 | 331 |
| 154 | 3300045051 | Ga0451576_0027120 | Ga0451576_0027120_171_1208 | 331 |
| 155 | 3300048917 | Ga0496114_0000594 | Ga0496114_0000594_320_1357 | 331 |
| 156 | iso_pu_bacteria | 2842903701 | 2842908876 | 331 |
| 157 | iso_pu_bacteria | 2884634485 | 2884635381 | 331 |
| 158 | iso_pu_bacteria | 2914759650 | 2914759720 | 331 |
| 159 | iso_pu_bacteria | 2919692658 | 2919695677 | 331 |
| 160 | 3300005337 | Ga0070682_100241275 | Ga0070682_1002412751 | 332 |
| 161 | 3300005563 | Ga0068855_100000240 | Ga0068855_1000002404 | 332 |
| 162 | 3300005616 | Ga0068852_100151779 | Ga0068852_1001517792 | 332 |
| 163 | 3300009093 | Ga0105240_10108377 | Ga0105240_101083773 | 332 |
| 164 | 3300009174 | Ga0105241_10170979 | Ga0105241_101709791 | 332 |
| 165 | 3300013296 | Ga0157374_10297505 | Ga0157374_102975052 | 332 |
| 166 | 3300013306 | Ga0163162_10029333 | Ga0163162_100293333 | 332 |
| 167 | 3300013308 | Ga0157375_10205722 | Ga0157375_102057222 | 332 |
| 168 | 3300014326 | Ga0157380_10162904 | Ga0157380_101629042 | 332 |
| 169 | 3300025931 | Ga0207644_10168342 | Ga0207644_101683422 | 332 |
| 170 | 3300025949 | Ga0207667_10000037 | Ga0207667_10000037129 | 332 |
| 171 | 3300026121 | Ga0207683_10057036 | Ga0207683_100570364 | 332 |
| 172 | 3300028794 | Ga0307515_10000681 | Ga0307515_1000068157 | 332 |
| 173 | 3300028794 | Ga0307515_10081729 | Ga0307515_100817294 | 332 |
| 174 | 3300028794 | Ga0307515_10093645 | Ga0307515_100936453 | 332 |
| 175 | 3300028794 | Ga0307515_10229784 | Ga0307515_102297842 | 332 |
| 176 | 3300031727 | Ga0316576_10075969 | Ga0316576_100759692 | 332 |
| 177 | 3300031728 | Ga0316578_10057826 | Ga0316578_100578262 | 332 |
| 178 | 3300035695 | Ga0373927_0005849 | Ga0373927_0005849_7132_8175 | 332 |
| 179 | 3300036647 | Ga0316582_0060474 | Ga0316582_0060474_1269_2336 | 332 |
| 180 | 3300036712 | Ga0316584_0027245 | Ga0316584_0027245_2029_3078 | 332 |
| 181 | 3300036712 | Ga0316584_0122674 | Ga0316584_0122674_489_1556 | 332 |
| 182 | 2162886007 | SwRhRL2b_contig_787417 | SwRhRL2b_0404.00004120 | 333 |
| 183 | 3300001904 | JGI24736J21556_1003139 | JGI24736J21556_10031392 | 333 |
| 184 | 3300001979 | JGI24740J21852_10020774 | JGI24740J21852_100207741 | 333 |
| 185 | 3300001990 | JGI24737J22298_10007120 | JGI24737J22298_100071203 | 333 |
| 186 | 3300002067 | JGI24735J21928_10000004 | JGI24735J21928_1000000496 | 333 |
| 187 | 3300002737 | JGI25162J39368_1000011 | JGI25162J39368_1000011117 | 333 |
| 188 | 3300002737 | JGI25162J39368_1000614 | JGI25162J39368_10006145 | 333 |
| 189 | 3300002738 | JGI25154J39366_1000040 | JGI25154J39366_100004022 | 333 |
| 190 | 3300002741 | JGI25157J39369_1003731 | JGI25157J39369_10037312 | 333 |
| 191 | 3300002741 | JGI25157J39369_1004254 | JGI25157J39369_10042542 | 333 |
| 192 | 3300002772 | JGI25164J39214_1003371 | JGI25164J39214_10033712 | 333 |
| 193 | 3300002773 | JGI25152J39213_1000143 | JGI25152J39213_100014354 | 333 |
| 194 | 3300002774 | JGI25150J39212_1000001 | JGI25150J39212_1000001466 | 333 |
| 195 | 3300003187 | JGI25151J46595_10000001 | JGI25151J46595_10000001336 | 333 |
| 196 | 3300003214 | JGI25165J46597_1000985 | JGI25165J46597_10009859 | 333 |
| 197 | 3300003215 | JGI25153J46596_10000001 | JGI25153J46596_10000001225 | 333 |
| 198 | 3300003215 | JGI25153J46596_10003346 | JGI25153J46596_100033466 | 333 |
| 199 | 3300003316 | rootH1_10024829 | rootH1_1002482915 | 333 |
| 200 | 3300003316 | rootH1_10063239 | rootH1_100632395 | 333 |
| 201 | 3300003316 | rootH1_10140822 | rootH1_101408222 | 333 |
| 202 | 3300003320 | rootH2_10001891 | rootH2_10001891197 | 333 |
| 203 | 3300003320 | rootH2_10003679 | rootH2_100036794 | 333 |
| 204 | 3300003320 | rootH2_10013742 | rootH2_100137428 | 333 |
| 205 | 3300003320 | rootH2_10053227 | rootH2_100532273 | 333 |
| 206 | 3300003320 | rootH2_10090920 | rootH2_100909203 | 333 |
| 207 | 3300003320 | rootH2_10184838 | rootH2_101848382 | 333 |
| 208 | 3300003322 | rootL2_10017790 | rootL2_100177904 | 333 |
| 209 | 3300003322 | rootL2_10028141 | rootL2_100281412 | 333 |
| 210 | 3300003322 | rootL2_10030620 | rootL2_100306201 | 333 |
| 211 | 3300003322 | rootL2_10107720 | rootL2_101077204 | 333 |
| 212 | 3300003322 | rootL2_10223865 | rootL2_102238652 | 333 |
| 213 | 3300003322 | rootL2_10315621 | rootL2_103156212 | 333 |
| 214 | 3300003323 | rootH1_10000019 | rootH1_100000193 | 333 |
| 215 | 3300003323 | rootH1_10008801 | rootH1_100088019 | 333 |
| 216 | 3300003323 | rootH1_10054491 | rootH1_100544912 | 333 |
| 217 | 3300003323 | rootH1_10163486 | rootH1_101634862 | 333 |
| 218 | 3300003323 | rootH1_10178453 | rootH1_101784532 | 333 |
| 219 | 3300003354 | JGI25160J50197_1006644 | JGI25160J50197_10066443 | 333 |
| 220 | 3300003781 | Ga0055536_1000001 | Ga0055536_1000001272 | 333 |
| 221 | 3300003791 | Ga0055530_10004772 | Ga0055530_100047724 | 333 |
| 222 | 3300003794 | Ga0055531_10000131 | Ga0055531_1000013141 | 333 |
| 223 | 3300005262 | Ga0065165_1000300 | Ga0065165_100030071 | 333 |
| 224 | 3300005288 | Ga0065714_10003545 | Ga0065714_100035456 | 333 |
| 225 | 3300005288 | Ga0065714_10004089 | Ga0065714_100040899 | 333 |
| 226 | 3300005288 | Ga0065714_10010706 | Ga0065714_100107062 | 333 |
| 227 | 3300005288 | Ga0065714_10064863 | Ga0065714_1006486315 | 333 |
| 228 | 3300005288 | Ga0065714_10067358 | Ga0065714_100673584 | 333 |
| 229 | 3300005288 | Ga0065714_10099861 | Ga0065714_100998612 | 333 |
| 230 | 3300005289 | Ga0065704_10000210 | Ga0065704_100002104 | 333 |
| 231 | 3300005290 | Ga0065712_10008583 | Ga0065712_100085832 | 333 |
| 232 | 3300005290 | Ga0065712_10124654 | Ga0065712_101246542 | 333 |
| 233 | 3300005293 | Ga0065715_10004221 | Ga0065715_100042215 | 333 |
| 234 | 3300005327 | Ga0070658_10000049 | Ga0070658_1000004921 | 333 |
| 235 | 3300005327 | Ga0070658_10031135 | Ga0070658_100311352 | 333 |
| 236 | 3300005327 | Ga0070658_10101229 | Ga0070658_101012292 | 333 |
| 237 | 3300005328 | Ga0070676_10000336 | Ga0070676_100003369 | 333 |
| 238 | 3300005328 | Ga0070676_10026339 | Ga0070676_100263391 | 333 |
| 239 | 3300005329 | Ga0070683_100032467 | Ga0070683_1000324673 | 333 |
| 240 | 3300005329 | Ga0070683_100067205 | Ga0070683_1000672052 | 333 |
| 241 | 3300005330 | Ga0070690_100012862 | Ga0070690_1000128622 | 333 |
| 242 | 3300005331 | Ga0070670_100033933 | Ga0070670_1000339332 | 333 |
| 243 | 3300005331 | Ga0070670_100034230 | Ga0070670_1000342302 | 333 |
| 244 | 3300005331 | Ga0070670_100086541 | Ga0070670_1000865412 | 333 |
| 245 | 3300005331 | Ga0070670_100181544 | Ga0070670_1001815441 | 333 |
| 246 | 3300005331 | Ga0070670_100435816 | Ga0070670_1004358161 | 333 |
| 247 | 3300005333 | Ga0070677_10014143 | Ga0070677_100141432 | 333 |
| 248 | 3300005334 | Ga0068869_100039400 | Ga0068869_1000394003 | 333 |
| 249 | 3300005335 | Ga0070666_10002847 | Ga0070666_100028478 | 333 |
| 250 | 3300005335 | Ga0070666_10056865 | Ga0070666_100568652 | 333 |
| 251 | 3300005336 | Ga0070680_100015517 | Ga0070680_1000155174 | 333 |
| 252 | 3300005336 | Ga0070680_100171020 | Ga0070680_1001710202 | 333 |
| 253 | 3300005337 | Ga0070682_100001275 | Ga0070682_10000127510 | 333 |
| 254 | 3300005337 | Ga0070682_100119478 | Ga0070682_1001194781 | 333 |
| 255 | 3300005338 | Ga0068868_100004138 | Ga0068868_1000041388 | 333 |
| 256 | 3300005338 | Ga0068868_100008530 | Ga0068868_1000085303 | 333 |
| 257 | 3300005338 | Ga0068868_100011418 | Ga0068868_1000114182 | 333 |
| 258 | 3300005338 | Ga0068868_100015143 | Ga0068868_1000151433 | 333 |
| 259 | 3300005338 | Ga0068868_100020344 | Ga0068868_1000203442 | 333 |
| 260 | 3300005339 | Ga0070660_100027944 | Ga0070660_1000279442 | 333 |
| 261 | 3300005339 | Ga0070660_100043577 | Ga0070660_1000435773 | 333 |
| 262 | 3300005339 | Ga0070660_100171259 | Ga0070660_1001712591 | 333 |
| 263 | 3300005341 | Ga0070691_10004326 | Ga0070691_100043266 | 333 |
| 264 | 3300005344 | Ga0070661_100023944 | Ga0070661_1000239443 | 333 |
| 265 | 3300005344 | Ga0070661_100043909 | Ga0070661_1000439093 | 333 |
| 266 | 3300005347 | Ga0070668_100004446 | Ga0070668_1000044468 | 333 |
| 267 | 3300005353 | Ga0070669_100018155 | Ga0070669_1000181554 | 333 |
| 268 | 3300005354 | Ga0070675_100015326 | Ga0070675_1000153266 | 333 |
| 269 | 3300005354 | Ga0070675_100016332 | Ga0070675_1000163325 | 333 |
| 270 | 3300005354 | Ga0070675_100027340 | Ga0070675_1000273401 | 333 |
| 271 | 3300005354 | Ga0070675_100044109 | Ga0070675_1000441093 | 333 |
| 272 | 3300005354 | Ga0070675_100268887 | Ga0070675_1002688871 | 333 |
| 273 | 3300005355 | Ga0070671_100046891 | Ga0070671_1000468912 | 333 |
| 274 | 3300005355 | Ga0070671_100159729 | Ga0070671_1001597292 | 333 |
| 275 | 3300005364 | Ga0070673_100004993 | Ga0070673_1000049931 | 333 |
| 276 | 3300005364 | Ga0070673_100016856 | Ga0070673_1000168566 | 333 |
| 277 | 3300005364 | Ga0070673_100026479 | Ga0070673_1000264792 | 333 |
| 278 | 3300005364 | Ga0070673_100035251 | Ga0070673_1000352512 | 333 |
| 279 | 3300005365 | Ga0070688_100001700 | Ga0070688_1000017003 | 333 |
| 280 | 3300005366 | Ga0070659_100006699 | Ga0070659_1000066996 | 333 |
| 281 | 3300005366 | Ga0070659_100047474 | Ga0070659_1000474744 | 333 |
| 282 | 3300005366 | Ga0070659_100069713 | Ga0070659_1000697132 | 333 |
| 283 | 3300005366 | Ga0070659_100244848 | Ga0070659_1002448482 | 333 |
| 284 | 3300005367 | Ga0070667_100000492 | Ga0070667_10000049223 | 333 |
| 285 | 3300005367 | Ga0070667_100001349 | Ga0070667_10000134914 | 333 |
| 286 | 3300005367 | Ga0070667_100048526 | Ga0070667_1000485264 | 333 |
| 287 | 3300005455 | Ga0070663_100001195 | Ga0070663_10000119511 | 333 |
| 288 | 3300005455 | Ga0070663_100081084 | Ga0070663_1000810842 | 333 |
| 289 | 3300005455 | Ga0070663_100271155 | Ga0070663_1002711551 | 333 |
| 290 | 3300005456 | Ga0070678_100001813 | Ga0070678_1000018135 | 333 |
| 291 | 3300005456 | Ga0070678_100107493 | Ga0070678_1001074932 | 333 |
| 292 | 3300005457 | Ga0070662_100000045 | Ga0070662_10000004525 | 333 |
| 293 | 3300005457 | Ga0070662_100025109 | Ga0070662_1000251093 | 333 |
| 294 | 3300005457 | Ga0070662_100096983 | Ga0070662_1000969832 | 333 |
| 295 | 3300005458 | Ga0070681_10018316 | Ga0070681_100183164 | 333 |
| 296 | 3300005458 | Ga0070681_10029313 | Ga0070681_100293136 | 333 |
| 297 | 3300005458 | Ga0070681_10040763 | Ga0070681_100407633 | 333 |
| 298 | 3300005459 | Ga0068867_100004573 | Ga0068867_1000045732 | 333 |
| 299 | 3300005459 | Ga0068867_100036004 | Ga0068867_1000360043 | 333 |
| 300 | 3300005459 | Ga0068867_100060265 | Ga0068867_1000602652 | 333 |
| 301 | 3300005459 | Ga0068867_100333504 | Ga0068867_1003335041 | 333 |
| 302 | 3300005466 | Ga0070685_10002206 | Ga0070685_100022064 | 333 |
| 303 | 3300005466 | Ga0070685_10005910 | Ga0070685_100059102 | 333 |
| 304 | 3300005466 | Ga0070685_10027809 | Ga0070685_100278092 | 333 |
| 305 | 3300005466 | Ga0070685_10077516 | Ga0070685_100775162 | 333 |
| 306 | 3300005530 | Ga0070679_100004536 | Ga0070679_1000045363 | 333 |
| 307 | 3300005530 | Ga0070679_100006277 | Ga0070679_1000062779 | 333 |
| 308 | 3300005530 | Ga0070679_100008873 | Ga0070679_1000088732 | 333 |
| 309 | 3300005530 | Ga0070679_100127028 | Ga0070679_1001270282 | 333 |
| 310 | 3300005535 | Ga0070684_100035368 | Ga0070684_1000353682 | 333 |
| 311 | 3300005535 | Ga0070684_100042359 | Ga0070684_1000423592 | 333 |
| 312 | 3300005535 | Ga0070684_100127303 | Ga0070684_1001273032 | 333 |
| 313 | 3300005535 | Ga0070684_100132672 | Ga0070684_1001326722 | 333 |
| 314 | 3300005539 | Ga0068853_100003018 | Ga0068853_10000301814 | 333 |
| 315 | 3300005539 | Ga0068853_100008065 | Ga0068853_1000080653 | 333 |
| 316 | 3300005539 | Ga0068853_100008667 | Ga0068853_1000086676 | 333 |
| 317 | 3300005539 | Ga0068853_100013120 | Ga0068853_1000131209 | 333 |
| 318 | 3300005539 | Ga0068853_100022472 | Ga0068853_1000224722 | 333 |
| 319 | 3300005539 | Ga0068853_100057348 | Ga0068853_1000573482 | 333 |
| 320 | 3300005539 | Ga0068853_100139186 | Ga0068853_1001391862 | 333 |
| 321 | 3300005539 | Ga0068853_100301937 | Ga0068853_1003019372 | 333 |
| 322 | 3300005543 | Ga0070672_100001489 | Ga0070672_1000014894 | 333 |
| 323 | 3300005543 | Ga0070672_100055232 | Ga0070672_1000552322 | 333 |
| 324 | 3300005543 | Ga0070672_100083317 | Ga0070672_1000833172 | 333 |
| 325 | 3300005543 | Ga0070672_100090358 | Ga0070672_1000903581 | 333 |
| 326 | 3300005543 | Ga0070672_100156349 | Ga0070672_1001563492 | 333 |
| 327 | 3300005544 | Ga0070686_100032891 | Ga0070686_1000328911 | 333 |
| 328 | 3300005544 | Ga0070686_100073191 | Ga0070686_1000731912 | 333 |
| 329 | 3300005544 | Ga0070686_100280374 | Ga0070686_1002803741 | 333 |
| 330 | 3300005547 | Ga0070693_100003483 | Ga0070693_1000034835 | 333 |
| 331 | 3300005547 | Ga0070693_100179055 | Ga0070693_1001790552 | 333 |
| 332 | 3300005548 | Ga0070665_100000020 | Ga0070665_100000020206 | 333 |
| 333 | 3300005548 | Ga0070665_100016967 | Ga0070665_1000169674 | 333 |
| 334 | 3300005548 | Ga0070665_100043231 | Ga0070665_1000432312 | 333 |
| 335 | 3300005563 | Ga0068855_100000346 | Ga0068855_10000034635 | 333 |
| 336 | 3300005563 | Ga0068855_100005837 | Ga0068855_1000058378 | 333 |
| 337 | 3300005563 | Ga0068855_100008169 | Ga0068855_1000081698 | 333 |
| 338 | 3300005563 | Ga0068855_100022866 | Ga0068855_1000228662 | 333 |
| 339 | 3300005563 | Ga0068855_100024060 | Ga0068855_1000240604 | 333 |
| 340 | 3300005563 | Ga0068855_100026080 | Ga0068855_1000260804 | 333 |
| 341 | 3300005563 | Ga0068855_100032308 | Ga0068855_1000323086 | 333 |
| 342 | 3300005563 | Ga0068855_100035811 | Ga0068855_1000358112 | 333 |
| 343 | 3300005563 | Ga0068855_100047040 | Ga0068855_1000470403 | 333 |
| 344 | 3300005563 | Ga0068855_100062842 | Ga0068855_1000628424 | 333 |
| 345 | 3300005563 | Ga0068855_100070659 | Ga0068855_1000706593 | 333 |
| 346 | 3300005563 | Ga0068855_100071810 | Ga0068855_1000718102 | 333 |
| 347 | 3300005564 | Ga0070664_100192898 | Ga0070664_1001928983 | 333 |
| 348 | 3300005564 | Ga0070664_100244621 | Ga0070664_1002446212 | 333 |
| 349 | 3300005577 | Ga0068857_100007822 | Ga0068857_1000078224 | 333 |
| 350 | 3300005577 | Ga0068857_100008143 | Ga0068857_1000081438 | 333 |
| 351 | 3300005577 | Ga0068857_100019055 | Ga0068857_1000190557 | 333 |
| 352 | 3300005577 | Ga0068857_100037750 | Ga0068857_1000377504 | 333 |
| 353 | 3300005577 | Ga0068857_100209964 | Ga0068857_1002099641 | 333 |
| 354 | 3300005578 | Ga0068854_100036735 | Ga0068854_1000367352 | 333 |
| 355 | 3300005578 | Ga0068854_100051761 | Ga0068854_1000517612 | 333 |
| 356 | 3300005578 | Ga0068854_100184752 | Ga0068854_1001847522 | 333 |
| 357 | 3300005614 | Ga0068856_100000835 | Ga0068856_10000083519 | 333 |
| 358 | 3300005614 | Ga0068856_100010959 | Ga0068856_10001095910 | 333 |
| 359 | 3300005614 | Ga0068856_100017673 | Ga0068856_1000176735 | 333 |
| 360 | 3300005614 | Ga0068856_100041561 | Ga0068856_1000415612 | 333 |
| 361 | 3300005614 | Ga0068856_100050057 | Ga0068856_1000500574 | 333 |
| 362 | 3300005614 | Ga0068856_100072662 | Ga0068856_1000726622 | 333 |
| 363 | 3300005616 | Ga0068852_100001345 | Ga0068852_1000013451 | 333 |
| 364 | 3300005616 | Ga0068852_100003445 | Ga0068852_1000034457 | 333 |
| 365 | 3300005616 | Ga0068852_100083617 | Ga0068852_1000836172 | 333 |
| 366 | 3300005616 | Ga0068852_100227662 | Ga0068852_1002276623 | 333 |
| 367 | 3300005616 | Ga0068852_100362436 | Ga0068852_1003624361 | 333 |
| 368 | 3300005617 | Ga0068859_100019039 | Ga0068859_1000190393 | 333 |
| 369 | 3300005617 | Ga0068859_100222016 | Ga0068859_1002220162 | 333 |
| 370 | 3300005618 | Ga0068864_100005800 | Ga0068864_1000058002 | 333 |
| 371 | 3300005718 | Ga0068866_10011575 | Ga0068866_100115752 | 333 |
| 372 | 3300005719 | Ga0068861_100276800 | Ga0068861_1002768002 | 333 |
| 373 | 3300005834 | Ga0068851_10015604 | Ga0068851_100156042 | 333 |
| 374 | 3300005834 | Ga0068851_10047333 | Ga0068851_100473332 | 333 |
| 375 | 3300005840 | Ga0068870_10028107 | Ga0068870_100281071 | 333 |
| 376 | 3300005840 | Ga0068870_10142332 | Ga0068870_101423322 | 333 |
| 377 | 3300005841 | Ga0068863_100000412 | Ga0068863_10000041216 | 333 |
| 378 | 3300005841 | Ga0068863_100032411 | Ga0068863_1000324112 | 333 |
| 379 | 3300005841 | Ga0068863_100077889 | Ga0068863_1000778892 | 333 |
| 380 | 3300005841 | Ga0068863_100089741 | Ga0068863_1000897413 | 333 |
| 381 | 3300005842 | Ga0068858_100342504 | Ga0068858_1003425041 | 333 |
| 382 | 3300005843 | Ga0068860_100000916 | Ga0068860_10000091622 | 333 |
| 383 | 3300005843 | Ga0068860_100081090 | Ga0068860_1000810903 | 333 |
| 384 | 3300005843 | Ga0068860_100186633 | Ga0068860_1001866332 | 333 |
| 385 | 3300005844 | Ga0068862_100155708 | Ga0068862_1001557082 | 333 |
| 386 | 3300005844 | Ga0068862_100377924 | Ga0068862_1003779242 | 333 |
| 387 | 3300005983 | Ga0081540_1037226 | Ga0081540_10372262 | 333 |
| 388 | 3300006195 | Ga0075366_10005218 | Ga0075366_100052185 | 333 |
| 389 | 3300006195 | Ga0075366_10006027 | Ga0075366_100060277 | 333 |
| 390 | 3300006195 | Ga0075366_10019255 | Ga0075366_100192554 | 333 |
| 391 | 3300006195 | Ga0075366_10020069 | Ga0075366_100200695 | 333 |
| 392 | 3300006195 | Ga0075366_10074534 | Ga0075366_100745342 | 333 |
| 393 | 3300006237 | Ga0097621_100002086 | Ga0097621_1000020862 | 333 |
| 394 | 3300006237 | Ga0097621_100018421 | Ga0097621_1000184214 | 333 |
| 395 | 3300006237 | Ga0097621_100022179 | Ga0097621_1000221794 | 333 |
| 396 | 3300006237 | Ga0097621_100051361 | Ga0097621_1000513613 | 333 |
| 397 | 3300006237 | Ga0097621_100093559 | Ga0097621_1000935593 | 333 |
| 398 | 3300006358 | Ga0068871_100000100 | Ga0068871_10000010022 | 333 |
| 399 | 3300006358 | Ga0068871_100312735 | Ga0068871_1003127352 | 333 |
| 400 | 3300006844 | Ga0075428_100017721 | Ga0075428_1000177214 | 333 |
| 401 | 3300006844 | Ga0075428_100050469 | Ga0075428_1000504694 | 333 |
| 402 | 3300006847 | Ga0075431_100030371 | Ga0075431_1000303716 | 333 |
| 403 | 3300006847 | Ga0075431_100118749 | Ga0075431_1001187492 | 333 |
| 404 | 3300006871 | Ga0075434_100105830 | Ga0075434_1001058302 | 333 |
| 405 | 3300006880 | Ga0075429_100018092 | Ga0075429_1000180924 | 333 |
| 406 | 3300006881 | Ga0068865_100000174 | Ga0068865_1000001747 | 333 |
| 407 | 3300006881 | Ga0068865_100003461 | Ga0068865_1000034612 | 333 |
| 408 | 3300006881 | Ga0068865_100028117 | Ga0068865_1000281173 | 333 |
| 409 | 3300006881 | Ga0068865_100077970 | Ga0068865_1000779702 | 333 |
| 410 | 3300006881 | Ga0068865_100103533 | Ga0068865_1001035332 | 333 |
| 411 | 3300006931 | Ga0097620_100019038 | Ga0097620_1000190385 | 333 |
| 412 | 3300006931 | Ga0097620_100222010 | Ga0097620_1002220102 | 333 |
| 413 | 3300009011 | Ga0105251_10086058 | Ga0105251_100860582 | 333 |
| 414 | 3300009036 | Ga0105244_10098006 | Ga0105244_100980062 | 333 |
| 415 | 3300009093 | Ga0105240_10000074 | Ga0105240_10000074126 | 333 |
| 416 | 3300009093 | Ga0105240_10000237 | Ga0105240_1000023725 | 333 |
| 417 | 3300009093 | Ga0105240_10000598 | Ga0105240_1000059845 | 333 |
| 418 | 3300009093 | Ga0105240_10000626 | Ga0105240_1000062619 | 333 |
| 419 | 3300009093 | Ga0105240_10001351 | Ga0105240_1000135122 | 333 |
| 420 | 3300009093 | Ga0105240_10001595 | Ga0105240_1000159512 | 333 |
| 421 | 3300009093 | Ga0105240_10007062 | Ga0105240_1000706218 | 333 |
| 422 | 3300009093 | Ga0105240_10008151 | Ga0105240_100081513 | 333 |
| 423 | 3300009093 | Ga0105240_10022028 | Ga0105240_100220288 | 333 |
| 424 | 3300009093 | Ga0105240_10045715 | Ga0105240_100457153 | 333 |
| 425 | 3300009093 | Ga0105240_10066229 | Ga0105240_100662294 | 333 |
| 426 | 3300009093 | Ga0105240_10084727 | Ga0105240_100847273 | 333 |
| 427 | 3300009093 | Ga0105240_10096537 | Ga0105240_100965372 | 333 |
| 428 | 3300009093 | Ga0105240_10126815 | Ga0105240_101268152 | 333 |
| 429 | 3300009093 | Ga0105240_10261192 | Ga0105240_102611922 | 333 |
| 430 | 3300009093 | Ga0105240_10349622 | Ga0105240_103496222 | 333 |
| 431 | 3300009094 | Ga0111539_10034093 | Ga0111539_100340935 | 333 |
| 432 | 3300009098 | Ga0105245_10114265 | Ga0105245_101142652 | 333 |
| 433 | 3300009147 | Ga0114129_10033962 | Ga0114129_100339622 | 333 |
| 434 | 3300009174 | Ga0105241_10000086 | Ga0105241_1000008651 | 333 |
| 435 | 3300009174 | Ga0105241_10000659 | Ga0105241_1000065924 | 333 |
| 436 | 3300009174 | Ga0105241_10005221 | Ga0105241_100052212 | 333 |
| 437 | 3300009174 | Ga0105241_10042948 | Ga0105241_100429482 | 333 |
| 438 | 3300009174 | Ga0105241_10057228 | Ga0105241_100572282 | 333 |
| 439 | 3300009174 | Ga0105241_10284031 | Ga0105241_102840312 | 333 |
| 440 | 3300009176 | Ga0105242_10009407 | Ga0105242_100094075 | 333 |
| 441 | 3300009176 | Ga0105242_10015906 | Ga0105242_100159064 | 333 |
| 442 | 3300009176 | Ga0105242_10066597 | Ga0105242_100665972 | 333 |
| 443 | 3300009177 | Ga0105248_10570485 | Ga0105248_105704851 | 333 |
| 444 | 3300009545 | Ga0105237_10000224 | Ga0105237_1000022452 | 333 |
| 445 | 3300009545 | Ga0105237_10001565 | Ga0105237_1000156523 | 333 |
| 446 | 3300009545 | Ga0105237_10003647 | Ga0105237_100036474 | 333 |
| 447 | 3300009545 | Ga0105237_10004072 | Ga0105237_1000407218 | 333 |
| 448 | 3300009545 | Ga0105237_10009395 | Ga0105237_100093958 | 333 |
| 449 | 3300009545 | Ga0105237_10018293 | Ga0105237_100182936 | 333 |
| 450 | 3300009545 | Ga0105237_10028286 | Ga0105237_100282865 | 333 |
| 451 | 3300009545 | Ga0105237_10036976 | Ga0105237_100369765 | 333 |
| 452 | 3300009545 | Ga0105237_10057618 | Ga0105237_100576182 | 333 |
| 453 | 3300009545 | Ga0105237_10059488 | Ga0105237_100594882 | 333 |
| 454 | 3300009545 | Ga0105237_10067260 | Ga0105237_100672604 | 333 |
| 455 | 3300009545 | Ga0105237_10140408 | Ga0105237_101404082 | 333 |
| 456 | 3300009545 | Ga0105237_10193118 | Ga0105237_101931182 | 333 |
| 457 | 3300009545 | Ga0105237_10196753 | Ga0105237_101967532 | 333 |
| 458 | 3300009545 | Ga0105237_10264291 | Ga0105237_102642911 | 333 |
| 459 | 3300009545 | Ga0105237_10285413 | Ga0105237_102854132 | 333 |
| 460 | 3300009545 | Ga0105237_10397595 | Ga0105237_103975952 | 333 |
| 461 | 3300009551 | Ga0105238_10001132 | Ga0105238_1000113224 | 333 |
| 462 | 3300009551 | Ga0105238_10052663 | Ga0105238_100526633 | 333 |
| 463 | 3300009551 | Ga0105238_10097033 | Ga0105238_100970332 | 333 |
| 464 | 3300009553 | Ga0105249_10005103 | Ga0105249_100051039 | 333 |
| 465 | 3300009553 | Ga0105249_10005252 | Ga0105249_100052523 | 333 |
| 466 | 3300009553 | Ga0105249_10008737 | Ga0105249_100087376 | 333 |
| 467 | 3300009553 | Ga0105249_10055248 | Ga0105249_100552483 | 333 |
| 468 | 3300009553 | Ga0105249_10079798 | Ga0105249_100797983 | 333 |
| 469 | 3300009553 | Ga0105249_10148121 | Ga0105249_101481212 | 333 |
| 470 | 3300009553 | Ga0105249_10203305 | Ga0105249_102033052 | 333 |
| 471 | 3300009553 | Ga0105249_10461435 | Ga0105249_104614352 | 333 |
| 472 | 3300010375 | Ga0105239_10000002 | Ga0105239_10000002144 | 333 |
| 473 | 3300010375 | Ga0105239_10000048 | Ga0105239_1000004876 | 333 |
| 474 | 3300010375 | Ga0105239_10000758 | Ga0105239_1000075825 | 333 |
| 475 | 3300010375 | Ga0105239_10001789 | Ga0105239_1000178929 | 333 |
| 476 | 3300010375 | Ga0105239_10001948 | Ga0105239_100019482 | 333 |
| 477 | 3300010375 | Ga0105239_10002090 | Ga0105239_1000209016 | 333 |
| 478 | 3300010375 | Ga0105239_10002752 | Ga0105239_100027527 | 333 |
| 479 | 3300010375 | Ga0105239_10005094 | Ga0105239_1000509416 | 333 |
| 480 | 3300010375 | Ga0105239_10008918 | Ga0105239_100089182 | 333 |
| 481 | 3300010375 | Ga0105239_10016195 | Ga0105239_100161953 | 333 |
| 482 | 3300010375 | Ga0105239_10024710 | Ga0105239_100247104 | 333 |
| 483 | 3300010375 | Ga0105239_10039298 | Ga0105239_100392982 | 333 |
| 484 | 3300010375 | Ga0105239_10045406 | Ga0105239_100454065 | 333 |
| 485 | 3300010375 | Ga0105239_10078015 | Ga0105239_100780153 | 333 |
| 486 | 3300010375 | Ga0105239_10087796 | Ga0105239_100877962 | 333 |
| 487 | 3300010375 | Ga0105239_10121599 | Ga0105239_101215992 | 333 |
| 488 | 3300010375 | Ga0105239_10166914 | Ga0105239_101669142 | 333 |
| 489 | 3300011119 | Ga0105246_10028028 | Ga0105246_100280282 | 333 |
| 490 | 3300011119 | Ga0105246_10053815 | Ga0105246_100538152 | 333 |
| 491 | 3300011119 | Ga0105246_10249830 | Ga0105246_102498302 | 333 |
| 492 | 3300013100 | Ga0157373_10000821 | Ga0157373_1000082111 | 333 |
| 493 | 3300013100 | Ga0157373_10002581 | Ga0157373_1000258113 | 333 |
| 494 | 3300013100 | Ga0157373_10019401 | Ga0157373_100194012 | 333 |
| 495 | 3300013100 | Ga0157373_10020933 | Ga0157373_100209334 | 333 |
| 496 | 3300013100 | Ga0157373_10092748 | Ga0157373_100927482 | 333 |
| 497 | 3300013100 | Ga0157373_10097891 | Ga0157373_100978912 | 333 |
| 498 | 3300013102 | Ga0157371_10000016 | Ga0157371_10000016139 | 333 |
| 499 | 3300013102 | Ga0157371_10000135 | Ga0157371_1000013552 | 333 |
| 500 | 3300013102 | Ga0157371_10000563 | Ga0157371_1000056327 | 333 |
| 501 | 3300013102 | Ga0157371_10001915 | Ga0157371_1000191518 | 333 |
| 502 | 3300013102 | Ga0157371_10003683 | Ga0157371_100036834 | 333 |
| 503 | 3300013102 | Ga0157371_10009984 | Ga0157371_100099845 | 333 |
| 504 | 3300013102 | Ga0157371_10018424 | Ga0157371_100184244 | 333 |
| 505 | 3300013102 | Ga0157371_10034813 | Ga0157371_100348133 | 333 |
| 506 | 3300013102 | Ga0157371_10077958 | Ga0157371_100779582 | 333 |
| 507 | 3300013104 | Ga0157370_10000500 | Ga0157370_100005006 | 333 |
| 508 | 3300013104 | Ga0157370_10001022 | Ga0157370_1000102221 | 333 |
| 509 | 3300013104 | Ga0157370_10001166 | Ga0157370_100011663 | 333 |
| 510 | 3300013104 | Ga0157370_10005338 | Ga0157370_100053384 | 333 |
| 511 | 3300013104 | Ga0157370_10010727 | Ga0157370_100107277 | 333 |
| 512 | 3300013104 | Ga0157370_10014206 | Ga0157370_100142065 | 333 |
| 513 | 3300013104 | Ga0157370_10031451 | Ga0157370_100314513 | 333 |
| 514 | 3300013104 | Ga0157370_10036413 | Ga0157370_100364133 | 333 |
| 515 | 3300013104 | Ga0157370_10039822 | Ga0157370_100398222 | 333 |
| 516 | 3300013104 | Ga0157370_10262108 | Ga0157370_102621081 | 333 |
| 517 | 3300013105 | Ga0157369_10000475 | Ga0157369_100004755 | 333 |
| 518 | 3300013105 | Ga0157369_10046098 | Ga0157369_100460982 | 333 |
| 519 | 3300013105 | Ga0157369_10051032 | Ga0157369_100510322 | 333 |
| 520 | 3300013105 | Ga0157369_10057127 | Ga0157369_100571273 | 333 |
| 521 | 3300013105 | Ga0157369_10081875 | Ga0157369_100818752 | 333 |
| 522 | 3300013105 | Ga0157369_10117845 | Ga0157369_101178452 | 333 |
| 523 | 3300013105 | Ga0157369_10159155 | Ga0157369_101591552 | 333 |
| 524 | 3300013105 | Ga0157369_10231674 | Ga0157369_102316742 | 333 |
| 525 | 3300013296 | Ga0157374_10000001 | Ga0157374_10000001224 | 333 |
| 526 | 3300013296 | Ga0157374_10000128 | Ga0157374_100001288 | 333 |
| 527 | 3300013296 | Ga0157374_10000202 | Ga0157374_1000020215 | 333 |
| 528 | 3300013296 | Ga0157374_10004614 | Ga0157374_100046143 | 333 |
| 529 | 3300013296 | Ga0157374_10028575 | Ga0157374_100285754 | 333 |
| 530 | 3300013296 | Ga0157374_10034089 | Ga0157374_100340893 | 333 |
| 531 | 3300013296 | Ga0157374_10051367 | Ga0157374_100513672 | 333 |
| 532 | 3300013296 | Ga0157374_10054818 | Ga0157374_100548182 | 333 |
| 533 | 3300013296 | Ga0157374_10099620 | Ga0157374_100996202 | 333 |
| 534 | 3300013296 | Ga0157374_10492119 | Ga0157374_104921191 | 333 |
| 535 | 3300013297 | Ga0157378_10005717 | Ga0157378_100057175 | 333 |
| 536 | 3300013297 | Ga0157378_10005849 | Ga0157378_100058494 | 333 |
| 537 | 3300013297 | Ga0157378_10010586 | Ga0157378_100105862 | 333 |
| 538 | 3300013297 | Ga0157378_10043948 | Ga0157378_100439483 | 333 |
| 539 | 3300013297 | Ga0157378_10107269 | Ga0157378_101072692 | 333 |
| 540 | 3300013297 | Ga0157378_10260343 | Ga0157378_102603432 | 333 |
| 541 | 3300013297 | Ga0157378_10290658 | Ga0157378_102906582 | 333 |
| 542 | 3300013306 | Ga0163162_10000032 | Ga0163162_1000003228 | 333 |
| 543 | 3300013306 | Ga0163162_10000152 | Ga0163162_100001529 | 333 |
| 544 | 3300013306 | Ga0163162_10009046 | Ga0163162_100090465 | 333 |
| 545 | 3300013306 | Ga0163162_10011763 | Ga0163162_100117632 | 333 |
| 546 | 3300013306 | Ga0163162_10015657 | Ga0163162_100156576 | 333 |
| 547 | 3300013306 | Ga0163162_10016026 | Ga0163162_100160264 | 333 |
| 548 | 3300013306 | Ga0163162_10052936 | Ga0163162_100529362 | 333 |
| 549 | 3300013306 | Ga0163162_10054110 | Ga0163162_100541104 | 333 |
| 550 | 3300013306 | Ga0163162_10095248 | Ga0163162_100952482 | 333 |
| 551 | 3300013306 | Ga0163162_10295516 | Ga0163162_102955162 | 333 |
| 552 | 3300013306 | Ga0163162_10459650 | Ga0163162_104596502 | 333 |
| 553 | 3300013307 | Ga0157372_10000017 | Ga0157372_10000017155 | 333 |
| 554 | 3300013307 | Ga0157372_10000061 | Ga0157372_1000006141 | 333 |
| 555 | 3300013307 | Ga0157372_10000921 | Ga0157372_1000092123 | 333 |
| 556 | 3300013307 | Ga0157372_10003385 | Ga0157372_100033852 | 333 |
| 557 | 3300013307 | Ga0157372_10004228 | Ga0157372_100042283 | 333 |
| 558 | 3300013307 | Ga0157372_10018588 | Ga0157372_100185889 | 333 |
| 559 | 3300013307 | Ga0157372_10020418 | Ga0157372_100204183 | 333 |
| 560 | 3300013307 | Ga0157372_10142889 | Ga0157372_101428893 | 333 |
| 561 | 3300013307 | Ga0157372_10151540 | Ga0157372_101515402 | 333 |
| 562 | 3300013307 | Ga0157372_10166690 | Ga0157372_101666902 | 333 |
| 563 | 3300013307 | Ga0157372_10207727 | Ga0157372_102077272 | 333 |
| 564 | 3300013308 | Ga0157375_10037080 | Ga0157375_100370803 | 333 |
| 565 | 3300013308 | Ga0157375_10040512 | Ga0157375_100405122 | 333 |
| 566 | 3300013308 | Ga0157375_10045096 | Ga0157375_100450963 | 333 |
| 567 | 3300013308 | Ga0157375_10045413 | Ga0157375_100454134 | 333 |
| 568 | 3300013308 | Ga0157375_10123056 | Ga0157375_101230561 | 333 |
| 569 | 3300013308 | Ga0157375_10174141 | Ga0157375_101741412 | 333 |
| 570 | 3300013308 | Ga0157375_10202478 | Ga0157375_102024783 | 333 |
| 571 | 3300013308 | Ga0157375_10480579 | Ga0157375_104805792 | 333 |
| 572 | 3300013308 | Ga0157375_10578419 | Ga0157375_105784192 | 333 |
| 573 | 3300014325 | Ga0163163_10000653 | Ga0163163_100006535 | 333 |
| 574 | 3300014325 | Ga0163163_10195869 | Ga0163163_101958692 | 333 |
| 575 | 3300014325 | Ga0163163_10403595 | Ga0163163_104035952 | 333 |
| 576 | 3300014326 | Ga0157380_10168749 | Ga0157380_101687492 | 333 |
| 577 | 3300014326 | Ga0157380_10234046 | Ga0157380_102340462 | 333 |
| 578 | 3300014497 | Ga0182008_10000006 | Ga0182008_10000006322 | 333 |
| 579 | 3300014497 | Ga0182008_10000818 | Ga0182008_100008183 | 333 |
| 580 | 3300014497 | Ga0182008_10001192 | Ga0182008_100011927 | 333 |
| 581 | 3300014968 | Ga0157379_10001301 | Ga0157379_100013012 | 333 |
| 582 | 3300014968 | Ga0157379_10180015 | Ga0157379_101800152 | 333 |
| 583 | 3300014968 | Ga0157379_10206039 | Ga0157379_102060392 | 333 |
| 584 | 3300014969 | Ga0157376_10000721 | Ga0157376_100007219 | 333 |
| 585 | 3300014969 | Ga0157376_10001279 | Ga0157376_100012794 | 333 |
| 586 | 3300014969 | Ga0157376_10008360 | Ga0157376_100083605 | 333 |
| 587 | 3300014969 | Ga0157376_10025181 | Ga0157376_100251814 | 333 |
| 588 | 3300014969 | Ga0157376_10037767 | Ga0157376_100377673 | 333 |
| 589 | 3300014969 | Ga0157376_10055030 | Ga0157376_100550302 | 333 |
| 590 | 3300014969 | Ga0157376_10067496 | Ga0157376_100674962 | 333 |
| 591 | 3300015261 | Ga0182006_1000068 | Ga0182006_10000683 | 333 |
| 592 | 3300015261 | Ga0182006_1000869 | Ga0182006_10008695 | 333 |
| 593 | 3300015261 | Ga0182006_1003367 | Ga0182006_10033673 | 333 |
| 594 | 3300015262 | Ga0182007_10000003 | Ga0182007_10000003284 | 333 |
| 595 | 3300015682 | Ga0183373_1001 | Ga0183373_1001680 | 333 |
| 596 | 3300017792 | Ga0163161_10000074 | Ga0163161_10000074113 | 333 |
| 597 | 3300017792 | Ga0163161_10015370 | Ga0163161_100153703 | 333 |
| 598 | 3300017792 | Ga0163161_10016813 | Ga0163161_100168133 | 333 |
| 599 | 3300017792 | Ga0163161_10067138 | Ga0163161_100671382 | 333 |
| 600 | 3300017792 | Ga0163161_10171589 | Ga0163161_101715892 | 333 |
| 601 | 3300021361 | Ga0213872_10009314 | Ga0213872_100093145 | 333 |
| 602 | 3300025208 | Ga0209436_103157 | Ga0209436_1031575 | 333 |
| 603 | 3300025231 | Ga0207427_100103 | Ga0207427_10010394 | 333 |
| 604 | 3300025233 | Ga0209437_100017 | Ga0209437_100017279 | 333 |
| 605 | 3300025233 | Ga0209437_100101 | Ga0209437_100101115 | 333 |
| 606 | 3300025245 | Ga0207425_1000002 | Ga0207425_1000002705 | 333 |
| 607 | 3300025246 | Ga0209646_1000002 | Ga0209646_1000002515 | 333 |
| 608 | 3300025246 | Ga0209646_1000745 | Ga0209646_10007457 | 333 |
| 609 | 3300025250 | Ga0209026_1000434 | Ga0209026_100043418 | 333 |
| 610 | 3300025250 | Ga0209026_1006913 | Ga0209026_10069132 | 333 |
| 611 | 3300025258 | Ga0209129_1000002 | Ga0209129_1000002705 | 333 |
| 612 | 3300025261 | Ga0209233_1000124 | Ga0209233_1000124121 | 333 |
| 613 | 3300025284 | Ga0209130_1005416 | Ga0209130_10054163 | 333 |
| 614 | 3300025292 | Ga0209676_1000008 | Ga0209676_1000008589 | 333 |
| 615 | 3300025292 | Ga0209676_1000425 | Ga0209676_100042546 | 333 |
| 616 | 3300025294 | Ga0209025_1000004 | Ga0209025_1000004485 | 333 |
| 617 | 3300025297 | Ga0209758_1000006 | Ga0209758_1000006485 | 333 |
| 618 | 3300025297 | Ga0209758_1003065 | Ga0209758_10030657 | 333 |
| 619 | 3300025298 | Ga0209050_1000045 | Ga0209050_1000045196 | 333 |
| 620 | 3300025302 | Ga0207426_1000002 | Ga0207426_1000002521 | 333 |
| 621 | 3300025302 | Ga0207426_1000051 | Ga0207426_1000051337 | 333 |
| 622 | 3300025302 | Ga0207426_1000497 | Ga0207426_100049718 | 333 |
| 623 | 3300025304 | Ga0209257_1000001 | Ga0209257_10000011450 | 333 |
| 624 | 3300025321 | Ga0207656_10017547 | Ga0207656_100175472 | 333 |
| 625 | 3300025893 | Ga0207682_10010357 | Ga0207682_100103573 | 333 |
| 626 | 3300025900 | Ga0207710_10008558 | Ga0207710_100085582 | 333 |
| 627 | 3300025901 | Ga0207688_10009386 | Ga0207688_100093864 | 333 |
| 628 | 3300025903 | Ga0207680_10015585 | Ga0207680_100155853 | 333 |
| 629 | 3300025903 | Ga0207680_10023544 | Ga0207680_100235441 | 333 |
| 630 | 3300025903 | Ga0207680_10052159 | Ga0207680_100521591 | 333 |
| 631 | 3300025904 | Ga0207647_10000105 | Ga0207647_1000010529 | 333 |
| 632 | 3300025904 | Ga0207647_10000511 | Ga0207647_1000051117 | 333 |
| 633 | 3300025904 | Ga0207647_10007406 | Ga0207647_100074066 | 333 |
| 634 | 3300025904 | Ga0207647_10016870 | Ga0207647_100168702 | 333 |
| 635 | 3300025904 | Ga0207647_10022172 | Ga0207647_100221722 | 333 |
| 636 | 3300025904 | Ga0207647_10098536 | Ga0207647_100985362 | 333 |
| 637 | 3300025907 | Ga0207645_10000622 | Ga0207645_1000062222 | 333 |
| 638 | 3300025907 | Ga0207645_10001210 | Ga0207645_1000121015 | 333 |
| 639 | 3300025907 | Ga0207645_10003591 | Ga0207645_100035913 | 333 |
| 640 | 3300025907 | Ga0207645_10004714 | Ga0207645_100047144 | 333 |
| 641 | 3300025908 | Ga0207643_10023368 | Ga0207643_100233684 | 333 |
| 642 | 3300025908 | Ga0207643_10126218 | Ga0207643_101262182 | 333 |
| 643 | 3300025909 | Ga0207705_10000079 | Ga0207705_1000007979 | 333 |
| 644 | 3300025909 | Ga0207705_10017692 | Ga0207705_100176922 | 333 |
| 645 | 3300025909 | Ga0207705_10045764 | Ga0207705_100457642 | 333 |
| 646 | 3300025909 | Ga0207705_10189042 | Ga0207705_101890422 | 333 |
| 647 | 3300025911 | Ga0207654_10016294 | Ga0207654_100162942 | 333 |
| 648 | 3300025912 | Ga0207707_10000051 | Ga0207707_1000005159 | 333 |
| 649 | 3300025912 | Ga0207707_10021406 | Ga0207707_100214063 | 333 |
| 650 | 3300025912 | Ga0207707_10193606 | Ga0207707_101936062 | 333 |
| 651 | 3300025913 | Ga0207695_10000013 | Ga0207695_1000001326 | 333 |
| 652 | 3300025913 | Ga0207695_10000084 | Ga0207695_10000084210 | 333 |
| 653 | 3300025913 | Ga0207695_10000323 | Ga0207695_1000032357 | 333 |
| 654 | 3300025913 | Ga0207695_10001232 | Ga0207695_100012327 | 333 |
| 655 | 3300025913 | Ga0207695_10004447 | Ga0207695_1000444714 | 333 |
| 656 | 3300025913 | Ga0207695_10007846 | Ga0207695_100078462 | 333 |
| 657 | 3300025913 | Ga0207695_10009118 | Ga0207695_1000911812 | 333 |
| 658 | 3300025913 | Ga0207695_10015643 | Ga0207695_100156432 | 333 |
| 659 | 3300025913 | Ga0207695_10122675 | Ga0207695_101226752 | 333 |
| 660 | 3300025913 | Ga0207695_10189847 | Ga0207695_101898472 | 333 |
| 661 | 3300025913 | Ga0207695_10234174 | Ga0207695_102341742 | 333 |
| 662 | 3300025914 | Ga0207671_10000272 | Ga0207671_100002724 | 333 |
| 663 | 3300025914 | Ga0207671_10001497 | Ga0207671_100014976 | 333 |
| 664 | 3300025914 | Ga0207671_10005889 | Ga0207671_1000588910 | 333 |
| 665 | 3300025914 | Ga0207671_10009491 | Ga0207671_100094917 | 333 |
| 666 | 3300025914 | Ga0207671_10012189 | Ga0207671_100121896 | 333 |
| 667 | 3300025914 | Ga0207671_10014622 | Ga0207671_100146224 | 333 |
| 668 | 3300025914 | Ga0207671_10036318 | Ga0207671_100363182 | 333 |
| 669 | 3300025914 | Ga0207671_10042678 | Ga0207671_100426782 | 333 |
| 670 | 3300025914 | Ga0207671_10103071 | Ga0207671_101030712 | 333 |
| 671 | 3300025914 | Ga0207671_10121560 | Ga0207671_101215602 | 333 |
| 672 | 3300025914 | Ga0207671_10220780 | Ga0207671_102207802 | 333 |
| 673 | 3300025914 | Ga0207671_10335001 | Ga0207671_103350011 | 333 |
| 674 | 3300025917 | Ga0207660_10009778 | Ga0207660_100097786 | 333 |
| 675 | 3300025918 | Ga0207662_10016297 | Ga0207662_100162972 | 333 |
| 676 | 3300025918 | Ga0207662_10019350 | Ga0207662_100193503 | 333 |
| 677 | 3300025919 | Ga0207657_10059750 | Ga0207657_100597502 | 333 |
| 678 | 3300025919 | Ga0207657_10082590 | Ga0207657_100825902 | 333 |
| 679 | 3300025919 | Ga0207657_10350426 | Ga0207657_103504261 | 333 |
| 680 | 3300025920 | Ga0207649_10017077 | Ga0207649_100170773 | 333 |
| 681 | 3300025921 | Ga0207652_10000384 | Ga0207652_1000038424 | 333 |
| 682 | 3300025921 | Ga0207652_10001696 | Ga0207652_1000169611 | 333 |
| 683 | 3300025921 | Ga0207652_10014179 | Ga0207652_100141797 | 333 |
| 684 | 3300025921 | Ga0207652_10015091 | Ga0207652_100150912 | 333 |
| 685 | 3300025924 | Ga0207694_10077795 | Ga0207694_100777952 | 333 |
| 686 | 3300025924 | Ga0207694_10094692 | Ga0207694_100946922 | 333 |
| 687 | 3300025924 | Ga0207694_10195493 | Ga0207694_101954932 | 333 |
| 688 | 3300025924 | Ga0207694_10247457 | Ga0207694_102474571 | 333 |
| 689 | 3300025925 | Ga0207650_10019073 | Ga0207650_100190735 | 333 |
| 690 | 3300025925 | Ga0207650_10042343 | Ga0207650_100423431 | 333 |
| 691 | 3300025925 | Ga0207650_10070695 | Ga0207650_100706952 | 333 |
| 692 | 3300025926 | Ga0207659_10008155 | Ga0207659_100081552 | 333 |
| 693 | 3300025926 | Ga0207659_10037371 | Ga0207659_100373712 | 333 |
| 694 | 3300025926 | Ga0207659_10053334 | Ga0207659_100533341 | 333 |
| 695 | 3300025926 | Ga0207659_10163272 | Ga0207659_101632721 | 333 |
| 696 | 3300025927 | Ga0207687_10106215 | Ga0207687_101062152 | 333 |
| 697 | 3300025931 | Ga0207644_10120271 | Ga0207644_101202712 | 333 |
| 698 | 3300025932 | Ga0207690_10000318 | Ga0207690_1000031831 | 333 |
| 699 | 3300025932 | Ga0207690_10013661 | Ga0207690_100136615 | 333 |
| 700 | 3300025932 | Ga0207690_10160203 | Ga0207690_101602033 | 333 |
| 701 | 3300025933 | Ga0207706_10000120 | Ga0207706_1000012040 | 333 |
| 702 | 3300025933 | Ga0207706_10029817 | Ga0207706_100298173 | 333 |
| 703 | 3300025933 | Ga0207706_10049670 | Ga0207706_100496702 | 333 |
| 704 | 3300025933 | Ga0207706_10099200 | Ga0207706_100992002 | 333 |
| 705 | 3300025933 | Ga0207706_10211759 | Ga0207706_102117592 | 333 |
| 706 | 3300025934 | Ga0207686_10024502 | Ga0207686_100245023 | 333 |
| 707 | 3300025936 | Ga0207670_10107261 | Ga0207670_101072611 | 333 |
| 708 | 3300025936 | Ga0207670_10126200 | Ga0207670_101262002 | 333 |
| 709 | 3300025938 | Ga0207704_10028986 | Ga0207704_100289862 | 333 |
| 710 | 3300025938 | Ga0207704_10073370 | Ga0207704_100733701 | 333 |
| 711 | 3300025938 | Ga0207704_10212037 | Ga0207704_102120372 | 333 |
| 712 | 3300025940 | Ga0207691_10002527 | Ga0207691_100025277 | 333 |
| 713 | 3300025940 | Ga0207691_10023686 | Ga0207691_100236863 | 333 |
| 714 | 3300025940 | Ga0207691_10027226 | Ga0207691_100272262 | 333 |
| 715 | 3300025940 | Ga0207691_10042760 | Ga0207691_100427602 | 333 |
| 716 | 3300025940 | Ga0207691_10052586 | Ga0207691_100525863 | 333 |
| 717 | 3300025940 | Ga0207691_10066643 | Ga0207691_100666432 | 333 |
| 718 | 3300025940 | Ga0207691_10194754 | Ga0207691_101947542 | 333 |
| 719 | 3300025942 | Ga0207689_10003051 | Ga0207689_1000305116 | 333 |
| 720 | 3300025942 | Ga0207689_10008841 | Ga0207689_100088415 | 333 |
| 721 | 3300025942 | Ga0207689_10077529 | Ga0207689_100775292 | 333 |
| 722 | 3300025942 | Ga0207689_10107260 | Ga0207689_101072603 | 333 |
| 723 | 3300025942 | Ga0207689_10125004 | Ga0207689_101250042 | 333 |
| 724 | 3300025942 | Ga0207689_10157763 | Ga0207689_101577631 | 333 |
| 725 | 3300025942 | Ga0207689_10234984 | Ga0207689_102349842 | 333 |
| 726 | 3300025944 | Ga0207661_10033412 | Ga0207661_100334121 | 333 |
| 727 | 3300025944 | Ga0207661_10055683 | Ga0207661_100556833 | 333 |
| 728 | 3300025944 | Ga0207661_10119674 | Ga0207661_101196742 | 333 |
| 729 | 3300025944 | Ga0207661_10250394 | Ga0207661_102503942 | 333 |
| 730 | 3300025945 | Ga0207679_10007258 | Ga0207679_100072587 | 333 |
| 731 | 3300025945 | Ga0207679_10026046 | Ga0207679_100260462 | 333 |
| 732 | 3300025949 | Ga0207667_10000135 | Ga0207667_100001355 | 333 |
| 733 | 3300025949 | Ga0207667_10007957 | Ga0207667_100079577 | 333 |
| 734 | 3300025949 | Ga0207667_10011669 | Ga0207667_100116694 | 333 |
| 735 | 3300025949 | Ga0207667_10017914 | Ga0207667_100179148 | 333 |
| 736 | 3300025949 | Ga0207667_10028059 | Ga0207667_100280594 | 333 |
| 737 | 3300025949 | Ga0207667_10028127 | Ga0207667_100281274 | 333 |
| 738 | 3300025949 | Ga0207667_10038231 | Ga0207667_100382313 | 333 |
| 739 | 3300025949 | Ga0207667_10048612 | Ga0207667_100486121 | 333 |
| 740 | 3300025949 | Ga0207667_10164208 | Ga0207667_101642082 | 333 |
| 741 | 3300025949 | Ga0207667_10209178 | Ga0207667_102091782 | 333 |
| 742 | 3300025949 | Ga0207667_10345220 | Ga0207667_103452202 | 333 |
| 743 | 3300025949 | Ga0207667_10533199 | Ga0207667_105331991 | 333 |
| 744 | 3300025960 | Ga0207651_10005116 | Ga0207651_100051165 | 333 |
| 745 | 3300025960 | Ga0207651_10124360 | Ga0207651_101243602 | 333 |
| 746 | 3300025960 | Ga0207651_10144307 | Ga0207651_101443072 | 333 |
| 747 | 3300025960 | Ga0207651_10156626 | Ga0207651_101566262 | 333 |
| 748 | 3300025961 | Ga0207712_10007103 | Ga0207712_100071037 | 333 |
| 749 | 3300025961 | Ga0207712_10355651 | Ga0207712_103556511 | 333 |
| 750 | 3300025972 | Ga0207668_10000540 | Ga0207668_100005402 | 333 |
| 751 | 3300025972 | Ga0207668_10118577 | Ga0207668_101185772 | 333 |
| 752 | 3300025972 | Ga0207668_10250364 | Ga0207668_102503642 | 333 |
| 753 | 3300025981 | Ga0207640_10052155 | Ga0207640_100521552 | 333 |
| 754 | 3300025986 | Ga0207658_10039183 | Ga0207658_100391832 | 333 |
| 755 | 3300025986 | Ga0207658_10049171 | Ga0207658_100491713 | 333 |
| 756 | 3300025986 | Ga0207658_10181257 | Ga0207658_101812572 | 333 |
| 757 | 3300026023 | Ga0207677_10004313 | Ga0207677_100043134 | 333 |
| 758 | 3300026023 | Ga0207677_10014691 | Ga0207677_100146913 | 333 |
| 759 | 3300026023 | Ga0207677_10019806 | Ga0207677_100198064 | 333 |
| 760 | 3300026023 | Ga0207677_10059201 | Ga0207677_100592012 | 333 |
| 761 | 3300026023 | Ga0207677_10074545 | Ga0207677_100745452 | 333 |
| 762 | 3300026023 | Ga0207677_10253314 | Ga0207677_102533142 | 333 |
| 763 | 3300026035 | Ga0207703_10001644 | Ga0207703_100016443 | 333 |
| 764 | 3300026035 | Ga0207703_10201182 | Ga0207703_102011821 | 333 |
| 765 | 3300026041 | Ga0207639_10001126 | Ga0207639_1000112616 | 333 |
| 766 | 3300026041 | Ga0207639_10016182 | Ga0207639_100161824 | 333 |
| 767 | 3300026041 | Ga0207639_10119624 | Ga0207639_101196241 | 333 |
| 768 | 3300026041 | Ga0207639_10140418 | Ga0207639_101404182 | 333 |
| 769 | 3300026041 | Ga0207639_10149561 | Ga0207639_101495612 | 333 |
| 770 | 3300026041 | Ga0207639_10210951 | Ga0207639_102109512 | 333 |
| 771 | 3300026041 | Ga0207639_10285933 | Ga0207639_102859332 | 333 |
| 772 | 3300026067 | Ga0207678_10038074 | Ga0207678_100380743 | 333 |
| 773 | 3300026067 | Ga0207678_10068160 | Ga0207678_100681603 | 333 |
| 774 | 3300026067 | Ga0207678_10224546 | Ga0207678_102245461 | 333 |
| 775 | 3300026075 | Ga0207708_10160493 | Ga0207708_101604932 | 333 |
| 776 | 3300026078 | Ga0207702_10000196 | Ga0207702_1000019653 | 333 |
| 777 | 3300026078 | Ga0207702_10057179 | Ga0207702_100571792 | 333 |
| 778 | 3300026078 | Ga0207702_10093576 | Ga0207702_100935763 | 333 |
| 779 | 3300026078 | Ga0207702_10104078 | Ga0207702_101040782 | 333 |
| 780 | 3300026078 | Ga0207702_10447303 | Ga0207702_104473031 | 333 |
| 781 | 3300026088 | Ga0207641_10000253 | Ga0207641_1000025331 | 333 |
| 782 | 3300026088 | Ga0207641_10018015 | Ga0207641_100180156 | 333 |
| 783 | 3300026088 | Ga0207641_10052914 | Ga0207641_100529143 | 333 |
| 784 | 3300026088 | Ga0207641_10111008 | Ga0207641_101110082 | 333 |
| 785 | 3300026089 | Ga0207648_10002506 | Ga0207648_100025064 | 333 |
| 786 | 3300026089 | Ga0207648_10004019 | Ga0207648_1000401912 | 333 |
| 787 | 3300026089 | Ga0207648_10018210 | Ga0207648_100182103 | 333 |
| 788 | 3300026089 | Ga0207648_10034323 | Ga0207648_100343232 | 333 |
| 789 | 3300026089 | Ga0207648_10036449 | Ga0207648_100364492 | 333 |
| 790 | 3300026089 | Ga0207648_10042309 | Ga0207648_100423092 | 333 |
| 791 | 3300026095 | Ga0207676_10063266 | Ga0207676_100632663 | 333 |
| 792 | 3300026095 | Ga0207676_10223176 | Ga0207676_102231762 | 333 |
| 793 | 3300026095 | Ga0207676_10348413 | Ga0207676_103484131 | 333 |
| 794 | 3300026095 | Ga0207676_10355882 | Ga0207676_103558821 | 333 |
| 795 | 3300026116 | Ga0207674_10000672 | Ga0207674_1000067210 | 333 |
| 796 | 3300026116 | Ga0207674_10006740 | Ga0207674_1000674012 | 333 |
| 797 | 3300026116 | Ga0207674_10114299 | Ga0207674_101142992 | 333 |
| 798 | 3300026116 | Ga0207674_10160935 | Ga0207674_101609352 | 333 |
| 799 | 3300026116 | Ga0207674_10178043 | Ga0207674_101780433 | 333 |
| 800 | 3300026118 | Ga0207675_100014435 | Ga0207675_1000144354 | 333 |
| 801 | 3300026118 | Ga0207675_100066138 | Ga0207675_1000661383 | 333 |
| 802 | 3300026118 | Ga0207675_100134293 | Ga0207675_1001342932 | 333 |
| 803 | 3300026121 | Ga0207683_10003712 | Ga0207683_100037127 | 333 |
| 804 | 3300026121 | Ga0207683_10005010 | Ga0207683_100050105 | 333 |
| 805 | 3300026121 | Ga0207683_10065629 | Ga0207683_100656292 | 333 |
| 806 | 3300026121 | Ga0207683_10117716 | Ga0207683_101177162 | 333 |
| 807 | 3300026142 | Ga0207698_10001082 | Ga0207698_1000108217 | 333 |
| 808 | 3300026142 | Ga0207698_10011290 | Ga0207698_100112907 | 333 |
| 809 | 3300026142 | Ga0207698_10055732 | Ga0207698_100557322 | 333 |
| 810 | 3300028379 | Ga0268266_10000018 | Ga0268266_10000018283 | 333 |
| 811 | 3300028379 | Ga0268266_10085801 | Ga0268266_100858012 | 333 |
| 812 | 3300028379 | Ga0268266_10090778 | Ga0268266_100907782 | 333 |
| 813 | 3300028380 | Ga0268265_10014622 | Ga0268265_100146222 | 333 |
| 814 | 3300028380 | Ga0268265_10099403 | Ga0268265_100994032 | 333 |
| 815 | 3300028381 | Ga0268264_10001720 | Ga0268264_1000172013 | 333 |
| 816 | 3300028381 | Ga0268264_10009362 | Ga0268264_100093623 | 333 |
| 817 | 3300028381 | Ga0268264_10047708 | Ga0268264_100477082 | 333 |
| 818 | 3300028786 | Ga0307517_10002048 | Ga0307517_100020488 | 333 |
| 819 | 3300028786 | Ga0307517_10004683 | Ga0307517_1000468314 | 333 |
| 820 | 3300028794 | Ga0307515_10001752 | Ga0307515_1000175246 | 333 |
| 821 | 3300028794 | Ga0307515_10002910 | Ga0307515_1000291030 | 333 |
| 822 | 3300028794 | Ga0307515_10014453 | Ga0307515_1001445310 | 333 |
| 823 | 3300030731 | Ga0316177_1198244 | Ga0316177_11982444 | 333 |
| 824 | 3300030732 | Ga0316176_1050137 | Ga0316176_10501376 | 333 |
| 825 | 3300030742 | Ga0316183_1065995 | Ga0316183_10659958 | 333 |
| 826 | 3300030744 | Ga0316181_1148726 | Ga0316181_11487267 | 333 |
| 827 | 3300031251 | Ga0265327_10000010 | Ga0265327_10000010315 | 333 |
| 828 | 3300031456 | Ga0307513_10156292 | Ga0307513_101562921 | 333 |
| 829 | 3300031507 | Ga0307509_10048545 | Ga0307509_100485453 | 333 |
| 830 | 3300031616 | Ga0307508_10002100 | Ga0307508_1000210015 | 333 |
| 831 | 3300031730 | Ga0307516_10003117 | Ga0307516_1000311710 | 333 |
| 832 | 3300031731 | Ga0307405_10000003 | Ga0307405_1000000370 | 333 |
| 833 | 3300031731 | Ga0307405_10014179 | Ga0307405_100141792 | 333 |
| 834 | 3300031731 | Ga0307405_10059446 | Ga0307405_100594462 | 333 |
| 835 | 3300031824 | Ga0307413_10178076 | Ga0307413_101780762 | 333 |
| 836 | 3300031852 | Ga0307410_10194020 | Ga0307410_101940201 | 333 |
| 837 | 3300031901 | Ga0307406_10117919 | Ga0307406_101179192 | 333 |
| 838 | 3300031903 | Ga0307407_10000008 | Ga0307407_1000000882 | 333 |
| 839 | 3300031911 | Ga0307412_10000427 | Ga0307412_100004275 | 333 |
| 840 | 3300031911 | Ga0307412_10037619 | Ga0307412_100376192 | 333 |
| 841 | 3300031995 | Ga0307409_100008566 | Ga0307409_1000085668 | 333 |
| 842 | 3300032002 | Ga0307416_100000009 | Ga0307416_100000009228 | 333 |
| 843 | 3300032002 | Ga0307416_100113426 | Ga0307416_1001134262 | 333 |
| 844 | 3300032004 | Ga0307414_10000038 | Ga0307414_10000038108 | 333 |
| 845 | 3300032004 | Ga0307414_10002879 | Ga0307414_100028793 | 333 |
| 846 | 3300032004 | Ga0307414_10012334 | Ga0307414_100123345 | 333 |
| 847 | 3300032004 | Ga0307414_10034651 | Ga0307414_100346513 | 333 |
| 848 | 3300032004 | Ga0307414_10105314 | Ga0307414_101053142 | 333 |
| 849 | 3300032004 | Ga0307414_10242776 | Ga0307414_102427762 | 333 |
| 850 | 3300033179 | Ga0307507_10000064 | Ga0307507_1000006454 | 333 |
| 851 | 3300033180 | Ga0307510_10002860 | Ga0307510_1000286014 | 333 |
| 852 | 3300035695 | Ga0373927_0037163 | Ga0373927_0037163_1107_2162 | 333 |
| 853 | 3300036401 | Ga0373937_0023482 | Ga0373937_0023482_2762_3811 | 333 |
| 854 | 3300036401 | Ga0373937_0152899 | Ga0373937_0152899_842_1894 | 333 |
| 855 | 3300036401 | Ga0373937_0250410 | Ga0373937_0250410_532_1575 | 333 |
| 856 | 3300037068 | Ga0373925_0104333 | Ga0373925_0104333_370_1422 | 333 |
| 857 | 3300037312 | Ga0395899_0000033 | Ga0395899_0000033_33867_35015 | 333 |
| 858 | 3300037312 | Ga0395899_0000493 | Ga0395899_0000493_26768_27814 | 333 |
| 859 | 3300037312 | Ga0395899_0000629 | Ga0395899_0000629_15706_16752 | 333 |
| 860 | 3300037312 | Ga0395899_0001884 | Ga0395899_0001884_5172_6224 | 333 |
| 861 | 3300037312 | Ga0395899_0029186 | Ga0395899_0029186_1222_2274 | 333 |
| 862 | 3300037312 | Ga0395899_0029721 | Ga0395899_0029721_2811_3857 | 333 |
| 863 | 3300037312 | Ga0395899_0041383 | Ga0395899_0041383_1327_2379 | 333 |
| 864 | 3300037312 | Ga0395899_0066951 | Ga0395899_0066951_1526_2578 | 333 |
| 865 | 3300037312 | Ga0395899_0133975 | Ga0395899_0133975_221_1273 | 333 |
| 866 | 3300037418 | Ga0395900_0000480 | Ga0395900_0000480_32175_33221 | 333 |
| 867 | 3300037418 | Ga0395900_0000506 | Ga0395900_0000506_31879_32937 | 333 |
| 868 | 3300037418 | Ga0395900_0006601 | Ga0395900_0006601_6048_7100 | 333 |
| 869 | 3300037418 | Ga0395900_0009920 | Ga0395900_0009920_3248_4294 | 333 |
| 870 | 3300037418 | Ga0395900_0012177 | Ga0395900_0012177_4034_5086 | 333 |
| 871 | 3300037418 | Ga0395900_0175354 | Ga0395900_0175354_894_1946 | 333 |
| 872 | 3300037418 | Ga0395900_0179537 | Ga0395900_0179537_904_1968 | 333 |
| 873 | 3300037466 | Ga0395898_0001651 | Ga0395898_0001651_21201_22253 | 333 |
| 874 | 3300037466 | Ga0395898_0032624 | Ga0395898_0032624_1385_2437 | 333 |
| 875 | 3300037466 | Ga0395898_0041094 | Ga0395898_0041094_128_1180 | 333 |
| 876 | 3300037466 | Ga0395898_0056108 | Ga0395898_0056108_1983_3035 | 333 |
| 877 | 3300037471 | Ga0395905_0000254 | Ga0395905_0000254_407_1453 | 333 |
| 878 | 3300037471 | Ga0395905_0000738 | Ga0395905_0000738_9875_10921 | 333 |
| 879 | 3300037471 | Ga0395905_0001166 | Ga0395905_0001166_27547_28593 | 333 |
| 880 | 3300037471 | Ga0395905_0006569 | Ga0395905_0006569_3982_5034 | 333 |
| 881 | 3300038443 | Ga0395901_0000853 | Ga0395901_0000853_9853_10899 | 333 |
| 882 | 3300038443 | Ga0395901_0004350 | Ga0395901_0004350_2692_3744 | 333 |
| 883 | 3300038443 | Ga0395901_0010578 | Ga0395901_0010578_3872_4924 | 333 |
| 884 | 3300038443 | Ga0395901_0059253 | Ga0395901_0059253_689_1741 | 333 |
| 885 | 3300038443 | Ga0395901_0067844 | Ga0395901_0067844_866_1918 | 333 |
| 886 | 3300038443 | Ga0395901_0081109 | Ga0395901_0081109_1898_2950 | 333 |
| 887 | 3300038443 | Ga0395901_0119295 | Ga0395901_0119295_60_1106 | 333 |
| 888 | 3300039447 | Ga0436361_0021149 | Ga0436361_0021149_4473_5519 | 333 |
| 889 | 3300042005 | Ga0439448_0022307 | Ga0439448_0022307_907_1953 | 333 |
| 890 | 3300042876 | Ga0451577_0000010 | Ga0451577_0000010_365692_366750 | 333 |
| 891 | 3300042876 | Ga0451577_0068138 | Ga0451577_0068138_2053_3150 | 333 |
| 892 | 3300044656 | Ga0466969_0000912 | Ga0466969_0000912_5620_6675 | 333 |
| 893 | 3300044656 | Ga0466969_0053439 | Ga0466969_0053439_252_1298 | 333 |
| 894 | 3300044656 | Ga0466969_0098395 | Ga0466969_0098395_40_1089 | 333 |
| 895 | 3300044658 | Ga0466972_0000013 | Ga0466972_0000013_70900_71955 | 333 |
| 896 | 3300044658 | Ga0466972_0005607 | Ga0466972_0005607_2714_3793 | 333 |
| 897 | 3300044673 | Ga0453683_0000031 | Ga0453683_0000031_14214_15257 | 333 |
| 898 | 3300044673 | Ga0453683_0001482 | Ga0453683_0001482_151_1194 | 333 |
| 899 | 3300044673 | Ga0453683_0085783 | Ga0453683_0085783_570_1628 | 333 |
| 900 | 3300044684 | Ga0466966_0000045 | Ga0466966_0000045_88635_89690 | 333 |
| 901 | 3300044684 | Ga0466966_0053935 | Ga0466966_0053935_1411_2457 | 333 |
| 902 | 3300044693 | Ga0466961_0066482 | Ga0466961_0066482_627_1676 | 333 |
| 903 | 3300044693 | Ga0466961_0088177 | Ga0466961_0088177_743_1789 | 333 |
| 904 | 3300044712 | Ga0453684_0000191 | Ga0453684_0000191_249937_250995 | 333 |
| 905 | 3300044712 | Ga0453684_0178992 | Ga0453684_0178992_1122_2219 | 333 |
| 906 | 3300044712 | Ga0453684_0192947 | Ga0453684_0192947_746_1801 | 333 |
| 907 | 3300044712 | Ga0453684_0311331 | Ga0453684_0311331_557_1639 | 333 |
| 908 | 3300044712 | Ga0453684_0442253 | Ga0453684_0442253_92_1174 | 333 |
| 909 | 3300044735 | Ga0466968_0089549 | Ga0466968_0089549_67_1113 | 333 |
| 910 | 3300044765 | Ga0466970_0018485 | Ga0466970_0018485_847_1893 | 333 |
| 911 | 3300044765 | Ga0466970_0069434 | Ga0466970_0069434_770_1819 | 333 |
| 912 | 3300044842 | Ga0466957_0003333 | Ga0466957_0003333_4785_5840 | 333 |
| 913 | 3300044842 | Ga0466957_0152139 | Ga0466957_0152139_140_1189 | 333 |
| 914 | 3300045049 | Ga0466959_0000023 | Ga0466959_0000023_94818_95873 | 333 |
| 915 | 3300045049 | Ga0466959_0083862 | Ga0466959_0083862_751_1824 | 333 |
| 916 | 3300045051 | Ga0451576_0000088 | Ga0451576_0000088_5222_6280 | 333 |
| 917 | 3300045051 | Ga0451576_0040329 | Ga0451576_0040329_2608_3651 | 333 |
| 918 | 3300045051 | Ga0451576_0204986 | Ga0451576_0204986_180_1223 | 333 |
| 919 | 3300046459 | Ga0495629_0035357 | Ga0495629_0035357_1974_3026 | 333 |
| 920 | 3300046460 | Ga0495638_0049677 | Ga0495638_0049677_1238_2293 | 333 |
| 921 | 3300046462 | Ga0495651_0090903 | Ga0495651_0090903_607_1653 | 333 |
| 922 | 3300046471 | Ga0495650_0000087 | Ga0495650_0000087_13660_14706 | 333 |
| 923 | 3300046492 | Ga0495585_0000286 | Ga0495585_0000286_40493_41539 | 333 |
| 924 | 3300046492 | Ga0495585_0001651 | Ga0495585_0001651_13233_14291 | 333 |
| 925 | 3300046506 | Ga0495583_0094765 | Ga0495583_0094765_28_1074 | 333 |
| 926 | 3300046507 | Ga0495606_0000052 | Ga0495606_0000052_180288_181334 | 333 |
| 927 | 3300046507 | Ga0495606_0014847 | Ga0495606_0014847_3437_4483 | 333 |
| 928 | 3300046512 | Ga0495610_0000903 | Ga0495610_0000903_7344_8390 | 333 |
| 929 | 3300046512 | Ga0495610_0006770 | Ga0495610_0006770_1920_2975 | 333 |
| 930 | 3300046512 | Ga0495610_0010020 | Ga0495610_0010020_798_1838 | 333 |
| 931 | 3300046513 | Ga0495616_0005196 | Ga0495616_0005196_4149_5195 | 333 |
| 932 | 3300046514 | Ga0495618_0007268 | Ga0495618_0007268_378_1427 | 333 |
| 933 | 3300046516 | Ga0495628_0017891 | Ga0495628_0017891_1748_2797 | 333 |
| 934 | 3300046517 | Ga0495630_0049633 | Ga0495630_0049633_971_2020 | 333 |
| 935 | 3300046517 | Ga0495630_0116104 | Ga0495630_0116104_834_1886 | 333 |
| 936 | 3300046518 | Ga0495631_0027708 | Ga0495631_0027708_606_1652 | 333 |
| 937 | 3300046523 | Ga0495644_0007188 | Ga0495644_0007188_991_2037 | 333 |
| 938 | 3300046524 | Ga0495648_0077885 | Ga0495648_0077885_258_1358 | 333 |
| 939 | 3300046533 | Ga0495640_0061455 | Ga0495640_0061455_1313_2362 | 333 |
| 940 | 3300046537 | Ga0495598_0027721 | Ga0495598_0027721_138_1184 | 333 |
| 941 | 3300046558 | Ga0495633_0000080 | Ga0495633_0000080_4158_5207 | 333 |
| 942 | 3300046558 | Ga0495633_0000081 | Ga0495633_0000081_44430_45488 | 333 |
| 943 | 3300046558 | Ga0495633_0072173 | Ga0495633_0072173_424_1476 | 333 |
| 944 | 3300046616 | Ga0495668_0000012 | Ga0495668_0000012_277755_278813 | 333 |
| 945 | 3300046642 | Ga0495634_0069334 | Ga0495634_0069334_1080_2129 | 333 |
| 946 | 3300046660 | Ga0495625_0000036 | Ga0495625_0000036_9029_10075 | 333 |
| 947 | 3300046660 | Ga0495625_0002289 | Ga0495625_0002289_9086_10144 | 333 |
| 948 | 3300046660 | Ga0495625_0010136 | Ga0495625_0010136_1355_2407 | 333 |
| 949 | 3300046660 | Ga0495625_0014574 | Ga0495625_0014574_3242_4288 | 333 |
| 950 | 3300046660 | Ga0495625_0021139 | Ga0495625_0021139_3209_4360 | 333 |
| 951 | 3300046660 | Ga0495625_0091239 | Ga0495625_0091239_526_1572 | 333 |
| 952 | 3300046660 | Ga0495625_0233913 | Ga0495625_0233913_72_1148 | 333 |
| 953 | 3300046665 | Ga0495661_0003611 | Ga0495661_0003611_7909_8955 | 333 |
| 954 | 3300046665 | Ga0495661_0092978 | Ga0495661_0092978_46_1092 | 333 |
| 955 | 3300046680 | Ga0495646_0058441 | Ga0495646_0058441_27_1076 | 333 |
| 956 | 3300046683 | Ga0495658_0017216 | Ga0495658_0017216_515_1573 | 333 |
| 957 | 3300046683 | Ga0495658_0020389 | Ga0495658_0020389_1482_2534 | 333 |
| 958 | 3300046684 | Ga0495669_0058397 | Ga0495669_0058397_539_1585 | 333 |
| 959 | 3300046689 | Ga0495613_0161327 | Ga0495613_0161327_251_1297 | 333 |
| 960 | 3300046694 | Ga0495649_0000017 | Ga0495649_0000017_211636_212682 | 333 |
| 961 | 3300046794 | Ga0495589_0123181 | Ga0495589_0123181_190_1236 | 333 |
| 962 | 3300046810 | Ga0495660_0013731 | Ga0495660_0013731_2475_3521 | 333 |
| 963 | 3300047319 | Ga0495674_0018467 | Ga0495674_0018467_3409_4461 | 333 |
| 964 | 3300047323 | Ga0495683_0023732 | Ga0495683_0023732_1219_2265 | 333 |
| 965 | 3300047443 | Ga0495687_055425 | Ga0495687_055425_22_1068 | 333 |
| 966 | 3300047469 | Ga0495673_0068477 | Ga0495673_0068477_369_1415 | 333 |
| 967 | 3300047471 | Ga0495684_0161177 | Ga0495684_0161177_245_1297 | 333 |
| 968 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_410320_411369 | 333 |
| 969 | 3300047472 | Ga0495686_0000582 | Ga0495686_0000582_22710_23753 | 333 |
| 970 | 3300047472 | Ga0495686_0005494 | Ga0495686_0005494_8662_9708 | 333 |
| 971 | 3300047472 | Ga0495686_0020028 | Ga0495686_0020028_723_1793 | 333 |
| 972 | 3300048912 | Ga0496109_0054915 | Ga0496109_0054915_1872_2924 | 333 |
| 973 | 3300048917 | Ga0496114_0369263 | Ga0496114_0369263_90_1133 | 333 |
| 974 | 3300048918 | Ga0496115_0045415 | Ga0496115_0045415_1197_2240 | 333 |
| 975 | 3300048925 | Ga0496122_0001208 | Ga0496122_0001208_13526_14566 | 333 |
| 976 | 3300048926 | Ga0496123_0008537 | Ga0496123_0008537_2599_3639 | 333 |
| 977 | 3300048927 | Ga0496124_0111474 | Ga0496124_0111474_39_1085 | 333 |
| 978 | 3300048928 | Ga0496125_0011341 | Ga0496125_0011341_7572_8612 | 333 |
| 979 | 3300048929 | Ga0496126_0022457 | Ga0496126_0022457_2884_3942 | 333 |
| 980 | 3300048929 | Ga0496126_0212279 | Ga0496126_0212279_239_1285 | 333 |
| 981 | 3300049459 | Ga0495678_014851 | Ga0495678_014851_953_2104 | 333 |
| 982 | 3300049568 | Ga0501031_0003605 | Ga0501031_0003605_351_1400 | 333 |
| 983 | 3300049569 | Ga0501032_0091050 | Ga0501032_0091050_79_1128 | 333 |
| 984 | 3300049570 | Ga0501033_0010675 | Ga0501033_0010675_1064_2122 | 333 |
| 985 | 3300049571 | Ga0501034_0004012 | Ga0501034_0004012_11465_12517 | 333 |
| 986 | 3300049571 | Ga0501034_0016530 | Ga0501034_0016530_3826_4875 | 333 |
| 987 | 3300049571 | Ga0501034_0025459 | Ga0501034_0025459_486_1640 | 333 |
| 988 | 3300049571 | Ga0501034_0027052 | Ga0501034_0027052_1463_2521 | 333 |
| 989 | 3300049571 | Ga0501034_0146271 | Ga0501034_0146271_84_1133 | 333 |
| 990 | 3300049571 | Ga0501034_0330791 | Ga0501034_0330791_170_1213 | 333 |
| 991 | 3300049572 | Ga0501036_0041913 | Ga0501036_0041913_314_1363 | 333 |
| 992 | 3300049573 | Ga0501037_0039086 | Ga0501037_0039086_1929_2978 | 333 |
| 993 | 3300049574 | Ga0501038_0012291 | Ga0501038_0012291_5552_6601 | 333 |
| 994 | 3300049575 | Ga0501039_0022501 | Ga0501039_0022501_2689_3738 | 333 |
| 995 | 3300049579 | Ga0501043_0009607 | Ga0501043_0009607_6331_7380 | 333 |
| 996 | 3300049579 | Ga0501043_0024314 | Ga0501043_0024314_1446_2495 | 333 |
| 997 | 3300049579 | Ga0501043_0028424 | Ga0501043_0028424_1620_2774 | 333 |
| 998 | 3300049580 | Ga0501046_0045170 | Ga0501046_0045170_1223_2272 | 333 |
| 999 | 3300049580 | Ga0501046_0239907 | Ga0501046_0239907_133_1182 | 333 |
| 1000 | 3300049581 | Ga0501047_0021075 | Ga0501047_0021075_2332_3384 | 333 |
| 1001 | 3300049581 | Ga0501047_0027231 | Ga0501047_0027231_537_1607 | 333 |
| 1002 | 3300049581 | Ga0501047_0066956 | Ga0501047_0066956_1805_2848 | 333 |
| 1003 | 3300049581 | Ga0501047_0072959 | Ga0501047_0072959_1227_2276 | 333 |
| 1004 | 3300049581 | Ga0501047_0332711 | Ga0501047_0332711_180_1292 | 333 |
| 1005 | 3300049582 | Ga0501048_0043141 | Ga0501048_0043141_1330_2379 | 333 |
| 1006 | 3300049583 | Ga0501067_0095409 | Ga0501067_0095409_387_1430 | 333 |
| 1007 | 3300049584 | Ga0501068_0153904 | Ga0501068_0153904_162_1205 | 333 |
| 1008 | 3300049585 | Ga0501069_0081356 | Ga0501069_0081356_723_1814 | 333 |
| 1009 | 3300049589 | Ga0501073_0019693 | Ga0501073_0019693_3698_4747 | 333 |
| 1010 | 3300049590 | Ga0501074_0062516 | Ga0501074_0062516_859_1908 | 333 |
| 1011 | 3300049649 | Ga0501198_002157 | Ga0501198_002157_1127_2182 | 333 |
| 1012 | 3300049652 | Ga0501202_002208 | Ga0501202_002208_1580_2635 | 333 |
| 1013 | 3300049661 | Ga0501217_000620 | Ga0501217_000620_3932_4987 | 333 |
| 1014 | 3300049661 | Ga0501217_022688 | Ga0501217_022688_32_1090 | 333 |
| 1015 | 3300049668 | Ga0501233_010478 | Ga0501233_010478_337_1392 | 333 |
| 1016 | 3300049675 | Ga0501243_008416 | Ga0501243_008416_20_1087 | 333 |
| 1017 | 3300049679 | Ga0501249_008390 | Ga0501249_008390_34_1107 | 333 |
| 1018 | 3300049679 | Ga0501249_009305 | Ga0501249_009305_273_1313 | 333 |
| 1019 | 3300049686 | Ga0501257_016312 | Ga0501257_016312_196_1260 | 333 |
| 1020 | 3300049703 | Ga0501219_000052 | Ga0501219_000052_17275_18327 | 333 |
| 1021 | 3300049704 | Ga0501221_000044 | Ga0501221_000044_4297_5352 | 333 |
| 1022 | 3300049705 | Ga0501225_0001739 | Ga0501225_0001739_848_1900 | 333 |
| 1023 | 3300049705 | Ga0501225_0013111 | Ga0501225_0013111_1124_2179 | 333 |
| 1024 | 3300049708 | Ga0501245_002249 | Ga0501245_002249_126_1181 | 333 |
| 1025 | 3300049742 | Ga0501080_0057861 | Ga0501080_0057861_988_2037 | 333 |
| 1026 | 3300049742 | Ga0501080_0123580 | Ga0501080_0123580_1268_2326 | 333 |
| 1027 | 3300049758 | Ga0501241_000031 | Ga0501241_000031_22825_23880 | 333 |
| 1028 | 3300049822 | Ga0501035_0015438 | Ga0501035_0015438_1226_2275 | 333 |
| 1029 | 3300049822 | Ga0501035_0027505 | Ga0501035_0027505_2694_3746 | 333 |
| 1030 | 3300049823 | Ga0501044_0017840 | Ga0501044_0017840_4348_5397 | 333 |
| 1031 | 3300049823 | Ga0501044_0028924 | Ga0501044_0028924_1853_2911 | 333 |
| 1032 | 3300049823 | Ga0501044_0052694 | Ga0501044_0052694_2143_3192 | 333 |
| 1033 | 3300050005 | Ga0501284_00029 | Ga0501284_00029_20602_21654 | 333 |
| 1034 | 3300050493 | nmdc:mga0k408_3518_c1 | nmdc:mga0k408_3518_c1_4238_5284 | 333 |
| 1035 | 3300050493 | nmdc:mga0k408_749_c1 | nmdc:mga0k408_749_c1_16735_17781 | 333 |
| 1036 | 3300050493 | nmdc:mga0k408_821_c1 | nmdc:mga0k408_821_c1_5301_6353 | 333 |
| 1037 | 3300050507 | nmdc:mga05p37_13616_c1 | nmdc:mga05p37_13616_c1_8055_9113 | 333 |
| 1038 | 3300050508 | nmdc:mga09592_983_c1 | nmdc:mga09592_983_c1_20713_21759 | 333 |
| 1039 | 3300050509 | nmdc:mga0qj67_97741_c1 | nmdc:mga0qj67_97741_c1_20_1066 | 333 |
| 1040 | 3300053080 | Ga0500635_0002671 | Ga0500635_0002671_3196_4242 | 333 |
| 1041 | 3300053085 | Ga0495619_0170484 | Ga0495619_0170484_310_1359 | 333 |
| 1042 | 3300053086 | Ga0500578_0004418 | Ga0500578_0004418_1856_2986 | 333 |
| 1043 | 3300053090 | Ga0500646_0001428 | Ga0500646_0001428_1811_2857 | 333 |
| 1044 | 3300053092 | Ga0500583_0000108 | Ga0500583_0000108_26630_27685 | 333 |
| 1045 | 3300053093 | Ga0500651_0000084 | Ga0500651_0000084_57884_58954 | 333 |
| 1046 | 3300053093 | Ga0500651_0064350 | Ga0500651_0064350_933_1982 | 333 |
| 1047 | 3300053122 | Ga0500608_016279 | Ga0500608_016279_1117_2163 | 333 |
| 1048 | 3300053125 | Ga0500618_000002 | Ga0500618_000002_53355_54404 | 333 |
| 1049 | 3300053131 | Ga0500652_037526 | Ga0500652_037526_829_1884 | 333 |
| 1050 | 3300053147 | Ga0500589_003337 | Ga0500589_003337_3997_5052 | 333 |
| 1051 | 3300053153 | Ga0500616_0145895 | Ga0500616_0145895_38_1090 | 333 |
| 1052 | 3300053156 | Ga0500622_0000777 | Ga0500622_0000777_19536_20585 | 333 |
| 1053 | 3300053156 | Ga0500622_0004557 | Ga0500622_0004557_1211_2257 | 333 |
| 1054 | 3300053157 | Ga0500624_000271 | Ga0500624_000271_16319_17452 | 333 |
| 1055 | 3300053177 | Ga0500636_0044658 | Ga0500636_0044658_1305_2360 | 333 |
| 1056 | 3300053727 | Ga0500611_000022 | Ga0500611_000022_87747_88802 | 333 |
| 1057 | 3300061719 | Ga0466962_0023524 | Ga0466962_0023524_1243_2292 | 333 |
| 1058 | iso_pu_bacteria | 2522125168 | 2522551056 | 333 |
| 1059 | iso_pu_bacteria | 8055588893 | 8055589911 | 333 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wbt-assembly1.cif.gz_C-2 | crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate | 0.9043 | 43 | 332 |
| 3ly1-assembly1.cif.gz_B | crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution | 0.9022 | 43 | 332 |
| 3ftb-assembly2.cif.gz_E | the crystal structure of the histidinol-phosphate aminotransferase from clostridium acetobutylicum | 0.9018 | 35 | 332 |
| 4r5z-assembly2.cif.gz_D | crystal structure of rv3772 encoded aminotransferase | 0.8977 | 35 | 332 |
| 3ftb-assembly2.cif.gz_D | the crystal structure of the histidinol-phosphate aminotransferase from clostridium acetobutylicum | 0.8947 | 35 | 332 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P06986_261_350_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9944 | 240 | 328 | 3.90.1150.10 |
| af_P36605_51_267_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9746 | 44 | 238 | 3.40.640.10 |
| af_P06986_261_350_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9726 | 240 | 328 | 3.90.1150.10 |
| af_P07172_76_273_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.969 | 55 | 237 | 3.40.640.10 |
| 1fg7A01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9622 | 41 | 238 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A376W9F3-F1-model_v4 | histidinol-phosphate transaminase (EC 2.6.1.9) | 0.9944 | 249 | 333 |
GO:0004400
GO:0008652 GO:0030170 |
| AF-A0A645C0K0-F1-model_v4 | Histidine biosynthesis bifunctional protein HisB | 0.9889 | 251 | 332 |
GO:0000105
GO:0004424 GO:0030170 |
| AF-A0A7S2TT69-F1-model_v4 | histidinol-phosphate transaminase (EC 2.6.1.9) (Imidazole acetol-phosphate transaminase) | 0.988 | 45 | 332 |
GO:0000105
GO:0004400 GO:0030170 |
| AF-A0A1F3N601-F1-model_v4 | Aminotransferase class I/classII large domain-containing protein | 0.9812 | 191 | 333 |
GO:0000105
GO:0008483 GO:0030170 |
| AF-A0A705R659-F1-model_v4 | Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol-phosphate transaminase) | 0.9798 | 60 | 333 |
GO:0000105
GO:0004400 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar