F489247
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1059 | 432 | 2118 | 390 |
Family's Representative Sequence
| Representative Sequence | 3300025928|Ga0207700_10140313|Ga0207700_101403132 |
| Length | 461 |
| Sequence | MGSPGFCQLASTSRHPFSGKVHPAKTPLGNPVFIDTVDDGQVFLSAFNLQQSPAKFMNERLCAMKNQNHRDVVILSGVRTALGKFGGALKDIPPTELAGEVVRESVKRSGVAASEIGNFVFGHVIHTDAKDMYLSRVAALRGGLSIETPALTLNRMCGSGLQAIITAANMIARGDCDAAVAGGVESMSRAPYWLSSMRWGARMNDAPAVDVLVAALTDPFDEVHMGMTAENVARKWGITREDQDALAVESHRRANCAILTARFKGQIVPIELKSRKGSTWFDTDESPRADVTMEALTKLKPVFDKNGTITAGNASSINDGAAAVVLMEEHAAQERGFKPMAKLIDYAVTGVDPAVMGIGPVSAVRKLYERTGFTNDDMDVIEANEAFAAQVLAVRKELDLPADKTNPNGSGISLGHPIGATGAIVTVKAIHELHRIGGQYALVTMCIGGGQGIAAIFQSMN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 116 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 118 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 185 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 187 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 208 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 211 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031591 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 214 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 216 | 3300031686 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 217 | 3300031690 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 218 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 220 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 221 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 223 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 227 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 228 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 229 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 234 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 235 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 236 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 243 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 247 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 249 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 252 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 253 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 257 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 258 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 259 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 262 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 263 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 265 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 266 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 267 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 268 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 269 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 270 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 271 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 272 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 273 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 274 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 275 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 276 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 277 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 278 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 279 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 280 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 281 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 282 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 283 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 284 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 285 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 286 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 287 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 288 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 289 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 290 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 291 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 292 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 293 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 294 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 350 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 351 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 352 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 353 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 354 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 355 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 358 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 359 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 360 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 361 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 362 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 363 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 364 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 365 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 366 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 367 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 392 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 409 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 411 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 413 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 414 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 415 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 416 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 417 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 418 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 419 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 420 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 421 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 422 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 423 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 424 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 425 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 426 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 427 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 428 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 429 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 430 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 431 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 432 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.13 |
| Metatranscriptomes | 1.98 |
| Isolates | 1.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.09 |
| Nodule | 0.47 |
| Rhizoplane | 6.14 |
| Rhizosphere | 91.31 |
| Stem | 0 |
| Stem Tuber | 0.09 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207700_10140313 | 3300025928 | Bacteria | 1985 |
| 2 | Ga0070658_10003173 | 3300005327 | Bacteria | 13571 |
| 3 | Ga0070658_10012163 | 3300005327 | Bacteria | 6909 |
| 4 | Ga0070676_10050329 | 3300005328 | Bacteria | 2442 |
| 5 | Ga0070676_10125612 | 3300005328 | Bacteria | 1616 |
| 6 | Ga0070683_100069719 | 3300005329 | Bacteria | 3278 |
| 7 | Ga0070690_100000648 | 3300005330 | Bacteria | 17732 |
| 8 | Ga0070670_100009204 | 3300005331 | Bacteria | 8440 |
| 9 | Ga0070670_100022569 | 3300005331 | Bacteria | 5415 |
| 10 | Ga0070670_100170511 | 3300005331 | Bacteria | 1887 |
| 11 | Ga0068869_100037864 | 3300005334 | Bacteria | 3432 |
| 12 | Ga0068869_100042011 | 3300005334 | Bacteria | 3276 |
| 13 | Ga0070666_10003020 | 3300005335 | Bacteria | 10205 |
| 14 | Ga0070666_10031985 | 3300005335 | Bacteria | 3474 |
| 15 | Ga0070666_10099532 | 3300005335 | Bacteria | 2002 |
| 16 | Ga0068868_100020923 | 3300005338 | Bacteria | 4924 |
| 17 | Ga0068868_100085499 | 3300005338 | Bacteria | 2535 |
| 18 | Ga0068868_100088206 | 3300005338 | Bacteria | 2496 |
| 19 | Ga0070660_100086836 | 3300005339 | Bacteria | 2462 |
| 20 | Ga0070689_100199641 | 3300005340 | Bacteria | 1632 |
| 21 | Ga0070661_100066556 | 3300005344 | Bacteria | 2647 |
| 22 | Ga0070661_100202336 | 3300005344 | Bacteria | 1518 |
| 23 | Ga0070668_100034095 | 3300005347 | Bacteria | 3879 |
| 24 | Ga0070668_100081951 | 3300005347 | Bacteria | 2530 |
| 25 | Ga0070668_100086025 | 3300005347 | Bacteria | 2472 |
| 26 | Ga0070668_100091723 | 3300005347 | Bacteria | 2395 |
| 27 | Ga0070668_100228364 | 3300005347 | Bacteria | 1538 |
| 28 | Ga0070675_100036273 | 3300005354 | Bacteria | 4011 |
| 29 | Ga0070671_100036449 | 3300005355 | Bacteria | 4079 |
| 30 | Ga0070671_100106551 | 3300005355 | Bacteria | 2353 |
| 31 | Ga0070674_100019344 | 3300005356 | Bacteria | 4325 |
| 32 | Ga0070673_100000604 | 3300005364 | Bacteria | 19614 |
| 33 | Ga0070673_100046222 | 3300005364 | Bacteria | 3380 |
| 34 | Ga0070673_100154002 | 3300005364 | Bacteria | 1949 |
| 35 | Ga0070688_100000230 | 3300005365 | Bacteria | 29284 |
| 36 | Ga0070659_100057630 | 3300005366 | Bacteria | 3063 |
| 37 | Ga0070667_100019458 | 3300005367 | Bacteria | 5633 |
| 38 | Ga0070667_100030121 | 3300005367 | Bacteria | 4525 |
| 39 | Ga0070667_100391404 | 3300005367 | Bacteria | 1264 |
| 40 | Ga0070703_10013188 | 3300005406 | Bacteria | 2345 |
| 41 | Ga0070709_10002201 | 3300005434 | Bacteria | 10568 |
| 42 | Ga0070709_10022519 | 3300005434 | Bacteria | 3687 |
| 43 | Ga0070709_10055658 | 3300005434 | Bacteria | 2498 |
| 44 | Ga0070709_10108540 | 3300005434 | Bacteria | 1862 |
| 45 | Ga0070709_10141510 | 3300005434 | Bacteria | 1653 |
| 46 | Ga0070714_100016032 | 3300005435 | Bacteria | 6041 |
| 47 | Ga0070714_100054491 | 3300005435 | Bacteria | 3416 |
| 48 | Ga0070714_100130835 | 3300005435 | Bacteria | 2243 |
| 49 | Ga0070713_100029261 | 3300005436 | Bacteria | 4360 |
| 50 | Ga0070713_100039741 | 3300005436 | Bacteria | 3821 |
| 51 | Ga0070713_100045854 | 3300005436 | Bacteria | 3584 |
| 52 | Ga0070713_100121414 | 3300005436 | Bacteria | 2292 |
| 53 | Ga0070713_100124046 | 3300005436 | Bacteria | 2269 |
| 54 | Ga0070713_100262007 | 3300005436 | Bacteria | 1580 |
| 55 | Ga0070710_10037126 | 3300005437 | Bacteria | 2668 |
| 56 | Ga0070710_10091457 | 3300005437 | Bacteria | 1795 |
| 57 | Ga0070710_10121500 | 3300005437 | Bacteria | 1582 |
| 58 | Ga0070711_100002535 | 3300005439 | Bacteria | 10449 |
| 59 | Ga0070711_100037365 | 3300005439 | Bacteria | 3259 |
| 60 | Ga0070711_100044062 | 3300005439 | Bacteria | 3026 |
| 61 | Ga0070711_100048645 | 3300005439 | Bacteria | 2901 |
| 62 | Ga0070711_100054297 | 3300005439 | Bacteria | 2764 |
| 63 | Ga0070711_100108511 | 3300005439 | Bacteria | 2033 |
| 64 | Ga0070705_100142894 | 3300005440 | Bacteria | 1577 |
| 65 | Ga0070700_100152340 | 3300005441 | Bacteria | 1583 |
| 66 | Ga0070708_100004822 | 3300005445 | Bacteria | 10638 |
| 67 | Ga0070708_100008096 | 3300005445 | Bacteria | 8427 |
| 68 | Ga0070708_100014754 | 3300005445 | Bacteria | 6437 |
| 69 | Ga0070708_100027188 | 3300005445 | Bacteria | 4906 |
| 70 | Ga0070708_100100781 | 3300005445 | Bacteria | 2644 |
| 71 | Ga0070708_100135621 | 3300005445 | Bacteria | 2280 |
| 72 | Ga0070708_100201837 | 3300005445 | Bacteria | 1862 |
| 73 | Ga0070708_100249665 | 3300005445 | Bacteria | 1667 |
| 74 | Ga0070708_100351353 | 3300005445 | Bacteria | 1389 |
| 75 | Ga0070663_100153871 | 3300005455 | Bacteria | 1766 |
| 76 | Ga0070663_100228969 | 3300005455 | Bacteria | 1463 |
| 77 | Ga0070678_100025004 | 3300005456 | Bacteria | 4009 |
| 78 | Ga0070678_100096243 | 3300005456 | Bacteria | 2283 |
| 79 | Ga0070678_100131606 | 3300005456 | Bacteria | 1988 |
| 80 | Ga0070678_100271075 | 3300005456 | Bacteria | 1431 |
| 81 | Ga0070662_100085804 | 3300005457 | Bacteria | 2353 |
| 82 | Ga0070662_100086358 | 3300005457 | Bacteria | 2346 |
| 83 | Ga0070662_100116431 | 3300005457 | Bacteria | 2043 |
| 84 | Ga0070662_100155877 | 3300005457 | Bacteria | 1783 |
| 85 | Ga0070681_10004191 | 3300005458 | Bacteria | 13657 |
| 86 | Ga0068867_100032637 | 3300005459 | Bacteria | 3767 |
| 87 | Ga0068867_100049701 | 3300005459 | Bacteria | 3088 |
| 88 | Ga0068867_100074029 | 3300005459 | Bacteria | 2552 |
| 89 | Ga0070685_10007741 | 3300005466 | Bacteria | 5501 |
| 90 | Ga0070706_100016360 | 3300005467 | Bacteria | 6852 |
| 91 | Ga0070706_100048123 | 3300005467 | Bacteria | 3935 |
| 92 | Ga0070706_100092320 | 3300005467 | Bacteria | 2808 |
| 93 | Ga0070706_100114186 | 3300005467 | Bacteria | 2514 |
| 94 | Ga0070707_100032373 | 3300005468 | Bacteria | 4982 |
| 95 | Ga0070707_100033526 | 3300005468 | Bacteria | 4897 |
| 96 | Ga0070698_100001112 | 3300005471 | Bacteria | 29679 |
| 97 | Ga0070698_100005059 | 3300005471 | Bacteria | 14451 |
| 98 | Ga0070698_100068334 | 3300005471 | Bacteria | 3571 |
| 99 | Ga0070698_100216452 | 3300005471 | Bacteria | 1849 |
| 100 | Ga0070698_100338553 | 3300005471 | Bacteria | 1436 |
| 101 | Ga0070699_100000638 | 3300005518 | Bacteria | 32809 |
| 102 | Ga0070699_100193496 | 3300005518 | Bacteria | 1807 |
| 103 | Ga0070699_100282907 | 3300005518 | Bacteria | 1486 |
| 104 | Ga0070679_100001416 | 3300005530 | Bacteria | 21214 |
| 105 | Ga0070684_100027283 | 3300005535 | Bacteria | 4817 |
| 106 | Ga0070684_100029728 | 3300005535 | Bacteria | 4634 |
| 107 | Ga0070684_100097331 | 3300005535 | Bacteria | 2624 |
| 108 | Ga0070697_100013922 | 3300005536 | Bacteria | 6315 |
| 109 | Ga0068853_100019539 | 3300005539 | Bacteria | 5618 |
| 110 | Ga0068853_100060166 | 3300005539 | Bacteria | 3281 |
| 111 | Ga0068853_100138292 | 3300005539 | Bacteria | 2185 |
| 112 | Ga0068853_100148936 | 3300005539 | Bacteria | 2105 |
| 113 | Ga0070672_100076164 | 3300005543 | Bacteria | 2679 |
| 114 | Ga0070686_100019417 | 3300005544 | Bacteria | 4005 |
| 115 | Ga0070686_100053032 | 3300005544 | Bacteria | 2588 |
| 116 | Ga0070695_100045044 | 3300005545 | Bacteria | 2811 |
| 117 | Ga0070693_100001260 | 3300005547 | Bacteria | 11459 |
| 118 | Ga0070665_100003689 | 3300005548 | Bacteria | 16221 |
| 119 | Ga0070665_100022665 | 3300005548 | Bacteria | 6323 |
| 120 | Ga0070665_100028102 | 3300005548 | Bacteria | 5665 |
| 121 | Ga0070665_100034065 | 3300005548 | Bacteria | 5122 |
| 122 | Ga0070665_100058274 | 3300005548 | Bacteria | 3872 |
| 123 | Ga0070665_100089939 | 3300005548 | Bacteria | 3076 |
| 124 | Ga0070665_100116226 | 3300005548 | Bacteria | 2678 |
| 125 | Ga0070704_100045252 | 3300005549 | Bacteria | 3061 |
| 126 | Ga0070704_100081594 | 3300005549 | Bacteria | 2382 |
| 127 | Ga0068855_100006280 | 3300005563 | Bacteria | 14483 |
| 128 | Ga0068855_100027075 | 3300005563 | Bacteria | 6859 |
| 129 | Ga0068855_100046098 | 3300005563 | Bacteria | 5154 |
| 130 | Ga0068855_100047298 | 3300005563 | Bacteria | 5083 |
| 131 | Ga0068855_100127109 | 3300005563 | Bacteria | 2913 |
| 132 | Ga0070664_100057684 | 3300005564 | Bacteria | 3301 |
| 133 | Ga0070664_100183347 | 3300005564 | Bacteria | 1862 |
| 134 | Ga0068857_100013480 | 3300005577 | Bacteria | 7121 |
| 135 | Ga0068857_100093504 | 3300005577 | Bacteria | 2693 |
| 136 | Ga0068857_100179211 | 3300005577 | Bacteria | 1928 |
| 137 | Ga0068857_100210786 | 3300005577 | Bacteria | 1773 |
| 138 | Ga0068854_100010617 | 3300005578 | Bacteria | 5976 |
| 139 | Ga0068854_100036106 | 3300005578 | Bacteria | 3463 |
| 140 | Ga0068854_100140571 | 3300005578 | Bacteria | 1852 |
| 141 | Ga0068856_100001773 | 3300005614 | Bacteria | 22538 |
| 142 | Ga0068856_100008586 | 3300005614 | Bacteria | 9932 |
| 143 | Ga0068856_100058166 | 3300005614 | Bacteria | 3817 |
| 144 | Ga0068856_100071594 | 3300005614 | Bacteria | 3432 |
| 145 | Ga0068856_100117000 | 3300005614 | Bacteria | 2666 |
| 146 | Ga0068856_100140457 | 3300005614 | Bacteria | 2422 |
| 147 | Ga0068856_100163592 | 3300005614 | Bacteria | 2236 |
| 148 | Ga0068856_100175191 | 3300005614 | Bacteria | 2157 |
| 149 | Ga0068856_100491259 | 3300005614 | Bacteria | 1248 |
| 150 | Ga0070702_100024129 | 3300005615 | Bacteria | 3240 |
| 151 | Ga0070702_100028220 | 3300005615 | Bacteria | 3040 |
| 152 | Ga0070702_100092214 | 3300005615 | Bacteria | 1839 |
| 153 | Ga0068852_100002392 | 3300005616 | Bacteria | 12932 |
| 154 | Ga0068852_100018353 | 3300005616 | Bacteria | 5511 |
| 155 | Ga0068852_100043681 | 3300005616 | Bacteria | 3802 |
| 156 | Ga0068852_100045253 | 3300005616 | Bacteria | 3742 |
| 157 | Ga0068852_100045282 | 3300005616 | Bacteria | 3741 |
| 158 | Ga0068852_100056096 | 3300005616 | Bacteria | 3402 |
| 159 | Ga0068852_100139986 | 3300005616 | Bacteria | 2238 |
| 160 | Ga0068859_100000264 | 3300005617 | Bacteria | 52493 |
| 161 | Ga0068859_100007343 | 3300005617 | Bacteria | 11180 |
| 162 | Ga0068864_100000630 | 3300005618 | Bacteria | 29644 |
| 163 | Ga0068864_100000916 | 3300005618 | Bacteria | 24730 |
| 164 | Ga0068864_100205476 | 3300005618 | Bacteria | 1811 |
| 165 | Ga0068864_100320527 | 3300005618 | Bacteria | 1455 |
| 166 | Ga0068866_10001032 | 3300005718 | Bacteria | 12250 |
| 167 | Ga0068866_10017537 | 3300005718 | Bacteria | 3221 |
| 168 | Ga0068866_10049825 | 3300005718 | Bacteria | 2124 |
| 169 | Ga0068866_10053414 | 3300005718 | Bacteria | 2066 |
| 170 | Ga0068861_100017452 | 3300005719 | Bacteria | 5097 |
| 171 | Ga0068861_100266143 | 3300005719 | Bacteria | 1470 |
| 172 | Ga0068851_10002195 | 3300005834 | Bacteria | 8586 |
| 173 | Ga0068851_10003831 | 3300005834 | Bacteria | 6731 |
| 174 | Ga0068851_10096717 | 3300005834 | Bacteria | 1562 |
| 175 | Ga0068870_10026698 | 3300005840 | Bacteria | 2881 |
| 176 | Ga0068870_10033448 | 3300005840 | Bacteria | 2624 |
| 177 | Ga0068870_10091307 | 3300005840 | Bacteria | 1703 |
| 178 | Ga0068863_100000240 | 3300005841 | Bacteria | 58413 |
| 179 | Ga0068863_100019096 | 3300005841 | Bacteria | 6562 |
| 180 | Ga0068863_100053206 | 3300005841 | Bacteria | 3836 |
| 181 | Ga0068863_100212676 | 3300005841 | Bacteria | 1862 |
| 182 | Ga0068863_100248358 | 3300005841 | Bacteria | 1718 |
| 183 | Ga0068863_100377271 | 3300005841 | Bacteria | 1384 |
| 184 | Ga0068858_100000129 | 3300005842 | Bacteria | 79265 |
| 185 | Ga0068858_100003332 | 3300005842 | Bacteria | 15997 |
| 186 | Ga0068858_100011293 | 3300005842 | Bacteria | 8440 |
| 187 | Ga0068858_100067432 | 3300005842 | Bacteria | 3314 |
| 188 | Ga0068858_100111361 | 3300005842 | Bacteria | 2556 |
| 189 | Ga0068858_100258962 | 3300005842 | Bacteria | 1653 |
| 190 | Ga0068860_100040790 | 3300005843 | Bacteria | 4435 |
| 191 | Ga0068860_100085877 | 3300005843 | Bacteria | 2994 |
| 192 | Ga0068860_100137527 | 3300005843 | Bacteria | 2346 |
| 193 | Ga0068862_100168452 | 3300005844 | Bacteria | 1960 |
| 194 | Ga0068862_100189492 | 3300005844 | Bacteria | 1850 |
| 195 | Ga0081455_10022970 | 3300005937 | Bacteria | 5815 |
| 196 | Ga0081538_10001988 | 3300005981 | Bacteria | 20419 |
| 197 | Ga0081538_10004043 | 3300005981 | Bacteria | 13640 |
| 198 | Ga0081538_10009100 | 3300005981 | Bacteria | 8331 |
| 199 | Ga0081538_10017764 | 3300005981 | Bacteria | 5380 |
| 200 | Ga0081538_10020949 | 3300005981 | Bacteria | 4795 |
| 201 | Ga0081540_1017515 | 3300005983 | Bacteria | 4431 |
| 202 | Ga0081539_10035620 | 3300005985 | Bacteria | 2988 |
| 203 | Ga0070717_10000530 | 3300006028 | Bacteria | 24179 |
| 204 | Ga0070717_10010336 | 3300006028 | Bacteria | 7042 |
| 205 | Ga0070717_10069079 | 3300006028 | Bacteria | 2941 |
| 206 | Ga0070717_10114972 | 3300006028 | Bacteria | 2299 |
| 207 | Ga0070717_10115091 | 3300006028 | Bacteria | 2298 |
| 208 | Ga0070717_10133537 | 3300006028 | Bacteria | 2136 |
| 209 | Ga0070715_10002782 | 3300006163 | Bacteria | 5440 |
| 210 | Ga0070716_100002716 | 3300006173 | Bacteria | 8202 |
| 211 | Ga0070716_100029723 | 3300006173 | Bacteria | 2957 |
| 212 | Ga0070712_100000161 | 3300006175 | Bacteria | 36151 |
| 213 | Ga0070712_100035711 | 3300006175 | Bacteria | 3375 |
| 214 | Ga0070712_100073473 | 3300006175 | Bacteria | 2453 |
| 215 | Ga0070712_100138512 | 3300006175 | Bacteria | 1854 |
| 216 | Ga0070712_100199599 | 3300006175 | Bacteria | 1570 |
| 217 | Ga0075427_10008670 | 3300006194 | Bacteria | 1510 |
| 218 | Ga0097621_100032431 | 3300006237 | Bacteria | 4152 |
| 219 | Ga0097621_100039710 | 3300006237 | Bacteria | 3781 |
| 220 | Ga0097621_100061027 | 3300006237 | Bacteria | 3092 |
| 221 | Ga0097621_100130011 | 3300006237 | Bacteria | 2143 |
| 222 | Ga0068871_100017029 | 3300006358 | Bacteria | 5489 |
| 223 | Ga0068871_100053357 | 3300006358 | Bacteria | 3276 |
| 224 | Ga0075428_100002525 | 3300006844 | Bacteria | 19895 |
| 225 | Ga0075428_100071418 | 3300006844 | Bacteria | 3794 |
| 226 | Ga0075430_100001715 | 3300006846 | Bacteria | 17877 |
| 227 | Ga0075431_100070688 | 3300006847 | Bacteria | 3602 |
| 228 | Ga0075434_100094566 | 3300006871 | Bacteria | 2993 |
| 229 | Ga0075429_100001213 | 3300006880 | Bacteria | 20918 |
| 230 | Ga0068865_100022657 | 3300006881 | Bacteria | 4101 |
| 231 | Ga0068865_100035012 | 3300006881 | Bacteria | 3374 |
| 232 | Ga0068865_100042995 | 3300006881 | Bacteria | 3084 |
| 233 | Ga0068865_100066363 | 3300006881 | Bacteria | 2545 |
| 234 | Ga0097620_100000264 | 3300006931 | Bacteria | 52493 |
| 235 | Ga0097620_100007342 | 3300006931 | Bacteria | 11180 |
| 236 | Ga0075435_100093726 | 3300007076 | Bacteria | 2481 |
| 237 | Ga0099795_10052005 | 3300007788 | Bacteria | 1495 |
| 238 | Ga0105251_10008283 | 3300009011 | Bacteria | 6280 |
| 239 | Ga0105250_10029359 | 3300009092 | Bacteria | 2213 |
| 240 | Ga0105240_10001911 | 3300009093 | Bacteria | 34575 |
| 241 | Ga0105240_10002523 | 3300009093 | Bacteria | 29393 |
| 242 | Ga0105240_10012228 | 3300009093 | Bacteria | 11864 |
| 243 | Ga0105240_10026921 | 3300009093 | Bacteria | 7538 |
| 244 | Ga0105240_10264905 | 3300009093 | Bacteria | 1981 |
| 245 | Ga0111539_10014360 | 3300009094 | Bacteria | 9886 |
| 246 | Ga0111539_10149852 | 3300009094 | Bacteria | 2731 |
| 247 | Ga0111539_10614523 | 3300009094 | Bacteria | 1266 |
| 248 | Ga0105245_10006288 | 3300009098 | Bacteria | 10452 |
| 249 | Ga0105245_10009844 | 3300009098 | Bacteria | 8327 |
| 250 | Ga0105245_10027663 | 3300009098 | Bacteria | 4997 |
| 251 | Ga0105245_10032121 | 3300009098 | Bacteria | 4647 |
| 252 | Ga0105245_10038276 | 3300009098 | Bacteria | 4267 |
| 253 | Ga0105245_10174497 | 3300009098 | Bacteria | 2049 |
| 254 | Ga0105247_10062613 | 3300009101 | Bacteria | 2308 |
| 255 | Ga0114129_10001051 | 3300009147 | Bacteria | 36178 |
| 256 | Ga0114129_10127533 | 3300009147 | Bacteria | 3497 |
| 257 | Ga0114129_10431620 | 3300009147 | Bacteria | 1731 |
| 258 | Ga0105243_10015380 | 3300009148 | Bacteria | 5787 |
| 259 | Ga0105243_10175011 | 3300009148 | Bacteria | 1862 |
| 260 | Ga0105243_10284076 | 3300009148 | Bacteria | 1492 |
| 261 | Ga0105241_10000094 | 3300009174 | Bacteria | 66981 |
| 262 | Ga0105241_10006065 | 3300009174 | Bacteria | 8915 |
| 263 | Ga0105241_10018097 | 3300009174 | Bacteria | 5181 |
| 264 | Ga0105241_10033888 | 3300009174 | Bacteria | 3835 |
| 265 | Ga0105241_10079456 | 3300009174 | Bacteria | 2565 |
| 266 | Ga0105241_10181416 | 3300009174 | Bacteria | 1747 |
| 267 | Ga0105242_10014026 | 3300009176 | Bacteria | 6201 |
| 268 | Ga0105242_10048704 | 3300009176 | Bacteria | 3445 |
| 269 | Ga0105242_10073795 | 3300009176 | Bacteria | 2838 |
| 270 | Ga0105242_10157454 | 3300009176 | Bacteria | 1985 |
| 271 | Ga0105242_10263595 | 3300009176 | Bacteria | 1558 |
| 272 | Ga0105248_10002708 | 3300009177 | Bacteria | 19691 |
| 273 | Ga0105248_10007990 | 3300009177 | Bacteria | 11618 |
| 274 | Ga0105248_10065147 | 3300009177 | Bacteria | 4091 |
| 275 | Ga0105248_10066092 | 3300009177 | Bacteria | 4061 |
| 276 | Ga0105248_10088033 | 3300009177 | Bacteria | 3495 |
| 277 | Ga0105248_10099583 | 3300009177 | Bacteria | 3275 |
| 278 | Ga0105237_10046219 | 3300009545 | Bacteria | 4379 |
| 279 | Ga0105237_10079538 | 3300009545 | Bacteria | 3268 |
| 280 | Ga0105237_10089201 | 3300009545 | Bacteria | 3073 |
| 281 | Ga0105238_10018589 | 3300009551 | Bacteria | 7076 |
| 282 | Ga0105238_10020402 | 3300009551 | Bacteria | 6746 |
| 283 | Ga0105238_10024383 | 3300009551 | Bacteria | 6166 |
| 284 | Ga0105238_10049704 | 3300009551 | Bacteria | 4222 |
| 285 | Ga0105238_10098503 | 3300009551 | Bacteria | 2908 |
| 286 | Ga0105238_10102451 | 3300009551 | Bacteria | 2844 |
| 287 | Ga0105249_10028536 | 3300009553 | Bacteria | 5037 |
| 288 | Ga0105249_10090514 | 3300009553 | Bacteria | 2861 |
| 289 | Ga0105249_10096795 | 3300009553 | Bacteria | 2770 |
| 290 | Ga0105249_10103700 | 3300009553 | Bacteria | 2679 |
| 291 | Ga0105239_10041497 | 3300010375 | Bacteria | 5042 |
| 292 | Ga0105239_10069873 | 3300010375 | Bacteria | 3857 |
| 293 | Ga0105239_10230953 | 3300010375 | Bacteria | 2075 |
| 294 | Ga0105246_10003801 | 3300011119 | Bacteria | 9148 |
| 295 | Ga0157373_10023623 | 3300013100 | Bacteria | 4455 |
| 296 | Ga0157373_10045197 | 3300013100 | Bacteria | 3144 |
| 297 | Ga0157370_10000551 | 3300013104 | Bacteria | 46757 |
| 298 | Ga0157370_10017663 | 3300013104 | Bacteria | 7191 |
| 299 | Ga0157370_10036946 | 3300013104 | Bacteria | 4737 |
| 300 | Ga0157370_10057658 | 3300013104 | Bacteria | 3692 |
| 301 | Ga0157369_10001019 | 3300013105 | Bacteria | 35287 |
| 302 | Ga0157369_10006030 | 3300013105 | Bacteria | 14067 |
| 303 | Ga0157369_10016591 | 3300013105 | Bacteria | 8278 |
| 304 | Ga0157369_10055523 | 3300013105 | Bacteria | 4275 |
| 305 | Ga0157369_10076809 | 3300013105 | Bacteria | 3580 |
| 306 | Ga0157369_10376027 | 3300013105 | Bacteria | 1475 |
| 307 | Ga0157374_10000954 | 3300013296 | Bacteria | 25106 |
| 308 | Ga0157374_10003641 | 3300013296 | Bacteria | 12967 |
| 309 | Ga0157374_10060855 | 3300013296 | Bacteria | 3535 |
| 310 | Ga0157378_10006444 | 3300013297 | Bacteria | 10262 |
| 311 | Ga0157378_10063542 | 3300013297 | Bacteria | 3298 |
| 312 | Ga0157378_10075862 | 3300013297 | Bacteria | 3028 |
| 313 | Ga0157378_10099811 | 3300013297 | Bacteria | 2649 |
| 314 | Ga0157378_10145976 | 3300013297 | Bacteria | 2200 |
| 315 | Ga0163162_10027172 | 3300013306 | Bacteria | 5658 |
| 316 | Ga0163162_10068920 | 3300013306 | Bacteria | 3589 |
| 317 | Ga0163162_10071314 | 3300013306 | Bacteria | 3527 |
| 318 | Ga0157372_10006108 | 3300013307 | Bacteria | 12799 |
| 319 | Ga0157372_10011236 | 3300013307 | Bacteria | 9524 |
| 320 | Ga0157372_10020689 | 3300013307 | Bacteria | 7101 |
| 321 | Ga0157372_10048987 | 3300013307 | Bacteria | 4697 |
| 322 | Ga0157372_10067989 | 3300013307 | Bacteria | 4005 |
| 323 | Ga0157372_10087368 | 3300013307 | Bacteria | 3538 |
| 324 | Ga0157372_10096041 | 3300013307 | Bacteria | 3377 |
| 325 | Ga0157372_10458244 | 3300013307 | Bacteria | 1486 |
| 326 | Ga0157375_10001655 | 3300013308 | Bacteria | 19164 |
| 327 | Ga0157375_10004421 | 3300013308 | Bacteria | 12205 |
| 328 | Ga0157375_10053196 | 3300013308 | Bacteria | 3983 |
| 329 | Ga0163163_10000225 | 3300014325 | Bacteria | 58314 |
| 330 | Ga0163163_10132844 | 3300014325 | Bacteria | 2529 |
| 331 | Ga0163163_10341038 | 3300014325 | Bacteria | 1554 |
| 332 | Ga0157379_10003294 | 3300014968 | Bacteria | 13667 |
| 333 | Ga0157379_10026897 | 3300014968 | Bacteria | 5121 |
| 334 | Ga0157379_10047019 | 3300014968 | Bacteria | 3850 |
| 335 | Ga0157379_10072622 | 3300014968 | Bacteria | 3079 |
| 336 | Ga0157379_10114486 | 3300014968 | Bacteria | 2424 |
| 337 | Ga0157379_10125137 | 3300014968 | Bacteria | 2313 |
| 338 | Ga0157376_10018409 | 3300014969 | Bacteria | 5355 |
| 339 | Ga0157376_10035017 | 3300014969 | Bacteria | 4058 |
| 340 | Ga0157376_10128173 | 3300014969 | Bacteria | 2260 |
| 341 | Ga0163161_10113324 | 3300017792 | Bacteria | 2029 |
| 342 | Ga0206355_1391959 | 3300020076 | Bacteria | 1852 |
| 343 | Ga0206350_10152870 | 3300020080 | Bacteria | 2747 |
| 344 | Ga0213872_10025029 | 3300021361 | Bacteria | 2745 |
| 345 | Ga0213871_10009684 | 3300021441 | Bacteria | 2165 |
| 346 | Ga0207697_10005630 | 3300025315 | Bacteria | 5789 |
| 347 | Ga0207656_10019285 | 3300025321 | Bacteria | 2697 |
| 348 | Ga0207696_1025290 | 3300025711 | Bacteria | 1853 |
| 349 | Ga0207713_1008998 | 3300025735 | Bacteria | 5678 |
| 350 | Ga0207653_10024132 | 3300025885 | Bacteria | 1940 |
| 351 | Ga0207653_10031132 | 3300025885 | Bacteria | 1723 |
| 352 | Ga0207692_10008893 | 3300025898 | Bacteria | 4173 |
| 353 | Ga0207692_10022568 | 3300025898 | Bacteria | 2897 |
| 354 | Ga0207692_10024933 | 3300025898 | Bacteria | 2787 |
| 355 | Ga0207692_10026630 | 3300025898 | Bacteria | 2714 |
| 356 | Ga0207692_10082462 | 3300025898 | Bacteria | 1723 |
| 357 | Ga0207642_10004460 | 3300025899 | Bacteria | 4518 |
| 358 | Ga0207642_10022014 | 3300025899 | Bacteria | 2520 |
| 359 | Ga0207710_10007412 | 3300025900 | Bacteria | 4647 |
| 360 | Ga0207710_10007994 | 3300025900 | Bacteria | 4470 |
| 361 | Ga0207688_10028983 | 3300025901 | Bacteria | 3046 |
| 362 | Ga0207688_10029464 | 3300025901 | Bacteria | 3023 |
| 363 | Ga0207688_10161289 | 3300025901 | Bacteria | 1329 |
| 364 | Ga0207680_10002108 | 3300025903 | Bacteria | 9306 |
| 365 | Ga0207680_10017243 | 3300025903 | Bacteria | 3811 |
| 366 | Ga0207647_10010170 | 3300025904 | Bacteria | 6649 |
| 367 | Ga0207685_10016482 | 3300025905 | Bacteria | 2367 |
| 368 | Ga0207699_10014332 | 3300025906 | Bacteria | 4083 |
| 369 | Ga0207699_10033666 | 3300025906 | Bacteria | 2898 |
| 370 | Ga0207699_10038038 | 3300025906 | Bacteria | 2754 |
| 371 | Ga0207699_10049263 | 3300025906 | Bacteria | 2479 |
| 372 | Ga0207699_10110833 | 3300025906 | Bacteria | 1758 |
| 373 | Ga0207645_10007748 | 3300025907 | Bacteria | 7560 |
| 374 | Ga0207645_10009954 | 3300025907 | Bacteria | 6549 |
| 375 | Ga0207643_10012717 | 3300025908 | Bacteria | 4549 |
| 376 | Ga0207705_10073328 | 3300025909 | Bacteria | 2483 |
| 377 | Ga0207684_10000954 | 3300025910 | Bacteria | 32598 |
| 378 | Ga0207684_10005728 | 3300025910 | Bacteria | 11408 |
| 379 | Ga0207684_10006890 | 3300025910 | Bacteria | 10280 |
| 380 | Ga0207684_10013877 | 3300025910 | Bacteria | 6958 |
| 381 | Ga0207684_10063832 | 3300025910 | Bacteria | 3126 |
| 382 | Ga0207654_10000055 | 3300025911 | Bacteria | 77517 |
| 383 | Ga0207654_10020137 | 3300025911 | Bacteria | 3532 |
| 384 | Ga0207654_10050141 | 3300025911 | Bacteria | 2397 |
| 385 | Ga0207707_10100378 | 3300025912 | Bacteria | 2529 |
| 386 | Ga0207695_10001516 | 3300025913 | Bacteria | 38541 |
| 387 | Ga0207695_10031465 | 3300025913 | Bacteria | 5818 |
| 388 | Ga0207695_10032690 | 3300025913 | Bacteria | 5689 |
| 389 | Ga0207695_10062904 | 3300025913 | Bacteria | 3828 |
| 390 | Ga0207671_10030882 | 3300025914 | Bacteria | 3994 |
| 391 | Ga0207693_10000075 | 3300025915 | Bacteria | 88428 |
| 392 | Ga0207693_10028375 | 3300025915 | Bacteria | 4422 |
| 393 | Ga0207693_10040946 | 3300025915 | Bacteria | 3649 |
| 394 | Ga0207693_10055672 | 3300025915 | Bacteria | 3103 |
| 395 | Ga0207693_10077907 | 3300025915 | Bacteria | 2595 |
| 396 | Ga0207663_10001176 | 3300025916 | Bacteria | 12068 |
| 397 | Ga0207663_10010425 | 3300025916 | Bacteria | 4949 |
| 398 | Ga0207663_10016779 | 3300025916 | Bacteria | 4069 |
| 399 | Ga0207663_10036517 | 3300025916 | Bacteria | 2957 |
| 400 | Ga0207663_10040038 | 3300025916 | Bacteria | 2845 |
| 401 | Ga0207663_10058544 | 3300025916 | Bacteria | 2432 |
| 402 | Ga0207663_10065139 | 3300025916 | Bacteria | 2328 |
| 403 | Ga0207657_10012854 | 3300025919 | Bacteria | 8236 |
| 404 | Ga0207649_10157674 | 3300025920 | Bacteria | 1570 |
| 405 | Ga0207652_10011393 | 3300025921 | Bacteria | 7167 |
| 406 | Ga0207646_10001454 | 3300025922 | Bacteria | 29350 |
| 407 | Ga0207646_10001794 | 3300025922 | Bacteria | 25959 |
| 408 | Ga0207646_10010227 | 3300025922 | Bacteria | 9186 |
| 409 | Ga0207646_10033189 | 3300025922 | Bacteria | 4671 |
| 410 | Ga0207646_10243385 | 3300025922 | Bacteria | 1625 |
| 411 | Ga0207694_10024796 | 3300025924 | Bacteria | 4556 |
| 412 | Ga0207650_10014653 | 3300025925 | Bacteria | 5447 |
| 413 | Ga0207650_10144503 | 3300025925 | Bacteria | 1873 |
| 414 | Ga0207650_10156785 | 3300025925 | Bacteria | 1801 |
| 415 | Ga0207659_10022156 | 3300025926 | Bacteria | 4227 |
| 416 | Ga0207687_10004569 | 3300025927 | Bacteria | 9211 |
| 417 | Ga0207687_10004816 | 3300025927 | Bacteria | 8974 |
| 418 | Ga0207687_10005342 | 3300025927 | Bacteria | 8503 |
| 419 | Ga0207687_10031675 | 3300025927 | Bacteria | 3576 |
| 420 | Ga0207687_10045338 | 3300025927 | Bacteria | 3039 |
| 421 | Ga0207700_10004604 | 3300025928 | Bacteria | 8163 |
| 422 | Ga0207700_10007500 | 3300025928 | Bacteria | 6671 |
| 423 | Ga0207700_10010051 | 3300025928 | Bacteria | 5949 |
| 424 | Ga0207700_10056966 | 3300025928 | Bacteria | 2944 |
| 425 | Ga0207700_10162281 | 3300025928 | Bacteria | 1857 |
| 426 | Ga0207664_10007497 | 3300025929 | Bacteria | 7568 |
| 427 | Ga0207664_10014506 | 3300025929 | Bacteria | 5693 |
| 428 | Ga0207664_10021631 | 3300025929 | Bacteria | 4787 |
| 429 | Ga0207664_10021936 | 3300025929 | Bacteria | 4758 |
| 430 | Ga0207664_10033175 | 3300025929 | Bacteria | 3964 |
| 431 | Ga0207664_10065214 | 3300025929 | Bacteria | 2915 |
| 432 | Ga0207664_10082345 | 3300025929 | Bacteria | 2621 |
| 433 | Ga0207644_10003739 | 3300025931 | Bacteria | 9863 |
| 434 | Ga0207644_10058053 | 3300025931 | Bacteria | 2796 |
| 435 | Ga0207644_10080990 | 3300025931 | Bacteria | 2398 |
| 436 | Ga0207644_10118145 | 3300025931 | Bacteria | 2015 |
| 437 | Ga0207706_10005916 | 3300025933 | Bacteria | 11379 |
| 438 | Ga0207706_10007072 | 3300025933 | Bacteria | 10376 |
| 439 | Ga0207706_10019925 | 3300025933 | Bacteria | 6028 |
| 440 | Ga0207706_10214641 | 3300025933 | Bacteria | 1686 |
| 441 | Ga0207686_10000195 | 3300025934 | Bacteria | 47027 |
| 442 | Ga0207686_10009911 | 3300025934 | Bacteria | 5178 |
| 443 | Ga0207686_10179173 | 3300025934 | Bacteria | 1502 |
| 444 | Ga0207670_10081076 | 3300025936 | Bacteria | 2270 |
| 445 | Ga0207669_10010554 | 3300025937 | Bacteria | 4450 |
| 446 | Ga0207669_10101491 | 3300025937 | Bacteria | 1903 |
| 447 | Ga0207704_10003239 | 3300025938 | Bacteria | 7377 |
| 448 | Ga0207704_10006687 | 3300025938 | Bacteria | 5401 |
| 449 | Ga0207704_10040211 | 3300025938 | Bacteria | 2730 |
| 450 | Ga0207665_10007093 | 3300025939 | Bacteria | 7419 |
| 451 | Ga0207665_10008118 | 3300025939 | Bacteria | 6929 |
| 452 | Ga0207665_10053431 | 3300025939 | Bacteria | 2723 |
| 453 | Ga0207691_10003999 | 3300025940 | Bacteria | 14297 |
| 454 | Ga0207691_10074094 | 3300025940 | Bacteria | 3071 |
| 455 | Ga0207691_10106640 | 3300025940 | Bacteria | 2495 |
| 456 | Ga0207691_10196271 | 3300025940 | Bacteria | 1758 |
| 457 | Ga0207711_10000092 | 3300025941 | Bacteria | 95507 |
| 458 | Ga0207711_10000990 | 3300025941 | Bacteria | 27231 |
| 459 | Ga0207711_10032534 | 3300025941 | Bacteria | 4409 |
| 460 | Ga0207689_10013663 | 3300025942 | Bacteria | 6922 |
| 461 | Ga0207689_10259847 | 3300025942 | Bacteria | 1437 |
| 462 | Ga0207661_10016902 | 3300025944 | Bacteria | 5388 |
| 463 | Ga0207661_10081570 | 3300025944 | Bacteria | 2672 |
| 464 | Ga0207667_10007142 | 3300025949 | Bacteria | 13481 |
| 465 | Ga0207667_10019388 | 3300025949 | Bacteria | 7593 |
| 466 | Ga0207667_10177281 | 3300025949 | Bacteria | 2189 |
| 467 | Ga0207651_10000135 | 3300025960 | Bacteria | 31996 |
| 468 | Ga0207651_10008828 | 3300025960 | Bacteria | 5470 |
| 469 | Ga0207668_10064602 | 3300025972 | Bacteria | 2587 |
| 470 | Ga0207668_10115320 | 3300025972 | Bacteria | 2023 |
| 471 | Ga0207640_10020200 | 3300025981 | Bacteria | 3952 |
| 472 | Ga0207640_10081286 | 3300025981 | Bacteria | 2215 |
| 473 | Ga0207640_10216463 | 3300025981 | Bacteria | 1463 |
| 474 | Ga0207658_10034011 | 3300025986 | Bacteria | 3639 |
| 475 | Ga0207658_10141432 | 3300025986 | Bacteria | 1948 |
| 476 | Ga0207677_10009996 | 3300026023 | Bacteria | 5354 |
| 477 | Ga0207677_10054216 | 3300026023 | Bacteria | 2735 |
| 478 | Ga0207677_10060561 | 3300026023 | Bacteria | 2617 |
| 479 | Ga0207677_10169121 | 3300026023 | Bacteria | 1707 |
| 480 | Ga0207703_10000321 | 3300026035 | Bacteria | 52064 |
| 481 | Ga0207703_10000820 | 3300026035 | Bacteria | 30614 |
| 482 | Ga0207703_10188912 | 3300026035 | Bacteria | 1823 |
| 483 | Ga0207639_10009952 | 3300026041 | Bacteria | 6570 |
| 484 | Ga0207678_10027515 | 3300026067 | Bacteria | 4962 |
| 485 | Ga0207708_10019124 | 3300026075 | Bacteria | 5159 |
| 486 | Ga0207708_10034843 | 3300026075 | Bacteria | 3829 |
| 487 | Ga0207708_10060179 | 3300026075 | Bacteria | 2899 |
| 488 | Ga0207702_10053125 | 3300026078 | Bacteria | 3430 |
| 489 | Ga0207702_10069818 | 3300026078 | Bacteria | 3021 |
| 490 | Ga0207702_10231039 | 3300026078 | Bacteria | 1729 |
| 491 | Ga0207641_10000003 | 3300026088 | Bacteria | 496984 |
| 492 | Ga0207641_10008138 | 3300026088 | Bacteria | 8681 |
| 493 | Ga0207641_10012408 | 3300026088 | Bacteria | 6986 |
| 494 | Ga0207641_10029522 | 3300026088 | Bacteria | 4536 |
| 495 | Ga0207648_10015422 | 3300026089 | Bacteria | 7030 |
| 496 | Ga0207648_10016234 | 3300026089 | Bacteria | 6813 |
| 497 | Ga0207648_10022641 | 3300026089 | Bacteria | 5641 |
| 498 | Ga0207648_10129957 | 3300026089 | Bacteria | 2217 |
| 499 | Ga0207676_10000078 | 3300026095 | Bacteria | 95021 |
| 500 | Ga0207676_10000097 | 3300026095 | Bacteria | 78464 |
| 501 | Ga0207676_10108173 | 3300026095 | Bacteria | 2320 |
| 502 | Ga0207674_10000538 | 3300026116 | Bacteria | 49663 |
| 503 | Ga0207674_10011156 | 3300026116 | Bacteria | 10103 |
| 504 | Ga0207674_10242097 | 3300026116 | Bacteria | 1751 |
| 505 | Ga0207675_100000958 | 3300026118 | Bacteria | 28793 |
| 506 | Ga0207675_100021820 | 3300026118 | Bacteria | 5962 |
| 507 | Ga0207675_100036448 | 3300026118 | Bacteria | 4588 |
| 508 | Ga0207675_100042289 | 3300026118 | Bacteria | 4254 |
| 509 | Ga0207675_100287094 | 3300026118 | Bacteria | 1600 |
| 510 | Ga0207683_10001124 | 3300026121 | Bacteria | 24325 |
| 511 | Ga0207683_10008191 | 3300026121 | Bacteria | 8941 |
| 512 | Ga0207683_10020197 | 3300026121 | Bacteria | 5695 |
| 513 | Ga0207698_10000144 | 3300026142 | Bacteria | 45298 |
| 514 | Ga0207698_10100317 | 3300026142 | Bacteria | 2397 |
| 515 | Ga0207698_10299980 | 3300026142 | Bacteria | 1495 |
| 516 | Ga0207428_10000624 | 3300027907 | Bacteria | 41590 |
| 517 | Ga0207428_10003344 | 3300027907 | Bacteria | 15593 |
| 518 | Ga0268266_10008722 | 3300028379 | Bacteria | 8987 |
| 519 | Ga0268266_10010874 | 3300028379 | Bacteria | 7928 |
| 520 | Ga0268266_10183241 | 3300028379 | Bacteria | 1908 |
| 521 | Ga0268265_10146130 | 3300028380 | Bacteria | 1987 |
| 522 | Ga0268265_10193784 | 3300028380 | Bacteria | 1757 |
| 523 | Ga0268265_10210885 | 3300028380 | Bacteria | 1692 |
| 524 | Ga0268264_10009581 | 3300028381 | Bacteria | 8020 |
| 525 | Ga0268264_10010681 | 3300028381 | Bacteria | 7586 |
| 526 | Ga0268264_10253731 | 3300028381 | Bacteria | 1635 |
| 527 | Ga0268264_10308840 | 3300028381 | Bacteria | 1491 |
| 528 | Ga0268264_10354691 | 3300028381 | Bacteria | 1397 |
| 529 | Ga0265337_1000353 | 3300028556 | Bacteria | 24533 |
| 530 | Ga0265326_10001874 | 3300028558 | Bacteria | 7202 |
| 531 | Ga0265319_1000417 | 3300028563 | Bacteria | 30701 |
| 532 | Ga0265334_10000158 | 3300028573 | Bacteria | 41931 |
| 533 | Ga0265318_10001998 | 3300028577 | Bacteria | 11315 |
| 534 | Ga0265323_10009382 | 3300028653 | Bacteria | 4003 |
| 535 | Ga0265322_10003453 | 3300028654 | Bacteria | 4772 |
| 536 | Ga0265336_10001221 | 3300028666 | Bacteria | 12194 |
| 537 | Ga0265336_10001604 | 3300028666 | Bacteria | 10091 |
| 538 | Ga0265338_10000059 | 3300028800 | Bacteria | 198047 |
| 539 | Ga0265338_10007142 | 3300028800 | Bacteria | 13982 |
| 540 | Ga0265338_10053292 | 3300028800 | Bacteria | 3621 |
| 541 | Ga0265324_10000993 | 3300029957 | Bacteria | 17441 |
| 542 | Ga0265775_100354 | 3300030762 | Bacteria | 1792 |
| 543 | Ga0265763_1000042 | 3300030763 | Bacteria | 4950 |
| 544 | Ga0265777_100556 | 3300030877 | Bacteria | 1749 |
| 545 | Ga0265776_100251 | 3300030880 | Bacteria | 1793 |
| 546 | Ga0265764_100167 | 3300030882 | Bacteria | 2145 |
| 547 | Ga0265761_100334 | 3300030889 | Bacteria | 1755 |
| 548 | Ga0265773_1000055 | 3300031018 | Bacteria | 2729 |
| 549 | Ga0265779_100332 | 3300031043 | Bacteria | 1751 |
| 550 | Ga0265760_10015866 | 3300031090 | Bacteria | 2161 |
| 551 | Ga0265330_10005945 | 3300031235 | Bacteria | 6041 |
| 552 | Ga0265332_10003109 | 3300031238 | Bacteria | 8092 |
| 553 | Ga0265332_10003491 | 3300031238 | Bacteria | 7566 |
| 554 | Ga0265320_10003285 | 3300031240 | Bacteria | 10918 |
| 555 | Ga0265329_10001141 | 3300031242 | Bacteria | 13055 |
| 556 | Ga0265340_10000791 | 3300031247 | Bacteria | 17945 |
| 557 | Ga0265339_10011994 | 3300031249 | Bacteria | 5311 |
| 558 | Ga0265331_10000945 | 3300031250 | Bacteria | 23156 |
| 559 | Ga0265327_10008872 | 3300031251 | Bacteria | 7389 |
| 560 | Ga0265316_10010471 | 3300031344 | Bacteria | 8445 |
| 561 | Ga0265316_10010551 | 3300031344 | Bacteria | 8410 |
| 562 | Ga0265316_10205309 | 3300031344 | Bacteria | 1459 |
| 563 | Ga0307408_100000004 | 3300031548 | Bacteria | 572889 |
| 564 | Ga0310116_102878 | 3300031591 | Bacteria | 1745 |
| 565 | Ga0265313_10006340 | 3300031595 | Bacteria | 8415 |
| 566 | Ga0307508_10156743 | 3300031616 | Bacteria | 1881 |
| 567 | Ga0310119_103989 | 3300031686 | Bacteria | 1804 |
| 568 | Ga0310101_100696 | 3300031690 | Bacteria | 3145 |
| 569 | Ga0265314_10000220 | 3300031711 | Bacteria | 84921 |
| 570 | Ga0265314_10002504 | 3300031711 | Bacteria | 18743 |
| 571 | Ga0316576_10009469 | 3300031727 | Bacteria | 6289 |
| 572 | Ga0316578_10012243 | 3300031728 | Bacteria | 4519 |
| 573 | Ga0307405_10012205 | 3300031731 | Bacteria | 4536 |
| 574 | Ga0307405_10034102 | 3300031731 | Bacteria | 3025 |
| 575 | Ga0307405_10148242 | 3300031731 | Bacteria | 1646 |
| 576 | Ga0307413_10024768 | 3300031824 | Bacteria | 3277 |
| 577 | Ga0307413_10031108 | 3300031824 | Bacteria | 3007 |
| 578 | Ga0307407_10029699 | 3300031903 | Bacteria | 2940 |
| 579 | Ga0307409_100001484 | 3300031995 | Bacteria | 11569 |
| 580 | Ga0307416_100000506 | 3300032002 | Bacteria | 19880 |
| 581 | Ga0307416_100242183 | 3300032002 | Bacteria | 1748 |
| 582 | Ga0307414_10023969 | 3300032004 | Bacteria | 3882 |
| 583 | Ga0307414_10089065 | 3300032004 | Bacteria | 2286 |
| 584 | Ga0307415_100005611 | 3300032126 | Bacteria | 6680 |
| 585 | Ga0307415_100015938 | 3300032126 | Bacteria | 4463 |
| 586 | Ga0316583_10005519 | 3300032133 | Bacteria | 4538 |
| 587 | Ga0316593_10009668 | 3300032168 | Bacteria | 2734 |
| 588 | Ga0316592_1006997 | 3300033524 | Bacteria | 2190 |
| 589 | Ga0316588_1003500 | 3300033528 | Bacteria | 2875 |
| 590 | Ga0316588_1008164 | 3300033528 | Bacteria | 2146 |
| 591 | Ga0316596_1010795 | 3300033541 | Bacteria | 2220 |
| 592 | Ga0316215_1002172 | 3300033544 | Bacteria | 1854 |
| 593 | Ga0373938_0004402 | 3300034957 | Bacteria | 2352 |
| 594 | Ga0373926_0004797 | 3300035083 | Bacteria | 4446 |
| 595 | Ga0373926_0055950 | 3300035083 | Bacteria | 1430 |
| 596 | Ga0373934_0007490 | 3300035086 | Bacteria | 4053 |
| 597 | Ga0373934_0010981 | 3300035086 | Bacteria | 3405 |
| 598 | Ga0373944_0001312 | 3300035089 | Bacteria | 6254 |
| 599 | Ga0373949_0008242 | 3300035090 | Bacteria | 2282 |
| 600 | Ga0373923_0001816 | 3300035111 | Bacteria | 6314 |
| 601 | Ga0373923_0002481 | 3300035111 | Bacteria | 5695 |
| 602 | Ga0373923_0010881 | 3300035111 | Bacteria | 3323 |
| 603 | Ga0373932_0005011 | 3300035112 | Bacteria | 3118 |
| 604 | Ga0373936_0000795 | 3300035113 | Bacteria | 11168 |
| 605 | Ga0373939_0004880 | 3300035114 | Bacteria | 3182 |
| 606 | Ga0373953_0006915 | 3300035117 | Bacteria | 3767 |
| 607 | Ga0373953_0009719 | 3300035117 | Bacteria | 3321 |
| 608 | Ga0373953_0019027 | 3300035117 | Bacteria | 2549 |
| 609 | Ga0373954_0008993 | 3300035118 | Bacteria | 4394 |
| 610 | Ga0373954_0032347 | 3300035118 | Bacteria | 2417 |
| 611 | Ga0373956_0006493 | 3300035119 | Bacteria | 4686 |
| 612 | Ga0373956_0014531 | 3300035119 | Bacteria | 3291 |
| 613 | Ga0373956_0050212 | 3300035119 | Bacteria | 1872 |
| 614 | Ga0373957_0001351 | 3300035120 | Bacteria | 6585 |
| 615 | Ga0373957_0017577 | 3300035120 | Bacteria | 2493 |
| 616 | Ga0373960_0001547 | 3300035121 | Bacteria | 5125 |
| 617 | Ga0373943_0005766 | 3300035170 | Bacteria | 5560 |
| 618 | Ga0373943_0031639 | 3300035170 | Bacteria | 2511 |
| 619 | Ga0373943_0064937 | 3300035170 | Bacteria | 1834 |
| 620 | Ga0373946_0001732 | 3300035171 | Bacteria | 7611 |
| 621 | Ga0373955_0003821 | 3300035172 | Bacteria | 6636 |
| 622 | Ga0373955_0004630 | 3300035172 | Bacteria | 6098 |
| 623 | Ga0373955_0005029 | 3300035172 | Bacteria | 5910 |
| 624 | Ga0373955_0006943 | 3300035172 | Bacteria | 5179 |
| 625 | Ga0373955_0027448 | 3300035172 | Bacteria | 2943 |
| 626 | Ga0373955_0142688 | 3300035172 | Bacteria | 1405 |
| 627 | Ga0373962_0008013 | 3300035242 | Bacteria | 2595 |
| 628 | Ga0316574_0044733 | 3300035398 | Bacteria | 2740 |
| 629 | Ga0316574_0104676 | 3300035398 | Bacteria | 1812 |
| 630 | Ga0373924_0000599 | 3300035410 | Bacteria | 11133 |
| 631 | Ga0373924_0007596 | 3300035410 | Bacteria | 3917 |
| 632 | Ga0373924_0009219 | 3300035410 | Bacteria | 3613 |
| 633 | Ga0373931_0028239 | 3300035691 | Bacteria | 2870 |
| 634 | Ga0373931_0034470 | 3300035691 | Bacteria | 2627 |
| 635 | Ga0373935_0037501 | 3300035692 | Bacteria | 3033 |
| 636 | Ga0373935_0081884 | 3300035692 | Bacteria | 2099 |
| 637 | Ga0373927_0013694 | 3300035695 | Bacteria | 5385 |
| 638 | Ga0373927_0057258 | 3300035695 | Bacteria | 2520 |
| 639 | Ga0373927_0120530 | 3300035695 | Bacteria | 1712 |
| 640 | Ga0373933_0000854 | 3300035724 | Bacteria | 18658 |
| 641 | Ga0373933_0026149 | 3300035724 | Bacteria | 3350 |
| 642 | Ga0373933_0037070 | 3300035724 | Bacteria | 2858 |
| 643 | Ga0373947_0002539 | 3300035725 | Bacteria | 10968 |
| 644 | Ga0373947_0073408 | 3300035725 | Bacteria | 2102 |
| 645 | Ga0373947_0131084 | 3300035725 | Bacteria | 1600 |
| 646 | Ga0373937_0001913 | 3300036401 | Bacteria | 17462 |
| 647 | Ga0373937_0007560 | 3300036401 | Bacteria | 9411 |
| 648 | Ga0373937_0008336 | 3300036401 | Bacteria | 8997 |
| 649 | Ga0373937_0015349 | 3300036401 | Bacteria | 6774 |
| 650 | Ga0373937_0030040 | 3300036401 | Bacteria | 4922 |
| 651 | Ga0373937_0088814 | 3300036401 | Bacteria | 2861 |
| 652 | Ga0373937_0153916 | 3300036401 | Bacteria | 2154 |
| 653 | Ga0373937_0196590 | 3300036401 | Bacteria | 1895 |
| 654 | Ga0265778_000007 | 3300036457 | Bacteria | 9953 |
| 655 | Ga0372808_002133 | 3300036459 | Bacteria | 2225 |
| 656 | Ga0316584_0054667 | 3300036712 | Bacteria | 2988 |
| 657 | Ga0373925_0000869 | 3300037068 | Bacteria | 27621 |
| 658 | Ga0373925_0028545 | 3300037068 | Bacteria | 4088 |
| 659 | Ga0373925_0034287 | 3300037068 | Bacteria | 3740 |
| 660 | Ga0373925_0209813 | 3300037068 | Bacteria | 1551 |
| 661 | Ga0395899_0174576 | 3300037312 | Bacteria | 1512 |
| 662 | Ga0395900_0039304 | 3300037418 | Bacteria | 4874 |
| 663 | Ga0395898_0019375 | 3300037466 | Bacteria | 6926 |
| 664 | Ga0395898_0032423 | 3300037466 | Bacteria | 5215 |
| 665 | Ga0395898_0052314 | 3300037466 | Bacteria | 3990 |
| 666 | Ga0395898_0293817 | 3300037466 | Bacteria | 1550 |
| 667 | Ga0395905_0091434 | 3300037471 | Bacteria | 2853 |
| 668 | Ga0395905_0188583 | 3300037471 | Bacteria | 1935 |
| 669 | Ga0395901_0014296 | 3300038443 | Bacteria | 8080 |
| 670 | Ga0395901_0096320 | 3300038443 | Bacteria | 3101 |
| 671 | Ga0436365_1230062 | 3300039437 | Bacteria | 1937 |
| 672 | Ga0436365_1898856 | 3300039437 | Bacteria | 3803 |
| 673 | Ga0436360_0222705 | 3300039438 | Bacteria | 5140 |
| 674 | Ga0436360_0719502 | 3300039438 | Bacteria | 1863 |
| 675 | Ga0436361_0205689 | 3300039447 | Bacteria | 9447 |
| 676 | Ga0436361_0307959 | 3300039447 | Bacteria | 2434 |
| 677 | Ga0436361_0580165 | 3300039447 | Bacteria | 2381 |
| 678 | Ga0436361_0853489 | 3300039447 | Bacteria | 4342 |
| 679 | Ga0436361_1029785 | 3300039447 | Bacteria | 1492 |
| 680 | Ga0436362_1149665 | 3300039453 | Bacteria | 3507 |
| 681 | Ga0439448_0001781 | 3300042005 | Bacteria | 5690 |
| 682 | Ga0439450_001151 | 3300042008 | Bacteria | 3771 |
| 683 | Ga0439451_016545 | 3300042009 | Bacteria | 1485 |
| 684 | Ga0439455_0002594 | 3300042012 | Bacteria | 3314 |
| 685 | Ga0439463_001008 | 3300042016 | Bacteria | 7656 |
| 686 | Ga0439463_009931 | 3300042016 | Bacteria | 2338 |
| 687 | Ga0450900_000328 | 3300042136 | Bacteria | 3475 |
| 688 | Ga0450902_008546 | 3300042137 | Bacteria | 1600 |
| 689 | Ga0450889_002495 | 3300042144 | Bacteria | 1832 |
| 690 | Ga0439444_0008787 | 3300042437 | Bacteria | 1579 |
| 691 | Ga0439464_0005753 | 3300042439 | Bacteria | 3215 |
| 692 | Ga0439464_0009910 | 3300042439 | Bacteria | 2513 |
| 693 | Ga0439460_0000927 | 3300042461 | Bacteria | 6697 |
| 694 | Ga0450916_001828 | 3300042530 | Bacteria | 2179 |
| 695 | Ga0439440_0003827 | 3300042993 | Bacteria | 2926 |
| 696 | Ga0466966_0000534 | 3300044684 | Bacteria | 24194 |
| 697 | Ga0466966_0163931 | 3300044684 | Bacteria | 1353 |
| 698 | Ga0466963_0034599 | 3300044694 | Bacteria | 3288 |
| 699 | Ga0453684_0006843 | 3300044712 | Bacteria | 21422 |
| 700 | Ga0466968_0000051 | 3300044735 | Bacteria | 33313 |
| 701 | Ga0466970_0000145 | 3300044765 | Bacteria | 32723 |
| 702 | Ga0466960_0007565 | 3300044901 | Bacteria | 4421 |
| 703 | Ga0466959_0005687 | 3300045049 | Bacteria | 8579 |
| 704 | Ga0466967_0001263 | 3300045976 | Bacteria | 14323 |
| 705 | Ga0466967_0185741 | 3300045976 | Bacteria | 1963 |
| 706 | Ga0495592_0002119 | 3300046454 | Bacteria | 13990 |
| 707 | Ga0495592_0010184 | 3300046454 | Bacteria | 7088 |
| 708 | Ga0495592_0012972 | 3300046454 | Bacteria | 6336 |
| 709 | Ga0495592_0047568 | 3300046454 | Bacteria | 3194 |
| 710 | Ga0495592_0095779 | 3300046454 | Bacteria | 2122 |
| 711 | Ga0495603_0002266 | 3300046455 | Bacteria | 11301 |
| 712 | Ga0495603_0094739 | 3300046455 | Bacteria | 1744 |
| 713 | Ga0495629_0008928 | 3300046459 | Bacteria | 7367 |
| 714 | Ga0495629_0011741 | 3300046459 | Bacteria | 6356 |
| 715 | Ga0495629_0031412 | 3300046459 | Bacteria | 3761 |
| 716 | Ga0495629_0031757 | 3300046459 | Bacteria | 3738 |
| 717 | Ga0495629_0083961 | 3300046459 | Bacteria | 2222 |
| 718 | Ga0495641_0008808 | 3300046461 | Bacteria | 6083 |
| 719 | Ga0495641_0010516 | 3300046461 | Bacteria | 5356 |
| 720 | Ga0495651_0009790 | 3300046462 | Bacteria | 7369 |
| 721 | Ga0495651_0014394 | 3300046462 | Bacteria | 6116 |
| 722 | Ga0495651_0064429 | 3300046462 | Bacteria | 2800 |
| 723 | Ga0495651_0076597 | 3300046462 | Bacteria | 2533 |
| 724 | Ga0495653_0003405 | 3300046463 | Bacteria | 12788 |
| 725 | Ga0495653_0016515 | 3300046463 | Bacteria | 6007 |
| 726 | Ga0495653_0043519 | 3300046463 | Bacteria | 3490 |
| 727 | Ga0495653_0047476 | 3300046463 | Bacteria | 3320 |
| 728 | Ga0495580_0004777 | 3300046472 | Bacteria | 11344 |
| 729 | Ga0495580_0041389 | 3300046472 | Bacteria | 3286 |
| 730 | Ga0495580_0111240 | 3300046472 | Bacteria | 1902 |
| 731 | Ga0495582_0000536 | 3300046473 | Bacteria | 20990 |
| 732 | Ga0495582_0001255 | 3300046473 | Bacteria | 14251 |
| 733 | Ga0495582_0008463 | 3300046473 | Bacteria | 5677 |
| 734 | Ga0495639_0001015 | 3300046475 | Bacteria | 12686 |
| 735 | Ga0495639_0042115 | 3300046475 | Bacteria | 2058 |
| 736 | Ga0495662_0004058 | 3300046476 | Bacteria | 7373 |
| 737 | Ga0495662_0079583 | 3300046476 | Bacteria | 1593 |
| 738 | Ga0495662_0086297 | 3300046476 | Bacteria | 1528 |
| 739 | Ga0495662_0092494 | 3300046476 | Bacteria | 1475 |
| 740 | Ga0495664_0015963 | 3300046477 | Bacteria | 4275 |
| 741 | Ga0495664_0036687 | 3300046477 | Bacteria | 2890 |
| 742 | Ga0495664_0089973 | 3300046477 | Bacteria | 1845 |
| 743 | Ga0495664_0093351 | 3300046477 | Bacteria | 1810 |
| 744 | Ga0495664_0107382 | 3300046477 | Bacteria | 1684 |
| 745 | Ga0495664_0157137 | 3300046477 | Bacteria | 1379 |
| 746 | Ga0495594_0008942 | 3300046499 | Bacteria | 5166 |
| 747 | Ga0495594_0053399 | 3300046499 | Bacteria | 2226 |
| 748 | Ga0495594_0111578 | 3300046499 | Bacteria | 1542 |
| 749 | Ga0495608_0003487 | 3300046511 | Bacteria | 11269 |
| 750 | Ga0495608_0004902 | 3300046511 | Bacteria | 9584 |
| 751 | Ga0495608_0051980 | 3300046511 | Bacteria | 2713 |
| 752 | Ga0495618_0030451 | 3300046514 | Bacteria | 3370 |
| 753 | Ga0495618_0034809 | 3300046514 | Bacteria | 3160 |
| 754 | Ga0495618_0040635 | 3300046514 | Bacteria | 2928 |
| 755 | Ga0495618_0048715 | 3300046514 | Bacteria | 2675 |
| 756 | Ga0495628_0010355 | 3300046516 | Bacteria | 7927 |
| 757 | Ga0495628_0035440 | 3300046516 | Bacteria | 4009 |
| 758 | Ga0495628_0035856 | 3300046516 | Bacteria | 3984 |
| 759 | Ga0495628_0115295 | 3300046516 | Bacteria | 2063 |
| 760 | Ga0495628_0135642 | 3300046516 | Bacteria | 1881 |
| 761 | Ga0495630_0006459 | 3300046517 | Bacteria | 8340 |
| 762 | Ga0495630_0014692 | 3300046517 | Bacteria | 5708 |
| 763 | Ga0495630_0109647 | 3300046517 | Bacteria | 2091 |
| 764 | Ga0495630_0118557 | 3300046517 | Bacteria | 2007 |
| 765 | Ga0495630_0180198 | 3300046517 | Bacteria | 1611 |
| 766 | Ga0495643_0020603 | 3300046522 | Bacteria | 3799 |
| 767 | Ga0495644_0013632 | 3300046523 | Bacteria | 3118 |
| 768 | Ga0495666_0047792 | 3300046526 | Bacteria | 2061 |
| 769 | Ga0495652_0004055 | 3300046529 | Bacteria | 14167 |
| 770 | Ga0495652_0054627 | 3300046529 | Bacteria | 3400 |
| 771 | Ga0495652_0093207 | 3300046529 | Bacteria | 2459 |
| 772 | Ga0495652_0184911 | 3300046529 | Bacteria | 1595 |
| 773 | Ga0495665_0003367 | 3300046531 | Bacteria | 8673 |
| 774 | Ga0495665_0016041 | 3300046531 | Bacteria | 4036 |
| 775 | Ga0495665_0062331 | 3300046531 | Bacteria | 1969 |
| 776 | Ga0495640_0013323 | 3300046533 | Bacteria | 6248 |
| 777 | Ga0495640_0042191 | 3300046533 | Bacteria | 3185 |
| 778 | Ga0495640_0047253 | 3300046533 | Bacteria | 2979 |
| 779 | Ga0495640_0067064 | 3300046533 | Bacteria | 2418 |
| 780 | Ga0495640_0112769 | 3300046533 | Bacteria | 1775 |
| 781 | Ga0495586_0002083 | 3300046535 | Bacteria | 10863 |
| 782 | Ga0495586_0062475 | 3300046535 | Bacteria | 2028 |
| 783 | Ga0495587_0004565 | 3300046536 | Bacteria | 9091 |
| 784 | Ga0495587_0006283 | 3300046536 | Bacteria | 7755 |
| 785 | Ga0495587_0008558 | 3300046536 | Bacteria | 6574 |
| 786 | Ga0495587_0016759 | 3300046536 | Bacteria | 4557 |
| 787 | Ga0495587_0071990 | 3300046536 | Bacteria | 2010 |
| 788 | Ga0495587_0080681 | 3300046536 | Bacteria | 1885 |
| 789 | Ga0495587_0109919 | 3300046536 | Bacteria | 1584 |
| 790 | Ga0495621_0000668 | 3300046539 | Bacteria | 8679 |
| 791 | Ga0495645_0005550 | 3300046543 | Bacteria | 8674 |
| 792 | Ga0495645_0065202 | 3300046543 | Bacteria | 2634 |
| 793 | Ga0495645_0217835 | 3300046543 | Bacteria | 1285 |
| 794 | Ga0495667_0004820 | 3300046559 | Bacteria | 9122 |
| 795 | Ga0495667_0009073 | 3300046559 | Bacteria | 6756 |
| 796 | Ga0495667_0011788 | 3300046559 | Bacteria | 5922 |
| 797 | Ga0495667_0025257 | 3300046559 | Bacteria | 4004 |
| 798 | Ga0495667_0033311 | 3300046559 | Bacteria | 3448 |
| 799 | Ga0495667_0042427 | 3300046559 | Bacteria | 3016 |
| 800 | Ga0495656_0009549 | 3300046615 | Bacteria | 3491 |
| 801 | Ga0495634_0012637 | 3300046642 | Bacteria | 6112 |
| 802 | Ga0495634_0027359 | 3300046642 | Bacteria | 3967 |
| 803 | Ga0495634_0046758 | 3300046642 | Bacteria | 2919 |
| 804 | Ga0495634_0142152 | 3300046642 | Bacteria | 1523 |
| 805 | Ga0495635_0006479 | 3300046663 | Bacteria | 8163 |
| 806 | Ga0495635_0009118 | 3300046663 | Bacteria | 6928 |
| 807 | Ga0495635_0044956 | 3300046663 | Bacteria | 3046 |
| 808 | Ga0495635_0120874 | 3300046663 | Bacteria | 1786 |
| 809 | Ga0495588_0076889 | 3300046674 | Bacteria | 1740 |
| 810 | Ga0495657_0002732 | 3300046675 | Bacteria | 14736 |
| 811 | Ga0495657_0009416 | 3300046675 | Bacteria | 7401 |
| 812 | Ga0495657_0012539 | 3300046675 | Bacteria | 6294 |
| 813 | Ga0495657_0012802 | 3300046675 | Bacteria | 6218 |
| 814 | Ga0495657_0126266 | 3300046675 | Bacteria | 1606 |
| 815 | Ga0495599_0007604 | 3300046678 | Bacteria | 6580 |
| 816 | Ga0495599_0032079 | 3300046678 | Bacteria | 3297 |
| 817 | Ga0495599_0176278 | 3300046678 | Bacteria | 1318 |
| 818 | Ga0495623_0008288 | 3300046679 | Bacteria | 6761 |
| 819 | Ga0495623_0012823 | 3300046679 | Bacteria | 5427 |
| 820 | Ga0495623_0066509 | 3300046679 | Bacteria | 2252 |
| 821 | Ga0495623_0131260 | 3300046679 | Bacteria | 1500 |
| 822 | Ga0495646_0009568 | 3300046680 | Bacteria | 6152 |
| 823 | Ga0495646_0033982 | 3300046680 | Bacteria | 3169 |
| 824 | Ga0495646_0053104 | 3300046680 | Bacteria | 2445 |
| 825 | Ga0495646_0103895 | 3300046680 | Bacteria | 1625 |
| 826 | Ga0495646_0129034 | 3300046680 | Bacteria | 1425 |
| 827 | Ga0495647_0004826 | 3300046681 | Bacteria | 4404 |
| 828 | Ga0495658_0001474 | 3300046683 | Bacteria | 12390 |
| 829 | Ga0495658_0002104 | 3300046683 | Bacteria | 10106 |
| 830 | Ga0495658_0045920 | 3300046683 | Bacteria | 2453 |
| 831 | Ga0495658_0194870 | 3300046683 | Bacteria | 1261 |
| 832 | Ga0495669_0093725 | 3300046684 | Bacteria | 1389 |
| 833 | Ga0495613_0000840 | 3300046689 | Bacteria | 23716 |
| 834 | Ga0495613_0006946 | 3300046689 | Bacteria | 8443 |
| 835 | Ga0495613_0109995 | 3300046689 | Bacteria | 1986 |
| 836 | Ga0495613_0280924 | 3300046689 | Bacteria | 1156 |
| 837 | Ga0495624_0003774 | 3300046690 | Bacteria | 11195 |
| 838 | Ga0495649_0017660 | 3300046694 | Bacteria | 4023 |
| 839 | Ga0495600_0001383 | 3300046809 | Bacteria | 13395 |
| 840 | Ga0495600_0078395 | 3300046809 | Bacteria | 2157 |
| 841 | Ga0495600_0088245 | 3300046809 | Bacteria | 2023 |
| 842 | Ga0495600_0110888 | 3300046809 | Bacteria | 1786 |
| 843 | Ga0495581_0000209 | 3300047315 | Bacteria | 27473 |
| 844 | Ga0495581_0084276 | 3300047315 | Bacteria | 1841 |
| 845 | Ga0495604_0002821 | 3300047317 | Bacteria | 13952 |
| 846 | Ga0495604_0019973 | 3300047317 | Bacteria | 5355 |
| 847 | Ga0495674_0009446 | 3300047319 | Bacteria | 9265 |
| 848 | Ga0495674_0010298 | 3300047319 | Bacteria | 8851 |
| 849 | Ga0495674_0024366 | 3300047319 | Bacteria | 5560 |
| 850 | Ga0495674_0036552 | 3300047319 | Bacteria | 4419 |
| 851 | Ga0495674_0047397 | 3300047319 | Bacteria | 3811 |
| 852 | Ga0495674_0139126 | 3300047319 | Bacteria | 2041 |
| 853 | Ga0495674_0212130 | 3300047319 | Bacteria | 1603 |
| 854 | Ga0495676_0037058 | 3300047321 | Bacteria | 4064 |
| 855 | Ga0495676_0079611 | 3300047321 | Bacteria | 2490 |
| 856 | Ga0495676_0115250 | 3300047321 | Bacteria | 1965 |
| 857 | Ga0495680_0022116 | 3300047322 | Bacteria | 5309 |
| 858 | Ga0495680_0030646 | 3300047322 | Bacteria | 4389 |
| 859 | Ga0495680_0036158 | 3300047322 | Bacteria | 3968 |
| 860 | Ga0495680_0058858 | 3300047322 | Bacteria | 2967 |
| 861 | Ga0495680_0078156 | 3300047322 | Bacteria | 2504 |
| 862 | Ga0495687_022905 | 3300047443 | Bacteria | 2992 |
| 863 | Ga0495675_0004359 | 3300047444 | Bacteria | 8565 |
| 864 | Ga0495675_0010020 | 3300047444 | Bacteria | 5911 |
| 865 | Ga0495675_0022000 | 3300047444 | Bacteria | 4063 |
| 866 | Ga0495684_0011406 | 3300047471 | Bacteria | 6860 |
| 867 | Ga0495684_0033402 | 3300047471 | Bacteria | 3945 |
| 868 | Ga0495684_0093547 | 3300047471 | Bacteria | 2276 |
| 869 | Ga0495684_0097985 | 3300047471 | Bacteria | 2217 |
| 870 | Ga0495684_0169026 | 3300047471 | Bacteria | 1627 |
| 871 | Ga0495593_0000634 | 3300047673 | Bacteria | 20135 |
| 872 | Ga0495593_0001668 | 3300047673 | Bacteria | 13143 |
| 873 | Ga0495593_0003465 | 3300047673 | Bacteria | 9448 |
| 874 | Ga0495602_0057706 | 3300048088 | Bacteria | 3403 |
| 875 | Ga0495614_0002707 | 3300048089 | Bacteria | 7877 |
| 876 | Ga0496100_0007149 | 3300048903 | Bacteria | 6133 |
| 877 | Ga0496100_0020028 | 3300048903 | Bacteria | 4004 |
| 878 | Ga0496100_0062007 | 3300048903 | Bacteria | 2466 |
| 879 | Ga0496101_0008502 | 3300048904 | Bacteria | 6709 |
| 880 | Ga0496101_0019854 | 3300048904 | Bacteria | 4595 |
| 881 | Ga0496101_0077755 | 3300048904 | Bacteria | 2446 |
| 882 | Ga0496102_0012490 | 3300048905 | Bacteria | 7352 |
| 883 | Ga0496102_0020673 | 3300048905 | Bacteria | 5816 |
| 884 | Ga0496102_0027502 | 3300048905 | Bacteria | 5079 |
| 885 | Ga0496102_0051532 | 3300048905 | Bacteria | 3749 |
| 886 | Ga0496103_0128150 | 3300048906 | Bacteria | 1619 |
| 887 | Ga0496104_0002664 | 3300048907 | Bacteria | 15367 |
| 888 | Ga0496104_0020773 | 3300048907 | Bacteria | 6022 |
| 889 | Ga0496104_0034266 | 3300048907 | Bacteria | 4732 |
| 890 | Ga0496104_0109899 | 3300048907 | Bacteria | 2642 |
| 891 | Ga0496104_0146741 | 3300048907 | Bacteria | 2265 |
| 892 | Ga0496105_0005131 | 3300048908 | Bacteria | 9931 |
| 893 | Ga0496105_0024231 | 3300048908 | Bacteria | 4931 |
| 894 | Ga0496105_0025592 | 3300048908 | Bacteria | 4806 |
| 895 | Ga0496105_0033976 | 3300048908 | Bacteria | 4192 |
| 896 | Ga0496106_0019124 | 3300048909 | Bacteria | 5077 |
| 897 | Ga0496107_0002076 | 3300048910 | Bacteria | 12817 |
| 898 | Ga0496107_0009665 | 3300048910 | Bacteria | 6689 |
| 899 | Ga0496107_0014299 | 3300048910 | Bacteria | 5558 |
| 900 | Ga0496107_0033993 | 3300048910 | Bacteria | 3649 |
| 901 | Ga0496108_0000786 | 3300048911 | Bacteria | 24786 |
| 902 | Ga0496108_0002623 | 3300048911 | Bacteria | 14403 |
| 903 | Ga0496108_0056527 | 3300048911 | Bacteria | 3297 |
| 904 | Ga0496108_0067234 | 3300048911 | Bacteria | 3022 |
| 905 | Ga0496109_0002909 | 3300048912 | Bacteria | 14302 |
| 906 | Ga0496109_0004480 | 3300048912 | Bacteria | 11670 |
| 907 | Ga0496109_0004797 | 3300048912 | Bacteria | 11290 |
| 908 | Ga0496109_0020072 | 3300048912 | Bacteria | 5903 |
| 909 | Ga0496109_0110128 | 3300048912 | Bacteria | 2560 |
| 910 | Ga0496110_0005737 | 3300048913 | Bacteria | 9753 |
| 911 | Ga0496110_0007789 | 3300048913 | Bacteria | 8582 |
| 912 | Ga0496110_0010326 | 3300048913 | Bacteria | 7589 |
| 913 | Ga0496110_0014367 | 3300048913 | Bacteria | 6572 |
| 914 | Ga0496110_0049778 | 3300048913 | Bacteria | 3678 |
| 915 | Ga0496110_0127338 | 3300048913 | Bacteria | 2298 |
| 916 | Ga0496111_0001855 | 3300048914 | Bacteria | 12475 |
| 917 | Ga0496111_0109282 | 3300048914 | Bacteria | 2036 |
| 918 | Ga0496112_0001692 | 3300048915 | Bacteria | 17195 |
| 919 | Ga0496112_0023845 | 3300048915 | Bacteria | 5852 |
| 920 | Ga0496112_0034665 | 3300048915 | Bacteria | 4912 |
| 921 | Ga0496112_0059823 | 3300048915 | Bacteria | 3754 |
| 922 | Ga0496112_0139807 | 3300048915 | Bacteria | 2391 |
| 923 | Ga0496112_0151318 | 3300048915 | Bacteria | 2287 |
| 924 | Ga0496112_0296627 | 3300048915 | Bacteria | 1562 |
| 925 | Ga0496113_0033150 | 3300048916 | Bacteria | 3758 |
| 926 | Ga0496114_0002209 | 3300048917 | Bacteria | 14816 |
| 927 | Ga0496114_0016971 | 3300048917 | Bacteria | 5871 |
| 928 | Ga0496114_0033382 | 3300048917 | Bacteria | 4240 |
| 929 | Ga0496114_0040261 | 3300048917 | Bacteria | 3868 |
| 930 | Ga0496114_0081356 | 3300048917 | Bacteria | 2736 |
| 931 | Ga0496114_0100489 | 3300048917 | Bacteria | 2468 |
| 932 | Ga0496114_0101532 | 3300048917 | Bacteria | 2456 |
| 933 | Ga0496115_0006191 | 3300048918 | Bacteria | 8750 |
| 934 | Ga0496115_0008704 | 3300048918 | Bacteria | 7520 |
| 935 | Ga0496115_0051089 | 3300048918 | Bacteria | 3314 |
| 936 | Ga0496115_0112335 | 3300048918 | Bacteria | 2238 |
| 937 | Ga0496115_0213793 | 3300048918 | Bacteria | 1592 |
| 938 | Ga0496122_0003944 | 3300048925 | Bacteria | 18967 |
| 939 | Ga0496124_0018040 | 3300048927 | Bacteria | 6626 |
| 940 | Ga0496125_0047816 | 3300048928 | Bacteria | 3573 |
| 941 | Ga0496126_0033887 | 3300048929 | Bacteria | 4803 |
| 942 | Ga0501031_0011848 | 3300049568 | Bacteria | 5685 |
| 943 | Ga0501032_0022546 | 3300049569 | Bacteria | 4364 |
| 944 | Ga0501032_0025238 | 3300049569 | Bacteria | 4098 |
| 945 | Ga0501032_0145785 | 3300049569 | Bacteria | 1558 |
| 946 | Ga0501033_0005281 | 3300049570 | Bacteria | 10249 |
| 947 | Ga0501033_0050194 | 3300049570 | Bacteria | 3096 |
| 948 | Ga0501034_0071110 | 3300049571 | Bacteria | 3489 |
| 949 | Ga0501036_0027922 | 3300049572 | Bacteria | 4771 |
| 950 | Ga0501036_0088396 | 3300049572 | Bacteria | 2618 |
| 951 | Ga0501037_0029447 | 3300049573 | Bacteria | 4056 |
| 952 | Ga0501037_0081480 | 3300049573 | Bacteria | 2346 |
| 953 | Ga0501038_0023010 | 3300049574 | Bacteria | 5577 |
| 954 | Ga0501038_0028803 | 3300049574 | Bacteria | 4930 |
| 955 | Ga0501039_0108429 | 3300049575 | Bacteria | 2170 |
| 956 | Ga0501039_0212145 | 3300049575 | Bacteria | 1522 |
| 957 | Ga0501040_0000570 | 3300049576 | Bacteria | 22410 |
| 958 | Ga0501040_0001391 | 3300049576 | Bacteria | 15288 |
| 959 | Ga0501040_0001418 | 3300049576 | Bacteria | 15169 |
| 960 | Ga0501040_0062969 | 3300049576 | Bacteria | 2551 |
| 961 | Ga0501041_0001215 | 3300049577 | Bacteria | 14104 |
| 962 | Ga0501041_0002366 | 3300049577 | Bacteria | 10666 |
| 963 | Ga0501042_0001159 | 3300049578 | Bacteria | 15254 |
| 964 | Ga0501042_0001598 | 3300049578 | Bacteria | 13470 |
| 965 | Ga0501042_0002297 | 3300049578 | Bacteria | 11682 |
| 966 | Ga0501042_0037251 | 3300049578 | Bacteria | 3452 |
| 967 | Ga0501042_0082308 | 3300049578 | Bacteria | 2307 |
| 968 | Ga0501046_0000396 | 3300049580 | Bacteria | 43570 |
| 969 | Ga0501046_0007849 | 3300049580 | Bacteria | 9362 |
| 970 | Ga0501046_0024827 | 3300049580 | Bacteria | 4911 |
| 971 | Ga0501047_0101967 | 3300049581 | Bacteria | 2749 |
| 972 | Ga0501048_0001242 | 3300049582 | Bacteria | 19324 |
| 973 | Ga0501048_0002400 | 3300049582 | Bacteria | 14301 |
| 974 | Ga0501048_0046074 | 3300049582 | Bacteria | 3113 |
| 975 | Ga0501067_0020129 | 3300049583 | Bacteria | 3691 |
| 976 | Ga0501068_0022430 | 3300049584 | Bacteria | 3692 |
| 977 | Ga0501068_0023400 | 3300049584 | Bacteria | 3620 |
| 978 | Ga0501069_0011648 | 3300049585 | Bacteria | 4662 |
| 979 | Ga0501069_0069482 | 3300049585 | Bacteria | 1972 |
| 980 | Ga0501070_0072526 | 3300049586 | Bacteria | 2850 |
| 981 | Ga0501070_0253546 | 3300049586 | Bacteria | 1439 |
| 982 | Ga0501071_0000152 | 3300049587 | Bacteria | 29111 |
| 983 | Ga0501071_0002241 | 3300049587 | Bacteria | 11634 |
| 984 | Ga0501071_0029120 | 3300049587 | Bacteria | 3896 |
| 985 | Ga0501072_0041514 | 3300049588 | Bacteria | 3613 |
| 986 | Ga0501074_0001225 | 3300049590 | Bacteria | 16923 |
| 987 | Ga0501074_0018847 | 3300049590 | Bacteria | 5013 |
| 988 | Ga0501074_0029196 | 3300049590 | Bacteria | 3994 |
| 989 | Ga0501074_0203659 | 3300049590 | Bacteria | 1410 |
| 990 | Ga0501075_0004720 | 3300049591 | Bacteria | 9256 |
| 991 | Ga0501075_0168631 | 3300049591 | Bacteria | 1670 |
| 992 | Ga0501076_0000023 | 3300049592 | Bacteria | 79158 |
| 993 | Ga0501076_0001652 | 3300049592 | Bacteria | 15059 |
| 994 | Ga0501077_0000791 | 3300049593 | Bacteria | 19142 |
| 995 | Ga0501077_0004544 | 3300049593 | Bacteria | 8439 |
| 996 | Ga0501209_000142 | 3300049656 | Bacteria | 7841 |
| 997 | Ga0501079_0000965 | 3300049741 | Bacteria | 19814 |
| 998 | Ga0501079_0001325 | 3300049741 | Bacteria | 17399 |
| 999 | Ga0501080_0012624 | 3300049742 | Bacteria | 7745 |
| 1000 | Ga0501081_0000093 | 3300049743 | Bacteria | 36647 |
| 1001 | Ga0501081_0017812 | 3300049743 | Bacteria | 4708 |
| 1002 | Ga0501035_0005571 | 3300049822 | Bacteria | 11897 |
| 1003 | Ga0501035_0025017 | 3300049822 | Bacteria | 5474 |
| 1004 | Ga0501045_0004202 | 3300049824 | Bacteria | 9943 |
| 1005 | Ga0501045_0014414 | 3300049824 | Bacteria | 5601 |
| 1006 | nmdc:mga05p37_2303_c1 | 3300050507 | Bacteria | 22270 |
| 1007 | nmdc:mga05p37_28254_c1 | 3300050507 | Bacteria | 6839 |
| 1008 | nmdc:mga09592_1897_c1 | 3300050508 | Bacteria | 16816 |
| 1009 | nmdc:mga06r32_139786_c1 | 3300050510 | Bacteria | 2397 |
| 1010 | nmdc:mga06r32_7620_c1 | 3300050510 | Bacteria | 9735 |
| 1011 | nmdc:mga08y16_150663_c1 | 3300050511 | Bacteria | 2418 |
| 1012 | nmdc:mga08y16_25185_c1 | 3300050511 | Bacteria | 6275 |
| 1013 | nmdc:mga08y16_9552_c1 | 3300050511 | Bacteria | 10180 |
| 1014 | nmdc:mga0n895_33281_c1 | 3300050512 | Bacteria | 4953 |
| 1015 | nmdc:mga0rr50_13392_c1 | 3300050513 | Bacteria | 5338 |
| 1016 | nmdc:mga0rr50_193229_c1 | 3300050513 | Bacteria | 1669 |
| 1017 | nmdc:mga0rr50_36935_c1 | 3300050513 | Bacteria | 3522 |
| 1018 | nmdc:mga08x19_51552_c1 | 3300050514 | Bacteria | 2644 |
| 1019 | Ga0495601_0104335 | 3300053077 | Bacteria | 1832 |
| 1020 | Ga0495601_0165065 | 3300053077 | Bacteria | 1447 |
| 1021 | Ga0495612_0006742 | 3300053078 | Bacteria | 4703 |
| 1022 | Ga0495595_0004180 | 3300053084 | Bacteria | 5803 |
| 1023 | Ga0495595_0012620 | 3300053084 | Bacteria | 3555 |
| 1024 | Ga0495595_0035327 | 3300053084 | Bacteria | 2264 |
| 1025 | Ga0495595_0042863 | 3300053084 | Bacteria | 2074 |
| 1026 | Ga0495595_0113585 | 3300053084 | Bacteria | 1315 |
| 1027 | Ga0495619_0007849 | 3300053085 | Bacteria | 6751 |
| 1028 | Ga0495619_0128337 | 3300053085 | Bacteria | 1742 |
| 1029 | Ga0495619_0138708 | 3300053085 | Bacteria | 1673 |
| 1030 | Ga0500637_0098092 | 3300053178 | Bacteria | 1699 |
| 1031 | Ga0501084_0002417 | 3300054114 | Bacteria | 15019 |
| 1032 | Ga0501084_0005153 | 3300054114 | Bacteria | 10689 |
| 1033 | Ga0501084_0049612 | 3300054114 | Bacteria | 3514 |
| 1034 | Ga0590075_025356 | 3300059424 | Bacteria | 1490 |
| 1035 | Ga0501082_0000975 | 3300060353 | Bacteria | 25267 |
| 1036 | Ga0501082_0019602 | 3300060353 | Bacteria | 5833 |
| 1037 | Ga0501082_0051421 | 3300060353 | Bacteria | 3551 |
| 1038 | Ga0530510_0001613 | 3300061734 | Bacteria | 15226 |
| 1039 | Ga0530510_0048255 | 3300061734 | Bacteria | 3077 |
| 1040 | 2524612893 | 2524023250 | Bacteria | 5457705 |
| 1041 | 2600444412 | 2600254954 | Bacteria | 5100516 |
| 1042 | 2602011497 | 2600255389 | Bacteria | 5275336 |
| 1043 | 2672335624 | 2671180330 | Bacteria | 5521719 |
| 1044 | 2715501541 | 2713897090 | Bacteria | 3353799 |
| 1045 | 2738816431 | 2738541295 | Bacteria | 5730091 |
| 1046 | 2816865130 | 2816332186 | Bacteria | 5331395 |
| 1047 | 2823423528 | 2823421272 | Bacteria | 5372474 |
| 1048 | 2842316070 | 2842311132 | Bacteria | 6616990 |
| 1049 | 2842683998 | 2842682962 | Bacteria | 5589973 |
| 1050 | 2854911672 | 2854911287 | Bacteria | 5582813 |
| 1051 | 2855022012 | 2855020534 | Bacteria | 3204685 |
| 1052 | 2855732437 | 2855730933 | Bacteria | 7047938 |
| 1053 | 2855769145 | 2855767633 | Bacteria | 7049357 |
| 1054 | 2919503166 | 2919501602 | Bacteria | 5286340 |
| 1055 | 2926066263 | 2926063275 | Bacteria | 5285848 |
| 1056 | 2928512652 | 2928510474 | Bacteria | 4815308 |
| 1057 | 3006979859 | 3006978542 | Bacteria | 5328100 |
| 1058 | 8034964987 | 8034962539 | Bacteria | 4884839 |
| 1059 | 8055269901 | 8055266321 | Bacteria | 7999742 |
| 1060 | Ga0207700_10140313 | |||
| 1061 | Ga0070658_10003173 | |||
| 1062 | Ga0070658_10012163 | |||
| 1063 | Ga0070676_10050329 | |||
| 1064 | Ga0070676_10125612 | |||
| 1065 | Ga0070683_100069719 | |||
| 1066 | Ga0070690_100000648 | |||
| 1067 | Ga0070670_100009204 | |||
| 1068 | Ga0070670_100022569 | |||
| 1069 | Ga0070670_100170511 | |||
| 1070 | Ga0068869_100037864 | |||
| 1071 | Ga0068869_100042011 | |||
| 1072 | Ga0070666_10003020 | |||
| 1073 | Ga0070666_10031985 | |||
| 1074 | Ga0070666_10099532 | |||
| 1075 | Ga0068868_100020923 | |||
| 1076 | Ga0068868_100085499 | |||
| 1077 | Ga0068868_100088206 | |||
| 1078 | Ga0070660_100086836 | |||
| 1079 | Ga0070689_100199641 | |||
| 1080 | Ga0070661_100066556 | |||
| 1081 | Ga0070661_100202336 | |||
| 1082 | Ga0070668_100034095 | |||
| 1083 | Ga0070668_100081951 | |||
| 1084 | Ga0070668_100086025 | |||
| 1085 | Ga0070668_100091723 | |||
| 1086 | Ga0070668_100228364 | |||
| 1087 | Ga0070675_100036273 | |||
| 1088 | Ga0070671_100036449 | |||
| 1089 | Ga0070671_100106551 | |||
| 1090 | Ga0070674_100019344 | |||
| 1091 | Ga0070673_100000604 | |||
| 1092 | Ga0070673_100046222 | |||
| 1093 | Ga0070673_100154002 | |||
| 1094 | Ga0070688_100000230 | |||
| 1095 | Ga0070659_100057630 | |||
| 1096 | Ga0070667_100019458 | |||
| 1097 | Ga0070667_100030121 | |||
| 1098 | Ga0070667_100391404 | |||
| 1099 | Ga0070703_10013188 | |||
| 1100 | Ga0070709_10002201 | |||
| 1101 | Ga0070709_10022519 | |||
| 1102 | Ga0070709_10055658 | |||
| 1103 | Ga0070709_10108540 | |||
| 1104 | Ga0070709_10141510 | |||
| 1105 | Ga0070714_100016032 | |||
| 1106 | Ga0070714_100054491 | |||
| 1107 | Ga0070714_100130835 | |||
| 1108 | Ga0070713_100029261 | |||
| 1109 | Ga0070713_100039741 | |||
| 1110 | Ga0070713_100045854 | |||
| 1111 | Ga0070713_100121414 | |||
| 1112 | Ga0070713_100124046 | |||
| 1113 | Ga0070713_100262007 | |||
| 1114 | Ga0070710_10037126 | |||
| 1115 | Ga0070710_10091457 | |||
| 1116 | Ga0070710_10121500 | |||
| 1117 | Ga0070711_100002535 | |||
| 1118 | Ga0070711_100037365 | |||
| 1119 | Ga0070711_100044062 | |||
| 1120 | Ga0070711_100048645 | |||
| 1121 | Ga0070711_100054297 | |||
| 1122 | Ga0070711_100108511 | |||
| 1123 | Ga0070705_100142894 | |||
| 1124 | Ga0070700_100152340 | |||
| 1125 | Ga0070708_100004822 | |||
| 1126 | Ga0070708_100008096 | |||
| 1127 | Ga0070708_100014754 | |||
| 1128 | Ga0070708_100027188 | |||
| 1129 | Ga0070708_100100781 | |||
| 1130 | Ga0070708_100135621 | |||
| 1131 | Ga0070708_100201837 | |||
| 1132 | Ga0070708_100249665 | |||
| 1133 | Ga0070708_100351353 | |||
| 1134 | Ga0070663_100153871 | |||
| 1135 | Ga0070663_100228969 | |||
| 1136 | Ga0070678_100025004 | |||
| 1137 | Ga0070678_100096243 | |||
| 1138 | Ga0070678_100131606 | |||
| 1139 | Ga0070678_100271075 | |||
| 1140 | Ga0070662_100085804 | |||
| 1141 | Ga0070662_100086358 | |||
| 1142 | Ga0070662_100116431 | |||
| 1143 | Ga0070662_100155877 | |||
| 1144 | Ga0070681_10004191 | |||
| 1145 | Ga0068867_100032637 | |||
| 1146 | Ga0068867_100049701 | |||
| 1147 | Ga0068867_100074029 | |||
| 1148 | Ga0070685_10007741 | |||
| 1149 | Ga0070706_100016360 | |||
| 1150 | Ga0070706_100048123 | |||
| 1151 | Ga0070706_100092320 | |||
| 1152 | Ga0070706_100114186 | |||
| 1153 | Ga0070707_100032373 | |||
| 1154 | Ga0070707_100033526 | |||
| 1155 | Ga0070698_100001112 | |||
| 1156 | Ga0070698_100005059 | |||
| 1157 | Ga0070698_100068334 | |||
| 1158 | Ga0070698_100216452 | |||
| 1159 | Ga0070698_100338553 | |||
| 1160 | Ga0070699_100000638 | |||
| 1161 | Ga0070699_100193496 | |||
| 1162 | Ga0070699_100282907 | |||
| 1163 | Ga0070679_100001416 | |||
| 1164 | Ga0070684_100027283 | |||
| 1165 | Ga0070684_100029728 | |||
| 1166 | Ga0070684_100097331 | |||
| 1167 | Ga0070697_100013922 | |||
| 1168 | Ga0068853_100019539 | |||
| 1169 | Ga0068853_100060166 | |||
| 1170 | Ga0068853_100138292 | |||
| 1171 | Ga0068853_100148936 | |||
| 1172 | Ga0070672_100076164 | |||
| 1173 | Ga0070686_100019417 | |||
| 1174 | Ga0070686_100053032 | |||
| 1175 | Ga0070695_100045044 | |||
| 1176 | Ga0070693_100001260 | |||
| 1177 | Ga0070665_100003689 | |||
| 1178 | Ga0070665_100022665 | |||
| 1179 | Ga0070665_100028102 | |||
| 1180 | Ga0070665_100034065 | |||
| 1181 | Ga0070665_100058274 | |||
| 1182 | Ga0070665_100089939 | |||
| 1183 | Ga0070665_100116226 | |||
| 1184 | Ga0070704_100045252 | |||
| 1185 | Ga0070704_100081594 | |||
| 1186 | Ga0068855_100006280 | |||
| 1187 | Ga0068855_100027075 | |||
| 1188 | Ga0068855_100046098 | |||
| 1189 | Ga0068855_100047298 | |||
| 1190 | Ga0068855_100127109 | |||
| 1191 | Ga0070664_100057684 | |||
| 1192 | Ga0070664_100183347 | |||
| 1193 | Ga0068857_100013480 | |||
| 1194 | Ga0068857_100093504 | |||
| 1195 | Ga0068857_100179211 | |||
| 1196 | Ga0068857_100210786 | |||
| 1197 | Ga0068854_100010617 | |||
| 1198 | Ga0068854_100036106 | |||
| 1199 | Ga0068854_100140571 | |||
| 1200 | Ga0068856_100001773 | |||
| 1201 | Ga0068856_100008586 | |||
| 1202 | Ga0068856_100058166 | |||
| 1203 | Ga0068856_100071594 | |||
| 1204 | Ga0068856_100117000 | |||
| 1205 | Ga0068856_100140457 | |||
| 1206 | Ga0068856_100163592 | |||
| 1207 | Ga0068856_100175191 | |||
| 1208 | Ga0068856_100491259 | |||
| 1209 | Ga0070702_100024129 | |||
| 1210 | Ga0070702_100028220 | |||
| 1211 | Ga0070702_100092214 | |||
| 1212 | Ga0068852_100002392 | |||
| 1213 | Ga0068852_100018353 | |||
| 1214 | Ga0068852_100043681 | |||
| 1215 | Ga0068852_100045253 | |||
| 1216 | Ga0068852_100045282 | |||
| 1217 | Ga0068852_100056096 | |||
| 1218 | Ga0068852_100139986 | |||
| 1219 | Ga0068859_100000264 | |||
| 1220 | Ga0068859_100007343 | |||
| 1221 | Ga0068864_100000630 | |||
| 1222 | Ga0068864_100000916 | |||
| 1223 | Ga0068864_100205476 | |||
| 1224 | Ga0068864_100320527 | |||
| 1225 | Ga0068866_10001032 | |||
| 1226 | Ga0068866_10017537 | |||
| 1227 | Ga0068866_10049825 | |||
| 1228 | Ga0068866_10053414 | |||
| 1229 | Ga0068861_100017452 | |||
| 1230 | Ga0068861_100266143 | |||
| 1231 | Ga0068851_10002195 | |||
| 1232 | Ga0068851_10003831 | |||
| 1233 | Ga0068851_10096717 | |||
| 1234 | Ga0068870_10026698 | |||
| 1235 | Ga0068870_10033448 | |||
| 1236 | Ga0068870_10091307 | |||
| 1237 | Ga0068863_100000240 | |||
| 1238 | Ga0068863_100019096 | |||
| 1239 | Ga0068863_100053206 | |||
| 1240 | Ga0068863_100212676 | |||
| 1241 | Ga0068863_100248358 | |||
| 1242 | Ga0068863_100377271 | |||
| 1243 | Ga0068858_100000129 | |||
| 1244 | Ga0068858_100003332 | |||
| 1245 | Ga0068858_100011293 | |||
| 1246 | Ga0068858_100067432 | |||
| 1247 | Ga0068858_100111361 | |||
| 1248 | Ga0068858_100258962 | |||
| 1249 | Ga0068860_100040790 | |||
| 1250 | Ga0068860_100085877 | |||
| 1251 | Ga0068860_100137527 | |||
| 1252 | Ga0068862_100168452 | |||
| 1253 | Ga0068862_100189492 | |||
| 1254 | Ga0081455_10022970 | |||
| 1255 | Ga0081538_10001988 | |||
| 1256 | Ga0081538_10004043 | |||
| 1257 | Ga0081538_10009100 | |||
| 1258 | Ga0081538_10017764 | |||
| 1259 | Ga0081538_10020949 | |||
| 1260 | Ga0081540_1017515 | |||
| 1261 | Ga0081539_10035620 | |||
| 1262 | Ga0070717_10000530 | |||
| 1263 | Ga0070717_10010336 | |||
| 1264 | Ga0070717_10069079 | |||
| 1265 | Ga0070717_10114972 | |||
| 1266 | Ga0070717_10115091 | |||
| 1267 | Ga0070717_10133537 | |||
| 1268 | Ga0070715_10002782 | |||
| 1269 | Ga0070716_100002716 | |||
| 1270 | Ga0070716_100029723 | |||
| 1271 | Ga0070712_100000161 | |||
| 1272 | Ga0070712_100035711 | |||
| 1273 | Ga0070712_100073473 | |||
| 1274 | Ga0070712_100138512 | |||
| 1275 | Ga0070712_100199599 | |||
| 1276 | Ga0075427_10008670 | |||
| 1277 | Ga0097621_100032431 | |||
| 1278 | Ga0097621_100039710 | |||
| 1279 | Ga0097621_100061027 | |||
| 1280 | Ga0097621_100130011 | |||
| 1281 | Ga0068871_100017029 | |||
| 1282 | Ga0068871_100053357 | |||
| 1283 | Ga0075428_100002525 | |||
| 1284 | Ga0075428_100071418 | |||
| 1285 | Ga0075430_100001715 | |||
| 1286 | Ga0075431_100070688 | |||
| 1287 | Ga0075434_100094566 | |||
| 1288 | Ga0075429_100001213 | |||
| 1289 | Ga0068865_100022657 | |||
| 1290 | Ga0068865_100035012 | |||
| 1291 | Ga0068865_100042995 | |||
| 1292 | Ga0068865_100066363 | |||
| 1293 | Ga0097620_100000264 | |||
| 1294 | Ga0097620_100007342 | |||
| 1295 | Ga0075435_100093726 | |||
| 1296 | Ga0099795_10052005 | |||
| 1297 | Ga0105251_10008283 | |||
| 1298 | Ga0105250_10029359 | |||
| 1299 | Ga0105240_10001911 | |||
| 1300 | Ga0105240_10002523 | |||
| 1301 | Ga0105240_10012228 | |||
| 1302 | Ga0105240_10026921 | |||
| 1303 | Ga0105240_10264905 | |||
| 1304 | Ga0111539_10014360 | |||
| 1305 | Ga0111539_10149852 | |||
| 1306 | Ga0111539_10614523 | |||
| 1307 | Ga0105245_10006288 | |||
| 1308 | Ga0105245_10009844 | |||
| 1309 | Ga0105245_10027663 | |||
| 1310 | Ga0105245_10032121 | |||
| 1311 | Ga0105245_10038276 | |||
| 1312 | Ga0105245_10174497 | |||
| 1313 | Ga0105247_10062613 | |||
| 1314 | Ga0114129_10001051 | |||
| 1315 | Ga0114129_10127533 | |||
| 1316 | Ga0114129_10431620 | |||
| 1317 | Ga0105243_10015380 | |||
| 1318 | Ga0105243_10175011 | |||
| 1319 | Ga0105243_10284076 | |||
| 1320 | Ga0105241_10000094 | |||
| 1321 | Ga0105241_10006065 | |||
| 1322 | Ga0105241_10018097 | |||
| 1323 | Ga0105241_10033888 | |||
| 1324 | Ga0105241_10079456 | |||
| 1325 | Ga0105241_10181416 | |||
| 1326 | Ga0105242_10014026 | |||
| 1327 | Ga0105242_10048704 | |||
| 1328 | Ga0105242_10073795 | |||
| 1329 | Ga0105242_10157454 | |||
| 1330 | Ga0105242_10263595 | |||
| 1331 | Ga0105248_10002708 | |||
| 1332 | Ga0105248_10007990 | |||
| 1333 | Ga0105248_10065147 | |||
| 1334 | Ga0105248_10066092 | |||
| 1335 | Ga0105248_10088033 | |||
| 1336 | Ga0105248_10099583 | |||
| 1337 | Ga0105237_10046219 | |||
| 1338 | Ga0105237_10079538 | |||
| 1339 | Ga0105237_10089201 | |||
| 1340 | Ga0105238_10018589 | |||
| 1341 | Ga0105238_10020402 | |||
| 1342 | Ga0105238_10024383 | |||
| 1343 | Ga0105238_10049704 | |||
| 1344 | Ga0105238_10098503 | |||
| 1345 | Ga0105238_10102451 | |||
| 1346 | Ga0105249_10028536 | |||
| 1347 | Ga0105249_10090514 | |||
| 1348 | Ga0105249_10096795 | |||
| 1349 | Ga0105249_10103700 | |||
| 1350 | Ga0105239_10041497 | |||
| 1351 | Ga0105239_10069873 | |||
| 1352 | Ga0105239_10230953 | |||
| 1353 | Ga0105246_10003801 | |||
| 1354 | Ga0157373_10023623 | |||
| 1355 | Ga0157373_10045197 | |||
| 1356 | Ga0157370_10000551 | |||
| 1357 | Ga0157370_10017663 | |||
| 1358 | Ga0157370_10036946 | |||
| 1359 | Ga0157370_10057658 | |||
| 1360 | Ga0157369_10001019 | |||
| 1361 | Ga0157369_10006030 | |||
| 1362 | Ga0157369_10016591 | |||
| 1363 | Ga0157369_10055523 | |||
| 1364 | Ga0157369_10076809 | |||
| 1365 | Ga0157369_10376027 | |||
| 1366 | Ga0157374_10000954 | |||
| 1367 | Ga0157374_10003641 | |||
| 1368 | Ga0157374_10060855 | |||
| 1369 | Ga0157378_10006444 | |||
| 1370 | Ga0157378_10063542 | |||
| 1371 | Ga0157378_10075862 | |||
| 1372 | Ga0157378_10099811 | |||
| 1373 | Ga0157378_10145976 | |||
| 1374 | Ga0163162_10027172 | |||
| 1375 | Ga0163162_10068920 | |||
| 1376 | Ga0163162_10071314 | |||
| 1377 | Ga0157372_10006108 | |||
| 1378 | Ga0157372_10011236 | |||
| 1379 | Ga0157372_10020689 | |||
| 1380 | Ga0157372_10048987 | |||
| 1381 | Ga0157372_10067989 | |||
| 1382 | Ga0157372_10087368 | |||
| 1383 | Ga0157372_10096041 | |||
| 1384 | Ga0157372_10458244 | |||
| 1385 | Ga0157375_10001655 | |||
| 1386 | Ga0157375_10004421 | |||
| 1387 | Ga0157375_10053196 | |||
| 1388 | Ga0163163_10000225 | |||
| 1389 | Ga0163163_10132844 | |||
| 1390 | Ga0163163_10341038 | |||
| 1391 | Ga0157379_10003294 | |||
| 1392 | Ga0157379_10026897 | |||
| 1393 | Ga0157379_10047019 | |||
| 1394 | Ga0157379_10072622 | |||
| 1395 | Ga0157379_10114486 | |||
| 1396 | Ga0157379_10125137 | |||
| 1397 | Ga0157376_10018409 | |||
| 1398 | Ga0157376_10035017 | |||
| 1399 | Ga0157376_10128173 | |||
| 1400 | Ga0163161_10113324 | |||
| 1401 | Ga0206355_1391959 | |||
| 1402 | Ga0206350_10152870 | |||
| 1403 | Ga0213872_10025029 | |||
| 1404 | Ga0213871_10009684 | |||
| 1405 | Ga0207697_10005630 | |||
| 1406 | Ga0207656_10019285 | |||
| 1407 | Ga0207696_1025290 | |||
| 1408 | Ga0207713_1008998 | |||
| 1409 | Ga0207653_10024132 | |||
| 1410 | Ga0207653_10031132 | |||
| 1411 | Ga0207692_10008893 | |||
| 1412 | Ga0207692_10022568 | |||
| 1413 | Ga0207692_10024933 | |||
| 1414 | Ga0207692_10026630 | |||
| 1415 | Ga0207692_10082462 | |||
| 1416 | Ga0207642_10004460 | |||
| 1417 | Ga0207642_10022014 | |||
| 1418 | Ga0207710_10007412 | |||
| 1419 | Ga0207710_10007994 | |||
| 1420 | Ga0207688_10028983 | |||
| 1421 | Ga0207688_10029464 | |||
| 1422 | Ga0207688_10161289 | |||
| 1423 | Ga0207680_10002108 | |||
| 1424 | Ga0207680_10017243 | |||
| 1425 | Ga0207647_10010170 | |||
| 1426 | Ga0207685_10016482 | |||
| 1427 | Ga0207699_10014332 | |||
| 1428 | Ga0207699_10033666 | |||
| 1429 | Ga0207699_10038038 | |||
| 1430 | Ga0207699_10049263 | |||
| 1431 | Ga0207699_10110833 | |||
| 1432 | Ga0207645_10007748 | |||
| 1433 | Ga0207645_10009954 | |||
| 1434 | Ga0207643_10012717 | |||
| 1435 | Ga0207705_10073328 | |||
| 1436 | Ga0207684_10000954 | |||
| 1437 | Ga0207684_10005728 | |||
| 1438 | Ga0207684_10006890 | |||
| 1439 | Ga0207684_10013877 | |||
| 1440 | Ga0207684_10063832 | |||
| 1441 | Ga0207654_10000055 | |||
| 1442 | Ga0207654_10020137 | |||
| 1443 | Ga0207654_10050141 | |||
| 1444 | Ga0207707_10100378 | |||
| 1445 | Ga0207695_10001516 | |||
| 1446 | Ga0207695_10031465 | |||
| 1447 | Ga0207695_10032690 | |||
| 1448 | Ga0207695_10062904 | |||
| 1449 | Ga0207671_10030882 | |||
| 1450 | Ga0207693_10000075 | |||
| 1451 | Ga0207693_10028375 | |||
| 1452 | Ga0207693_10040946 | |||
| 1453 | Ga0207693_10055672 | |||
| 1454 | Ga0207693_10077907 | |||
| 1455 | Ga0207663_10001176 | |||
| 1456 | Ga0207663_10010425 | |||
| 1457 | Ga0207663_10016779 | |||
| 1458 | Ga0207663_10036517 | |||
| 1459 | Ga0207663_10040038 | |||
| 1460 | Ga0207663_10058544 | |||
| 1461 | Ga0207663_10065139 | |||
| 1462 | Ga0207657_10012854 | |||
| 1463 | Ga0207649_10157674 | |||
| 1464 | Ga0207652_10011393 | |||
| 1465 | Ga0207646_10001454 | |||
| 1466 | Ga0207646_10001794 | |||
| 1467 | Ga0207646_10010227 | |||
| 1468 | Ga0207646_10033189 | |||
| 1469 | Ga0207646_10243385 | |||
| 1470 | Ga0207694_10024796 | |||
| 1471 | Ga0207650_10014653 | |||
| 1472 | Ga0207650_10144503 | |||
| 1473 | Ga0207650_10156785 | |||
| 1474 | Ga0207659_10022156 | |||
| 1475 | Ga0207687_10004569 | |||
| 1476 | Ga0207687_10004816 | |||
| 1477 | Ga0207687_10005342 | |||
| 1478 | Ga0207687_10031675 | |||
| 1479 | Ga0207687_10045338 | |||
| 1480 | Ga0207700_10004604 | |||
| 1481 | Ga0207700_10007500 | |||
| 1482 | Ga0207700_10010051 | |||
| 1483 | Ga0207700_10056966 | |||
| 1484 | Ga0207700_10162281 | |||
| 1485 | Ga0207664_10007497 | |||
| 1486 | Ga0207664_10014506 | |||
| 1487 | Ga0207664_10021631 | |||
| 1488 | Ga0207664_10021936 | |||
| 1489 | Ga0207664_10033175 | |||
| 1490 | Ga0207664_10065214 | |||
| 1491 | Ga0207664_10082345 | |||
| 1492 | Ga0207644_10003739 | |||
| 1493 | Ga0207644_10058053 | |||
| 1494 | Ga0207644_10080990 | |||
| 1495 | Ga0207644_10118145 | |||
| 1496 | Ga0207706_10005916 | |||
| 1497 | Ga0207706_10007072 | |||
| 1498 | Ga0207706_10019925 | |||
| 1499 | Ga0207706_10214641 | |||
| 1500 | Ga0207686_10000195 | |||
| 1501 | Ga0207686_10009911 | |||
| 1502 | Ga0207686_10179173 | |||
| 1503 | Ga0207670_10081076 | |||
| 1504 | Ga0207669_10010554 | |||
| 1505 | Ga0207669_10101491 | |||
| 1506 | Ga0207704_10003239 | |||
| 1507 | Ga0207704_10006687 | |||
| 1508 | Ga0207704_10040211 | |||
| 1509 | Ga0207665_10007093 | |||
| 1510 | Ga0207665_10008118 | |||
| 1511 | Ga0207665_10053431 | |||
| 1512 | Ga0207691_10003999 | |||
| 1513 | Ga0207691_10074094 | |||
| 1514 | Ga0207691_10106640 | |||
| 1515 | Ga0207691_10196271 | |||
| 1516 | Ga0207711_10000092 | |||
| 1517 | Ga0207711_10000990 | |||
| 1518 | Ga0207711_10032534 | |||
| 1519 | Ga0207689_10013663 | |||
| 1520 | Ga0207689_10259847 | |||
| 1521 | Ga0207661_10016902 | |||
| 1522 | Ga0207661_10081570 | |||
| 1523 | Ga0207667_10007142 | |||
| 1524 | Ga0207667_10019388 | |||
| 1525 | Ga0207667_10177281 | |||
| 1526 | Ga0207651_10000135 | |||
| 1527 | Ga0207651_10008828 | |||
| 1528 | Ga0207668_10064602 | |||
| 1529 | Ga0207668_10115320 | |||
| 1530 | Ga0207640_10020200 | |||
| 1531 | Ga0207640_10081286 | |||
| 1532 | Ga0207640_10216463 | |||
| 1533 | Ga0207658_10034011 | |||
| 1534 | Ga0207658_10141432 | |||
| 1535 | Ga0207677_10009996 | |||
| 1536 | Ga0207677_10054216 | |||
| 1537 | Ga0207677_10060561 | |||
| 1538 | Ga0207677_10169121 | |||
| 1539 | Ga0207703_10000321 | |||
| 1540 | Ga0207703_10000820 | |||
| 1541 | Ga0207703_10188912 | |||
| 1542 | Ga0207639_10009952 | |||
| 1543 | Ga0207678_10027515 | |||
| 1544 | Ga0207708_10019124 | |||
| 1545 | Ga0207708_10034843 | |||
| 1546 | Ga0207708_10060179 | |||
| 1547 | Ga0207702_10053125 | |||
| 1548 | Ga0207702_10069818 | |||
| 1549 | Ga0207702_10231039 | |||
| 1550 | Ga0207641_10000003 | |||
| 1551 | Ga0207641_10008138 | |||
| 1552 | Ga0207641_10012408 | |||
| 1553 | Ga0207641_10029522 | |||
| 1554 | Ga0207648_10015422 | |||
| 1555 | Ga0207648_10016234 | |||
| 1556 | Ga0207648_10022641 | |||
| 1557 | Ga0207648_10129957 | |||
| 1558 | Ga0207676_10000078 | |||
| 1559 | Ga0207676_10000097 | |||
| 1560 | Ga0207676_10108173 | |||
| 1561 | Ga0207674_10000538 | |||
| 1562 | Ga0207674_10011156 | |||
| 1563 | Ga0207674_10242097 | |||
| 1564 | Ga0207675_100000958 | |||
| 1565 | Ga0207675_100021820 | |||
| 1566 | Ga0207675_100036448 | |||
| 1567 | Ga0207675_100042289 | |||
| 1568 | Ga0207675_100287094 | |||
| 1569 | Ga0207683_10001124 | |||
| 1570 | Ga0207683_10008191 | |||
| 1571 | Ga0207683_10020197 | |||
| 1572 | Ga0207698_10000144 | |||
| 1573 | Ga0207698_10100317 | |||
| 1574 | Ga0207698_10299980 | |||
| 1575 | Ga0207428_10000624 | |||
| 1576 | Ga0207428_10003344 | |||
| 1577 | Ga0268266_10008722 | |||
| 1578 | Ga0268266_10010874 | |||
| 1579 | Ga0268266_10183241 | |||
| 1580 | Ga0268265_10146130 | |||
| 1581 | Ga0268265_10193784 | |||
| 1582 | Ga0268265_10210885 | |||
| 1583 | Ga0268264_10009581 | |||
| 1584 | Ga0268264_10010681 | |||
| 1585 | Ga0268264_10253731 | |||
| 1586 | Ga0268264_10308840 | |||
| 1587 | Ga0268264_10354691 | |||
| 1588 | Ga0265337_1000353 | |||
| 1589 | Ga0265326_10001874 | |||
| 1590 | Ga0265319_1000417 | |||
| 1591 | Ga0265334_10000158 | |||
| 1592 | Ga0265318_10001998 | |||
| 1593 | Ga0265323_10009382 | |||
| 1594 | Ga0265322_10003453 | |||
| 1595 | Ga0265336_10001221 | |||
| 1596 | Ga0265336_10001604 | |||
| 1597 | Ga0265338_10000059 | |||
| 1598 | Ga0265338_10007142 | |||
| 1599 | Ga0265338_10053292 | |||
| 1600 | Ga0265324_10000993 | |||
| 1601 | Ga0265775_100354 | |||
| 1602 | Ga0265763_1000042 | |||
| 1603 | Ga0265777_100556 | |||
| 1604 | Ga0265776_100251 | |||
| 1605 | Ga0265764_100167 | |||
| 1606 | Ga0265761_100334 | |||
| 1607 | Ga0265773_1000055 | |||
| 1608 | Ga0265779_100332 | |||
| 1609 | Ga0265760_10015866 | |||
| 1610 | Ga0265330_10005945 | |||
| 1611 | Ga0265332_10003109 | |||
| 1612 | Ga0265332_10003491 | |||
| 1613 | Ga0265320_10003285 | |||
| 1614 | Ga0265329_10001141 | |||
| 1615 | Ga0265340_10000791 | |||
| 1616 | Ga0265339_10011994 | |||
| 1617 | Ga0265331_10000945 | |||
| 1618 | Ga0265327_10008872 | |||
| 1619 | Ga0265316_10010471 | |||
| 1620 | Ga0265316_10010551 | |||
| 1621 | Ga0265316_10205309 | |||
| 1622 | Ga0307408_100000004 | |||
| 1623 | Ga0310116_102878 | |||
| 1624 | Ga0265313_10006340 | |||
| 1625 | Ga0307508_10156743 | |||
| 1626 | Ga0310119_103989 | |||
| 1627 | Ga0310101_100696 | |||
| 1628 | Ga0265314_10000220 | |||
| 1629 | Ga0265314_10002504 | |||
| 1630 | Ga0316576_10009469 | |||
| 1631 | Ga0316578_10012243 | |||
| 1632 | Ga0307405_10012205 | |||
| 1633 | Ga0307405_10034102 | |||
| 1634 | Ga0307405_10148242 | |||
| 1635 | Ga0307413_10024768 | |||
| 1636 | Ga0307413_10031108 | |||
| 1637 | Ga0307407_10029699 | |||
| 1638 | Ga0307409_100001484 | |||
| 1639 | Ga0307416_100000506 | |||
| 1640 | Ga0307416_100242183 | |||
| 1641 | Ga0307414_10023969 | |||
| 1642 | Ga0307414_10089065 | |||
| 1643 | Ga0307415_100005611 | |||
| 1644 | Ga0307415_100015938 | |||
| 1645 | Ga0316583_10005519 | |||
| 1646 | Ga0316593_10009668 | |||
| 1647 | Ga0316592_1006997 | |||
| 1648 | Ga0316588_1003500 | |||
| 1649 | Ga0316588_1008164 | |||
| 1650 | Ga0316596_1010795 | |||
| 1651 | Ga0316215_1002172 | |||
| 1652 | Ga0373938_0004402 | |||
| 1653 | Ga0373926_0004797 | |||
| 1654 | Ga0373926_0055950 | |||
| 1655 | Ga0373934_0007490 | |||
| 1656 | Ga0373934_0010981 | |||
| 1657 | Ga0373944_0001312 | |||
| 1658 | Ga0373949_0008242 | |||
| 1659 | Ga0373923_0001816 | |||
| 1660 | Ga0373923_0002481 | |||
| 1661 | Ga0373923_0010881 | |||
| 1662 | Ga0373932_0005011 | |||
| 1663 | Ga0373936_0000795 | |||
| 1664 | Ga0373939_0004880 | |||
| 1665 | Ga0373953_0006915 | |||
| 1666 | Ga0373953_0009719 | |||
| 1667 | Ga0373953_0019027 | |||
| 1668 | Ga0373954_0008993 | |||
| 1669 | Ga0373954_0032347 | |||
| 1670 | Ga0373956_0006493 | |||
| 1671 | Ga0373956_0014531 | |||
| 1672 | Ga0373956_0050212 | |||
| 1673 | Ga0373957_0001351 | |||
| 1674 | Ga0373957_0017577 | |||
| 1675 | Ga0373960_0001547 | |||
| 1676 | Ga0373943_0005766 | |||
| 1677 | Ga0373943_0031639 | |||
| 1678 | Ga0373943_0064937 | |||
| 1679 | Ga0373946_0001732 | |||
| 1680 | Ga0373955_0003821 | |||
| 1681 | Ga0373955_0004630 | |||
| 1682 | Ga0373955_0005029 | |||
| 1683 | Ga0373955_0006943 | |||
| 1684 | Ga0373955_0027448 | |||
| 1685 | Ga0373955_0142688 | |||
| 1686 | Ga0373962_0008013 | |||
| 1687 | Ga0316574_0044733 | |||
| 1688 | Ga0316574_0104676 | |||
| 1689 | Ga0373924_0000599 | |||
| 1690 | Ga0373924_0007596 | |||
| 1691 | Ga0373924_0009219 | |||
| 1692 | Ga0373931_0028239 | |||
| 1693 | Ga0373931_0034470 | |||
| 1694 | Ga0373935_0037501 | |||
| 1695 | Ga0373935_0081884 | |||
| 1696 | Ga0373927_0013694 | |||
| 1697 | Ga0373927_0057258 | |||
| 1698 | Ga0373927_0120530 | |||
| 1699 | Ga0373933_0000854 | |||
| 1700 | Ga0373933_0026149 | |||
| 1701 | Ga0373933_0037070 | |||
| 1702 | Ga0373947_0002539 | |||
| 1703 | Ga0373947_0073408 | |||
| 1704 | Ga0373947_0131084 | |||
| 1705 | Ga0373937_0001913 | |||
| 1706 | Ga0373937_0007560 | |||
| 1707 | Ga0373937_0008336 | |||
| 1708 | Ga0373937_0015349 | |||
| 1709 | Ga0373937_0030040 | |||
| 1710 | Ga0373937_0088814 | |||
| 1711 | Ga0373937_0153916 | |||
| 1712 | Ga0373937_0196590 | |||
| 1713 | Ga0265778_000007 | |||
| 1714 | Ga0372808_002133 | |||
| 1715 | Ga0316584_0054667 | |||
| 1716 | Ga0373925_0000869 | |||
| 1717 | Ga0373925_0028545 | |||
| 1718 | Ga0373925_0034287 | |||
| 1719 | Ga0373925_0209813 | |||
| 1720 | Ga0395899_0174576 | |||
| 1721 | Ga0395900_0039304 | |||
| 1722 | Ga0395898_0019375 | |||
| 1723 | Ga0395898_0032423 | |||
| 1724 | Ga0395898_0052314 | |||
| 1725 | Ga0395898_0293817 | |||
| 1726 | Ga0395905_0091434 | |||
| 1727 | Ga0395905_0188583 | |||
| 1728 | Ga0395901_0014296 | |||
| 1729 | Ga0395901_0096320 | |||
| 1730 | Ga0436365_1230062 | |||
| 1731 | Ga0436365_1898856 | |||
| 1732 | Ga0436360_0222705 | |||
| 1733 | Ga0436360_0719502 | |||
| 1734 | Ga0436361_0205689 | |||
| 1735 | Ga0436361_0307959 | |||
| 1736 | Ga0436361_0580165 | |||
| 1737 | Ga0436361_0853489 | |||
| 1738 | Ga0436361_1029785 | |||
| 1739 | Ga0436362_1149665 | |||
| 1740 | Ga0439448_0001781 | |||
| 1741 | Ga0439450_001151 | |||
| 1742 | Ga0439451_016545 | |||
| 1743 | Ga0439455_0002594 | |||
| 1744 | Ga0439463_001008 | |||
| 1745 | Ga0439463_009931 | |||
| 1746 | Ga0450900_000328 | |||
| 1747 | Ga0450902_008546 | |||
| 1748 | Ga0450889_002495 | |||
| 1749 | Ga0439444_0008787 | |||
| 1750 | Ga0439464_0005753 | |||
| 1751 | Ga0439464_0009910 | |||
| 1752 | Ga0439460_0000927 | |||
| 1753 | Ga0450916_001828 | |||
| 1754 | Ga0439440_0003827 | |||
| 1755 | Ga0466966_0000534 | |||
| 1756 | Ga0466966_0163931 | |||
| 1757 | Ga0466963_0034599 | |||
| 1758 | Ga0453684_0006843 | |||
| 1759 | Ga0466968_0000051 | |||
| 1760 | Ga0466970_0000145 | |||
| 1761 | Ga0466960_0007565 | |||
| 1762 | Ga0466959_0005687 | |||
| 1763 | Ga0466967_0001263 | |||
| 1764 | Ga0466967_0185741 | |||
| 1765 | Ga0495592_0002119 | |||
| 1766 | Ga0495592_0010184 | |||
| 1767 | Ga0495592_0012972 | |||
| 1768 | Ga0495592_0047568 | |||
| 1769 | Ga0495592_0095779 | |||
| 1770 | Ga0495603_0002266 | |||
| 1771 | Ga0495603_0094739 | |||
| 1772 | Ga0495629_0008928 | |||
| 1773 | Ga0495629_0011741 | |||
| 1774 | Ga0495629_0031412 | |||
| 1775 | Ga0495629_0031757 | |||
| 1776 | Ga0495629_0083961 | |||
| 1777 | Ga0495641_0008808 | |||
| 1778 | Ga0495641_0010516 | |||
| 1779 | Ga0495651_0009790 | |||
| 1780 | Ga0495651_0014394 | |||
| 1781 | Ga0495651_0064429 | |||
| 1782 | Ga0495651_0076597 | |||
| 1783 | Ga0495653_0003405 | |||
| 1784 | Ga0495653_0016515 | |||
| 1785 | Ga0495653_0043519 | |||
| 1786 | Ga0495653_0047476 | |||
| 1787 | Ga0495580_0004777 | |||
| 1788 | Ga0495580_0041389 | |||
| 1789 | Ga0495580_0111240 | |||
| 1790 | Ga0495582_0000536 | |||
| 1791 | Ga0495582_0001255 | |||
| 1792 | Ga0495582_0008463 | |||
| 1793 | Ga0495639_0001015 | |||
| 1794 | Ga0495639_0042115 | |||
| 1795 | Ga0495662_0004058 | |||
| 1796 | Ga0495662_0079583 | |||
| 1797 | Ga0495662_0086297 | |||
| 1798 | Ga0495662_0092494 | |||
| 1799 | Ga0495664_0015963 | |||
| 1800 | Ga0495664_0036687 | |||
| 1801 | Ga0495664_0089973 | |||
| 1802 | Ga0495664_0093351 | |||
| 1803 | Ga0495664_0107382 | |||
| 1804 | Ga0495664_0157137 | |||
| 1805 | Ga0495594_0008942 | |||
| 1806 | Ga0495594_0053399 | |||
| 1807 | Ga0495594_0111578 | |||
| 1808 | Ga0495608_0003487 | |||
| 1809 | Ga0495608_0004902 | |||
| 1810 | Ga0495608_0051980 | |||
| 1811 | Ga0495618_0030451 | |||
| 1812 | Ga0495618_0034809 | |||
| 1813 | Ga0495618_0040635 | |||
| 1814 | Ga0495618_0048715 | |||
| 1815 | Ga0495628_0010355 | |||
| 1816 | Ga0495628_0035440 | |||
| 1817 | Ga0495628_0035856 | |||
| 1818 | Ga0495628_0115295 | |||
| 1819 | Ga0495628_0135642 | |||
| 1820 | Ga0495630_0006459 | |||
| 1821 | Ga0495630_0014692 | |||
| 1822 | Ga0495630_0109647 | |||
| 1823 | Ga0495630_0118557 | |||
| 1824 | Ga0495630_0180198 | |||
| 1825 | Ga0495643_0020603 | |||
| 1826 | Ga0495644_0013632 | |||
| 1827 | Ga0495666_0047792 | |||
| 1828 | Ga0495652_0004055 | |||
| 1829 | Ga0495652_0054627 | |||
| 1830 | Ga0495652_0093207 | |||
| 1831 | Ga0495652_0184911 | |||
| 1832 | Ga0495665_0003367 | |||
| 1833 | Ga0495665_0016041 | |||
| 1834 | Ga0495665_0062331 | |||
| 1835 | Ga0495640_0013323 | |||
| 1836 | Ga0495640_0042191 | |||
| 1837 | Ga0495640_0047253 | |||
| 1838 | Ga0495640_0067064 | |||
| 1839 | Ga0495640_0112769 | |||
| 1840 | Ga0495586_0002083 | |||
| 1841 | Ga0495586_0062475 | |||
| 1842 | Ga0495587_0004565 | |||
| 1843 | Ga0495587_0006283 | |||
| 1844 | Ga0495587_0008558 | |||
| 1845 | Ga0495587_0016759 | |||
| 1846 | Ga0495587_0071990 | |||
| 1847 | Ga0495587_0080681 | |||
| 1848 | Ga0495587_0109919 | |||
| 1849 | Ga0495621_0000668 | |||
| 1850 | Ga0495645_0005550 | |||
| 1851 | Ga0495645_0065202 | |||
| 1852 | Ga0495645_0217835 | |||
| 1853 | Ga0495667_0004820 | |||
| 1854 | Ga0495667_0009073 | |||
| 1855 | Ga0495667_0011788 | |||
| 1856 | Ga0495667_0025257 | |||
| 1857 | Ga0495667_0033311 | |||
| 1858 | Ga0495667_0042427 | |||
| 1859 | Ga0495656_0009549 | |||
| 1860 | Ga0495634_0012637 | |||
| 1861 | Ga0495634_0027359 | |||
| 1862 | Ga0495634_0046758 | |||
| 1863 | Ga0495634_0142152 | |||
| 1864 | Ga0495635_0006479 | |||
| 1865 | Ga0495635_0009118 | |||
| 1866 | Ga0495635_0044956 | |||
| 1867 | Ga0495635_0120874 | |||
| 1868 | Ga0495588_0076889 | |||
| 1869 | Ga0495657_0002732 | |||
| 1870 | Ga0495657_0009416 | |||
| 1871 | Ga0495657_0012539 | |||
| 1872 | Ga0495657_0012802 | |||
| 1873 | Ga0495657_0126266 | |||
| 1874 | Ga0495599_0007604 | |||
| 1875 | Ga0495599_0032079 | |||
| 1876 | Ga0495599_0176278 | |||
| 1877 | Ga0495623_0008288 | |||
| 1878 | Ga0495623_0012823 | |||
| 1879 | Ga0495623_0066509 | |||
| 1880 | Ga0495623_0131260 | |||
| 1881 | Ga0495646_0009568 | |||
| 1882 | Ga0495646_0033982 | |||
| 1883 | Ga0495646_0053104 | |||
| 1884 | Ga0495646_0103895 | |||
| 1885 | Ga0495646_0129034 | |||
| 1886 | Ga0495647_0004826 | |||
| 1887 | Ga0495658_0001474 | |||
| 1888 | Ga0495658_0002104 | |||
| 1889 | Ga0495658_0045920 | |||
| 1890 | Ga0495658_0194870 | |||
| 1891 | Ga0495669_0093725 | |||
| 1892 | Ga0495613_0000840 | |||
| 1893 | Ga0495613_0006946 | |||
| 1894 | Ga0495613_0109995 | |||
| 1895 | Ga0495613_0280924 | |||
| 1896 | Ga0495624_0003774 | |||
| 1897 | Ga0495649_0017660 | |||
| 1898 | Ga0495600_0001383 | |||
| 1899 | Ga0495600_0078395 | |||
| 1900 | Ga0495600_0088245 | |||
| 1901 | Ga0495600_0110888 | |||
| 1902 | Ga0495581_0000209 | |||
| 1903 | Ga0495581_0084276 | |||
| 1904 | Ga0495604_0002821 | |||
| 1905 | Ga0495604_0019973 | |||
| 1906 | Ga0495674_0009446 | |||
| 1907 | Ga0495674_0010298 | |||
| 1908 | Ga0495674_0024366 | |||
| 1909 | Ga0495674_0036552 | |||
| 1910 | Ga0495674_0047397 | |||
| 1911 | Ga0495674_0139126 | |||
| 1912 | Ga0495674_0212130 | |||
| 1913 | Ga0495676_0037058 | |||
| 1914 | Ga0495676_0079611 | |||
| 1915 | Ga0495676_0115250 | |||
| 1916 | Ga0495680_0022116 | |||
| 1917 | Ga0495680_0030646 | |||
| 1918 | Ga0495680_0036158 | |||
| 1919 | Ga0495680_0058858 | |||
| 1920 | Ga0495680_0078156 | |||
| 1921 | Ga0495687_022905 | |||
| 1922 | Ga0495675_0004359 | |||
| 1923 | Ga0495675_0010020 | |||
| 1924 | Ga0495675_0022000 | |||
| 1925 | Ga0495684_0011406 | |||
| 1926 | Ga0495684_0033402 | |||
| 1927 | Ga0495684_0093547 | |||
| 1928 | Ga0495684_0097985 | |||
| 1929 | Ga0495684_0169026 | |||
| 1930 | Ga0495593_0000634 | |||
| 1931 | Ga0495593_0001668 | |||
| 1932 | Ga0495593_0003465 | |||
| 1933 | Ga0495602_0057706 | |||
| 1934 | Ga0495614_0002707 | |||
| 1935 | Ga0496100_0007149 | |||
| 1936 | Ga0496100_0020028 | |||
| 1937 | Ga0496100_0062007 | |||
| 1938 | Ga0496101_0008502 | |||
| 1939 | Ga0496101_0019854 | |||
| 1940 | Ga0496101_0077755 | |||
| 1941 | Ga0496102_0012490 | |||
| 1942 | Ga0496102_0020673 | |||
| 1943 | Ga0496102_0027502 | |||
| 1944 | Ga0496102_0051532 | |||
| 1945 | Ga0496103_0128150 | |||
| 1946 | Ga0496104_0002664 | |||
| 1947 | Ga0496104_0020773 | |||
| 1948 | Ga0496104_0034266 | |||
| 1949 | Ga0496104_0109899 | |||
| 1950 | Ga0496104_0146741 | |||
| 1951 | Ga0496105_0005131 | |||
| 1952 | Ga0496105_0024231 | |||
| 1953 | Ga0496105_0025592 | |||
| 1954 | Ga0496105_0033976 | |||
| 1955 | Ga0496106_0019124 | |||
| 1956 | Ga0496107_0002076 | |||
| 1957 | Ga0496107_0009665 | |||
| 1958 | Ga0496107_0014299 | |||
| 1959 | Ga0496107_0033993 | |||
| 1960 | Ga0496108_0000786 | |||
| 1961 | Ga0496108_0002623 | |||
| 1962 | Ga0496108_0056527 | |||
| 1963 | Ga0496108_0067234 | |||
| 1964 | Ga0496109_0002909 | |||
| 1965 | Ga0496109_0004480 | |||
| 1966 | Ga0496109_0004797 | |||
| 1967 | Ga0496109_0020072 | |||
| 1968 | Ga0496109_0110128 | |||
| 1969 | Ga0496110_0005737 | |||
| 1970 | Ga0496110_0007789 | |||
| 1971 | Ga0496110_0010326 | |||
| 1972 | Ga0496110_0014367 | |||
| 1973 | Ga0496110_0049778 | |||
| 1974 | Ga0496110_0127338 | |||
| 1975 | Ga0496111_0001855 | |||
| 1976 | Ga0496111_0109282 | |||
| 1977 | Ga0496112_0001692 | |||
| 1978 | Ga0496112_0023845 | |||
| 1979 | Ga0496112_0034665 | |||
| 1980 | Ga0496112_0059823 | |||
| 1981 | Ga0496112_0139807 | |||
| 1982 | Ga0496112_0151318 | |||
| 1983 | Ga0496112_0296627 | |||
| 1984 | Ga0496113_0033150 | |||
| 1985 | Ga0496114_0002209 | |||
| 1986 | Ga0496114_0016971 | |||
| 1987 | Ga0496114_0033382 | |||
| 1988 | Ga0496114_0040261 | |||
| 1989 | Ga0496114_0081356 | |||
| 1990 | Ga0496114_0100489 | |||
| 1991 | Ga0496114_0101532 | |||
| 1992 | Ga0496115_0006191 | |||
| 1993 | Ga0496115_0008704 | |||
| 1994 | Ga0496115_0051089 | |||
| 1995 | Ga0496115_0112335 | |||
| 1996 | Ga0496115_0213793 | |||
| 1997 | Ga0496122_0003944 | |||
| 1998 | Ga0496124_0018040 | |||
| 1999 | Ga0496125_0047816 | |||
| 2000 | Ga0496126_0033887 | |||
| 2001 | Ga0501031_0011848 | |||
| 2002 | Ga0501032_0022546 | |||
| 2003 | Ga0501032_0025238 | |||
| 2004 | Ga0501032_0145785 | |||
| 2005 | Ga0501033_0005281 | |||
| 2006 | Ga0501033_0050194 | |||
| 2007 | Ga0501034_0071110 | |||
| 2008 | Ga0501036_0027922 | |||
| 2009 | Ga0501036_0088396 | |||
| 2010 | Ga0501037_0029447 | |||
| 2011 | Ga0501037_0081480 | |||
| 2012 | Ga0501038_0023010 | |||
| 2013 | Ga0501038_0028803 | |||
| 2014 | Ga0501039_0108429 | |||
| 2015 | Ga0501039_0212145 | |||
| 2016 | Ga0501040_0000570 | |||
| 2017 | Ga0501040_0001391 | |||
| 2018 | Ga0501040_0001418 | |||
| 2019 | Ga0501040_0062969 | |||
| 2020 | Ga0501041_0001215 | |||
| 2021 | Ga0501041_0002366 | |||
| 2022 | Ga0501042_0001159 | |||
| 2023 | Ga0501042_0001598 | |||
| 2024 | Ga0501042_0002297 | |||
| 2025 | Ga0501042_0037251 | |||
| 2026 | Ga0501042_0082308 | |||
| 2027 | Ga0501046_0000396 | |||
| 2028 | Ga0501046_0007849 | |||
| 2029 | Ga0501046_0024827 | |||
| 2030 | Ga0501047_0101967 | |||
| 2031 | Ga0501048_0001242 | |||
| 2032 | Ga0501048_0002400 | |||
| 2033 | Ga0501048_0046074 | |||
| 2034 | Ga0501067_0020129 | |||
| 2035 | Ga0501068_0022430 | |||
| 2036 | Ga0501068_0023400 | |||
| 2037 | Ga0501069_0011648 | |||
| 2038 | Ga0501069_0069482 | |||
| 2039 | Ga0501070_0072526 | |||
| 2040 | Ga0501070_0253546 | |||
| 2041 | Ga0501071_0000152 | |||
| 2042 | Ga0501071_0002241 | |||
| 2043 | Ga0501071_0029120 | |||
| 2044 | Ga0501072_0041514 | |||
| 2045 | Ga0501074_0001225 | |||
| 2046 | Ga0501074_0018847 | |||
| 2047 | Ga0501074_0029196 | |||
| 2048 | Ga0501074_0203659 | |||
| 2049 | Ga0501075_0004720 | |||
| 2050 | Ga0501075_0168631 | |||
| 2051 | Ga0501076_0000023 | |||
| 2052 | Ga0501076_0001652 | |||
| 2053 | Ga0501077_0000791 | |||
| 2054 | Ga0501077_0004544 | |||
| 2055 | Ga0501209_000142 | |||
| 2056 | Ga0501079_0000965 | |||
| 2057 | Ga0501079_0001325 | |||
| 2058 | Ga0501080_0012624 | |||
| 2059 | Ga0501081_0000093 | |||
| 2060 | Ga0501081_0017812 | |||
| 2061 | Ga0501035_0005571 | |||
| 2062 | Ga0501035_0025017 | |||
| 2063 | Ga0501045_0004202 | |||
| 2064 | Ga0501045_0014414 | |||
| 2065 | nmdc:mga05p37_2303_c1 | |||
| 2066 | nmdc:mga05p37_28254_c1 | |||
| 2067 | nmdc:mga09592_1897_c1 | |||
| 2068 | nmdc:mga06r32_139786_c1 | |||
| 2069 | nmdc:mga06r32_7620_c1 | |||
| 2070 | nmdc:mga08y16_150663_c1 | |||
| 2071 | nmdc:mga08y16_25185_c1 | |||
| 2072 | nmdc:mga08y16_9552_c1 | |||
| 2073 | nmdc:mga0n895_33281_c1 | |||
| 2074 | nmdc:mga0rr50_13392_c1 | |||
| 2075 | nmdc:mga0rr50_193229_c1 | |||
| 2076 | nmdc:mga0rr50_36935_c1 | |||
| 2077 | nmdc:mga08x19_51552_c1 | |||
| 2078 | Ga0495601_0104335 | |||
| 2079 | Ga0495601_0165065 | |||
| 2080 | Ga0495612_0006742 | |||
| 2081 | Ga0495595_0004180 | |||
| 2082 | Ga0495595_0012620 | |||
| 2083 | Ga0495595_0035327 | |||
| 2084 | Ga0495595_0042863 | |||
| 2085 | Ga0495595_0113585 | |||
| 2086 | Ga0495619_0007849 | |||
| 2087 | Ga0495619_0128337 | |||
| 2088 | Ga0495619_0138708 | |||
| 2089 | Ga0500637_0098092 | |||
| 2090 | Ga0501084_0002417 | |||
| 2091 | Ga0501084_0005153 | |||
| 2092 | Ga0501084_0049612 | |||
| 2093 | Ga0590075_025356 | |||
| 2094 | Ga0501082_0000975 | |||
| 2095 | Ga0501082_0019602 | |||
| 2096 | Ga0501082_0051421 | |||
| 2097 | Ga0530510_0001613 | |||
| 2098 | Ga0530510_0048255 | |||
| 2099 | 2524612893 | |||
| 2100 | 2600444412 | |||
| 2101 | 2602011497 | |||
| 2102 | 2672335624 | |||
| 2103 | 2715501541 | |||
| 2104 | 2738816431 | |||
| 2105 | 2816865130 | |||
| 2106 | 2823423528 | |||
| 2107 | 2842316070 | |||
| 2108 | 2842683998 | |||
| 2109 | 2854911672 | |||
| 2110 | 2855022012 | |||
| 2111 | 2855732437 | |||
| 2112 | 2855769145 | |||
| 2113 | 2919503166 | |||
| 2114 | 2926066263 | |||
| 2115 | 2928512652 | |||
| 2116 | 3006979859 | |||
| 2117 | 8034964987 | |||
| 2118 | 8055269901 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nzs-assembly1.cif.gz_A | crystal structure of beta-ketothiolase bktb b from ralstonia eutropha h16 | 0.9914 | 4 | 394 |
| 4w61-assembly4.cif.gz_P | crystal structure of beta-ketoacyl thiolase b (bktb) from ralstonia eutropha | 0.9911 | 4 | 392 |
| 4w61-assembly2.cif.gz_E | crystal structure of beta-ketoacyl thiolase b (bktb) from ralstonia eutropha | 0.99 | 4 | 394 |
| 4w61-assembly3.cif.gz_K | crystal structure of beta-ketoacyl thiolase b (bktb) from ralstonia eutropha | 0.9895 | 4 | 394 |
| 4w61-assembly3.cif.gz_J | crystal structure of beta-ketoacyl thiolase b (bktb) from ralstonia eutropha | 0.9893 | 4 | 392 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76461_265_393_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9887 | 267 | 394 | 3.40.47.10 |
| af_A0A0G2KML7_1_235_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9872 | 159 | 393 | 3.40.47.10 |
| af_A0A096MJY8_281_393_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.986 | 278 | 388 | 3.40.47.10 |
| af_O53871_287_399_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9834 | 278 | 388 | 3.40.47.10 |
| af_A0A0G2KML7_1_235_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9831 | 159 | 393 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519H2S4-F1-model_v4 | acetyl-CoA C-acyltransferase (EC 2.3.1.16) | 0.9956 | 262 | 394 |
GO:0003985
GO:0006635 GO:0010124 |
| AF-A0A1F7L7J7-F1-model_v4 | Thiolase C-terminal domain-containing protein | 0.9947 | 283 | 395 |
GO:0003988
GO:0006635 GO:0010124 |
| AF-A0A1H7DGC5-F1-model_v4 | acetyl-CoA C-acyltransferase (EC 2.3.1.16) | 0.9944 | 188 | 394 |
GO:0003988
GO:0006635 GO:0010124 |
| AF-A0A1M3JHY1-F1-model_v4 | deleted | 0.9929 | 2 | 299 |
|
| AF-A0A2A4MBC4-F1-model_v4 | deleted | 0.9924 | 2 | 336 |
|