F489252

General Info

Members Datasets Scaffolds Average Seq Length
1059 432 987 348

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0000033|Ga0395899_0000033_33867_35015
Length 382
Sequence MSLRGGTTKQPHRVQYQSDEIATLSLEMTQSTNETMFSINNIIRKNIANLTPYSSARDEFQGEASVYLDANENAFGSPLEQQYNRYPDPLQYKVKKRLSEIKGVPPRNIFLGNGSDEAIDILFRSFCNPGVDNVILVPPTYGMYEVSANINDIQIKKVKLTEEYQLNLEGIAEAIDEHTKMIFVCSPNNPTGNSINRDDIETLLANFNGLIVIDEAYINFSRQKSFIQELTEYANLVVLQTLSKAWGLAGLRVGMAFASEEIIEVMNKVKPPYNINEASQDLALKALENVDQVNQWIREILNQRDRLVLTLKNFDFVQDIYPSDANFILVKTTAPKDIYNFLVDKGIIVRDRSKVDLCEGCLRITVGTPAENDVLLEALGKF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
6 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
7 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
8 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
9 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
10 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
11 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
12 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
13 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
14 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
15 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
16 2738541283 Pedobacter sp. OK701 Isolate Unclassified
17 2738541284 Pedobacter sp. YR016 Isolate Unclassified
18 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
19 2738541302 Pedobacter sp. CF074 Isolate Unclassified
20 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
21 2738543023 Pedobacter sp. OK628 Isolate Unclassified
22 2739367651 Pedobacter sp. OK291 Isolate Unclassified
23 2739367656 Pedobacter sp. CF523 Isolate Unclassified
24 2739367663 Pedobacter sp. YR510 Isolate Unclassified
25 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
26 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
27 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
28 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
29 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
30 2818991437 Pedobacter terrae 518 Isolate Unclassified
31 2818991444 Filimonas endophytica 3197 Isolate Unclassified
32 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
33 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
34 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
35 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
36 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
37 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
38 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
39 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
40 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
41 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
42 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
43 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
44 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
45 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
46 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
47 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
48 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
49 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
50 2914759650 Rhizosphaericola mali Isolate Rhizosphere
51 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
52 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
53 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
54 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
55 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
56 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
57 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
58 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
59 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
60 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
61 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
62 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
63 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
64 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
65 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
66 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
67 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
68 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
69 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
70 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
71 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
72 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
73 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
74 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
75 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
76 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
77 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
78 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
79 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
80 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
81 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
82 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
83 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
84 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
85 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
86 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
87 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
88 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
89 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
90 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
91 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
92 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
93 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
94 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
95 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
96 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
97 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
98 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
99 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
100 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
101 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
102 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
103 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
104 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
105 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
106 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
107 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
108 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
109 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
110 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
111 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
112 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
113 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
114 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
115 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
116 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
117 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
118 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
119 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
120 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
121 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
122 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
123 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
124 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
125 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
126 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
127 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
128 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
129 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
130 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
131 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
132 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
133 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
134 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
135 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
136 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
137 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
138 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
139 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
140 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
141 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
142 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
143 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
144 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
145 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
146 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
147 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
148 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
149 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
150 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
151 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
152 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
153 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
154 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
155 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
156 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
157 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
158 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
159 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
160 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
161 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
162 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
163 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
164 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
165 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
166 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
167 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
168 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
169 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
170 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
171 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
172 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
173 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
174 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
175 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
176 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
177 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
178 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
179 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
180 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
181 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
182 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
183 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
184 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
185 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
186 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
187 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
188 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
189 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
190 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
191 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
192 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
193 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
194 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
195 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
196 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
197 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
198 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
199 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
200 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
201 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
202 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
205 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
206 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
208 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
261 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
265 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
270 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
271 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
272 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
273 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
274 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
275 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
276 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
277 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
278 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
279 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
280 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
281 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
282 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
283 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
284 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
285 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
286 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
287 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
288 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
289 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
290 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
291 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
292 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
293 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
294 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
295 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
296 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
297 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
298 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
299 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
300 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
301 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
302 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
303 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
304 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
305 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
306 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
307 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
308 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
309 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
310 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
311 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
312 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
313 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
314 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
315 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
316 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
317 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
318 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
319 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
320 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
321 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
322 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
323 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
324 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
325 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
326 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
327 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
328 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
329 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
330 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
331 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
332 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
333 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
334 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
335 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
336 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
337 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
340 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
341 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
342 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
343 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
344 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
345 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
346 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
347 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
348 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
349 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
350 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
351 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
352 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
353 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
354 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
355 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
356 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
357 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
358 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
359 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
360 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
361 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
362 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
363 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
364 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
365 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
366 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
367 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
368 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
369 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
382 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
383 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
384 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
385 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
386 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
387 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
388 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
389 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
390 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
391 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
392 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
393 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
394 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
395 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
396 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
397 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
398 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
399 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
400 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
402 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
403 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
404 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
405 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
406 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
407 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
408 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
409 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
410 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
411 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
412 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
413 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
414 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
415 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
416 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
417 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
418 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
419 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
420 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
421 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
422 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
423 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
424 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
425 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
426 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
427 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
428 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
429 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
430 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
431 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
432 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.01
Metatranscriptomes 0.09
Isolates 6.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.04
Nodule 0.38
Rhizoplane 0.57
Rhizosphere 84.04
Stem 0
Stem Tuber 0
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_787417 2162886007 Bacteria 8367
2 JGI24736J21556_1003139 3300001904 Bacteria 2878
3 JGI24740J21852_10020774 3300001979 Bacteria 2284
4 JGI24737J22298_10007120 3300001990 Bacteria 3790
5 JGI24735J21928_10000004 3300002067 Bacteria 381713
6 JGI25162J39368_1000011 3300002737 Bacteria 379156
7 JGI25162J39368_1000614 3300002737 Bacteria 25616
8 JGI25154J39366_1000040 3300002738 Bacteria 147410
9 JGI25157J39369_1003731 3300002741 Bacteria 3001
10 JGI25157J39369_1004254 3300002741 Bacteria 2655
11 JGI25164J39214_1003371 3300002772 Bacteria 2048
12 JGI25152J39213_1000143 3300002773 Bacteria 48715
13 JGI25150J39212_1000001 3300002774 Bacteria 1318726
14 JGI25151J46595_10000001 3300003187 Bacteria 887211
15 JGI25165J46597_1000985 3300003214 Bacteria 19074
16 JGI25153J46596_10000001 3300003215 Bacteria 748985
17 JGI25153J46596_10003346 3300003215 Bacteria 9003
18 rootH1_10024829 3300003316 Bacteria 25564
19 rootH1_10063239 3300003316 Bacteria 6361
20 rootH1_10140822 3300003316 Bacteria 2510
21 rootH2_10001891 3300003320 Bacteria 464318
22 rootH2_10003679 3300003320 Bacteria 27278
23 rootH2_10013742 3300003320 Bacteria 11980
24 rootH2_10053227 3300003320 Bacteria 9083
25 rootH2_10090920 3300003320 Bacteria 6366
26 rootH2_10184838 3300003320 Bacteria 1249
27 rootL2_10017790 3300003322 Bacteria 3190
28 rootL2_10028141 3300003322 Bacteria 3723
29 rootL2_10030620 3300003322 Bacteria 1870
30 rootL2_10058669 3300003322 Bacteria 5201
31 rootL2_10107720 3300003322 Bacteria 5516
32 rootL2_10223865 3300003322 Bacteria 3144
33 rootL2_10315621 3300003322 Bacteria 2427
34 rootH1_10000019 3300003316 Bacteria 18606
35 rootH1_10000019 3300003323 Bacteria 34919
36 rootH1_10008801 3300003323 Bacteria 13652
37 rootH1_10035284 3300003323 Bacteria 47456
38 rootH1_10054491 3300003323 Bacteria 2542
39 rootH1_10163486 3300003323 Bacteria 2011
40 rootH1_10178453 3300003323 Bacteria 2808
41 rootH1_10298335 3300003323 Unclassified 3330
42 JGI25160J50197_1006644 3300003354 Bacteria 4654
43 Ga0006562J51391_1016454 3300003578 Bacteria 2028
44 Ga0055536_1000001 3300003781 Bacteria 630663
45 Ga0055530_10004772 3300003791 Bacteria 6816
46 Ga0055531_10000131 3300003794 Bacteria 85257
47 Ga0065165_1000300 3300005262 Bacteria 83016
48 Ga0065714_10003545 3300005288 Bacteria 7328
49 Ga0065714_10004089 3300005288 Bacteria 9774
50 Ga0065714_10010706 3300005288 Bacteria 2645
51 Ga0065714_10064863 3300005288 Bacteria 16719
52 Ga0065714_10067358 3300005288 Bacteria 5607
53 Ga0065714_10099861 3300005288 Bacteria 1665
54 Ga0065714_10107284 3300005288 Bacteria 1534
55 Ga0065714_10109461 3300005288 Bacteria 1500
56 Ga0065704_10000210 3300005289 Bacteria 93612
57 Ga0065704_10083999 3300005289 Bacteria 3388
58 Ga0065712_10008583 3300005290 Bacteria 3168
59 Ga0065712_10124654 3300005290 Bacteria 1616
60 Ga0065715_10004221 3300005293 Bacteria 4062
61 Ga0070658_10000049 3300005327 Bacteria 119985
62 Ga0070658_10031135 3300005327 Bacteria 4284
63 Ga0070658_10101229 3300005327 Bacteria 2382
64 Ga0070676_10000336 3300005328 Bacteria 21357
65 Ga0070676_10026339 3300005328 Bacteria 3292
66 Ga0070683_100030965 3300005329 Bacteria 4862
67 Ga0070683_100032467 3300005329 Bacteria 4755
68 Ga0070683_100067205 3300005329 Bacteria 3339
69 Ga0070690_100012862 3300005330 Bacteria 4931
70 Ga0070670_100033933 3300005331 Bacteria 4393
71 Ga0070670_100034230 3300005331 Bacteria 4372
72 Ga0070670_100086541 3300005331 Bacteria 2693
73 Ga0070670_100181544 3300005331 Bacteria 1827
74 Ga0070670_100435816 3300005331 Unclassified 1160
75 Ga0070677_10014143 3300005333 Bacteria 2803
76 Ga0068869_100039400 3300005334 Bacteria 3373
77 Ga0070666_10002847 3300005335 Bacteria 10454
78 Ga0070666_10056865 3300005335 Unclassified 2643
79 Ga0070680_100015517 3300005336 Bacteria 5975
80 Ga0070680_100171020 3300005336 Unclassified 1828
81 Ga0070682_100001275 3300005337 Bacteria 14290
82 Ga0070682_100119478 3300005337 Unclassified 1767
83 Ga0070682_100241275 3300005337 Bacteria 1297
84 Ga0068868_100004138 3300005338 Bacteria 10140
85 Ga0068868_100008530 3300005338 Bacteria 7338
86 Ga0068868_100011418 3300005338 Bacteria 6469
87 Ga0068868_100015143 3300005338 Bacteria 5698
88 Ga0068868_100020344 3300005338 Bacteria 4985
89 Ga0070660_100027944 3300005339 Bacteria 4216
90 Ga0070660_100043577 3300005339 Bacteria 3430
91 Ga0070660_100171259 3300005339 Bacteria 1754
92 Ga0070691_10004326 3300005341 Bacteria 6456
93 Ga0070661_100023944 3300005344 Bacteria 4380
94 Ga0070661_100043909 3300005344 Unclassified 3265
95 Ga0070668_100004446 3300005347 Bacteria 10401
96 Ga0070669_100018155 3300005353 Bacteria 5025
97 Ga0070675_100015326 3300005354 Bacteria 6059
98 Ga0070675_100016332 3300005354 Bacteria 5890
99 Ga0070675_100027340 3300005354 Bacteria 4582
100 Ga0070675_100044109 3300005354 Bacteria 3647
101 Ga0070675_100268887 3300005354 Bacteria 1495
102 Ga0070671_100046891 3300005355 Bacteria 3594
103 Ga0070671_100159729 3300005355 Unclassified 1905
104 Ga0070673_100004993 3300005364 Bacteria 8460
105 Ga0070673_100016856 3300005364 Bacteria 5179
106 Ga0070673_100026479 3300005364 Bacteria 4283
107 Ga0070673_100035251 3300005364 Bacteria 3793
108 Ga0070688_100001700 3300005365 Bacteria 10987
109 Ga0070659_100006699 3300005366 Bacteria 8329
110 Ga0070659_100047474 3300005366 Bacteria 3368
111 Ga0070659_100069713 3300005366 Bacteria 2791
112 Ga0070659_100244848 3300005366 Unclassified 1485
113 Ga0070667_100000492 3300005367 Bacteria 40164
114 Ga0070667_100001349 3300005367 Bacteria 22023
115 Ga0070667_100048526 3300005367 Bacteria 3574
116 Ga0070663_100001195 3300005455 Bacteria 14271
117 Ga0070663_100081084 3300005455 Unclassified 2384
118 Ga0070663_100271155 3300005455 Bacteria 1349
119 Ga0070678_100001813 3300005456 Bacteria 11512
120 Ga0070678_100107493 3300005456 Unclassified 2176
121 Ga0070662_100000045 3300005457 Bacteria 67900
122 Ga0070662_100025109 3300005457 Bacteria 4112
123 Ga0070662_100096983 3300005457 Bacteria 2225
124 Ga0070681_10018316 3300005458 Bacteria 6999
125 Ga0070681_10029313 3300005458 Bacteria 5526
126 Ga0070681_10040763 3300005458 Bacteria 4652
127 Ga0068867_100004573 3300005459 Bacteria 9730
128 Ga0068867_100036004 3300005459 Bacteria 3591
129 Ga0068867_100060265 3300005459 Unclassified 2815
130 Ga0068867_100333504 3300005459 Unclassified 1260
131 Ga0070685_10002206 3300005466 Bacteria 10050
132 Ga0070685_10005910 3300005466 Bacteria 6227
133 Ga0070685_10027809 3300005466 Bacteria 3129
134 Ga0070685_10077516 3300005466 Bacteria 1984
135 Ga0070679_100004536 3300005530 Bacteria 12825
136 Ga0070679_100006277 3300005530 Bacteria 11066
137 Ga0070679_100008873 3300005530 Bacteria 9490
138 Ga0070679_100127028 3300005530 Bacteria 2532
139 Ga0070684_100035368 3300005535 Bacteria 4275
140 Ga0070684_100042359 3300005535 Bacteria 3930
141 Ga0070684_100127303 3300005535 Bacteria 2295
142 Ga0070684_100132672 3300005535 Unclassified 2247
143 Ga0068853_100003018 3300005539 Bacteria 12852
144 Ga0068853_100008065 3300005539 Bacteria 8446
145 Ga0068853_100008667 3300005539 Bacteria 8178
146 Ga0068853_100013120 3300005539 Bacteria 6761
147 Ga0068853_100022472 3300005539 Bacteria 5268
148 Ga0068853_100057348 3300005539 Bacteria 3361
149 Ga0068853_100139186 3300005539 Bacteria 2178
150 Ga0068853_100301937 3300005539 Bacteria 1480
151 Ga0070672_100001489 3300005543 Bacteria 14544
152 Ga0070672_100055232 3300005543 Bacteria 3111
153 Ga0070672_100083317 3300005543 Bacteria 2566
154 Ga0070672_100090358 3300005543 Unclassified 2469
155 Ga0070672_100156349 3300005543 Bacteria 1889
156 Ga0070686_100032891 3300005544 Bacteria 3183
157 Ga0070686_100073191 3300005544 Unclassified 2249
158 Ga0070686_100280374 3300005544 Bacteria 1229
159 Ga0070693_100003483 3300005547 Bacteria 7347
160 Ga0070693_100179055 3300005547 Bacteria 1364
161 Ga0070665_100000020 3300005548 Bacteria 389687
162 Ga0070665_100016967 3300005548 Bacteria 7300
163 Ga0070665_100043231 3300005548 Bacteria 4528
164 Ga0068855_100000240 3300005563 Bacteria 69408
165 Ga0068855_100000346 3300005563 Bacteria 57719
166 Ga0068855_100005837 3300005563 Bacteria 15028
167 Ga0068855_100008169 3300005563 Bacteria 12653
168 Ga0068855_100022866 3300005563 Bacteria 7493
169 Ga0068855_100024060 3300005563 Bacteria 7292
170 Ga0068855_100026080 3300005563 Bacteria 6991
171 Ga0068855_100032308 3300005563 Bacteria 6251
172 Ga0068855_100035811 3300005563 Bacteria 5911
173 Ga0068855_100047040 3300005563 Bacteria 5098
174 Ga0068855_100062842 3300005563 Bacteria 4334
175 Ga0068855_100070659 3300005563 Bacteria 4061
176 Ga0068855_100071810 3300005563 Bacteria 4024
177 Ga0070664_100192898 3300005564 Unclassified 1815
178 Ga0070664_100244621 3300005564 Unclassified 1611
179 Ga0068857_100007822 3300005577 Bacteria 9217
180 Ga0068857_100008143 3300005577 Bacteria 9051
181 Ga0068857_100019055 3300005577 Bacteria 6022
182 Ga0068857_100037750 3300005577 Bacteria 4280
183 Ga0068857_100209964 3300005577 Bacteria 1776
184 Ga0068854_100036735 3300005578 Bacteria 3436
185 Ga0068854_100051761 3300005578 Bacteria 2943
186 Ga0068854_100184752 3300005578 Unclassified 1630
187 Ga0068856_100000835 3300005614 Bacteria 33215
188 Ga0068856_100010959 3300005614 Bacteria 8800
189 Ga0068856_100017673 3300005614 Bacteria 6914
190 Ga0068856_100041561 3300005614 Bacteria 4519
191 Ga0068856_100050057 3300005614 Bacteria 4118
192 Ga0068856_100072662 3300005614 Bacteria 3405
193 Ga0068856_100207105 3300005614 Bacteria 1976
194 Ga0068852_100001345 3300005616 Bacteria 16491
195 Ga0068852_100003445 3300005616 Bacteria 11058
196 Ga0068852_100083617 3300005616 Bacteria 2838
197 Ga0068852_100151779 3300005616 Bacteria 2155
198 Ga0068852_100227662 3300005616 Unclassified 1776
199 Ga0068852_100362436 3300005616 Bacteria 1418
200 Ga0068859_100019039 3300005617 Bacteria 6894
201 Ga0068859_100222016 3300005617 Unclassified 1977
202 Ga0068864_100005800 3300005618 Bacteria 10131
203 Ga0068866_10011575 3300005718 Bacteria 3821
204 Ga0068861_100276800 3300005719 Bacteria 1443
205 Ga0068851_10015604 3300005834 Bacteria 3621
206 Ga0068851_10047333 3300005834 Unclassified 2178
207 Ga0068870_10028107 3300005840 Bacteria 2820
208 Ga0068870_10142332 3300005840 Bacteria 1404
209 Ga0068863_100000412 3300005841 Bacteria 43521
210 Ga0068863_100032411 3300005841 Bacteria 4981
211 Ga0068863_100077889 3300005841 Bacteria 3138
212 Ga0068863_100089741 3300005841 Bacteria 2915
213 Ga0068858_100342504 3300005842 Bacteria 1431
214 Ga0068860_100000916 3300005843 Bacteria 32698
215 Ga0068860_100081090 3300005843 Bacteria 3085
216 Ga0068860_100186633 3300005843 Bacteria 2005
217 Ga0068862_100155708 3300005844 Bacteria 2037
218 Ga0068862_100377924 3300005844 Bacteria 1321
219 Ga0081540_1037226 3300005983 Bacteria 2582
220 Ga0075366_10005218 3300006195 Bacteria 7031
221 Ga0075366_10006027 3300006195 Bacteria 6604
222 Ga0075366_10019255 3300006195 Bacteria 3946
223 Ga0075366_10020069 3300006195 Bacteria 3875
224 Ga0075366_10074534 3300006195 Bacteria 2024
225 Ga0097621_100002086 3300006237 Bacteria 13691
226 Ga0097621_100018421 3300006237 Bacteria 5333
227 Ga0097621_100022179 3300006237 Bacteria 4926
228 Ga0097621_100051361 3300006237 Unclassified 3355
229 Ga0097621_100093559 3300006237 Unclassified 2519
230 Ga0097621_100164744 3300006237 Unclassified 1908
231 Ga0068871_100000100 3300006358 Bacteria 51253
232 Ga0068871_100312735 3300006358 Bacteria 1381
233 Ga0075428_100017721 3300006844 Bacteria 7870
234 Ga0075428_100050469 3300006844 Bacteria 4562
235 Ga0075431_100030371 3300006847 Bacteria 5566
236 Ga0075431_100118749 3300006847 Unclassified 2729
237 Ga0075434_100105830 3300006871 Bacteria 2823
238 Ga0075429_100018092 3300006880 Bacteria 6097
239 Ga0068865_100000174 3300006881 Bacteria 35630
240 Ga0068865_100003461 3300006881 Bacteria 9457
241 Ga0068865_100028117 3300006881 Bacteria 3721
242 Ga0068865_100077970 3300006881 Bacteria 2369
243 Ga0068865_100103533 3300006881 Unclassified 2088
244 Ga0097620_100019038 3300006931 Bacteria 6894
245 Ga0097620_100222010 3300006931 Unclassified 1977
246 Ga0079104_1000005 3300006946 Bacteria 407099
247 Ga0099826_10126639 3300006948 Bacteria 1496
248 Ga0105251_10086058 3300009011 Unclassified 1448
249 Ga0105244_10000063 3300009036 Bacteria 122746
250 Ga0105244_10098006 3300009036 Bacteria 1436
251 Ga0105250_10040141 3300009092 Bacteria 1877
252 Ga0105240_10000074 3300009093 Bacteria 199611
253 Ga0105240_10000237 3300009093 Bacteria 109895
254 Ga0105240_10000598 3300009093 Bacteria 67006
255 Ga0105240_10000626 3300009093 Bacteria 65179
256 Ga0105240_10001351 3300009093 Bacteria 42091
257 Ga0105240_10001595 3300009093 Bacteria 38516
258 Ga0105240_10007062 3300009093 Bacteria 16373
259 Ga0105240_10008151 3300009093 Bacteria 15026
260 Ga0105240_10022028 3300009093 Bacteria 8460
261 Ga0105240_10045715 3300009093 Bacteria 5553
262 Ga0105240_10066229 3300009093 Bacteria 4482
263 Ga0105240_10084727 3300009093 Bacteria 3886
264 Ga0105240_10096537 3300009093 Bacteria 3602
265 Ga0105240_10108377 3300009093 Bacteria 3365
266 Ga0105240_10126815 3300009093 Bacteria 3066
267 Ga0105240_10261192 3300009093 Bacteria 1997
268 Ga0105240_10349622 3300009093 Unclassified 1677
269 Ga0111539_10034093 3300009094 Bacteria 6176
270 Ga0105245_10114265 3300009098 Bacteria 2514
271 Ga0114129_10033962 3300009147 Bacteria 7205
272 Ga0105241_10000086 3300009174 Bacteria 69935
273 Ga0105241_10000659 3300009174 Bacteria 25872
274 Ga0105241_10005221 3300009174 Bacteria 9592
275 Ga0105241_10042948 3300009174 Bacteria 3423
276 Ga0105241_10057228 3300009174 Bacteria 2990
277 Ga0105241_10170979 3300009174 Bacteria 1795
278 Ga0105241_10284031 3300009174 Bacteria 1414
279 Ga0105242_10009407 3300009176 Bacteria 7494
280 Ga0105242_10015906 3300009176 Bacteria 5846
281 Ga0105242_10066597 3300009176 Bacteria 2975
282 Ga0105248_10570485 3300009177 Unclassified 1277
283 Ga0105237_10000224 3300009545 Bacteria 79854
284 Ga0105237_10001565 3300009545 Bacteria 29826
285 Ga0105237_10003647 3300009545 Bacteria 18154
286 Ga0105237_10004072 3300009545 Bacteria 17045
287 Ga0105237_10009395 3300009545 Bacteria 10472
288 Ga0105237_10018293 3300009545 Bacteria 7252
289 Ga0105237_10028286 3300009545 Bacteria 5712
290 Ga0105237_10036976 3300009545 Bacteria 4937
291 Ga0105237_10057618 3300009545 Bacteria 3887
292 Ga0105237_10059488 3300009545 Bacteria 3822
293 Ga0105237_10067260 3300009545 Bacteria 3577
294 Ga0105237_10140408 3300009545 Bacteria 2410
295 Ga0105237_10193118 3300009545 Bacteria 2036
296 Ga0105237_10196753 3300009545 Bacteria 2016
297 Ga0105237_10264291 3300009545 Bacteria 1724
298 Ga0105237_10285413 3300009545 Unclassified 1653
299 Ga0105237_10397595 3300009545 Bacteria 1383
300 Ga0105238_10001132 3300009551 Bacteria 26885
301 Ga0105238_10052663 3300009551 Bacteria 4091
302 Ga0105238_10097033 3300009551 Bacteria 2934
303 Ga0105249_10005103 3300009553 Bacteria 11318
304 Ga0105249_10005252 3300009553 Bacteria 11181
305 Ga0105249_10008737 3300009553 Bacteria 8837
306 Ga0105249_10055248 3300009553 Unclassified 3632
307 Ga0105249_10079798 3300009553 Bacteria 3039
308 Ga0105249_10148121 3300009553 Bacteria 2257
309 Ga0105249_10203305 3300009553 Bacteria 1939
310 Ga0105249_10461435 3300009553 Bacteria 1310
311 Ga0105239_10000002 3300010375 Bacteria 610298
312 Ga0105239_10000048 3300010375 Bacteria 177855
313 Ga0105239_10000758 3300010375 Bacteria 45640
314 Ga0105239_10001789 3300010375 Bacteria 28284
315 Ga0105239_10001948 3300010375 Bacteria 26930
316 Ga0105239_10002090 3300010375 Bacteria 25893
317 Ga0105239_10002752 3300010375 Bacteria 22079
318 Ga0105239_10005094 3300010375 Bacteria 15518
319 Ga0105239_10008918 3300010375 Bacteria 11347
320 Ga0105239_10016195 3300010375 Bacteria 8248
321 Ga0105239_10024710 3300010375 Bacteria 6618
322 Ga0105239_10039298 3300010375 Bacteria 5184
323 Ga0105239_10045406 3300010375 Bacteria 4815
324 Ga0105239_10078015 3300010375 Bacteria 3645
325 Ga0105239_10087796 3300010375 Bacteria 3429
326 Ga0105239_10121599 3300010375 Unclassified 2900
327 Ga0105239_10166914 3300010375 Unclassified 2462
328 Ga0105246_10028028 3300011119 Bacteria 3697
329 Ga0105246_10053815 3300011119 Bacteria 2771
330 Ga0105246_10249830 3300011119 Bacteria 1407
331 Ga0157373_10000002 3300013100 Bacteria 750094
332 Ga0157373_10000821 3300013100 Bacteria 24074
333 Ga0157373_10002581 3300013100 Bacteria 13752
334 Ga0157373_10019401 3300013100 Bacteria 4948
335 Ga0157373_10020933 3300013100 Bacteria 4749
336 Ga0157373_10092748 3300013100 Bacteria 2127
337 Ga0157373_10097891 3300013100 Bacteria 2065
338 Ga0157371_10000016 3300013102 Bacteria 330495
339 Ga0157371_10000135 3300013102 Bacteria 107607
340 Ga0157371_10000563 3300013102 Bacteria 43940
341 Ga0157371_10001161 3300013102 Bacteria 28350
342 Ga0157371_10001915 3300013102 Bacteria 20795
343 Ga0157371_10003683 3300013102 Bacteria 13759
344 Ga0157371_10005312 3300013102 Bacteria 10902
345 Ga0157371_10009984 3300013102 Bacteria 7430
346 Ga0157371_10018424 3300013102 Bacteria 5163
347 Ga0157371_10034813 3300013102 Bacteria 3611
348 Ga0157371_10077958 3300013102 Bacteria 2347
349 Ga0157370_10000500 3300013104 Bacteria 48866
350 Ga0157370_10001022 3300013104 Bacteria 35238
351 Ga0157370_10001166 3300013104 Bacteria 32718
352 Ga0157370_10005338 3300013104 Bacteria 14435
353 Ga0157370_10006435 3300013104 Bacteria 12959
354 Ga0157370_10007484 3300013104 Bacteria 11861
355 Ga0157370_10010727 3300013104 Bacteria 9634
356 Ga0157370_10014206 3300013104 Bacteria 8159
357 Ga0157370_10014665 3300013104 Bacteria 8007
358 Ga0157370_10017596 3300013104 Bacteria 7210
359 Ga0157370_10031451 3300013104 Bacteria 5191
360 Ga0157370_10036413 3300013104 Bacteria 4774
361 Ga0157370_10039822 3300013104 Bacteria 4539
362 Ga0157370_10262108 3300013104 Bacteria 1597
363 Ga0157369_10000475 3300013105 Bacteria 53219
364 Ga0157369_10001138 3300013105 Bacteria 33208
365 Ga0157369_10046098 3300013105 Bacteria 4739
366 Ga0157369_10051032 3300013105 Bacteria 4478
367 Ga0157369_10057127 3300013105 Bacteria 4211
368 Ga0157369_10081875 3300013105 Bacteria 3454
369 Ga0157369_10086419 3300013105 Bacteria 3349
370 Ga0157369_10117845 3300013105 Bacteria 2818
371 Ga0157369_10159155 3300013105 Bacteria 2384
372 Ga0157369_10231674 3300013105 Bacteria 1931
373 Ga0157374_10000001 3300013296 Bacteria 1077351
374 Ga0157374_10000128 3300013296 Bacteria 69753
375 Ga0157374_10000202 3300013296 Bacteria 54739
376 Ga0157374_10004614 3300013296 Bacteria 11557
377 Ga0157374_10028575 3300013296 Bacteria 5039
378 Ga0157374_10034089 3300013296 Bacteria 4648
379 Ga0157374_10051367 3300013296 Bacteria 3836
380 Ga0157374_10054818 3300013296 Bacteria 3720
381 Ga0157374_10099620 3300013296 Bacteria 2784
382 Ga0157374_10297505 3300013296 Bacteria 1596
383 Ga0157374_10492119 3300013296 Bacteria 1230
384 Ga0157378_10005717 3300013297 Bacteria 10884
385 Ga0157378_10005849 3300013297 Bacteria 10778
386 Ga0157378_10010586 3300013297 Bacteria 8059
387 Ga0157378_10043948 3300013297 Bacteria 3966
388 Ga0157378_10107269 3300013297 Bacteria 2556
389 Ga0157378_10260343 3300013297 Bacteria 1664
390 Ga0157378_10290658 3300013297 Bacteria 1579
391 Ga0163162_10000032 3300013306 Bacteria 156609
392 Ga0163162_10000152 3300013306 Bacteria 64273
393 Ga0163162_10009046 3300013306 Bacteria 9683
394 Ga0163162_10011763 3300013306 Bacteria 8536
395 Ga0163162_10015657 3300013306 Bacteria 7411
396 Ga0163162_10016026 3300013306 Bacteria 7325
397 Ga0163162_10029333 3300013306 Bacteria 5444
398 Ga0163162_10052936 3300013306 Bacteria 4079
399 Ga0163162_10054110 3300013306 Bacteria 4036
400 Ga0163162_10095248 3300013306 Unclassified 3063
401 Ga0163162_10295516 3300013306 Bacteria 1752
402 Ga0163162_10459650 3300013306 Bacteria 1404
403 Ga0157372_10000017 3300013307 Bacteria 219543
404 Ga0157372_10000061 3300013307 Bacteria 119814
405 Ga0157372_10000921 3300013307 Bacteria 32008
406 Ga0157372_10003385 3300013307 Bacteria 17204
407 Ga0157372_10004228 3300013307 Bacteria 15351
408 Ga0157372_10018588 3300013307 Bacteria 7477
409 Ga0157372_10020418 3300013307 Bacteria 7146
410 Ga0157372_10142889 3300013307 Bacteria 2759
411 Ga0157372_10151540 3300013307 Bacteria 2677
412 Ga0157372_10166690 3300013307 Bacteria 2548
413 Ga0157372_10207727 3300013307 Bacteria 2269
414 Ga0157375_10037080 3300013308 Bacteria 4668
415 Ga0157375_10040512 3300013308 Bacteria 4490
416 Ga0157375_10045096 3300013308 Unclassified 4290
417 Ga0157375_10045413 3300013308 Bacteria 4275
418 Ga0157375_10123056 3300013308 Unclassified 2706
419 Ga0157375_10174141 3300013308 Bacteria 2301
420 Ga0157375_10202478 3300013308 Bacteria 2141
421 Ga0157375_10205722 3300013308 Bacteria 2124
422 Ga0157375_10480579 3300013308 Bacteria 1407
423 Ga0157375_10578419 3300013308 Bacteria 1283
424 Ga0163163_10000653 3300014325 Bacteria 29691
425 Ga0163163_10195869 3300014325 Bacteria 2069
426 Ga0163163_10403595 3300014325 Unclassified 1425
427 Ga0157380_10162904 3300014326 Bacteria 1940
428 Ga0157380_10168749 3300014326 Bacteria 1909
429 Ga0157380_10234046 3300014326 Bacteria 1652
430 Ga0182008_10000006 3300014497 Bacteria 378521
431 Ga0182008_10000818 3300014497 Bacteria 21712
432 Ga0182008_10001192 3300014497 Bacteria 17914
433 Ga0157379_10001301 3300014968 Bacteria 20316
434 Ga0157379_10180015 3300014968 Unclassified 1910
435 Ga0157379_10206039 3300014968 Unclassified 1779
436 Ga0157376_10000721 3300014969 Bacteria 21396
437 Ga0157376_10001279 3300014969 Bacteria 16546
438 Ga0157376_10008360 3300014969 Bacteria 7464
439 Ga0157376_10025181 3300014969 Bacteria 4683
440 Ga0157376_10037767 3300014969 Bacteria 3925
441 Ga0157376_10055030 3300014969 Bacteria 3319
442 Ga0157376_10067496 3300014969 Unclassified 3025
443 Ga0182006_1000011 3300015261 Bacteria 408647
444 Ga0182006_1000068 3300015261 Bacteria 144823
445 Ga0182006_1000869 3300015261 Bacteria 20275
446 Ga0182006_1001882 3300015261 Bacteria 11983
447 Ga0182006_1003367 3300015261 Bacteria 8215
448 Ga0182007_10000003 3300015262 Bacteria 548244
449 Ga0183373_1001 3300015682 Bacteria 1410374
450 Ga0163161_10000012 3300017792 Bacteria 264639
451 Ga0163161_10000074 3300017792 Bacteria 101784
452 Ga0163161_10015370 3300017792 Bacteria 5336
453 Ga0163161_10016813 3300017792 Bacteria 5115
454 Ga0163161_10020644 3300017792 Bacteria 4625
455 Ga0163161_10067138 3300017792 Unclassified 2619
456 Ga0163161_10171589 3300017792 Bacteria 1659
457 Ga0213872_10009314 3300021361 Bacteria 4715
458 Ga0209436_103157 3300025208 Bacteria 4514
459 Ga0207427_100103 3300025231 Bacteria 119618
460 Ga0209437_100017 3300025233 Bacteria 694471
461 Ga0209437_100101 3300025233 Bacteria 226668
462 Ga0207425_1000002 3300025245 Bacteria 1362590
463 Ga0209646_1000002 3300025246 Bacteria 1425781
464 Ga0209646_1000745 3300025246 Bacteria 11381
465 Ga0209026_1000434 3300025250 Bacteria 34861
466 Ga0209026_1006913 3300025250 Bacteria 2666
467 Ga0209129_1000002 3300025258 Bacteria 1359086
468 Ga0209233_1000124 3300025261 Bacteria 226743
469 Ga0209130_1005416 3300025284 Bacteria 4431
470 Ga0209675_1000033 3300025291 Bacteria 271576
471 Ga0209676_1000008 3300025292 Bacteria 991778
472 Ga0209676_1000425 3300025292 Bacteria 74151
473 Ga0209025_1000004 3300025294 Bacteria 1361782
474 Ga0209758_1000006 3300025297 Bacteria 1359562
475 Ga0209758_1003065 3300025297 Bacteria 15894
476 Ga0209050_1000045 3300025298 Bacteria 388022
477 Ga0207426_1000002 3300025302 Bacteria 1249660
478 Ga0207426_1000051 3300025302 Bacteria 391700
479 Ga0207426_1000497 3300025302 Bacteria 58506
480 Ga0209257_1000001 3300025304 Bacteria 2274655
481 Ga0207656_10017547 3300025321 Unclassified 2806
482 Ga0207682_10010357 3300025893 Bacteria 3654
483 Ga0207710_10008558 3300025900 Bacteria 4313
484 Ga0207688_10009386 3300025901 Bacteria 5328
485 Ga0207680_10015585 3300025903 Bacteria 3970
486 Ga0207680_10023544 3300025903 Bacteria 3365
487 Ga0207680_10052159 3300025903 Bacteria 2449
488 Ga0207647_10000105 3300025904 Bacteria 65502
489 Ga0207647_10000511 3300025904 Bacteria 30935
490 Ga0207647_10007406 3300025904 Bacteria 7930
491 Ga0207647_10016870 3300025904 Bacteria 4974
492 Ga0207647_10022172 3300025904 Unclassified 4224
493 Ga0207647_10098536 3300025904 Unclassified 1737
494 Ga0207645_10000622 3300025907 Bacteria 29378
495 Ga0207645_10001210 3300025907 Bacteria 21312
496 Ga0207645_10003591 3300025907 Bacteria 11736
497 Ga0207645_10004714 3300025907 Bacteria 10031
498 Ga0207643_10023368 3300025908 Bacteria 3408
499 Ga0207643_10126218 3300025908 Bacteria 1519
500 Ga0207705_10000079 3300025909 Bacteria 119999
501 Ga0207705_10017692 3300025909 Bacteria 5099
502 Ga0207705_10045764 3300025909 Bacteria 3144
503 Ga0207705_10189042 3300025909 Bacteria 1556
504 Ga0207654_10016294 3300025911 Bacteria 3868
505 Ga0207654_10047242 3300025911 Bacteria 2459
506 Ga0207707_10000051 3300025912 Bacteria 117204
507 Ga0207707_10021406 3300025912 Bacteria 5653
508 Ga0207707_10193606 3300025912 Unclassified 1773
509 Ga0207695_10000013 3300025913 Bacteria 821265
510 Ga0207695_10000084 3300025913 Bacteria 282392
511 Ga0207695_10000323 3300025913 Bacteria 114265
512 Ga0207695_10001232 3300025913 Bacteria 43800
513 Ga0207695_10004447 3300025913 Bacteria 19105
514 Ga0207695_10007846 3300025913 Bacteria 13492
515 Ga0207695_10009118 3300025913 Bacteria 12316
516 Ga0207695_10015643 3300025913 Bacteria 8923
517 Ga0207695_10122675 3300025913 Bacteria 2564
518 Ga0207695_10189847 3300025913 Unclassified 1972
519 Ga0207695_10234174 3300025913 Bacteria 1740
520 Ga0207671_10000272 3300025914 Bacteria 77080
521 Ga0207671_10001497 3300025914 Bacteria 26937
522 Ga0207671_10002907 3300025914 Bacteria 17690
523 Ga0207671_10005889 3300025914 Bacteria 11125
524 Ga0207671_10009491 3300025914 Bacteria 8127
525 Ga0207671_10012189 3300025914 Bacteria 6935
526 Ga0207671_10014622 3300025914 Bacteria 6192
527 Ga0207671_10036318 3300025914 Bacteria 3654
528 Ga0207671_10042678 3300025914 Bacteria 3356
529 Ga0207671_10103071 3300025914 Bacteria 2163
530 Ga0207671_10121560 3300025914 Bacteria 1996
531 Ga0207671_10220780 3300025914 Bacteria 1485
532 Ga0207671_10335001 3300025914 Bacteria 1198
533 Ga0207660_10009778 3300025917 Bacteria 6208
534 Ga0207662_10016297 3300025918 Bacteria 4192
535 Ga0207662_10019350 3300025918 Bacteria 3873
536 Ga0207657_10059750 3300025919 Bacteria 3273
537 Ga0207657_10082590 3300025919 Bacteria 2697
538 Ga0207657_10350426 3300025919 Unclassified 1164
539 Ga0207649_10017077 3300025920 Bacteria 4108
540 Ga0207652_10000384 3300025921 Bacteria 46082
541 Ga0207652_10001696 3300025921 Bacteria 19285
542 Ga0207652_10014179 3300025921 Bacteria 6454
543 Ga0207652_10015091 3300025921 Bacteria 6268
544 Ga0207694_10077795 3300025924 Bacteria 2600
545 Ga0207694_10094692 3300025924 Bacteria 2360
546 Ga0207694_10195493 3300025924 Bacteria 1644
547 Ga0207694_10247457 3300025924 Unclassified 1458
548 Ga0207650_10019073 3300025925 Bacteria 4820
549 Ga0207650_10042343 3300025925 Bacteria 3341
550 Ga0207650_10070695 3300025925 Bacteria 2624
551 Ga0207659_10008155 3300025926 Bacteria 6484
552 Ga0207659_10037371 3300025926 Unclassified 3371
553 Ga0207659_10053334 3300025926 Bacteria 2884
554 Ga0207659_10163272 3300025926 Unclassified 1751
555 Ga0207687_10106215 3300025927 Bacteria 2075
556 Ga0207644_10120271 3300025931 Unclassified 1999
557 Ga0207644_10168342 3300025931 Bacteria 1709
558 Ga0207690_10000318 3300025932 Bacteria 32496
559 Ga0207690_10013661 3300025932 Bacteria 4885
560 Ga0207690_10160203 3300025932 Bacteria 1677
561 Ga0207706_10000120 3300025933 Bacteria 84222
562 Ga0207706_10029817 3300025933 Bacteria 4869
563 Ga0207706_10049670 3300025933 Bacteria 3706
564 Ga0207706_10099200 3300025933 Unclassified 2562
565 Ga0207706_10211759 3300025933 Bacteria 1699
566 Ga0207686_10024502 3300025934 Bacteria 3498
567 Ga0207670_10107261 3300025936 Bacteria 2005
568 Ga0207670_10126200 3300025936 Bacteria 1868
569 Ga0207704_10000099 3300025938 Bacteria 48088
570 Ga0207704_10028986 3300025938 Bacteria 3080
571 Ga0207704_10073370 3300025938 Bacteria 2179
572 Ga0207704_10212037 3300025938 Unclassified 1426
573 Ga0207691_10002527 3300025940 Bacteria 17886
574 Ga0207691_10023686 3300025940 Bacteria 5780
575 Ga0207691_10027226 3300025940 Bacteria 5363
576 Ga0207691_10042760 3300025940 Unclassified 4175
577 Ga0207691_10052586 3300025940 Bacteria 3720
578 Ga0207691_10066643 3300025940 Bacteria 3257
579 Ga0207691_10194754 3300025940 Unclassified 1766
580 Ga0207689_10003051 3300025942 Bacteria 15431
581 Ga0207689_10008841 3300025942 Bacteria 8746
582 Ga0207689_10077529 3300025942 Bacteria 2731
583 Ga0207689_10107260 3300025942 Unclassified 2295
584 Ga0207689_10125004 3300025942 Bacteria 2116
585 Ga0207689_10157763 3300025942 Bacteria 1870
586 Ga0207689_10234984 3300025942 Bacteria 1515
587 Ga0207661_10033412 3300025944 Unclassified 3992
588 Ga0207661_10055683 3300025944 Bacteria 3173
589 Ga0207661_10119674 3300025944 Bacteria 2240
590 Ga0207661_10250394 3300025944 Unclassified 1574
591 Ga0207679_10007258 3300025945 Bacteria 7021
592 Ga0207679_10026046 3300025945 Bacteria 4029
593 Ga0207667_10000037 3300025949 Bacteria 297252
594 Ga0207667_10000135 3300025949 Bacteria 111565
595 Ga0207667_10007957 3300025949 Bacteria 12648
596 Ga0207667_10011669 3300025949 Bacteria 10195
597 Ga0207667_10017914 3300025949 Bacteria 7961
598 Ga0207667_10028059 3300025949 Bacteria 6116
599 Ga0207667_10028127 3300025949 Bacteria 6107
600 Ga0207667_10038231 3300025949 Bacteria 5127
601 Ga0207667_10048612 3300025949 Bacteria 4485
602 Ga0207667_10164208 3300025949 Bacteria 2283
603 Ga0207667_10209178 3300025949 Bacteria 2000
604 Ga0207667_10345220 3300025949 Bacteria 1518
605 Ga0207667_10533199 3300025949 Unclassified 1188
606 Ga0207651_10005116 3300025960 Bacteria 6696
607 Ga0207651_10124360 3300025960 Bacteria 1962
608 Ga0207651_10144307 3300025960 Bacteria 1843
609 Ga0207651_10156626 3300025960 Unclassified 1780
610 Ga0207712_10007103 3300025961 Bacteria 7062
611 Ga0207712_10355651 3300025961 Unclassified 1219
612 Ga0207668_10000540 3300025972 Bacteria 23750
613 Ga0207668_10118577 3300025972 Bacteria 2000
614 Ga0207668_10250364 3300025972 Bacteria 1438
615 Ga0207640_10052155 3300025981 Bacteria 2663
616 Ga0207658_10039183 3300025986 Bacteria 3418
617 Ga0207658_10049171 3300025986 Bacteria 3097
618 Ga0207658_10181257 3300025986 Bacteria 1743
619 Ga0207677_10004313 3300026023 Bacteria 7617
620 Ga0207677_10014691 3300026023 Bacteria 4581
621 Ga0207677_10019806 3300026023 Bacteria 4072
622 Ga0207677_10059201 3300026023 Bacteria 2641
623 Ga0207677_10074545 3300026023 Bacteria 2408
624 Ga0207677_10253314 3300026023 Unclassified 1431
625 Ga0207703_10001644 3300026035 Bacteria 20118
626 Ga0207703_10201182 3300026035 Unclassified 1770
627 Ga0207639_10001126 3300026041 Bacteria 18166
628 Ga0207639_10016182 3300026041 Bacteria 5271
629 Ga0207639_10119624 3300026041 Bacteria 2162
630 Ga0207639_10140418 3300026041 Bacteria 2012
631 Ga0207639_10149561 3300026041 Unclassified 1954
632 Ga0207639_10210951 3300026041 Bacteria 1672
633 Ga0207639_10285933 3300026041 Bacteria 1452
634 Ga0207678_10038074 3300026067 Bacteria 4181
635 Ga0207678_10068160 3300026067 Bacteria 3053
636 Ga0207678_10224546 3300026067 Bacteria 1608
637 Ga0207708_10160493 3300026075 Bacteria 1775
638 Ga0207702_10000196 3300026078 Bacteria 71703
639 Ga0207702_10057179 3300026078 Bacteria 3315
640 Ga0207702_10074879 3300026078 Bacteria 2923
641 Ga0207702_10093576 3300026078 Bacteria 2636
642 Ga0207702_10104078 3300026078 Bacteria 2511
643 Ga0207702_10447303 3300026078 Bacteria 1253
644 Ga0207641_10000253 3300026088 Bacteria 67848
645 Ga0207641_10018015 3300026088 Bacteria 5787
646 Ga0207641_10052914 3300026088 Bacteria 3440
647 Ga0207641_10111008 3300026088 Bacteria 2431
648 Ga0207641_10153753 3300026088 Unclassified 2086
649 Ga0207648_10002506 3300026089 Bacteria 19710
650 Ga0207648_10004019 3300026089 Bacteria 15269
651 Ga0207648_10018210 3300026089 Bacteria 6362
652 Ga0207648_10034323 3300026089 Bacteria 4472
653 Ga0207648_10036449 3300026089 Unclassified 4332
654 Ga0207648_10042309 3300026089 Bacteria 3999
655 Ga0207676_10063266 3300026095 Bacteria 2938
656 Ga0207676_10223176 3300026095 Bacteria 1679
657 Ga0207676_10348413 3300026095 Bacteria 1369
658 Ga0207676_10355882 3300026095 Unclassified 1355
659 Ga0207674_10000672 3300026116 Bacteria 44419
660 Ga0207674_10006740 3300026116 Bacteria 13484
661 Ga0207674_10114299 3300026116 Bacteria 2672
662 Ga0207674_10160935 3300026116 Bacteria 2199
663 Ga0207674_10178043 3300026116 Bacteria 2078
664 Ga0207675_100014435 3300026118 Bacteria 7364
665 Ga0207675_100066138 3300026118 Bacteria 3378
666 Ga0207675_100134293 3300026118 Bacteria 2347
667 Ga0207683_10003712 3300026121 Bacteria 13255
668 Ga0207683_10005010 3300026121 Bacteria 11378
669 Ga0207683_10057036 3300026121 Bacteria 3428
670 Ga0207683_10065629 3300026121 Unclassified 3200
671 Ga0207683_10117716 3300026121 Bacteria 2382
672 Ga0207698_10001082 3300026142 Bacteria 15843
673 Ga0207698_10011290 3300026142 Bacteria 5783
674 Ga0207698_10055732 3300026142 Bacteria 3049
675 Ga0209281_1000094 3300027111 Bacteria 238155
676 Ga0209995_1001337 3300027471 Bacteria 3795
677 Ga0209968_1002355 3300027526 Bacteria 2857
678 Ga0210002_1001420 3300027617 Bacteria 3370
679 Ga0209282_1106414 3300027666 Bacteria 1433
680 Ga0209974_10017789 3300027876 Bacteria 2356
681 Ga0268266_10000018 3300028379 Bacteria 569141
682 Ga0268266_10085801 3300028379 Unclassified 2751
683 Ga0268266_10090778 3300028379 Unclassified 2678
684 Ga0268265_10014622 3300028380 Bacteria 5351
685 Ga0268265_10099403 3300028380 Bacteria 2346
686 Ga0268264_10001720 3300028381 Bacteria 20153
687 Ga0268264_10009362 3300028381 Bacteria 8107
688 Ga0268264_10047708 3300028381 Bacteria 3561
689 Ga0307517_10002048 3300028786 Bacteria 32795
690 Ga0307517_10004683 3300028786 Bacteria 20955
691 Ga0307515_10000681 3300028794 Bacteria 78150
692 Ga0307515_10001752 3300028794 Bacteria 48338
693 Ga0307515_10002910 3300028794 Bacteria 36374
694 Ga0307515_10014453 3300028794 Bacteria 14631
695 Ga0307515_10081729 3300028794 Bacteria 4192
696 Ga0307515_10093645 3300028794 Bacteria 3722
697 Ga0307515_10229784 3300028794 Bacteria 1651
698 Ga0265338_10001687 3300028800 Bacteria 35089
699 Ga0316177_1198244 3300030731 Bacteria 7343
700 Ga0316176_1050137 3300030732 Bacteria 14004
701 Ga0316183_1065995 3300030742 Bacteria 27909
702 Ga0316181_1148726 3300030744 Bacteria 7875
703 Ga0265327_10000010 3300031251 Bacteria 566817
704 Ga0307513_10156292 3300031456 Bacteria 2180
705 Ga0307509_10048545 3300031507 Bacteria 4557
706 Ga0307408_100002250 3300031548 Bacteria 13771
707 Ga0307508_10002100 3300031616 Bacteria 21430
708 Ga0316576_10075969 3300031727 Bacteria 2485
709 Ga0316578_10057826 3300031728 Bacteria 2279
710 Ga0307516_10003117 3300031730 Bacteria 21573
711 Ga0307405_10000003 3300031731 Bacteria 569064
712 Ga0307405_10014179 3300031731 Bacteria 4277
713 Ga0307405_10059446 3300031731 Bacteria 2409
714 Ga0307413_10115686 3300031824 Bacteria 1805
715 Ga0307413_10143113 3300031824 Bacteria 1655
716 Ga0307413_10178076 3300031824 Unclassified 1513
717 Ga0307410_10000067 3300031852 Bacteria 37092
718 Ga0307410_10194020 3300031852 Bacteria 1546
719 Ga0307406_10000035 3300031901 Bacteria 82953
720 Ga0307406_10117919 3300031901 Bacteria 1840
721 Ga0307407_10000008 3300031903 Bacteria 191228
722 Ga0307407_10063361 3300031903 Bacteria 2168
723 Ga0307412_10000427 3300031911 Bacteria 25500
724 Ga0307412_10037619 3300031911 Bacteria 3111
725 Ga0307409_100008566 3300031995 Bacteria 6218
726 Ga0307416_100000009 3300032002 Bacteria 374271
727 Ga0307416_100000639 3300032002 Bacteria 18075
728 Ga0307416_100113426 3300032002 Bacteria 2395
729 Ga0307414_10000009 3300032004 Bacteria 359782
730 Ga0307414_10000038 3300032004 Bacteria 150774
731 Ga0307414_10000063 3300032004 Bacteria 107710
732 Ga0307414_10002879 3300032004 Bacteria 9086
733 Ga0307414_10004631 3300032004 Bacteria 7486
734 Ga0307414_10008231 3300032004 Bacteria 5899
735 Ga0307414_10012334 3300032004 Bacteria 5049
736 Ga0307414_10034651 3300032004 Bacteria 3350
737 Ga0307414_10105314 3300032004 Bacteria 2132
738 Ga0307414_10242776 3300032004 Unclassified 1492
739 Ga0307411_10000001 3300032005 Bacteria 931810
740 Ga0307507_10000064 3300033179 Bacteria 161226
741 Ga0307510_10002860 3300033180 Bacteria 19841
742 Ga0307510_10041880 3300033180 Bacteria 4999
743 Ga0373927_0005849 3300035695 Bacteria 8433
744 Ga0373927_0037163 3300035695 Bacteria 3166
745 Ga0373937_0023482 3300036401 Bacteria 5553
746 Ga0373937_0152899 3300036401 Bacteria 2162
747 Ga0373937_0250410 3300036401 Bacteria 1670
748 Ga0316582_0060474 3300036647 Bacteria 2429
749 Ga0316584_0027245 3300036712 Bacteria 4205
750 Ga0316584_0122674 3300036712 Bacteria 1941
751 Ga0373925_0104333 3300037068 Bacteria 2183
752 Ga0395899_0000025 3300037312 Bacteria 350927
753 Ga0395899_0000033 3300037312 Bacteria 306589
754 Ga0395899_0000493 3300037312 Bacteria 44066
755 Ga0395899_0000629 3300037312 Bacteria 36706
756 Ga0395899_0001884 3300037312 Bacteria 17312
757 Ga0395899_0029186 3300037312 Bacteria 4149
758 Ga0395899_0029721 3300037312 Bacteria 4111
759 Ga0395899_0041383 3300037312 Bacteria 3443
760 Ga0395899_0066951 3300037312 Bacteria 2636
761 Ga0395899_0133975 3300037312 Unclassified 1767
762 Ga0395900_0000480 3300037418 Bacteria 56578
763 Ga0395900_0000506 3300037418 Bacteria 54890
764 Ga0395900_0006601 3300037418 Bacteria 12073
765 Ga0395900_0009920 3300037418 Bacteria 9750
766 Ga0395900_0012177 3300037418 Bacteria 8793
767 Ga0395900_0108003 3300037418 Bacteria 2859
768 Ga0395900_0175354 3300037418 Unclassified 2180
769 Ga0395900_0179537 3300037418 Unclassified 2152
770 Ga0395898_0001651 3300037466 Bacteria 30118
771 Ga0395898_0032624 3300037466 Bacteria 5199
772 Ga0395898_0041094 3300037466 Bacteria 4569
773 Ga0395898_0056108 3300037466 Bacteria 3841
774 Ga0395905_0000254 3300037471 Bacteria 79953
775 Ga0395905_0000738 3300037471 Bacteria 43061
776 Ga0395905_0001166 3300037471 Bacteria 32800
777 Ga0395905_0006569 3300037471 Bacteria 11683
778 Ga0395901_0000853 3300038443 Bacteria 33521
779 Ga0395901_0004350 3300038443 Bacteria 14289
780 Ga0395901_0010578 3300038443 Bacteria 9348
781 Ga0395901_0059253 3300038443 Bacteria 3983
782 Ga0395901_0067844 3300038443 Bacteria 3715
783 Ga0395901_0081109 3300038443 Bacteria 3388
784 Ga0395901_0119295 3300038443 Bacteria 2772
785 Ga0436361_0021149 3300039447 Bacteria 8615
786 Ga0439447_011193 3300041407 Bacteria 2629
787 Ga0439466_0001850 3300041411 Bacteria 8310
788 Ga0439448_0022307 3300042005 Bacteria 1967
789 Ga0439449_0000697 3300042007 Bacteria 12827
790 Ga0451577_0000010 3300042876 Bacteria 616686
791 Ga0451577_0011492 3300042876 Bacteria 8368
792 Ga0451577_0068138 3300042876 Bacteria 3174
793 Ga0451577_0097018 3300042876 Bacteria 2632
794 Ga0451577_0214216 3300042876 Bacteria 1740
795 Ga0451577_0370719 3300042876 Bacteria 1299
796 Ga0466969_0000912 3300044656 Bacteria 15928
797 Ga0466969_0053439 3300044656 Bacteria 1982
798 Ga0466969_0098395 3300044656 Bacteria 1379
799 Ga0466972_0000013 3300044658 Bacteria 229345
800 Ga0466972_0005607 3300044658 Bacteria 6290
801 Ga0453683_0000031 3300044673 Bacteria 241998
802 Ga0453683_0001482 3300044673 Bacteria 20102
803 Ga0453683_0085783 3300044673 Bacteria 1973
804 Ga0466966_0000045 3300044684 Bacteria 92504
805 Ga0466966_0053935 3300044684 Bacteria 2549
806 Ga0466961_0066482 3300044693 Bacteria 2290
807 Ga0466961_0088177 3300044693 Bacteria 1960
808 Ga0453684_0000191 3300044712 Bacteria 267816
809 Ga0453684_0009766 3300044712 Bacteria 16663
810 Ga0453684_0072910 3300044712 Bacteria 4332
811 Ga0453684_0097891 3300044712 Bacteria 3599
812 Ga0453684_0178992 3300044712 Bacteria 2491
813 Ga0453684_0192947 3300044712 Bacteria 2381
814 Ga0453684_0311331 3300044712 Bacteria 1786
815 Ga0453684_0442253 3300044712 Bacteria 1449
816 Ga0466968_0089549 3300044735 Bacteria 1362
817 Ga0466970_0018485 3300044765 Bacteria 3609
818 Ga0466970_0069434 3300044765 Bacteria 1894
819 Ga0466957_0003333 3300044842 Bacteria 8805
820 Ga0466957_0152139 3300044842 Bacteria 1497
821 Ga0466959_0000023 3300045049 Bacteria 124545
822 Ga0466959_0083862 3300045049 Bacteria 2294
823 Ga0451576_0000088 3300045051 Bacteria 234139
824 Ga0451576_0007064 3300045051 Bacteria 13567
825 Ga0451576_0027120 3300045051 Bacteria 6156
826 Ga0451576_0040329 3300045051 Bacteria 4943
827 Ga0451576_0204986 3300045051 Bacteria 2059
828 Ga0495629_0035357 3300046459 Bacteria 3531
829 Ga0495638_0049677 3300046460 Bacteria 2622
830 Ga0495651_0090903 3300046462 Bacteria 2289
831 Ga0495650_0000087 3300046471 Bacteria 234870
832 Ga0495585_0000286 3300046492 Bacteria 50524
833 Ga0495585_0001651 3300046492 Bacteria 17060
834 Ga0495583_0094765 3300046506 Bacteria 1281
835 Ga0495606_0000052 3300046507 Bacteria 201529
836 Ga0495606_0014847 3300046507 Bacteria 6048
837 Ga0495610_0000001 3300046512 Bacteria 1620061
838 Ga0495610_0000903 3300046512 Bacteria 27607
839 Ga0495610_0006770 3300046512 Bacteria 7778
840 Ga0495610_0010020 3300046512 Bacteria 5922
841 Ga0495616_0005196 3300046513 Bacteria 8053
842 Ga0495618_0007268 3300046514 Bacteria 6701
843 Ga0495628_0017891 3300046516 Bacteria 5883
844 Ga0495630_0049633 3300046517 Bacteria 3140
845 Ga0495630_0116104 3300046517 Bacteria 2029
846 Ga0495631_0027708 3300046518 Bacteria 2590
847 Ga0495644_0007188 3300046523 Bacteria 4303
848 Ga0495648_0077885 3300046524 Bacteria 1898
849 Ga0495640_0061455 3300046533 Unclassified 2552
850 Ga0495598_0027721 3300046537 Bacteria 1565
851 Ga0495633_0000080 3300046558 Bacteria 127703
852 Ga0495633_0000081 3300046558 Bacteria 125903
853 Ga0495633_0072173 3300046558 Bacteria 1610
854 Ga0495668_0000012 3300046616 Bacteria 458817
855 Ga0495634_0069334 3300046642 Bacteria 2327
856 Ga0495625_0000036 3300046660 Bacteria 221680
857 Ga0495625_0002289 3300046660 Bacteria 20991
858 Ga0495625_0010136 3300046660 Bacteria 7829
859 Ga0495625_0014574 3300046660 Bacteria 6267
860 Ga0495625_0021139 3300046660 Bacteria 5014
861 Ga0495625_0043637 3300046660 Bacteria 3251
862 Ga0495625_0091239 3300046660 Bacteria 2106
863 Ga0495625_0233913 3300046660 Bacteria 1199
864 Ga0495661_0003611 3300046665 Bacteria 11391
865 Ga0495661_0092978 3300046665 Bacteria 1712
866 Ga0495646_0058441 3300046680 Bacteria 2306
867 Ga0495658_0017216 3300046683 Bacteria 3731
868 Ga0495658_0020389 3300046683 Unclassified 3477
869 Ga0495669_0058397 3300046684 Bacteria 1741
870 Ga0495613_0161327 3300046689 Unclassified 1595
871 Ga0495649_0000017 3300046694 Bacteria 221685
872 Ga0495589_0123181 3300046794 Bacteria 1248
873 Ga0495660_0013731 3300046810 Bacteria 4694
874 Ga0495674_0018467 3300047319 Bacteria 6490
875 Ga0495683_0023732 3300047323 Bacteria 3152
876 Ga0495687_055425 3300047443 Bacteria 1657
877 Ga0495673_0068477 3300047469 Bacteria 1500
878 Ga0495684_0161177 3300047471 Bacteria 1673
879 Ga0495686_0000004 3300047472 Bacteria 869019
880 Ga0495686_0000582 3300047472 Bacteria 51799
881 Ga0495686_0005494 3300047472 Bacteria 9975
882 Ga0495686_0020028 3300047472 Bacteria 4464
883 Ga0496109_0054915 3300048912 Bacteria 3633
884 Ga0496114_0000594 3300048917 Bacteria 26726
885 Ga0496114_0369263 3300048917 Unclassified 1270
886 Ga0496115_0007421 3300048918 Bacteria 8067
887 Ga0496115_0045415 3300048918 Bacteria 3507
888 Ga0496116_0000032 3300048919 Bacteria 419997
889 Ga0496121_0091005 3300048924 Bacteria 2383
890 Ga0496122_0001208 3300048925 Bacteria 43998
891 Ga0496123_0008537 3300048926 Bacteria 9392
892 Ga0496124_0111474 3300048927 Bacteria 2201
893 Ga0496124_0126449 3300048927 Bacteria 2035
894 Ga0496125_0000059 3300048928 Bacteria 264149
895 Ga0496125_0011341 3300048928 Bacteria 8925
896 Ga0496126_0008790 3300048929 Bacteria 10843
897 Ga0496126_0022457 3300048929 Bacteria 6139
898 Ga0496126_0212279 3300048929 Bacteria 1629
899 Ga0495678_014851 3300049459 Bacteria 3607
900 Ga0501031_0003605 3300049568 Bacteria 9955
901 Ga0501032_0091050 3300049569 Bacteria 2024
902 Ga0501033_0010675 3300049570 Bacteria 7038
903 Ga0501034_0004012 3300049571 Bacteria 16517
904 Ga0501034_0016530 3300049571 Bacteria 7567
905 Ga0501034_0025459 3300049571 Bacteria 6024
906 Ga0501034_0027052 3300049571 Bacteria 5835
907 Ga0501034_0146271 3300049571 Bacteria 2340
908 Ga0501034_0330791 3300049571 Unclassified 1455
909 Ga0501036_0041913 3300049572 Bacteria 3874
910 Ga0501037_0039086 3300049573 Bacteria 3494
911 Ga0501038_0012291 3300049574 Bacteria 7820
912 Ga0501039_0022501 3300049575 Bacteria 4838
913 Ga0501043_0009607 3300049579 Bacteria 7578
914 Ga0501043_0024314 3300049579 Bacteria 4754
915 Ga0501043_0028424 3300049579 Bacteria 4390
916 Ga0501046_0024666 3300049580 Bacteria 4928
917 Ga0501046_0045170 3300049580 Bacteria 3501
918 Ga0501046_0239907 3300049580 Bacteria 1337
919 Ga0501047_0021075 3300049581 Bacteria 6258
920 Ga0501047_0027231 3300049581 Bacteria 5506
921 Ga0501047_0066956 3300049581 Bacteria 3462
922 Ga0501047_0072959 3300049581 Bacteria 3304
923 Ga0501047_0332711 3300049581 Unclassified 1357
924 Ga0501048_0043141 3300049582 Bacteria 3229
925 Ga0501067_0095409 3300049583 Bacteria 1651
926 Ga0501068_0153904 3300049584 Unclassified 1446
927 Ga0501069_0081356 3300049585 Unclassified 1824
928 Ga0501073_0019693 3300049589 Bacteria 4870
929 Ga0501074_0062516 3300049590 Bacteria 2681
930 Ga0501198_002157 3300049649 Unclassified 2629
931 Ga0501202_002208 3300049652 Unclassified 3247
932 Ga0501217_000620 3300049661 Bacteria 5983
933 Ga0501217_022688 3300049661 Bacteria 1491
934 Ga0501233_010478 3300049668 Unclassified 1827
935 Ga0501243_008416 3300049675 Bacteria 1589
936 Ga0501249_000037 3300049679 Bacteria 63492
937 Ga0501249_008390 3300049679 Bacteria 2145
938 Ga0501249_008602 3300049679 Bacteria 2118
939 Ga0501249_009305 3300049679 Bacteria 2044
940 Ga0501257_016312 3300049686 Bacteria 1722
941 Ga0501219_000052 3300049703 Bacteria 18661
942 Ga0501221_000044 3300049704 Bacteria 12905
943 Ga0501225_0001739 3300049705 Bacteria 6824
944 Ga0501225_0013111 3300049705 Unclassified 2321
945 Ga0501245_002249 3300049708 Unclassified 2571
946 Ga0501080_0057861 3300049742 Bacteria 3608
947 Ga0501080_0123580 3300049742 Bacteria 2398
948 Ga0501241_000031 3300049758 Bacteria 52001
949 Ga0501266_000011 3300049763 Bacteria 197280
950 Ga0501035_0015438 3300049822 Bacteria 7045
951 Ga0501035_0027505 3300049822 Bacteria 5198
952 Ga0501044_0009636 3300049823 Bacteria 10510
953 Ga0501044_0017840 3300049823 Bacteria 7614
954 Ga0501044_0028924 3300049823 Bacteria 5845
955 Ga0501044_0052694 3300049823 Bacteria 4191
956 Ga0501284_00029 3300050005 Bacteria 74818
957 nmdc:mga0k408_3518_c1 3300050493 Bacteria 8279
958 nmdc:mga0k408_41458_c1 3300050493 Bacteria 2232
959 nmdc:mga0k408_749_c1 3300050493 Bacteria 17824
960 nmdc:mga0k408_821_c1 3300050493 Bacteria 17147
961 nmdc:mga05p37_13616_c1 3300050507 Bacteria 9747
962 nmdc:mga09592_983_c1 3300050508 Bacteria 22557
963 nmdc:mga0qj67_97741_c1 3300050509 Bacteria 2365
964 Ga0500635_0002671 3300053080 Bacteria 4424
965 Ga0495619_0170484 3300053085 Bacteria 1505
966 Ga0500578_0004418 3300053086 Bacteria 9905
967 Ga0500646_0001428 3300053090 Bacteria 6341
968 Ga0500646_0004317 3300053090 Bacteria 3602
969 Ga0500583_0000108 3300053092 Bacteria 41760
970 Ga0500651_0000084 3300053093 Bacteria 60127
971 Ga0500651_0064350 3300053093 Bacteria 2287
972 Ga0500641_0000017 3300053096 Bacteria 132678
973 Ga0500641_0002621 3300053096 Bacteria 6345
974 Ga0500594_0003311 3300053118 Bacteria 3528
975 Ga0500608_016279 3300053122 Bacteria 3356
976 Ga0500618_000002 3300053125 Bacteria 370822
977 Ga0500652_037526 3300053131 Bacteria 1934
978 Ga0500658_0000003 3300053134 Bacteria 512506
979 Ga0500589_003337 3300053147 Bacteria 5739
980 Ga0500616_0145895 3300053153 Bacteria 1101
981 Ga0500622_0000777 3300053156 Bacteria 27709
982 Ga0500622_0004557 3300053156 Bacteria 8641
983 Ga0500624_000271 3300053157 Bacteria 17926
984 Ga0500636_0044658 3300053177 Bacteria 2613
985 Ga0500584_014924 3300053726 Bacteria 3565
986 Ga0500611_000022 3300053727 Bacteria 102349
987 Ga0466962_0023524 3300061719 Bacteria 2961

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009092 Ga0105250_10040141 Ga0105250_100401411 285
2 3300042007 Ga0439449_0000697 Ga0439449_0000697_249_1172 292
3 3300042876 Ga0451577_0011492 Ga0451577_0011492_2550_3614 300
4 3300042876 Ga0451577_0370719 Ga0451577_0370719_185_1249 309
5 3300049580 Ga0501046_0024666 Ga0501046_0024666_3324_4367 309
6 3300049823 Ga0501044_0009636 Ga0501044_0009636_1257_2300 309
7 3300025938 Ga0207704_10000099 Ga0207704_1000009913 312
8 3300006946 Ga0079104_1000005 Ga0079104_10000059 314
9 3300027111 Ga0209281_1000094 Ga0209281_100009410 314
10 3300026088 Ga0207641_10153753 Ga0207641_101537532 316
11 3300006237 Ga0097621_100164744 Ga0097621_1001647442 317
12 3300003322 rootL2_10058669 rootL2_100586694 319
13 3300005614 Ga0068856_100207105 Ga0068856_1002071052 319
14 3300025911 Ga0207654_10047242 Ga0207654_100472422 319
15 3300025914 Ga0207671_10002907 Ga0207671_100029075 319
16 3300026078 Ga0207702_10074879 Ga0207702_100748792 319
17 3300013102 Ga0157371_10001161 Ga0157371_100011619 320
18 3300013104 Ga0157370_10017596 Ga0157370_100175964 320
19 3300013105 Ga0157369_10086419 Ga0157369_100864192 320
20 3300032004 Ga0307414_10000009 Ga0307414_10000009164 322
21 iso_pu_bacteria 2523533629 2524004500 326
22 3300017792 Ga0163161_10020644 Ga0163161_100206445 327
23 3300037312 Ga0395899_0000025 Ga0395899_0000025_225669_226733 327
24 3300037418 Ga0395900_0108003 Ga0395900_0108003_1418_2482 327
25 3300042876 Ga0451577_0214216 Ga0451577_0214216_523_1554 327
26 3300044712 Ga0453684_0009766 Ga0453684_0009766_2827_3858 327
27 3300045051 Ga0451576_0007064 Ga0451576_0007064_11080_12111 327
28 3300050493 nmdc:mga0k408_41458_c1 nmdc:mga0k408_41458_c1_12_1043 327
29 iso_pu_bacteria 2511231000 2511234750 327
30 iso_pu_bacteria 2582581281 2585158508 327
31 iso_pu_bacteria 2582581282 2585162854 327
32 3300003323 rootH1_10035284 rootH1_1003528414 328
33 3300005289 Ga0065704_10083999 Ga0065704_100839992 328
34 3300005329 Ga0070683_100030965 Ga0070683_1000309655 328
35 3300015261 Ga0182006_1000011 Ga0182006_1000011243 328
36 3300025291 Ga0209675_1000033 Ga0209675_100003313 328
37 3300027876 Ga0209974_10017789 Ga0209974_100177892 328
38 3300046512 Ga0495610_0000001 Ga0495610_0000001_1448439_1449470 328
39 3300046660 Ga0495625_0043637 Ga0495625_0043637_1461_2597 328
40 iso_pu_bacteria 2513020052 2513235060 328
41 iso_pu_bacteria 2643221600 2644013061 328
42 iso_pu_bacteria 2643221667 2644372379 328
43 iso_pu_bacteria 2643221725 2644684851 328
44 iso_pu_bacteria 2738541279 2738732463 328
45 iso_pu_bacteria 2738541285 2738765028 328
46 iso_pu_bacteria 2738543007 2739214043 328
47 iso_pu_bacteria 2739367857 2740001323 328
48 iso_pu_bacteria 2739367858 2740006139 328
49 iso_pu_bacteria 2802428842 2802653773 328
50 iso_pu_bacteria 2881359912 2881363107 328
51 iso_pu_bacteria 2919683626 2919685973 328
52 iso_pu_bacteria 2929150217 2929153564 328
53 iso_pu_bacteria 2977268062 2977270228 328
54 3300048918 Ga0496115_0007421 Ga0496115_0007421_2267_3298 329
55 iso_pu_bacteria 2519899754 2520879408 329
56 iso_pu_bacteria 2585427687 2586210050 329
57 iso_pu_bacteria 2643221716 2644642605 329
58 iso_pu_bacteria 2738541283 2738757065 329
59 iso_pu_bacteria 2738541284 2738760402 329
60 iso_pu_bacteria 2738541302 2738851781 329
61 iso_pu_bacteria 2738543023 2739302549 329
62 iso_pu_bacteria 2739367651 2739590671 329
63 iso_pu_bacteria 2739367656 2739617093 329
64 iso_pu_bacteria 2739367663 2739647398 329
65 iso_pu_bacteria 2775506987 2776612453 329
66 iso_pu_bacteria 2816332280 2817416276 329
67 iso_pu_bacteria 2818991437 2819546345 329
68 iso_pu_bacteria 2842722452 2842725022 329
69 iso_pu_bacteria 2842909656 2842914186 329
70 iso_pu_bacteria 2849281842 2849286580 329
71 iso_pu_bacteria 2852627209 2852630368 329
72 iso_pu_bacteria 2857613821 2857614954 329
73 iso_pu_bacteria 2857618242 2857618658 329
74 iso_pu_bacteria 2857627736 2857630290 329
75 iso_pu_bacteria 2903895155 2903896890 329
76 iso_pu_bacteria 2904419702 2904422793 329
77 iso_pu_bacteria 2904445276 2904448666 329
78 iso_pu_bacteria 2904555929 2904557071 329
79 iso_pu_bacteria 2919186247 2919189655 329
80 iso_pu_bacteria 2919191525 2919195305 329
81 iso_pu_bacteria 2939664404 2939667881 329
82 iso_pu_bacteria 2945997725 2946001964 329
83 iso_pu_bacteria 2954016120 2954018848 329
84 iso_pu_bacteria 2958458903 2958461118 329
85 iso_pu_bacteria 8054307821 8054310082 329
86 iso_pu_bacteria 8055419101 8055421935 329
87 iso_pu_bacteria 8055592153 8055593425 329
88 iso_pu_bacteria 8056440228 8056443836 329
89 3300003323 rootH1_10298335 rootH1_102983353 330
90 3300003578 Ga0006562J51391_1016454 Ga0006562J51391_10164542 330
91 3300005288 Ga0065714_10107284 Ga0065714_101072841 330
92 3300005288 Ga0065714_10109461 Ga0065714_101094611 330
93 3300006948 Ga0099826_10126639 Ga0099826_101266391 330
94 3300009036 Ga0105244_10000063 Ga0105244_1000006322 330
95 3300013100 Ga0157373_10000002 Ga0157373_10000002528 330
96 3300013102 Ga0157371_10005312 Ga0157371_100053128 330
97 3300013104 Ga0157370_10006435 Ga0157370_100064353 330
98 3300013104 Ga0157370_10007484 Ga0157370_100074846 330
99 3300013104 Ga0157370_10014665 Ga0157370_100146653 330
100 3300013105 Ga0157369_10001138 Ga0157369_1000113818 330
101 3300015261 Ga0182006_1001882 Ga0182006_10018827 330
102 3300017792 Ga0163161_10000012 Ga0163161_1000001247 330
103 3300027471 Ga0209995_1001337 Ga0209995_10013374 330
104 3300027526 Ga0209968_1002355 Ga0209968_10023553 330
105 3300027617 Ga0210002_1001420 Ga0210002_10014202 330
106 3300027666 Ga0209282_1106414 Ga0209282_11064142 330
107 3300031548 Ga0307408_100002250 Ga0307408_1000022507 330
108 3300031824 Ga0307413_10115686 Ga0307413_101156863 330
109 3300031824 Ga0307413_10143113 Ga0307413_101431132 330
110 3300031852 Ga0307410_10000067 Ga0307410_100000675 330
111 3300031901 Ga0307406_10000035 Ga0307406_1000003545 330
112 3300031903 Ga0307407_10063361 Ga0307407_100633612 330
113 3300032002 Ga0307416_100000639 Ga0307416_1000006394 330
114 3300032004 Ga0307414_10000063 Ga0307414_1000006331 330
115 3300032004 Ga0307414_10004631 Ga0307414_100046314 330
116 3300032004 Ga0307414_10008231 Ga0307414_100082317 330
117 3300032005 Ga0307411_10000001 Ga0307411_10000001449 330
118 3300033180 Ga0307510_10041880 Ga0307510_100418803 330
119 3300041407 Ga0439447_011193 Ga0439447_011193_725_1771 330
120 3300041411 Ga0439466_0001850 Ga0439466_0001850_1774_2823 330
121 3300044712 Ga0453684_0072910 Ga0453684_0072910_1717_2787 330
122 3300048919 Ga0496116_0000032 Ga0496116_0000032_144151_145197 330
123 3300048924 Ga0496121_0091005 Ga0496121_0091005_105_1151 330
124 3300048927 Ga0496124_0126449 Ga0496124_0126449_197_1243 330
125 3300048928 Ga0496125_0000059 Ga0496125_0000059_143133_144182 330
126 3300048929 Ga0496126_0008790 Ga0496126_0008790_7189_8232 330
127 3300049679 Ga0501249_000037 Ga0501249_000037_34818_35864 330
128 3300049679 Ga0501249_008602 Ga0501249_008602_642_1688 330
129 3300049763 Ga0501266_000011 Ga0501266_000011_185778_186824 330
130 3300053090 Ga0500646_0004317 Ga0500646_0004317_2400_3446 330
131 3300053096 Ga0500641_0000017 Ga0500641_0000017_113452_114498 330
132 3300053096 Ga0500641_0002621 Ga0500641_0002621_2861_3907 330
133 3300053118 Ga0500594_0003311 Ga0500594_0003311_205_1251 330
134 3300053134 Ga0500658_0000003 Ga0500658_0000003_165562_166611 330
135 3300053726 Ga0500584_014924 Ga0500584_014924_1975_3021 330
136 iso_pu_bacteria 2599185184 2599478340 330
137 iso_pu_bacteria 2818991444 2819588775 330
138 iso_pu_bacteria 2833640130 2833643626 330
139 iso_pu_bacteria 2852623160 2852623164 330
140 iso_pu_bacteria 2884791551 2884795632 330
141 iso_pu_bacteria 2884933994 2884937971 330
142 iso_pu_bacteria 2919437846 2919440792 330
143 iso_pu_bacteria 2928078545 2928080610 330
144 iso_pu_bacteria 2928147474 2928150835 330
145 iso_pu_bacteria 2929177148 2929178797 330
146 iso_pu_bacteria 2932082852 2932083005 330
147 iso_pu_bacteria 2945977869 2945981199 330
148 iso_pu_bacteria 2946013367 2946019399 330
149 iso_pu_bacteria 2977232053 2977232530 330
150 iso_pu_bacteria 8003151029 8003153679 330
151 3300028800 Ga0265338_10001687 Ga0265338_100016879 331
152 3300042876 Ga0451577_0097018 Ga0451577_0097018_1151_2188 331
153 3300044712 Ga0453684_0097891 Ga0453684_0097891_1090_2124 331
154 3300045051 Ga0451576_0027120 Ga0451576_0027120_171_1208 331
155 3300048917 Ga0496114_0000594 Ga0496114_0000594_320_1357 331
156 iso_pu_bacteria 2842903701 2842908876 331
157 iso_pu_bacteria 2884634485 2884635381 331
158 iso_pu_bacteria 2914759650 2914759720 331
159 iso_pu_bacteria 2919692658 2919695677 331
160 3300005337 Ga0070682_100241275 Ga0070682_1002412751 332
161 3300005563 Ga0068855_100000240 Ga0068855_1000002404 332
162 3300005616 Ga0068852_100151779 Ga0068852_1001517792 332
163 3300009093 Ga0105240_10108377 Ga0105240_101083773 332
164 3300009174 Ga0105241_10170979 Ga0105241_101709791 332
165 3300013296 Ga0157374_10297505 Ga0157374_102975052 332
166 3300013306 Ga0163162_10029333 Ga0163162_100293333 332
167 3300013308 Ga0157375_10205722 Ga0157375_102057222 332
168 3300014326 Ga0157380_10162904 Ga0157380_101629042 332
169 3300025931 Ga0207644_10168342 Ga0207644_101683422 332
170 3300025949 Ga0207667_10000037 Ga0207667_10000037129 332
171 3300026121 Ga0207683_10057036 Ga0207683_100570364 332
172 3300028794 Ga0307515_10000681 Ga0307515_1000068157 332
173 3300028794 Ga0307515_10081729 Ga0307515_100817294 332
174 3300028794 Ga0307515_10093645 Ga0307515_100936453 332
175 3300028794 Ga0307515_10229784 Ga0307515_102297842 332
176 3300031727 Ga0316576_10075969 Ga0316576_100759692 332
177 3300031728 Ga0316578_10057826 Ga0316578_100578262 332
178 3300035695 Ga0373927_0005849 Ga0373927_0005849_7132_8175 332
179 3300036647 Ga0316582_0060474 Ga0316582_0060474_1269_2336 332
180 3300036712 Ga0316584_0027245 Ga0316584_0027245_2029_3078 332
181 3300036712 Ga0316584_0122674 Ga0316584_0122674_489_1556 332
182 2162886007 SwRhRL2b_contig_787417 SwRhRL2b_0404.00004120 333
183 3300001904 JGI24736J21556_1003139 JGI24736J21556_10031392 333
184 3300001979 JGI24740J21852_10020774 JGI24740J21852_100207741 333
185 3300001990 JGI24737J22298_10007120 JGI24737J22298_100071203 333
186 3300002067 JGI24735J21928_10000004 JGI24735J21928_1000000496 333
187 3300002737 JGI25162J39368_1000011 JGI25162J39368_1000011117 333
188 3300002737 JGI25162J39368_1000614 JGI25162J39368_10006145 333
189 3300002738 JGI25154J39366_1000040 JGI25154J39366_100004022 333
190 3300002741 JGI25157J39369_1003731 JGI25157J39369_10037312 333
191 3300002741 JGI25157J39369_1004254 JGI25157J39369_10042542 333
192 3300002772 JGI25164J39214_1003371 JGI25164J39214_10033712 333
193 3300002773 JGI25152J39213_1000143 JGI25152J39213_100014354 333
194 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001466 333
195 3300003187 JGI25151J46595_10000001 JGI25151J46595_10000001336 333
196 3300003214 JGI25165J46597_1000985 JGI25165J46597_10009859 333
197 3300003215 JGI25153J46596_10000001 JGI25153J46596_10000001225 333
198 3300003215 JGI25153J46596_10003346 JGI25153J46596_100033466 333
199 3300003316 rootH1_10024829 rootH1_1002482915 333
200 3300003316 rootH1_10063239 rootH1_100632395 333
201 3300003316 rootH1_10140822 rootH1_101408222 333
202 3300003320 rootH2_10001891 rootH2_10001891197 333
203 3300003320 rootH2_10003679 rootH2_100036794 333
204 3300003320 rootH2_10013742 rootH2_100137428 333
205 3300003320 rootH2_10053227 rootH2_100532273 333
206 3300003320 rootH2_10090920 rootH2_100909203 333
207 3300003320 rootH2_10184838 rootH2_101848382 333
208 3300003322 rootL2_10017790 rootL2_100177904 333
209 3300003322 rootL2_10028141 rootL2_100281412 333
210 3300003322 rootL2_10030620 rootL2_100306201 333
211 3300003322 rootL2_10107720 rootL2_101077204 333
212 3300003322 rootL2_10223865 rootL2_102238652 333
213 3300003322 rootL2_10315621 rootL2_103156212 333
214 3300003323 rootH1_10000019 rootH1_100000193 333
215 3300003323 rootH1_10008801 rootH1_100088019 333
216 3300003323 rootH1_10054491 rootH1_100544912 333
217 3300003323 rootH1_10163486 rootH1_101634862 333
218 3300003323 rootH1_10178453 rootH1_101784532 333
219 3300003354 JGI25160J50197_1006644 JGI25160J50197_10066443 333
220 3300003781 Ga0055536_1000001 Ga0055536_1000001272 333
221 3300003791 Ga0055530_10004772 Ga0055530_100047724 333
222 3300003794 Ga0055531_10000131 Ga0055531_1000013141 333
223 3300005262 Ga0065165_1000300 Ga0065165_100030071 333
224 3300005288 Ga0065714_10003545 Ga0065714_100035456 333
225 3300005288 Ga0065714_10004089 Ga0065714_100040899 333
226 3300005288 Ga0065714_10010706 Ga0065714_100107062 333
227 3300005288 Ga0065714_10064863 Ga0065714_1006486315 333
228 3300005288 Ga0065714_10067358 Ga0065714_100673584 333
229 3300005288 Ga0065714_10099861 Ga0065714_100998612 333
230 3300005289 Ga0065704_10000210 Ga0065704_100002104 333
231 3300005290 Ga0065712_10008583 Ga0065712_100085832 333
232 3300005290 Ga0065712_10124654 Ga0065712_101246542 333
233 3300005293 Ga0065715_10004221 Ga0065715_100042215 333
234 3300005327 Ga0070658_10000049 Ga0070658_1000004921 333
235 3300005327 Ga0070658_10031135 Ga0070658_100311352 333
236 3300005327 Ga0070658_10101229 Ga0070658_101012292 333
237 3300005328 Ga0070676_10000336 Ga0070676_100003369 333
238 3300005328 Ga0070676_10026339 Ga0070676_100263391 333
239 3300005329 Ga0070683_100032467 Ga0070683_1000324673 333
240 3300005329 Ga0070683_100067205 Ga0070683_1000672052 333
241 3300005330 Ga0070690_100012862 Ga0070690_1000128622 333
242 3300005331 Ga0070670_100033933 Ga0070670_1000339332 333
243 3300005331 Ga0070670_100034230 Ga0070670_1000342302 333
244 3300005331 Ga0070670_100086541 Ga0070670_1000865412 333
245 3300005331 Ga0070670_100181544 Ga0070670_1001815441 333
246 3300005331 Ga0070670_100435816 Ga0070670_1004358161 333
247 3300005333 Ga0070677_10014143 Ga0070677_100141432 333
248 3300005334 Ga0068869_100039400 Ga0068869_1000394003 333
249 3300005335 Ga0070666_10002847 Ga0070666_100028478 333
250 3300005335 Ga0070666_10056865 Ga0070666_100568652 333
251 3300005336 Ga0070680_100015517 Ga0070680_1000155174 333
252 3300005336 Ga0070680_100171020 Ga0070680_1001710202 333
253 3300005337 Ga0070682_100001275 Ga0070682_10000127510 333
254 3300005337 Ga0070682_100119478 Ga0070682_1001194781 333
255 3300005338 Ga0068868_100004138 Ga0068868_1000041388 333
256 3300005338 Ga0068868_100008530 Ga0068868_1000085303 333
257 3300005338 Ga0068868_100011418 Ga0068868_1000114182 333
258 3300005338 Ga0068868_100015143 Ga0068868_1000151433 333
259 3300005338 Ga0068868_100020344 Ga0068868_1000203442 333
260 3300005339 Ga0070660_100027944 Ga0070660_1000279442 333
261 3300005339 Ga0070660_100043577 Ga0070660_1000435773 333
262 3300005339 Ga0070660_100171259 Ga0070660_1001712591 333
263 3300005341 Ga0070691_10004326 Ga0070691_100043266 333
264 3300005344 Ga0070661_100023944 Ga0070661_1000239443 333
265 3300005344 Ga0070661_100043909 Ga0070661_1000439093 333
266 3300005347 Ga0070668_100004446 Ga0070668_1000044468 333
267 3300005353 Ga0070669_100018155 Ga0070669_1000181554 333
268 3300005354 Ga0070675_100015326 Ga0070675_1000153266 333
269 3300005354 Ga0070675_100016332 Ga0070675_1000163325 333
270 3300005354 Ga0070675_100027340 Ga0070675_1000273401 333
271 3300005354 Ga0070675_100044109 Ga0070675_1000441093 333
272 3300005354 Ga0070675_100268887 Ga0070675_1002688871 333
273 3300005355 Ga0070671_100046891 Ga0070671_1000468912 333
274 3300005355 Ga0070671_100159729 Ga0070671_1001597292 333
275 3300005364 Ga0070673_100004993 Ga0070673_1000049931 333
276 3300005364 Ga0070673_100016856 Ga0070673_1000168566 333
277 3300005364 Ga0070673_100026479 Ga0070673_1000264792 333
278 3300005364 Ga0070673_100035251 Ga0070673_1000352512 333
279 3300005365 Ga0070688_100001700 Ga0070688_1000017003 333
280 3300005366 Ga0070659_100006699 Ga0070659_1000066996 333
281 3300005366 Ga0070659_100047474 Ga0070659_1000474744 333
282 3300005366 Ga0070659_100069713 Ga0070659_1000697132 333
283 3300005366 Ga0070659_100244848 Ga0070659_1002448482 333
284 3300005367 Ga0070667_100000492 Ga0070667_10000049223 333
285 3300005367 Ga0070667_100001349 Ga0070667_10000134914 333
286 3300005367 Ga0070667_100048526 Ga0070667_1000485264 333
287 3300005455 Ga0070663_100001195 Ga0070663_10000119511 333
288 3300005455 Ga0070663_100081084 Ga0070663_1000810842 333
289 3300005455 Ga0070663_100271155 Ga0070663_1002711551 333
290 3300005456 Ga0070678_100001813 Ga0070678_1000018135 333
291 3300005456 Ga0070678_100107493 Ga0070678_1001074932 333
292 3300005457 Ga0070662_100000045 Ga0070662_10000004525 333
293 3300005457 Ga0070662_100025109 Ga0070662_1000251093 333
294 3300005457 Ga0070662_100096983 Ga0070662_1000969832 333
295 3300005458 Ga0070681_10018316 Ga0070681_100183164 333
296 3300005458 Ga0070681_10029313 Ga0070681_100293136 333
297 3300005458 Ga0070681_10040763 Ga0070681_100407633 333
298 3300005459 Ga0068867_100004573 Ga0068867_1000045732 333
299 3300005459 Ga0068867_100036004 Ga0068867_1000360043 333
300 3300005459 Ga0068867_100060265 Ga0068867_1000602652 333
301 3300005459 Ga0068867_100333504 Ga0068867_1003335041 333
302 3300005466 Ga0070685_10002206 Ga0070685_100022064 333
303 3300005466 Ga0070685_10005910 Ga0070685_100059102 333
304 3300005466 Ga0070685_10027809 Ga0070685_100278092 333
305 3300005466 Ga0070685_10077516 Ga0070685_100775162 333
306 3300005530 Ga0070679_100004536 Ga0070679_1000045363 333
307 3300005530 Ga0070679_100006277 Ga0070679_1000062779 333
308 3300005530 Ga0070679_100008873 Ga0070679_1000088732 333
309 3300005530 Ga0070679_100127028 Ga0070679_1001270282 333
310 3300005535 Ga0070684_100035368 Ga0070684_1000353682 333
311 3300005535 Ga0070684_100042359 Ga0070684_1000423592 333
312 3300005535 Ga0070684_100127303 Ga0070684_1001273032 333
313 3300005535 Ga0070684_100132672 Ga0070684_1001326722 333
314 3300005539 Ga0068853_100003018 Ga0068853_10000301814 333
315 3300005539 Ga0068853_100008065 Ga0068853_1000080653 333
316 3300005539 Ga0068853_100008667 Ga0068853_1000086676 333
317 3300005539 Ga0068853_100013120 Ga0068853_1000131209 333
318 3300005539 Ga0068853_100022472 Ga0068853_1000224722 333
319 3300005539 Ga0068853_100057348 Ga0068853_1000573482 333
320 3300005539 Ga0068853_100139186 Ga0068853_1001391862 333
321 3300005539 Ga0068853_100301937 Ga0068853_1003019372 333
322 3300005543 Ga0070672_100001489 Ga0070672_1000014894 333
323 3300005543 Ga0070672_100055232 Ga0070672_1000552322 333
324 3300005543 Ga0070672_100083317 Ga0070672_1000833172 333
325 3300005543 Ga0070672_100090358 Ga0070672_1000903581 333
326 3300005543 Ga0070672_100156349 Ga0070672_1001563492 333
327 3300005544 Ga0070686_100032891 Ga0070686_1000328911 333
328 3300005544 Ga0070686_100073191 Ga0070686_1000731912 333
329 3300005544 Ga0070686_100280374 Ga0070686_1002803741 333
330 3300005547 Ga0070693_100003483 Ga0070693_1000034835 333
331 3300005547 Ga0070693_100179055 Ga0070693_1001790552 333
332 3300005548 Ga0070665_100000020 Ga0070665_100000020206 333
333 3300005548 Ga0070665_100016967 Ga0070665_1000169674 333
334 3300005548 Ga0070665_100043231 Ga0070665_1000432312 333
335 3300005563 Ga0068855_100000346 Ga0068855_10000034635 333
336 3300005563 Ga0068855_100005837 Ga0068855_1000058378 333
337 3300005563 Ga0068855_100008169 Ga0068855_1000081698 333
338 3300005563 Ga0068855_100022866 Ga0068855_1000228662 333
339 3300005563 Ga0068855_100024060 Ga0068855_1000240604 333
340 3300005563 Ga0068855_100026080 Ga0068855_1000260804 333
341 3300005563 Ga0068855_100032308 Ga0068855_1000323086 333
342 3300005563 Ga0068855_100035811 Ga0068855_1000358112 333
343 3300005563 Ga0068855_100047040 Ga0068855_1000470403 333
344 3300005563 Ga0068855_100062842 Ga0068855_1000628424 333
345 3300005563 Ga0068855_100070659 Ga0068855_1000706593 333
346 3300005563 Ga0068855_100071810 Ga0068855_1000718102 333
347 3300005564 Ga0070664_100192898 Ga0070664_1001928983 333
348 3300005564 Ga0070664_100244621 Ga0070664_1002446212 333
349 3300005577 Ga0068857_100007822 Ga0068857_1000078224 333
350 3300005577 Ga0068857_100008143 Ga0068857_1000081438 333
351 3300005577 Ga0068857_100019055 Ga0068857_1000190557 333
352 3300005577 Ga0068857_100037750 Ga0068857_1000377504 333
353 3300005577 Ga0068857_100209964 Ga0068857_1002099641 333
354 3300005578 Ga0068854_100036735 Ga0068854_1000367352 333
355 3300005578 Ga0068854_100051761 Ga0068854_1000517612 333
356 3300005578 Ga0068854_100184752 Ga0068854_1001847522 333
357 3300005614 Ga0068856_100000835 Ga0068856_10000083519 333
358 3300005614 Ga0068856_100010959 Ga0068856_10001095910 333
359 3300005614 Ga0068856_100017673 Ga0068856_1000176735 333
360 3300005614 Ga0068856_100041561 Ga0068856_1000415612 333
361 3300005614 Ga0068856_100050057 Ga0068856_1000500574 333
362 3300005614 Ga0068856_100072662 Ga0068856_1000726622 333
363 3300005616 Ga0068852_100001345 Ga0068852_1000013451 333
364 3300005616 Ga0068852_100003445 Ga0068852_1000034457 333
365 3300005616 Ga0068852_100083617 Ga0068852_1000836172 333
366 3300005616 Ga0068852_100227662 Ga0068852_1002276623 333
367 3300005616 Ga0068852_100362436 Ga0068852_1003624361 333
368 3300005617 Ga0068859_100019039 Ga0068859_1000190393 333
369 3300005617 Ga0068859_100222016 Ga0068859_1002220162 333
370 3300005618 Ga0068864_100005800 Ga0068864_1000058002 333
371 3300005718 Ga0068866_10011575 Ga0068866_100115752 333
372 3300005719 Ga0068861_100276800 Ga0068861_1002768002 333
373 3300005834 Ga0068851_10015604 Ga0068851_100156042 333
374 3300005834 Ga0068851_10047333 Ga0068851_100473332 333
375 3300005840 Ga0068870_10028107 Ga0068870_100281071 333
376 3300005840 Ga0068870_10142332 Ga0068870_101423322 333
377 3300005841 Ga0068863_100000412 Ga0068863_10000041216 333
378 3300005841 Ga0068863_100032411 Ga0068863_1000324112 333
379 3300005841 Ga0068863_100077889 Ga0068863_1000778892 333
380 3300005841 Ga0068863_100089741 Ga0068863_1000897413 333
381 3300005842 Ga0068858_100342504 Ga0068858_1003425041 333
382 3300005843 Ga0068860_100000916 Ga0068860_10000091622 333
383 3300005843 Ga0068860_100081090 Ga0068860_1000810903 333
384 3300005843 Ga0068860_100186633 Ga0068860_1001866332 333
385 3300005844 Ga0068862_100155708 Ga0068862_1001557082 333
386 3300005844 Ga0068862_100377924 Ga0068862_1003779242 333
387 3300005983 Ga0081540_1037226 Ga0081540_10372262 333
388 3300006195 Ga0075366_10005218 Ga0075366_100052185 333
389 3300006195 Ga0075366_10006027 Ga0075366_100060277 333
390 3300006195 Ga0075366_10019255 Ga0075366_100192554 333
391 3300006195 Ga0075366_10020069 Ga0075366_100200695 333
392 3300006195 Ga0075366_10074534 Ga0075366_100745342 333
393 3300006237 Ga0097621_100002086 Ga0097621_1000020862 333
394 3300006237 Ga0097621_100018421 Ga0097621_1000184214 333
395 3300006237 Ga0097621_100022179 Ga0097621_1000221794 333
396 3300006237 Ga0097621_100051361 Ga0097621_1000513613 333
397 3300006237 Ga0097621_100093559 Ga0097621_1000935593 333
398 3300006358 Ga0068871_100000100 Ga0068871_10000010022 333
399 3300006358 Ga0068871_100312735 Ga0068871_1003127352 333
400 3300006844 Ga0075428_100017721 Ga0075428_1000177214 333
401 3300006844 Ga0075428_100050469 Ga0075428_1000504694 333
402 3300006847 Ga0075431_100030371 Ga0075431_1000303716 333
403 3300006847 Ga0075431_100118749 Ga0075431_1001187492 333
404 3300006871 Ga0075434_100105830 Ga0075434_1001058302 333
405 3300006880 Ga0075429_100018092 Ga0075429_1000180924 333
406 3300006881 Ga0068865_100000174 Ga0068865_1000001747 333
407 3300006881 Ga0068865_100003461 Ga0068865_1000034612 333
408 3300006881 Ga0068865_100028117 Ga0068865_1000281173 333
409 3300006881 Ga0068865_100077970 Ga0068865_1000779702 333
410 3300006881 Ga0068865_100103533 Ga0068865_1001035332 333
411 3300006931 Ga0097620_100019038 Ga0097620_1000190385 333
412 3300006931 Ga0097620_100222010 Ga0097620_1002220102 333
413 3300009011 Ga0105251_10086058 Ga0105251_100860582 333
414 3300009036 Ga0105244_10098006 Ga0105244_100980062 333
415 3300009093 Ga0105240_10000074 Ga0105240_10000074126 333
416 3300009093 Ga0105240_10000237 Ga0105240_1000023725 333
417 3300009093 Ga0105240_10000598 Ga0105240_1000059845 333
418 3300009093 Ga0105240_10000626 Ga0105240_1000062619 333
419 3300009093 Ga0105240_10001351 Ga0105240_1000135122 333
420 3300009093 Ga0105240_10001595 Ga0105240_1000159512 333
421 3300009093 Ga0105240_10007062 Ga0105240_1000706218 333
422 3300009093 Ga0105240_10008151 Ga0105240_100081513 333
423 3300009093 Ga0105240_10022028 Ga0105240_100220288 333
424 3300009093 Ga0105240_10045715 Ga0105240_100457153 333
425 3300009093 Ga0105240_10066229 Ga0105240_100662294 333
426 3300009093 Ga0105240_10084727 Ga0105240_100847273 333
427 3300009093 Ga0105240_10096537 Ga0105240_100965372 333
428 3300009093 Ga0105240_10126815 Ga0105240_101268152 333
429 3300009093 Ga0105240_10261192 Ga0105240_102611922 333
430 3300009093 Ga0105240_10349622 Ga0105240_103496222 333
431 3300009094 Ga0111539_10034093 Ga0111539_100340935 333
432 3300009098 Ga0105245_10114265 Ga0105245_101142652 333
433 3300009147 Ga0114129_10033962 Ga0114129_100339622 333
434 3300009174 Ga0105241_10000086 Ga0105241_1000008651 333
435 3300009174 Ga0105241_10000659 Ga0105241_1000065924 333
436 3300009174 Ga0105241_10005221 Ga0105241_100052212 333
437 3300009174 Ga0105241_10042948 Ga0105241_100429482 333
438 3300009174 Ga0105241_10057228 Ga0105241_100572282 333
439 3300009174 Ga0105241_10284031 Ga0105241_102840312 333
440 3300009176 Ga0105242_10009407 Ga0105242_100094075 333
441 3300009176 Ga0105242_10015906 Ga0105242_100159064 333
442 3300009176 Ga0105242_10066597 Ga0105242_100665972 333
443 3300009177 Ga0105248_10570485 Ga0105248_105704851 333
444 3300009545 Ga0105237_10000224 Ga0105237_1000022452 333
445 3300009545 Ga0105237_10001565 Ga0105237_1000156523 333
446 3300009545 Ga0105237_10003647 Ga0105237_100036474 333
447 3300009545 Ga0105237_10004072 Ga0105237_1000407218 333
448 3300009545 Ga0105237_10009395 Ga0105237_100093958 333
449 3300009545 Ga0105237_10018293 Ga0105237_100182936 333
450 3300009545 Ga0105237_10028286 Ga0105237_100282865 333
451 3300009545 Ga0105237_10036976 Ga0105237_100369765 333
452 3300009545 Ga0105237_10057618 Ga0105237_100576182 333
453 3300009545 Ga0105237_10059488 Ga0105237_100594882 333
454 3300009545 Ga0105237_10067260 Ga0105237_100672604 333
455 3300009545 Ga0105237_10140408 Ga0105237_101404082 333
456 3300009545 Ga0105237_10193118 Ga0105237_101931182 333
457 3300009545 Ga0105237_10196753 Ga0105237_101967532 333
458 3300009545 Ga0105237_10264291 Ga0105237_102642911 333
459 3300009545 Ga0105237_10285413 Ga0105237_102854132 333
460 3300009545 Ga0105237_10397595 Ga0105237_103975952 333
461 3300009551 Ga0105238_10001132 Ga0105238_1000113224 333
462 3300009551 Ga0105238_10052663 Ga0105238_100526633 333
463 3300009551 Ga0105238_10097033 Ga0105238_100970332 333
464 3300009553 Ga0105249_10005103 Ga0105249_100051039 333
465 3300009553 Ga0105249_10005252 Ga0105249_100052523 333
466 3300009553 Ga0105249_10008737 Ga0105249_100087376 333
467 3300009553 Ga0105249_10055248 Ga0105249_100552483 333
468 3300009553 Ga0105249_10079798 Ga0105249_100797983 333
469 3300009553 Ga0105249_10148121 Ga0105249_101481212 333
470 3300009553 Ga0105249_10203305 Ga0105249_102033052 333
471 3300009553 Ga0105249_10461435 Ga0105249_104614352 333
472 3300010375 Ga0105239_10000002 Ga0105239_10000002144 333
473 3300010375 Ga0105239_10000048 Ga0105239_1000004876 333
474 3300010375 Ga0105239_10000758 Ga0105239_1000075825 333
475 3300010375 Ga0105239_10001789 Ga0105239_1000178929 333
476 3300010375 Ga0105239_10001948 Ga0105239_100019482 333
477 3300010375 Ga0105239_10002090 Ga0105239_1000209016 333
478 3300010375 Ga0105239_10002752 Ga0105239_100027527 333
479 3300010375 Ga0105239_10005094 Ga0105239_1000509416 333
480 3300010375 Ga0105239_10008918 Ga0105239_100089182 333
481 3300010375 Ga0105239_10016195 Ga0105239_100161953 333
482 3300010375 Ga0105239_10024710 Ga0105239_100247104 333
483 3300010375 Ga0105239_10039298 Ga0105239_100392982 333
484 3300010375 Ga0105239_10045406 Ga0105239_100454065 333
485 3300010375 Ga0105239_10078015 Ga0105239_100780153 333
486 3300010375 Ga0105239_10087796 Ga0105239_100877962 333
487 3300010375 Ga0105239_10121599 Ga0105239_101215992 333
488 3300010375 Ga0105239_10166914 Ga0105239_101669142 333
489 3300011119 Ga0105246_10028028 Ga0105246_100280282 333
490 3300011119 Ga0105246_10053815 Ga0105246_100538152 333
491 3300011119 Ga0105246_10249830 Ga0105246_102498302 333
492 3300013100 Ga0157373_10000821 Ga0157373_1000082111 333
493 3300013100 Ga0157373_10002581 Ga0157373_1000258113 333
494 3300013100 Ga0157373_10019401 Ga0157373_100194012 333
495 3300013100 Ga0157373_10020933 Ga0157373_100209334 333
496 3300013100 Ga0157373_10092748 Ga0157373_100927482 333
497 3300013100 Ga0157373_10097891 Ga0157373_100978912 333
498 3300013102 Ga0157371_10000016 Ga0157371_10000016139 333
499 3300013102 Ga0157371_10000135 Ga0157371_1000013552 333
500 3300013102 Ga0157371_10000563 Ga0157371_1000056327 333
501 3300013102 Ga0157371_10001915 Ga0157371_1000191518 333
502 3300013102 Ga0157371_10003683 Ga0157371_100036834 333
503 3300013102 Ga0157371_10009984 Ga0157371_100099845 333
504 3300013102 Ga0157371_10018424 Ga0157371_100184244 333
505 3300013102 Ga0157371_10034813 Ga0157371_100348133 333
506 3300013102 Ga0157371_10077958 Ga0157371_100779582 333
507 3300013104 Ga0157370_10000500 Ga0157370_100005006 333
508 3300013104 Ga0157370_10001022 Ga0157370_1000102221 333
509 3300013104 Ga0157370_10001166 Ga0157370_100011663 333
510 3300013104 Ga0157370_10005338 Ga0157370_100053384 333
511 3300013104 Ga0157370_10010727 Ga0157370_100107277 333
512 3300013104 Ga0157370_10014206 Ga0157370_100142065 333
513 3300013104 Ga0157370_10031451 Ga0157370_100314513 333
514 3300013104 Ga0157370_10036413 Ga0157370_100364133 333
515 3300013104 Ga0157370_10039822 Ga0157370_100398222 333
516 3300013104 Ga0157370_10262108 Ga0157370_102621081 333
517 3300013105 Ga0157369_10000475 Ga0157369_100004755 333
518 3300013105 Ga0157369_10046098 Ga0157369_100460982 333
519 3300013105 Ga0157369_10051032 Ga0157369_100510322 333
520 3300013105 Ga0157369_10057127 Ga0157369_100571273 333
521 3300013105 Ga0157369_10081875 Ga0157369_100818752 333
522 3300013105 Ga0157369_10117845 Ga0157369_101178452 333
523 3300013105 Ga0157369_10159155 Ga0157369_101591552 333
524 3300013105 Ga0157369_10231674 Ga0157369_102316742 333
525 3300013296 Ga0157374_10000001 Ga0157374_10000001224 333
526 3300013296 Ga0157374_10000128 Ga0157374_100001288 333
527 3300013296 Ga0157374_10000202 Ga0157374_1000020215 333
528 3300013296 Ga0157374_10004614 Ga0157374_100046143 333
529 3300013296 Ga0157374_10028575 Ga0157374_100285754 333
530 3300013296 Ga0157374_10034089 Ga0157374_100340893 333
531 3300013296 Ga0157374_10051367 Ga0157374_100513672 333
532 3300013296 Ga0157374_10054818 Ga0157374_100548182 333
533 3300013296 Ga0157374_10099620 Ga0157374_100996202 333
534 3300013296 Ga0157374_10492119 Ga0157374_104921191 333
535 3300013297 Ga0157378_10005717 Ga0157378_100057175 333
536 3300013297 Ga0157378_10005849 Ga0157378_100058494 333
537 3300013297 Ga0157378_10010586 Ga0157378_100105862 333
538 3300013297 Ga0157378_10043948 Ga0157378_100439483 333
539 3300013297 Ga0157378_10107269 Ga0157378_101072692 333
540 3300013297 Ga0157378_10260343 Ga0157378_102603432 333
541 3300013297 Ga0157378_10290658 Ga0157378_102906582 333
542 3300013306 Ga0163162_10000032 Ga0163162_1000003228 333
543 3300013306 Ga0163162_10000152 Ga0163162_100001529 333
544 3300013306 Ga0163162_10009046 Ga0163162_100090465 333
545 3300013306 Ga0163162_10011763 Ga0163162_100117632 333
546 3300013306 Ga0163162_10015657 Ga0163162_100156576 333
547 3300013306 Ga0163162_10016026 Ga0163162_100160264 333
548 3300013306 Ga0163162_10052936 Ga0163162_100529362 333
549 3300013306 Ga0163162_10054110 Ga0163162_100541104 333
550 3300013306 Ga0163162_10095248 Ga0163162_100952482 333
551 3300013306 Ga0163162_10295516 Ga0163162_102955162 333
552 3300013306 Ga0163162_10459650 Ga0163162_104596502 333
553 3300013307 Ga0157372_10000017 Ga0157372_10000017155 333
554 3300013307 Ga0157372_10000061 Ga0157372_1000006141 333
555 3300013307 Ga0157372_10000921 Ga0157372_1000092123 333
556 3300013307 Ga0157372_10003385 Ga0157372_100033852 333
557 3300013307 Ga0157372_10004228 Ga0157372_100042283 333
558 3300013307 Ga0157372_10018588 Ga0157372_100185889 333
559 3300013307 Ga0157372_10020418 Ga0157372_100204183 333
560 3300013307 Ga0157372_10142889 Ga0157372_101428893 333
561 3300013307 Ga0157372_10151540 Ga0157372_101515402 333
562 3300013307 Ga0157372_10166690 Ga0157372_101666902 333
563 3300013307 Ga0157372_10207727 Ga0157372_102077272 333
564 3300013308 Ga0157375_10037080 Ga0157375_100370803 333
565 3300013308 Ga0157375_10040512 Ga0157375_100405122 333
566 3300013308 Ga0157375_10045096 Ga0157375_100450963 333
567 3300013308 Ga0157375_10045413 Ga0157375_100454134 333
568 3300013308 Ga0157375_10123056 Ga0157375_101230561 333
569 3300013308 Ga0157375_10174141 Ga0157375_101741412 333
570 3300013308 Ga0157375_10202478 Ga0157375_102024783 333
571 3300013308 Ga0157375_10480579 Ga0157375_104805792 333
572 3300013308 Ga0157375_10578419 Ga0157375_105784192 333
573 3300014325 Ga0163163_10000653 Ga0163163_100006535 333
574 3300014325 Ga0163163_10195869 Ga0163163_101958692 333
575 3300014325 Ga0163163_10403595 Ga0163163_104035952 333
576 3300014326 Ga0157380_10168749 Ga0157380_101687492 333
577 3300014326 Ga0157380_10234046 Ga0157380_102340462 333
578 3300014497 Ga0182008_10000006 Ga0182008_10000006322 333
579 3300014497 Ga0182008_10000818 Ga0182008_100008183 333
580 3300014497 Ga0182008_10001192 Ga0182008_100011927 333
581 3300014968 Ga0157379_10001301 Ga0157379_100013012 333
582 3300014968 Ga0157379_10180015 Ga0157379_101800152 333
583 3300014968 Ga0157379_10206039 Ga0157379_102060392 333
584 3300014969 Ga0157376_10000721 Ga0157376_100007219 333
585 3300014969 Ga0157376_10001279 Ga0157376_100012794 333
586 3300014969 Ga0157376_10008360 Ga0157376_100083605 333
587 3300014969 Ga0157376_10025181 Ga0157376_100251814 333
588 3300014969 Ga0157376_10037767 Ga0157376_100377673 333
589 3300014969 Ga0157376_10055030 Ga0157376_100550302 333
590 3300014969 Ga0157376_10067496 Ga0157376_100674962 333
591 3300015261 Ga0182006_1000068 Ga0182006_10000683 333
592 3300015261 Ga0182006_1000869 Ga0182006_10008695 333
593 3300015261 Ga0182006_1003367 Ga0182006_10033673 333
594 3300015262 Ga0182007_10000003 Ga0182007_10000003284 333
595 3300015682 Ga0183373_1001 Ga0183373_1001680 333
596 3300017792 Ga0163161_10000074 Ga0163161_10000074113 333
597 3300017792 Ga0163161_10015370 Ga0163161_100153703 333
598 3300017792 Ga0163161_10016813 Ga0163161_100168133 333
599 3300017792 Ga0163161_10067138 Ga0163161_100671382 333
600 3300017792 Ga0163161_10171589 Ga0163161_101715892 333
601 3300021361 Ga0213872_10009314 Ga0213872_100093145 333
602 3300025208 Ga0209436_103157 Ga0209436_1031575 333
603 3300025231 Ga0207427_100103 Ga0207427_10010394 333
604 3300025233 Ga0209437_100017 Ga0209437_100017279 333
605 3300025233 Ga0209437_100101 Ga0209437_100101115 333
606 3300025245 Ga0207425_1000002 Ga0207425_1000002705 333
607 3300025246 Ga0209646_1000002 Ga0209646_1000002515 333
608 3300025246 Ga0209646_1000745 Ga0209646_10007457 333
609 3300025250 Ga0209026_1000434 Ga0209026_100043418 333
610 3300025250 Ga0209026_1006913 Ga0209026_10069132 333
611 3300025258 Ga0209129_1000002 Ga0209129_1000002705 333
612 3300025261 Ga0209233_1000124 Ga0209233_1000124121 333
613 3300025284 Ga0209130_1005416 Ga0209130_10054163 333
614 3300025292 Ga0209676_1000008 Ga0209676_1000008589 333
615 3300025292 Ga0209676_1000425 Ga0209676_100042546 333
616 3300025294 Ga0209025_1000004 Ga0209025_1000004485 333
617 3300025297 Ga0209758_1000006 Ga0209758_1000006485 333
618 3300025297 Ga0209758_1003065 Ga0209758_10030657 333
619 3300025298 Ga0209050_1000045 Ga0209050_1000045196 333
620 3300025302 Ga0207426_1000002 Ga0207426_1000002521 333
621 3300025302 Ga0207426_1000051 Ga0207426_1000051337 333
622 3300025302 Ga0207426_1000497 Ga0207426_100049718 333
623 3300025304 Ga0209257_1000001 Ga0209257_10000011450 333
624 3300025321 Ga0207656_10017547 Ga0207656_100175472 333
625 3300025893 Ga0207682_10010357 Ga0207682_100103573 333
626 3300025900 Ga0207710_10008558 Ga0207710_100085582 333
627 3300025901 Ga0207688_10009386 Ga0207688_100093864 333
628 3300025903 Ga0207680_10015585 Ga0207680_100155853 333
629 3300025903 Ga0207680_10023544 Ga0207680_100235441 333
630 3300025903 Ga0207680_10052159 Ga0207680_100521591 333
631 3300025904 Ga0207647_10000105 Ga0207647_1000010529 333
632 3300025904 Ga0207647_10000511 Ga0207647_1000051117 333
633 3300025904 Ga0207647_10007406 Ga0207647_100074066 333
634 3300025904 Ga0207647_10016870 Ga0207647_100168702 333
635 3300025904 Ga0207647_10022172 Ga0207647_100221722 333
636 3300025904 Ga0207647_10098536 Ga0207647_100985362 333
637 3300025907 Ga0207645_10000622 Ga0207645_1000062222 333
638 3300025907 Ga0207645_10001210 Ga0207645_1000121015 333
639 3300025907 Ga0207645_10003591 Ga0207645_100035913 333
640 3300025907 Ga0207645_10004714 Ga0207645_100047144 333
641 3300025908 Ga0207643_10023368 Ga0207643_100233684 333
642 3300025908 Ga0207643_10126218 Ga0207643_101262182 333
643 3300025909 Ga0207705_10000079 Ga0207705_1000007979 333
644 3300025909 Ga0207705_10017692 Ga0207705_100176922 333
645 3300025909 Ga0207705_10045764 Ga0207705_100457642 333
646 3300025909 Ga0207705_10189042 Ga0207705_101890422 333
647 3300025911 Ga0207654_10016294 Ga0207654_100162942 333
648 3300025912 Ga0207707_10000051 Ga0207707_1000005159 333
649 3300025912 Ga0207707_10021406 Ga0207707_100214063 333
650 3300025912 Ga0207707_10193606 Ga0207707_101936062 333
651 3300025913 Ga0207695_10000013 Ga0207695_1000001326 333
652 3300025913 Ga0207695_10000084 Ga0207695_10000084210 333
653 3300025913 Ga0207695_10000323 Ga0207695_1000032357 333
654 3300025913 Ga0207695_10001232 Ga0207695_100012327 333
655 3300025913 Ga0207695_10004447 Ga0207695_1000444714 333
656 3300025913 Ga0207695_10007846 Ga0207695_100078462 333
657 3300025913 Ga0207695_10009118 Ga0207695_1000911812 333
658 3300025913 Ga0207695_10015643 Ga0207695_100156432 333
659 3300025913 Ga0207695_10122675 Ga0207695_101226752 333
660 3300025913 Ga0207695_10189847 Ga0207695_101898472 333
661 3300025913 Ga0207695_10234174 Ga0207695_102341742 333
662 3300025914 Ga0207671_10000272 Ga0207671_100002724 333
663 3300025914 Ga0207671_10001497 Ga0207671_100014976 333
664 3300025914 Ga0207671_10005889 Ga0207671_1000588910 333
665 3300025914 Ga0207671_10009491 Ga0207671_100094917 333
666 3300025914 Ga0207671_10012189 Ga0207671_100121896 333
667 3300025914 Ga0207671_10014622 Ga0207671_100146224 333
668 3300025914 Ga0207671_10036318 Ga0207671_100363182 333
669 3300025914 Ga0207671_10042678 Ga0207671_100426782 333
670 3300025914 Ga0207671_10103071 Ga0207671_101030712 333
671 3300025914 Ga0207671_10121560 Ga0207671_101215602 333
672 3300025914 Ga0207671_10220780 Ga0207671_102207802 333
673 3300025914 Ga0207671_10335001 Ga0207671_103350011 333
674 3300025917 Ga0207660_10009778 Ga0207660_100097786 333
675 3300025918 Ga0207662_10016297 Ga0207662_100162972 333
676 3300025918 Ga0207662_10019350 Ga0207662_100193503 333
677 3300025919 Ga0207657_10059750 Ga0207657_100597502 333
678 3300025919 Ga0207657_10082590 Ga0207657_100825902 333
679 3300025919 Ga0207657_10350426 Ga0207657_103504261 333
680 3300025920 Ga0207649_10017077 Ga0207649_100170773 333
681 3300025921 Ga0207652_10000384 Ga0207652_1000038424 333
682 3300025921 Ga0207652_10001696 Ga0207652_1000169611 333
683 3300025921 Ga0207652_10014179 Ga0207652_100141797 333
684 3300025921 Ga0207652_10015091 Ga0207652_100150912 333
685 3300025924 Ga0207694_10077795 Ga0207694_100777952 333
686 3300025924 Ga0207694_10094692 Ga0207694_100946922 333
687 3300025924 Ga0207694_10195493 Ga0207694_101954932 333
688 3300025924 Ga0207694_10247457 Ga0207694_102474571 333
689 3300025925 Ga0207650_10019073 Ga0207650_100190735 333
690 3300025925 Ga0207650_10042343 Ga0207650_100423431 333
691 3300025925 Ga0207650_10070695 Ga0207650_100706952 333
692 3300025926 Ga0207659_10008155 Ga0207659_100081552 333
693 3300025926 Ga0207659_10037371 Ga0207659_100373712 333
694 3300025926 Ga0207659_10053334 Ga0207659_100533341 333
695 3300025926 Ga0207659_10163272 Ga0207659_101632721 333
696 3300025927 Ga0207687_10106215 Ga0207687_101062152 333
697 3300025931 Ga0207644_10120271 Ga0207644_101202712 333
698 3300025932 Ga0207690_10000318 Ga0207690_1000031831 333
699 3300025932 Ga0207690_10013661 Ga0207690_100136615 333
700 3300025932 Ga0207690_10160203 Ga0207690_101602033 333
701 3300025933 Ga0207706_10000120 Ga0207706_1000012040 333
702 3300025933 Ga0207706_10029817 Ga0207706_100298173 333
703 3300025933 Ga0207706_10049670 Ga0207706_100496702 333
704 3300025933 Ga0207706_10099200 Ga0207706_100992002 333
705 3300025933 Ga0207706_10211759 Ga0207706_102117592 333
706 3300025934 Ga0207686_10024502 Ga0207686_100245023 333
707 3300025936 Ga0207670_10107261 Ga0207670_101072611 333
708 3300025936 Ga0207670_10126200 Ga0207670_101262002 333
709 3300025938 Ga0207704_10028986 Ga0207704_100289862 333
710 3300025938 Ga0207704_10073370 Ga0207704_100733701 333
711 3300025938 Ga0207704_10212037 Ga0207704_102120372 333
712 3300025940 Ga0207691_10002527 Ga0207691_100025277 333
713 3300025940 Ga0207691_10023686 Ga0207691_100236863 333
714 3300025940 Ga0207691_10027226 Ga0207691_100272262 333
715 3300025940 Ga0207691_10042760 Ga0207691_100427602 333
716 3300025940 Ga0207691_10052586 Ga0207691_100525863 333
717 3300025940 Ga0207691_10066643 Ga0207691_100666432 333
718 3300025940 Ga0207691_10194754 Ga0207691_101947542 333
719 3300025942 Ga0207689_10003051 Ga0207689_1000305116 333
720 3300025942 Ga0207689_10008841 Ga0207689_100088415 333
721 3300025942 Ga0207689_10077529 Ga0207689_100775292 333
722 3300025942 Ga0207689_10107260 Ga0207689_101072603 333
723 3300025942 Ga0207689_10125004 Ga0207689_101250042 333
724 3300025942 Ga0207689_10157763 Ga0207689_101577631 333
725 3300025942 Ga0207689_10234984 Ga0207689_102349842 333
726 3300025944 Ga0207661_10033412 Ga0207661_100334121 333
727 3300025944 Ga0207661_10055683 Ga0207661_100556833 333
728 3300025944 Ga0207661_10119674 Ga0207661_101196742 333
729 3300025944 Ga0207661_10250394 Ga0207661_102503942 333
730 3300025945 Ga0207679_10007258 Ga0207679_100072587 333
731 3300025945 Ga0207679_10026046 Ga0207679_100260462 333
732 3300025949 Ga0207667_10000135 Ga0207667_100001355 333
733 3300025949 Ga0207667_10007957 Ga0207667_100079577 333
734 3300025949 Ga0207667_10011669 Ga0207667_100116694 333
735 3300025949 Ga0207667_10017914 Ga0207667_100179148 333
736 3300025949 Ga0207667_10028059 Ga0207667_100280594 333
737 3300025949 Ga0207667_10028127 Ga0207667_100281274 333
738 3300025949 Ga0207667_10038231 Ga0207667_100382313 333
739 3300025949 Ga0207667_10048612 Ga0207667_100486121 333
740 3300025949 Ga0207667_10164208 Ga0207667_101642082 333
741 3300025949 Ga0207667_10209178 Ga0207667_102091782 333
742 3300025949 Ga0207667_10345220 Ga0207667_103452202 333
743 3300025949 Ga0207667_10533199 Ga0207667_105331991 333
744 3300025960 Ga0207651_10005116 Ga0207651_100051165 333
745 3300025960 Ga0207651_10124360 Ga0207651_101243602 333
746 3300025960 Ga0207651_10144307 Ga0207651_101443072 333
747 3300025960 Ga0207651_10156626 Ga0207651_101566262 333
748 3300025961 Ga0207712_10007103 Ga0207712_100071037 333
749 3300025961 Ga0207712_10355651 Ga0207712_103556511 333
750 3300025972 Ga0207668_10000540 Ga0207668_100005402 333
751 3300025972 Ga0207668_10118577 Ga0207668_101185772 333
752 3300025972 Ga0207668_10250364 Ga0207668_102503642 333
753 3300025981 Ga0207640_10052155 Ga0207640_100521552 333
754 3300025986 Ga0207658_10039183 Ga0207658_100391832 333
755 3300025986 Ga0207658_10049171 Ga0207658_100491713 333
756 3300025986 Ga0207658_10181257 Ga0207658_101812572 333
757 3300026023 Ga0207677_10004313 Ga0207677_100043134 333
758 3300026023 Ga0207677_10014691 Ga0207677_100146913 333
759 3300026023 Ga0207677_10019806 Ga0207677_100198064 333
760 3300026023 Ga0207677_10059201 Ga0207677_100592012 333
761 3300026023 Ga0207677_10074545 Ga0207677_100745452 333
762 3300026023 Ga0207677_10253314 Ga0207677_102533142 333
763 3300026035 Ga0207703_10001644 Ga0207703_100016443 333
764 3300026035 Ga0207703_10201182 Ga0207703_102011821 333
765 3300026041 Ga0207639_10001126 Ga0207639_1000112616 333
766 3300026041 Ga0207639_10016182 Ga0207639_100161824 333
767 3300026041 Ga0207639_10119624 Ga0207639_101196241 333
768 3300026041 Ga0207639_10140418 Ga0207639_101404182 333
769 3300026041 Ga0207639_10149561 Ga0207639_101495612 333
770 3300026041 Ga0207639_10210951 Ga0207639_102109512 333
771 3300026041 Ga0207639_10285933 Ga0207639_102859332 333
772 3300026067 Ga0207678_10038074 Ga0207678_100380743 333
773 3300026067 Ga0207678_10068160 Ga0207678_100681603 333
774 3300026067 Ga0207678_10224546 Ga0207678_102245461 333
775 3300026075 Ga0207708_10160493 Ga0207708_101604932 333
776 3300026078 Ga0207702_10000196 Ga0207702_1000019653 333
777 3300026078 Ga0207702_10057179 Ga0207702_100571792 333
778 3300026078 Ga0207702_10093576 Ga0207702_100935763 333
779 3300026078 Ga0207702_10104078 Ga0207702_101040782 333
780 3300026078 Ga0207702_10447303 Ga0207702_104473031 333
781 3300026088 Ga0207641_10000253 Ga0207641_1000025331 333
782 3300026088 Ga0207641_10018015 Ga0207641_100180156 333
783 3300026088 Ga0207641_10052914 Ga0207641_100529143 333
784 3300026088 Ga0207641_10111008 Ga0207641_101110082 333
785 3300026089 Ga0207648_10002506 Ga0207648_100025064 333
786 3300026089 Ga0207648_10004019 Ga0207648_1000401912 333
787 3300026089 Ga0207648_10018210 Ga0207648_100182103 333
788 3300026089 Ga0207648_10034323 Ga0207648_100343232 333
789 3300026089 Ga0207648_10036449 Ga0207648_100364492 333
790 3300026089 Ga0207648_10042309 Ga0207648_100423092 333
791 3300026095 Ga0207676_10063266 Ga0207676_100632663 333
792 3300026095 Ga0207676_10223176 Ga0207676_102231762 333
793 3300026095 Ga0207676_10348413 Ga0207676_103484131 333
794 3300026095 Ga0207676_10355882 Ga0207676_103558821 333
795 3300026116 Ga0207674_10000672 Ga0207674_1000067210 333
796 3300026116 Ga0207674_10006740 Ga0207674_1000674012 333
797 3300026116 Ga0207674_10114299 Ga0207674_101142992 333
798 3300026116 Ga0207674_10160935 Ga0207674_101609352 333
799 3300026116 Ga0207674_10178043 Ga0207674_101780433 333
800 3300026118 Ga0207675_100014435 Ga0207675_1000144354 333
801 3300026118 Ga0207675_100066138 Ga0207675_1000661383 333
802 3300026118 Ga0207675_100134293 Ga0207675_1001342932 333
803 3300026121 Ga0207683_10003712 Ga0207683_100037127 333
804 3300026121 Ga0207683_10005010 Ga0207683_100050105 333
805 3300026121 Ga0207683_10065629 Ga0207683_100656292 333
806 3300026121 Ga0207683_10117716 Ga0207683_101177162 333
807 3300026142 Ga0207698_10001082 Ga0207698_1000108217 333
808 3300026142 Ga0207698_10011290 Ga0207698_100112907 333
809 3300026142 Ga0207698_10055732 Ga0207698_100557322 333
810 3300028379 Ga0268266_10000018 Ga0268266_10000018283 333
811 3300028379 Ga0268266_10085801 Ga0268266_100858012 333
812 3300028379 Ga0268266_10090778 Ga0268266_100907782 333
813 3300028380 Ga0268265_10014622 Ga0268265_100146222 333
814 3300028380 Ga0268265_10099403 Ga0268265_100994032 333
815 3300028381 Ga0268264_10001720 Ga0268264_1000172013 333
816 3300028381 Ga0268264_10009362 Ga0268264_100093623 333
817 3300028381 Ga0268264_10047708 Ga0268264_100477082 333
818 3300028786 Ga0307517_10002048 Ga0307517_100020488 333
819 3300028786 Ga0307517_10004683 Ga0307517_1000468314 333
820 3300028794 Ga0307515_10001752 Ga0307515_1000175246 333
821 3300028794 Ga0307515_10002910 Ga0307515_1000291030 333
822 3300028794 Ga0307515_10014453 Ga0307515_1001445310 333
823 3300030731 Ga0316177_1198244 Ga0316177_11982444 333
824 3300030732 Ga0316176_1050137 Ga0316176_10501376 333
825 3300030742 Ga0316183_1065995 Ga0316183_10659958 333
826 3300030744 Ga0316181_1148726 Ga0316181_11487267 333
827 3300031251 Ga0265327_10000010 Ga0265327_10000010315 333
828 3300031456 Ga0307513_10156292 Ga0307513_101562921 333
829 3300031507 Ga0307509_10048545 Ga0307509_100485453 333
830 3300031616 Ga0307508_10002100 Ga0307508_1000210015 333
831 3300031730 Ga0307516_10003117 Ga0307516_1000311710 333
832 3300031731 Ga0307405_10000003 Ga0307405_1000000370 333
833 3300031731 Ga0307405_10014179 Ga0307405_100141792 333
834 3300031731 Ga0307405_10059446 Ga0307405_100594462 333
835 3300031824 Ga0307413_10178076 Ga0307413_101780762 333
836 3300031852 Ga0307410_10194020 Ga0307410_101940201 333
837 3300031901 Ga0307406_10117919 Ga0307406_101179192 333
838 3300031903 Ga0307407_10000008 Ga0307407_1000000882 333
839 3300031911 Ga0307412_10000427 Ga0307412_100004275 333
840 3300031911 Ga0307412_10037619 Ga0307412_100376192 333
841 3300031995 Ga0307409_100008566 Ga0307409_1000085668 333
842 3300032002 Ga0307416_100000009 Ga0307416_100000009228 333
843 3300032002 Ga0307416_100113426 Ga0307416_1001134262 333
844 3300032004 Ga0307414_10000038 Ga0307414_10000038108 333
845 3300032004 Ga0307414_10002879 Ga0307414_100028793 333
846 3300032004 Ga0307414_10012334 Ga0307414_100123345 333
847 3300032004 Ga0307414_10034651 Ga0307414_100346513 333
848 3300032004 Ga0307414_10105314 Ga0307414_101053142 333
849 3300032004 Ga0307414_10242776 Ga0307414_102427762 333
850 3300033179 Ga0307507_10000064 Ga0307507_1000006454 333
851 3300033180 Ga0307510_10002860 Ga0307510_1000286014 333
852 3300035695 Ga0373927_0037163 Ga0373927_0037163_1107_2162 333
853 3300036401 Ga0373937_0023482 Ga0373937_0023482_2762_3811 333
854 3300036401 Ga0373937_0152899 Ga0373937_0152899_842_1894 333
855 3300036401 Ga0373937_0250410 Ga0373937_0250410_532_1575 333
856 3300037068 Ga0373925_0104333 Ga0373925_0104333_370_1422 333
857 3300037312 Ga0395899_0000033 Ga0395899_0000033_33867_35015 333
858 3300037312 Ga0395899_0000493 Ga0395899_0000493_26768_27814 333
859 3300037312 Ga0395899_0000629 Ga0395899_0000629_15706_16752 333
860 3300037312 Ga0395899_0001884 Ga0395899_0001884_5172_6224 333
861 3300037312 Ga0395899_0029186 Ga0395899_0029186_1222_2274 333
862 3300037312 Ga0395899_0029721 Ga0395899_0029721_2811_3857 333
863 3300037312 Ga0395899_0041383 Ga0395899_0041383_1327_2379 333
864 3300037312 Ga0395899_0066951 Ga0395899_0066951_1526_2578 333
865 3300037312 Ga0395899_0133975 Ga0395899_0133975_221_1273 333
866 3300037418 Ga0395900_0000480 Ga0395900_0000480_32175_33221 333
867 3300037418 Ga0395900_0000506 Ga0395900_0000506_31879_32937 333
868 3300037418 Ga0395900_0006601 Ga0395900_0006601_6048_7100 333
869 3300037418 Ga0395900_0009920 Ga0395900_0009920_3248_4294 333
870 3300037418 Ga0395900_0012177 Ga0395900_0012177_4034_5086 333
871 3300037418 Ga0395900_0175354 Ga0395900_0175354_894_1946 333
872 3300037418 Ga0395900_0179537 Ga0395900_0179537_904_1968 333
873 3300037466 Ga0395898_0001651 Ga0395898_0001651_21201_22253 333
874 3300037466 Ga0395898_0032624 Ga0395898_0032624_1385_2437 333
875 3300037466 Ga0395898_0041094 Ga0395898_0041094_128_1180 333
876 3300037466 Ga0395898_0056108 Ga0395898_0056108_1983_3035 333
877 3300037471 Ga0395905_0000254 Ga0395905_0000254_407_1453 333
878 3300037471 Ga0395905_0000738 Ga0395905_0000738_9875_10921 333
879 3300037471 Ga0395905_0001166 Ga0395905_0001166_27547_28593 333
880 3300037471 Ga0395905_0006569 Ga0395905_0006569_3982_5034 333
881 3300038443 Ga0395901_0000853 Ga0395901_0000853_9853_10899 333
882 3300038443 Ga0395901_0004350 Ga0395901_0004350_2692_3744 333
883 3300038443 Ga0395901_0010578 Ga0395901_0010578_3872_4924 333
884 3300038443 Ga0395901_0059253 Ga0395901_0059253_689_1741 333
885 3300038443 Ga0395901_0067844 Ga0395901_0067844_866_1918 333
886 3300038443 Ga0395901_0081109 Ga0395901_0081109_1898_2950 333
887 3300038443 Ga0395901_0119295 Ga0395901_0119295_60_1106 333
888 3300039447 Ga0436361_0021149 Ga0436361_0021149_4473_5519 333
889 3300042005 Ga0439448_0022307 Ga0439448_0022307_907_1953 333
890 3300042876 Ga0451577_0000010 Ga0451577_0000010_365692_366750 333
891 3300042876 Ga0451577_0068138 Ga0451577_0068138_2053_3150 333
892 3300044656 Ga0466969_0000912 Ga0466969_0000912_5620_6675 333
893 3300044656 Ga0466969_0053439 Ga0466969_0053439_252_1298 333
894 3300044656 Ga0466969_0098395 Ga0466969_0098395_40_1089 333
895 3300044658 Ga0466972_0000013 Ga0466972_0000013_70900_71955 333
896 3300044658 Ga0466972_0005607 Ga0466972_0005607_2714_3793 333
897 3300044673 Ga0453683_0000031 Ga0453683_0000031_14214_15257 333
898 3300044673 Ga0453683_0001482 Ga0453683_0001482_151_1194 333
899 3300044673 Ga0453683_0085783 Ga0453683_0085783_570_1628 333
900 3300044684 Ga0466966_0000045 Ga0466966_0000045_88635_89690 333
901 3300044684 Ga0466966_0053935 Ga0466966_0053935_1411_2457 333
902 3300044693 Ga0466961_0066482 Ga0466961_0066482_627_1676 333
903 3300044693 Ga0466961_0088177 Ga0466961_0088177_743_1789 333
904 3300044712 Ga0453684_0000191 Ga0453684_0000191_249937_250995 333
905 3300044712 Ga0453684_0178992 Ga0453684_0178992_1122_2219 333
906 3300044712 Ga0453684_0192947 Ga0453684_0192947_746_1801 333
907 3300044712 Ga0453684_0311331 Ga0453684_0311331_557_1639 333
908 3300044712 Ga0453684_0442253 Ga0453684_0442253_92_1174 333
909 3300044735 Ga0466968_0089549 Ga0466968_0089549_67_1113 333
910 3300044765 Ga0466970_0018485 Ga0466970_0018485_847_1893 333
911 3300044765 Ga0466970_0069434 Ga0466970_0069434_770_1819 333
912 3300044842 Ga0466957_0003333 Ga0466957_0003333_4785_5840 333
913 3300044842 Ga0466957_0152139 Ga0466957_0152139_140_1189 333
914 3300045049 Ga0466959_0000023 Ga0466959_0000023_94818_95873 333
915 3300045049 Ga0466959_0083862 Ga0466959_0083862_751_1824 333
916 3300045051 Ga0451576_0000088 Ga0451576_0000088_5222_6280 333
917 3300045051 Ga0451576_0040329 Ga0451576_0040329_2608_3651 333
918 3300045051 Ga0451576_0204986 Ga0451576_0204986_180_1223 333
919 3300046459 Ga0495629_0035357 Ga0495629_0035357_1974_3026 333
920 3300046460 Ga0495638_0049677 Ga0495638_0049677_1238_2293 333
921 3300046462 Ga0495651_0090903 Ga0495651_0090903_607_1653 333
922 3300046471 Ga0495650_0000087 Ga0495650_0000087_13660_14706 333
923 3300046492 Ga0495585_0000286 Ga0495585_0000286_40493_41539 333
924 3300046492 Ga0495585_0001651 Ga0495585_0001651_13233_14291 333
925 3300046506 Ga0495583_0094765 Ga0495583_0094765_28_1074 333
926 3300046507 Ga0495606_0000052 Ga0495606_0000052_180288_181334 333
927 3300046507 Ga0495606_0014847 Ga0495606_0014847_3437_4483 333
928 3300046512 Ga0495610_0000903 Ga0495610_0000903_7344_8390 333
929 3300046512 Ga0495610_0006770 Ga0495610_0006770_1920_2975 333
930 3300046512 Ga0495610_0010020 Ga0495610_0010020_798_1838 333
931 3300046513 Ga0495616_0005196 Ga0495616_0005196_4149_5195 333
932 3300046514 Ga0495618_0007268 Ga0495618_0007268_378_1427 333
933 3300046516 Ga0495628_0017891 Ga0495628_0017891_1748_2797 333
934 3300046517 Ga0495630_0049633 Ga0495630_0049633_971_2020 333
935 3300046517 Ga0495630_0116104 Ga0495630_0116104_834_1886 333
936 3300046518 Ga0495631_0027708 Ga0495631_0027708_606_1652 333
937 3300046523 Ga0495644_0007188 Ga0495644_0007188_991_2037 333
938 3300046524 Ga0495648_0077885 Ga0495648_0077885_258_1358 333
939 3300046533 Ga0495640_0061455 Ga0495640_0061455_1313_2362 333
940 3300046537 Ga0495598_0027721 Ga0495598_0027721_138_1184 333
941 3300046558 Ga0495633_0000080 Ga0495633_0000080_4158_5207 333
942 3300046558 Ga0495633_0000081 Ga0495633_0000081_44430_45488 333
943 3300046558 Ga0495633_0072173 Ga0495633_0072173_424_1476 333
944 3300046616 Ga0495668_0000012 Ga0495668_0000012_277755_278813 333
945 3300046642 Ga0495634_0069334 Ga0495634_0069334_1080_2129 333
946 3300046660 Ga0495625_0000036 Ga0495625_0000036_9029_10075 333
947 3300046660 Ga0495625_0002289 Ga0495625_0002289_9086_10144 333
948 3300046660 Ga0495625_0010136 Ga0495625_0010136_1355_2407 333
949 3300046660 Ga0495625_0014574 Ga0495625_0014574_3242_4288 333
950 3300046660 Ga0495625_0021139 Ga0495625_0021139_3209_4360 333
951 3300046660 Ga0495625_0091239 Ga0495625_0091239_526_1572 333
952 3300046660 Ga0495625_0233913 Ga0495625_0233913_72_1148 333
953 3300046665 Ga0495661_0003611 Ga0495661_0003611_7909_8955 333
954 3300046665 Ga0495661_0092978 Ga0495661_0092978_46_1092 333
955 3300046680 Ga0495646_0058441 Ga0495646_0058441_27_1076 333
956 3300046683 Ga0495658_0017216 Ga0495658_0017216_515_1573 333
957 3300046683 Ga0495658_0020389 Ga0495658_0020389_1482_2534 333
958 3300046684 Ga0495669_0058397 Ga0495669_0058397_539_1585 333
959 3300046689 Ga0495613_0161327 Ga0495613_0161327_251_1297 333
960 3300046694 Ga0495649_0000017 Ga0495649_0000017_211636_212682 333
961 3300046794 Ga0495589_0123181 Ga0495589_0123181_190_1236 333
962 3300046810 Ga0495660_0013731 Ga0495660_0013731_2475_3521 333
963 3300047319 Ga0495674_0018467 Ga0495674_0018467_3409_4461 333
964 3300047323 Ga0495683_0023732 Ga0495683_0023732_1219_2265 333
965 3300047443 Ga0495687_055425 Ga0495687_055425_22_1068 333
966 3300047469 Ga0495673_0068477 Ga0495673_0068477_369_1415 333
967 3300047471 Ga0495684_0161177 Ga0495684_0161177_245_1297 333
968 3300047472 Ga0495686_0000004 Ga0495686_0000004_410320_411369 333
969 3300047472 Ga0495686_0000582 Ga0495686_0000582_22710_23753 333
970 3300047472 Ga0495686_0005494 Ga0495686_0005494_8662_9708 333
971 3300047472 Ga0495686_0020028 Ga0495686_0020028_723_1793 333
972 3300048912 Ga0496109_0054915 Ga0496109_0054915_1872_2924 333
973 3300048917 Ga0496114_0369263 Ga0496114_0369263_90_1133 333
974 3300048918 Ga0496115_0045415 Ga0496115_0045415_1197_2240 333
975 3300048925 Ga0496122_0001208 Ga0496122_0001208_13526_14566 333
976 3300048926 Ga0496123_0008537 Ga0496123_0008537_2599_3639 333
977 3300048927 Ga0496124_0111474 Ga0496124_0111474_39_1085 333
978 3300048928 Ga0496125_0011341 Ga0496125_0011341_7572_8612 333
979 3300048929 Ga0496126_0022457 Ga0496126_0022457_2884_3942 333
980 3300048929 Ga0496126_0212279 Ga0496126_0212279_239_1285 333
981 3300049459 Ga0495678_014851 Ga0495678_014851_953_2104 333
982 3300049568 Ga0501031_0003605 Ga0501031_0003605_351_1400 333
983 3300049569 Ga0501032_0091050 Ga0501032_0091050_79_1128 333
984 3300049570 Ga0501033_0010675 Ga0501033_0010675_1064_2122 333
985 3300049571 Ga0501034_0004012 Ga0501034_0004012_11465_12517 333
986 3300049571 Ga0501034_0016530 Ga0501034_0016530_3826_4875 333
987 3300049571 Ga0501034_0025459 Ga0501034_0025459_486_1640 333
988 3300049571 Ga0501034_0027052 Ga0501034_0027052_1463_2521 333
989 3300049571 Ga0501034_0146271 Ga0501034_0146271_84_1133 333
990 3300049571 Ga0501034_0330791 Ga0501034_0330791_170_1213 333
991 3300049572 Ga0501036_0041913 Ga0501036_0041913_314_1363 333
992 3300049573 Ga0501037_0039086 Ga0501037_0039086_1929_2978 333
993 3300049574 Ga0501038_0012291 Ga0501038_0012291_5552_6601 333
994 3300049575 Ga0501039_0022501 Ga0501039_0022501_2689_3738 333
995 3300049579 Ga0501043_0009607 Ga0501043_0009607_6331_7380 333
996 3300049579 Ga0501043_0024314 Ga0501043_0024314_1446_2495 333
997 3300049579 Ga0501043_0028424 Ga0501043_0028424_1620_2774 333
998 3300049580 Ga0501046_0045170 Ga0501046_0045170_1223_2272 333
999 3300049580 Ga0501046_0239907 Ga0501046_0239907_133_1182 333
1000 3300049581 Ga0501047_0021075 Ga0501047_0021075_2332_3384 333
1001 3300049581 Ga0501047_0027231 Ga0501047_0027231_537_1607 333
1002 3300049581 Ga0501047_0066956 Ga0501047_0066956_1805_2848 333
1003 3300049581 Ga0501047_0072959 Ga0501047_0072959_1227_2276 333
1004 3300049581 Ga0501047_0332711 Ga0501047_0332711_180_1292 333
1005 3300049582 Ga0501048_0043141 Ga0501048_0043141_1330_2379 333
1006 3300049583 Ga0501067_0095409 Ga0501067_0095409_387_1430 333
1007 3300049584 Ga0501068_0153904 Ga0501068_0153904_162_1205 333
1008 3300049585 Ga0501069_0081356 Ga0501069_0081356_723_1814 333
1009 3300049589 Ga0501073_0019693 Ga0501073_0019693_3698_4747 333
1010 3300049590 Ga0501074_0062516 Ga0501074_0062516_859_1908 333
1011 3300049649 Ga0501198_002157 Ga0501198_002157_1127_2182 333
1012 3300049652 Ga0501202_002208 Ga0501202_002208_1580_2635 333
1013 3300049661 Ga0501217_000620 Ga0501217_000620_3932_4987 333
1014 3300049661 Ga0501217_022688 Ga0501217_022688_32_1090 333
1015 3300049668 Ga0501233_010478 Ga0501233_010478_337_1392 333
1016 3300049675 Ga0501243_008416 Ga0501243_008416_20_1087 333
1017 3300049679 Ga0501249_008390 Ga0501249_008390_34_1107 333
1018 3300049679 Ga0501249_009305 Ga0501249_009305_273_1313 333
1019 3300049686 Ga0501257_016312 Ga0501257_016312_196_1260 333
1020 3300049703 Ga0501219_000052 Ga0501219_000052_17275_18327 333
1021 3300049704 Ga0501221_000044 Ga0501221_000044_4297_5352 333
1022 3300049705 Ga0501225_0001739 Ga0501225_0001739_848_1900 333
1023 3300049705 Ga0501225_0013111 Ga0501225_0013111_1124_2179 333
1024 3300049708 Ga0501245_002249 Ga0501245_002249_126_1181 333
1025 3300049742 Ga0501080_0057861 Ga0501080_0057861_988_2037 333
1026 3300049742 Ga0501080_0123580 Ga0501080_0123580_1268_2326 333
1027 3300049758 Ga0501241_000031 Ga0501241_000031_22825_23880 333
1028 3300049822 Ga0501035_0015438 Ga0501035_0015438_1226_2275 333
1029 3300049822 Ga0501035_0027505 Ga0501035_0027505_2694_3746 333
1030 3300049823 Ga0501044_0017840 Ga0501044_0017840_4348_5397 333
1031 3300049823 Ga0501044_0028924 Ga0501044_0028924_1853_2911 333
1032 3300049823 Ga0501044_0052694 Ga0501044_0052694_2143_3192 333
1033 3300050005 Ga0501284_00029 Ga0501284_00029_20602_21654 333
1034 3300050493 nmdc:mga0k408_3518_c1 nmdc:mga0k408_3518_c1_4238_5284 333
1035 3300050493 nmdc:mga0k408_749_c1 nmdc:mga0k408_749_c1_16735_17781 333
1036 3300050493 nmdc:mga0k408_821_c1 nmdc:mga0k408_821_c1_5301_6353 333
1037 3300050507 nmdc:mga05p37_13616_c1 nmdc:mga05p37_13616_c1_8055_9113 333
1038 3300050508 nmdc:mga09592_983_c1 nmdc:mga09592_983_c1_20713_21759 333
1039 3300050509 nmdc:mga0qj67_97741_c1 nmdc:mga0qj67_97741_c1_20_1066 333
1040 3300053080 Ga0500635_0002671 Ga0500635_0002671_3196_4242 333
1041 3300053085 Ga0495619_0170484 Ga0495619_0170484_310_1359 333
1042 3300053086 Ga0500578_0004418 Ga0500578_0004418_1856_2986 333
1043 3300053090 Ga0500646_0001428 Ga0500646_0001428_1811_2857 333
1044 3300053092 Ga0500583_0000108 Ga0500583_0000108_26630_27685 333
1045 3300053093 Ga0500651_0000084 Ga0500651_0000084_57884_58954 333
1046 3300053093 Ga0500651_0064350 Ga0500651_0064350_933_1982 333
1047 3300053122 Ga0500608_016279 Ga0500608_016279_1117_2163 333
1048 3300053125 Ga0500618_000002 Ga0500618_000002_53355_54404 333
1049 3300053131 Ga0500652_037526 Ga0500652_037526_829_1884 333
1050 3300053147 Ga0500589_003337 Ga0500589_003337_3997_5052 333
1051 3300053153 Ga0500616_0145895 Ga0500616_0145895_38_1090 333
1052 3300053156 Ga0500622_0000777 Ga0500622_0000777_19536_20585 333
1053 3300053156 Ga0500622_0004557 Ga0500622_0004557_1211_2257 333
1054 3300053157 Ga0500624_000271 Ga0500624_000271_16319_17452 333
1055 3300053177 Ga0500636_0044658 Ga0500636_0044658_1305_2360 333
1056 3300053727 Ga0500611_000022 Ga0500611_000022_87747_88802 333
1057 3300061719 Ga0466962_0023524 Ga0466962_0023524_1243_2292 333
1058 iso_pu_bacteria 2522125168 2522551056 333
1059 iso_pu_bacteria 8055588893 8055589911 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

64

379

0.94

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

55

233

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wbt-assembly1.cif.gz_C-2 crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate 0.9043 43 332
3ly1-assembly1.cif.gz_B crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution 0.9022 43 332
3ftb-assembly2.cif.gz_E the crystal structure of the histidinol-phosphate aminotransferase from clostridium acetobutylicum 0.9018 35 332
4r5z-assembly2.cif.gz_D crystal structure of rv3772 encoded aminotransferase 0.8977 35 332
3ftb-assembly2.cif.gz_D the crystal structure of the histidinol-phosphate aminotransferase from clostridium acetobutylicum 0.8947 35 332
ID Description Score Start End Superfamily
af_P06986_261_350_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9944 240 328 3.90.1150.10
af_P36605_51_267_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9746 44 238 3.40.640.10
af_P06986_261_350_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9726 240 328 3.90.1150.10
af_P07172_76_273_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.969 55 237 3.40.640.10
1fg7A01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9622 41 238 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A376W9F3-F1-model_v4 histidinol-phosphate transaminase (EC 2.6.1.9) 0.9944 249 333 GO:0004400
GO:0008652
GO:0030170
AF-A0A645C0K0-F1-model_v4 Histidine biosynthesis bifunctional protein HisB 0.9889 251 332 GO:0000105
GO:0004424
GO:0030170
AF-A0A7S2TT69-F1-model_v4 histidinol-phosphate transaminase (EC 2.6.1.9) (Imidazole acetol-phosphate transaminase) 0.988 45 332 GO:0000105
GO:0004400
GO:0030170
AF-A0A1F3N601-F1-model_v4 Aminotransferase class I/classII large domain-containing protein 0.9812 191 333 GO:0000105
GO:0008483
GO:0030170
AF-A0A705R659-F1-model_v4 Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol-phosphate transaminase) 0.9798 60 333 GO:0000105
GO:0004400
GO:0030170

Feature Viewer

pLDDT pTM Quality
89.39 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map