F489226

General Info

Members Datasets Scaffolds Average Seq Length
1058 487 1025 155

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10075606|Ga0105245_100756062
Length 180
Sequence VKLDSLYQEIILDHYKHPHRRGLREPFDAEVHHVNPTCGDEVTLRVKVSDGVVEDVSYDGAGCSISQASTSVLTDLVVGKPVEEAVAVQEEFLRLMQSKGTLEPDEEVLEDAVAFAGVSKYPSRVKCALLGWMAWKDATAQAVQREGAASEXXXSQRDRGVTRAARPALAPAGLSEEGTQ

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
3 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
4 2643221561 Nocardioides sp. Root151 Isolate Unclassified
5 2643221576 Nocardioides sp. Root614 Isolate Unclassified
6 2643221590 Nocardioides sp. Root682 Isolate Unclassified
7 2643221604 Nocardioides sp. Root190 Isolate Unclassified
8 2643221692 Nocardia sp. Root136 Isolate Unclassified
9 2643221696 Nocardioides sp. Root140 Isolate Unclassified
10 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
11 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
12 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
13 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
14 2738541305 Nocardioides sp. CF167 Isolate Unclassified
15 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
16 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
17 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
18 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
19 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
20 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
21 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
22 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
23 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
24 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
25 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
26 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
27 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
28 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
29 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
30 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
31 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
32 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
33 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
34 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
35 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
36 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
38 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
52 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
65 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
66 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
67 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
68 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
69 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
77 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
104 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
111 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
112 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
113 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
117 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
118 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
119 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
120 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
125 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
139 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
140 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
152 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
153 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
156 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
157 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
158 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
163 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
170 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
171 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
172 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
236 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
242 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
243 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
244 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
245 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
246 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
247 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
248 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
249 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
250 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
252 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
253 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
254 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
255 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
256 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
257 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
258 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
259 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
260 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
261 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
262 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
263 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
264 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
265 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
266 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
267 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
268 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
269 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
271 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
272 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
274 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
275 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
276 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
277 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
278 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
279 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
280 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
281 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
282 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
283 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
284 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
285 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
286 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
287 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
288 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
289 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
291 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
292 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
293 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
294 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
295 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
296 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
297 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
298 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
299 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
300 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
301 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
302 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
303 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
304 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
305 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
306 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
307 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
308 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
309 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
310 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
311 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
312 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
313 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
314 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
315 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
316 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
317 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
318 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
319 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
320 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
321 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
322 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
323 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
324 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
325 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
326 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
327 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
328 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
329 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
330 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
331 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
332 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
333 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
334 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
335 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
336 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
337 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
338 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
339 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
340 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
341 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
342 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
343 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
344 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
345 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
346 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
347 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
348 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
349 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
350 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
351 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
352 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
353 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
354 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
355 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
356 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
357 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
358 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
359 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
360 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
361 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
362 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
363 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
364 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
365 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
366 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
367 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
368 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
369 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
370 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
371 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
372 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
373 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
374 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
375 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
376 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
377 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
378 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
379 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
380 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
381 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
382 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
383 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
384 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
385 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
386 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
387 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
388 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
389 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
390 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
391 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
392 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
393 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
394 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
395 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
396 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
397 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
398 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
399 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
400 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
401 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
402 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
403 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
432 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
433 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
434 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
435 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
436 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
437 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
438 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
439 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
440 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
441 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
442 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
443 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
444 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
447 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
448 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
449 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
450 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
451 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
452 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
453 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
454 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
455 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
456 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
457 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
458 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
459 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
460 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
461 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
462 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
463 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
464 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
465 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
466 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
467 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
468 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
469 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
470 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
471 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
472 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
473 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
474 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
484 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
485 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
486 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
487 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.85
Metatranscriptomes 8.03
Isolates 3.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.32
Nodule 0.09
Rhizoplane 4.91
Rhizosphere 81.95
Stem 0
Stem Tuber 0
Unclassified 4.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1013336 3300001915 Bacteria 1396
2 JGI24746J21847_1041170 3300001977 Bacteria 643
3 JGI24740J21852_10017776 3300001979 Bacteria 2535
4 JGI24735J21928_10016670 3300002067 Bacteria 2276
5 JGI25404J52841_10056937 3300003659 Bacteria 820
6 Ga0055540_1000036 3300003792 Bacteria 164285
7 Ga0058863_11868134 3300004799 Bacteria 1356
8 Ga0058863_11885469 3300004799 Bacteria 1114
9 Ga0058861_11963846 3300004800 Bacteria 1082
10 Ga0058862_12752443 3300004803 Bacteria 1202
11 Ga0070658_10000603 3300005327 Bacteria 31119
12 Ga0070658_10043896 3300005327 Bacteria 3612
13 Ga0070658_10077548 3300005327 Bacteria 2726
14 Ga0070658_10100554 3300005327 Bacteria 2390
15 Ga0070683_100328580 3300005329 Bacteria 1456
16 Ga0070683_101289123 3300005329 Bacteria 702
17 Ga0070690_100062889 3300005330 Bacteria 2394
18 Ga0070670_100003677 3300005331 Bacteria 12782
19 Ga0068869_100001245 3300005334 Bacteria 15028
20 Ga0070666_10060956 3300005335 Bacteria 2554
21 Ga0070666_10191540 3300005335 Bacteria 1437
22 Ga0070680_100000622 3300005336 Bacteria 24598
23 Ga0070680_100092433 3300005336 Bacteria 2505
24 Ga0070680_100533021 3300005336 Bacteria 1006
25 Ga0070680_101286282 3300005336 Bacteria 633
26 Ga0070682_100107994 3300005337 Bacteria 1849
27 Ga0070682_100452214 3300005337 Bacteria 984
28 Ga0070682_100477806 3300005337 Bacteria 960
29 Ga0068868_100007359 3300005338 Bacteria 7840
30 Ga0068868_100384083 3300005338 Bacteria 1209
31 Ga0070660_100113719 3300005339 Bacteria 2155
32 Ga0070660_100282263 3300005339 Bacteria 1359
33 Ga0070689_100580593 3300005340 Bacteria 969
34 Ga0070689_101107990 3300005340 Bacteria 708
35 Ga0070691_10028714 3300005341 Bacteria 2601
36 Ga0070691_10584877 3300005341 Bacteria 657
37 Ga0070661_100534814 3300005344 Bacteria 941
38 Ga0070692_10002493 3300005345 Bacteria 7163
39 Ga0070668_100051232 3300005347 Bacteria 3180
40 Ga0070669_100596216 3300005353 Bacteria 925
41 Ga0070675_100013556 3300005354 Bacteria 6409
42 Ga0070671_100002954 3300005355 Bacteria 13219
43 Ga0070673_100008126 3300005364 Bacteria 6961
44 Ga0070659_100740895 3300005366 Bacteria 852
45 Ga0070667_100071409 3300005367 Bacteria 2957
46 Ga0070709_10095206 3300005434 Bacteria 1972
47 Ga0070709_10121217 3300005434 Bacteria 1773
48 Ga0070714_100003855 3300005435 Bacteria 11262
49 Ga0070714_100130112 3300005435 Bacteria 2249
50 Ga0070713_100007332 3300005436 Bacteria 7729
51 Ga0070713_100450429 3300005436 Bacteria 1209
52 Ga0070710_10000801 3300005437 Bacteria 15102
53 Ga0070710_10034672 3300005437 Bacteria 2747
54 Ga0070701_10456633 3300005438 Bacteria 821
55 Ga0070711_100151929 3300005439 Bacteria 1747
56 Ga0070711_100392882 3300005439 Bacteria 1124
57 Ga0070705_100013596 3300005440 Bacteria 4167
58 Ga0070705_100186024 3300005440 Bacteria 1411
59 Ga0070700_100036519 3300005441 Bacteria 2981
60 Ga0070700_100979137 3300005441 Bacteria 694
61 Ga0070663_100003424 3300005455 Bacteria 9156
62 Ga0070663_100010788 3300005455 Bacteria 5704
63 Ga0070663_100419915 3300005455 Bacteria 1097
64 Ga0070663_101357361 3300005455 Bacteria 628
65 Ga0070678_100010655 3300005456 Bacteria 5629
66 Ga0070678_100219979 3300005456 Bacteria 1578
67 Ga0070662_100086108 3300005457 Bacteria 2350
68 Ga0070662_100530031 3300005457 Bacteria 985
69 Ga0070681_10000561 3300005458 Bacteria 30603
70 Ga0070681_10076299 3300005458 Bacteria 3310
71 Ga0070681_10088899 3300005458 Bacteria 3041
72 Ga0070681_10926973 3300005458 Bacteria 790
73 Ga0068867_100189074 3300005459 Bacteria 1642
74 Ga0068867_100526755 3300005459 Bacteria 1020
75 Ga0070685_10024015 3300005466 Bacteria 3345
76 Ga0070685_10272009 3300005466 Bacteria 1131
77 Ga0070706_100518750 3300005467 Bacteria 1108
78 Ga0070707_100181398 3300005468 Bacteria 2052
79 Ga0070707_100212173 3300005468 Bacteria 1887
80 Ga0070679_100000912 3300005530 Bacteria 25636
81 Ga0070679_100012491 3300005530 Bacteria 8118
82 Ga0070679_100190367 3300005530 Bacteria 2021
83 Ga0070679_100679147 3300005530 Bacteria 972
84 Ga0070684_100255879 3300005535 Bacteria 1601
85 Ga0070684_100573619 3300005535 Bacteria 1048
86 Ga0070684_100723193 3300005535 Bacteria 929
87 Ga0070684_101177679 3300005535 Bacteria 721
88 Ga0070697_100015765 3300005536 Bacteria 5935
89 Ga0068853_100408167 3300005539 Bacteria 1272
90 Ga0070672_100416782 3300005543 Bacteria 1153
91 Ga0070672_101151148 3300005543 Bacteria 690
92 Ga0070686_100276370 3300005544 Bacteria 1237
93 Ga0070686_100548446 3300005544 Bacteria 904
94 Ga0070696_100497480 3300005546 Bacteria 969
95 Ga0070696_100718182 3300005546 Bacteria 816
96 Ga0070693_100179727 3300005547 Bacteria 1361
97 Ga0070665_100029684 3300005548 Bacteria 5502
98 Ga0070704_100281570 3300005549 Bacteria 1378
99 Ga0070664_100454083 3300005564 Bacteria 1177
100 Ga0068857_100280058 3300005577 Bacteria 1534
101 Ga0068857_100325556 3300005577 Bacteria 1420
102 Ga0068854_100047428 3300005578 Bacteria 3061
103 Ga0068854_100324875 3300005578 Bacteria 1252
104 Ga0070702_100000821 3300005615 Bacteria 11927
105 Ga0070702_100002847 3300005615 Bacteria 7590
106 Ga0070702_100444918 3300005615 Bacteria 939
107 Ga0070702_100950227 3300005615 Bacteria 677
108 Ga0068852_100064041 3300005616 Bacteria 3203
109 Ga0068852_100988807 3300005616 Bacteria 860
110 Ga0068852_101979930 3300005616 Bacteria 605
111 Ga0068859_100071646 3300005617 Bacteria 3502
112 Ga0068859_100126212 3300005617 Bacteria 2628
113 Ga0068864_100178627 3300005618 Bacteria 1939
114 Ga0068861_100217178 3300005719 Bacteria 1614
115 Ga0068861_100727552 3300005719 Bacteria 925
116 Ga0068861_101590455 3300005719 Bacteria 644
117 Ga0068851_10021990 3300005834 Bacteria 3101
118 Ga0068870_10001037 3300005840 Bacteria 10970
119 Ga0068870_10403656 3300005840 Bacteria 890
120 Ga0068870_10778447 3300005840 Bacteria 667
121 Ga0068863_100006203 3300005841 Bacteria 11727
122 Ga0068863_100838580 3300005841 Bacteria 918
123 Ga0068858_100048458 3300005842 Bacteria 3937
124 Ga0068860_100000311 3300005843 Bacteria 66954
125 Ga0068860_100614801 3300005843 Bacteria 1093
126 Ga0068862_100990174 3300005844 Bacteria 831
127 Ga0081455_10008050 3300005937 Bacteria 11010
128 Ga0081455_10194202 3300005937 Bacteria 1526
129 Ga0081540_1000117 3300005983 Bacteria 84123
130 Ga0081540_1051895 3300005983 Bacteria 2024
131 Ga0081539_10024421 3300005985 Bacteria 3921
132 Ga0081539_10078617 3300005985 Bacteria 1741
133 Ga0070717_10069655 3300006028 Bacteria 2930
134 Ga0075365_10009055 3300006038 Bacteria 5694
135 Ga0075365_10027959 3300006038 Bacteria 3592
136 Ga0075365_10037167 3300006038 Bacteria 3160
137 Ga0075365_10043679 3300006038 Bacteria 2934
138 Ga0075365_10281346 3300006038 Bacteria 1170
139 Ga0075365_10427097 3300006038 Bacteria 935
140 Ga0075365_10525721 3300006038 Bacteria 836
141 Ga0075365_10814805 3300006038 Bacteria 659
142 Ga0075368_10000188 3300006042 Bacteria 16897
143 Ga0075368_10013720 3300006042 Bacteria 2979
144 Ga0075368_10119014 3300006042 Bacteria 1093
145 Ga0075363_100006379 3300006048 Bacteria 5347
146 Ga0075363_100016364 3300006048 Bacteria 3663
147 Ga0075363_100085108 3300006048 Bacteria 1734
148 Ga0075363_100159700 3300006048 Bacteria 1276
149 Ga0075363_100167151 3300006048 Bacteria 1247
150 Ga0075364_10013400 3300006051 Bacteria 5038
151 Ga0075364_10015654 3300006051 Bacteria 4706
152 Ga0075364_10123355 3300006051 Bacteria 1735
153 Ga0075364_10149999 3300006051 Bacteria 1571
154 Ga0075364_10311184 3300006051 Bacteria 1072
155 Ga0075364_10323784 3300006051 Bacteria 1050
156 Ga0070716_100327919 3300006173 Bacteria 1075
157 Ga0070716_100546892 3300006173 Bacteria 863
158 Ga0070712_100113997 3300006175 Bacteria 2023
159 Ga0070712_100119096 3300006175 Bacteria 1984
160 Ga0075362_10010752 3300006177 Bacteria 3584
161 Ga0075362_10063831 3300006177 Bacteria 1671
162 Ga0075362_10183797 3300006177 Bacteria 1014
163 Ga0075367_10004589 3300006178 Bacteria 6759
164 Ga0075367_10027120 3300006178 Bacteria 3255
165 Ga0075367_10358481 3300006178 Bacteria 921
166 Ga0075367_10429354 3300006178 Bacteria 837
167 Ga0097621_100006415 3300006237 Bacteria 8350
168 Ga0075370_10009317 3300006353 Bacteria 5095
169 Ga0075370_10041500 3300006353 Bacteria 2597
170 Ga0075370_10065848 3300006353 Bacteria 2066
171 Ga0075370_10175446 3300006353 Bacteria 1261
172 Ga0075370_10205429 3300006353 Bacteria 1162
173 Ga0075370_10388409 3300006353 Bacteria 836
174 Ga0075428_100111063 3300006844 Bacteria 2987
175 Ga0075428_100421995 3300006844 Bacteria 1429
176 Ga0075431_100049848 3300006847 Bacteria 4317
177 Ga0075433_10005579 3300006852 Bacteria 9885
178 Ga0075434_100002856 3300006871 Bacteria 15319
179 Ga0075429_100453458 3300006880 Bacteria 1124
180 Ga0068865_100147964 3300006881 Bacteria 1778
181 Ga0068865_100363383 3300006881 Bacteria 1176
182 Ga0075436_100002169 3300006914 Bacteria 13525
183 Ga0075436_100013538 3300006914 Bacteria 5587
184 Ga0097620_100071648 3300006931 Bacteria 3502
185 Ga0097620_100126211 3300006931 Bacteria 2628
186 Ga0075435_100006462 3300007076 Bacteria 8291
187 Ga0105251_10008366 3300009011 Bacteria 6239
188 Ga0105251_10046840 3300009011 Bacteria 2080
189 Ga0105240_11127137 3300009093 Bacteria 834
190 Ga0105240_12490951 3300009093 Bacteria 535
191 Ga0111539_10017516 3300009094 Bacteria 8869
192 Ga0111539_10050843 3300009094 Bacteria 4938
193 Ga0111539_12281488 3300009094 Bacteria 628
194 Ga0105245_10075606 3300009098 Bacteria 3067
195 Ga0105245_11047374 3300009098 Bacteria 861
196 Ga0105245_11194175 3300009098 Bacteria 809
197 Ga0105245_11874486 3300009098 Bacteria 653
198 Ga0105247_10313276 3300009101 Bacteria 1092
199 Ga0114129_10004172 3300009147 Bacteria 20410
200 Ga0114129_10241311 3300009147 Bacteria 2429
201 Ga0105243_10111333 3300009148 Bacteria 2291
202 Ga0105243_10144836 3300009148 Bacteria 2032
203 Ga0105243_10601421 3300009148 Bacteria 1059
204 Ga0105243_10851185 3300009148 Bacteria 903
205 Ga0105243_11886853 3300009148 Bacteria 630
206 Ga0105241_10092283 3300009174 Bacteria 2391
207 Ga0105241_10209893 3300009174 Bacteria 1631
208 Ga0105242_10006011 3300009176 Bacteria 9358
209 Ga0105248_10054024 3300009177 Bacteria 4505
210 Ga0105248_11343235 3300009177 Bacteria 809
211 Ga0105237_10111283 3300009545 Bacteria 2730
212 Ga0105238_10199060 3300009551 Bacteria 1979
213 Ga0105249_10023032 3300009553 Bacteria 5584
214 Ga0105249_10831962 3300009553 Bacteria 988
215 Ga0105249_11295545 3300009553 Bacteria 800
216 Ga0105249_13501888 3300009553 Bacteria 505
217 Ga0099796_10188361 3300010159 Bacteria 831
218 Ga0105239_10027014 3300010375 Bacteria 6318
219 Ga0105239_11304588 3300010375 Bacteria 837
220 Ga0105239_12452413 3300010375 Bacteria 608
221 Ga0105246_10022876 3300011119 Bacteria 4039
222 Ga0105246_10117793 3300011119 Bacteria 1963
223 Ga0105246_10184398 3300011119 Bacteria 1610
224 Ga0105246_10466911 3300011119 Bacteria 1064
225 Ga0105246_11000288 3300011119 Bacteria 757
226 Ga0157373_10070352 3300013100 Bacteria 2472
227 Ga0157371_10097728 3300013102 Bacteria 2082
228 Ga0157370_10025448 3300013104 Bacteria 5858
229 Ga0157370_10429914 3300013104 Bacteria 1214
230 Ga0157370_10620900 3300013104 Bacteria 989
231 Ga0157369_10001259 3300013105 Bacteria 31492
232 Ga0157369_10020619 3300013105 Bacteria 7370
233 Ga0157369_10158228 3300013105 Bacteria 2392
234 Ga0157369_10295849 3300013105 Bacteria 1685
235 Ga0157369_10650809 3300013105 Bacteria 1087
236 Ga0157374_10206169 3300013296 Bacteria 1927
237 Ga0157374_10325781 3300013296 Bacteria 1523
238 Ga0157374_11395321 3300013296 Bacteria 723
239 Ga0157378_10227778 3300013297 Bacteria 1774
240 Ga0163162_10019250 3300013306 Bacteria 6693
241 Ga0163162_10396978 3300013306 Bacteria 1512
242 Ga0163162_10677252 3300013306 Bacteria 1154
243 Ga0163162_10689326 3300013306 Bacteria 1144
244 Ga0163162_11366363 3300013306 Bacteria 806
245 Ga0157372_10028842 3300013307 Bacteria 6058
246 Ga0157372_10344977 3300013307 Bacteria 1735
247 Ga0157372_10544157 3300013307 Bacteria 1353
248 Ga0157372_10563282 3300013307 Bacteria 1328
249 Ga0157372_10863301 3300013307 Bacteria 1050
250 Ga0157372_11011355 3300013307 Bacteria 963
251 Ga0157372_11700200 3300013307 Bacteria 726
252 Ga0157375_10034623 3300013308 Bacteria 4813
253 Ga0157375_10160740 3300013308 Bacteria 2388
254 Ga0157375_10219689 3300013308 Bacteria 2059
255 Ga0157375_10379131 3300013308 Bacteria 1581
256 Ga0157375_10643094 3300013308 Bacteria 1217
257 Ga0157375_10732980 3300013308 Bacteria 1141
258 Ga0157375_10879156 3300013308 Bacteria 1041
259 Ga0157375_11001806 3300013308 Bacteria 975
260 Ga0157375_11316920 3300013308 Bacteria 849
261 Ga0163163_11032346 3300014325 Bacteria 885
262 Ga0157380_10165169 3300014326 Bacteria 1928
263 Ga0157380_10957883 3300014326 Bacteria 886
264 Ga0157380_12189714 3300014326 Bacteria 616
265 Ga0157380_12678787 3300014326 Bacteria 565
266 Ga0157380_13062449 3300014326 Bacteria 533
267 Ga0182008_10040061 3300014497 Bacteria 2340
268 Ga0182008_10046941 3300014497 Bacteria 2146
269 Ga0182008_10321853 3300014497 Bacteria 814
270 Ga0182008_10558235 3300014497 Bacteria 637
271 Ga0157377_10206301 3300014745 Bacteria 1251
272 Ga0157377_11026102 3300014745 Bacteria 626
273 Ga0157379_10134130 3300014968 Bacteria 2230
274 Ga0157379_11268113 3300014968 Bacteria 711
275 Ga0157376_10066159 3300014969 Bacteria 3054
276 Ga0157376_10274463 3300014969 Bacteria 1585
277 Ga0182006_1249420 3300015261 Bacteria 583
278 Ga0163161_10029059 3300017792 Bacteria 3929
279 Ga0163161_10142069 3300017792 Bacteria 1818
280 Ga0163161_10269852 3300017792 Bacteria 1331
281 Ga0163161_11233663 3300017792 Bacteria 648
282 Ga0184603_133284 3300019192 Bacteria 765
283 Ga0197907_10307493 3300020069 Bacteria 6708
284 Ga0197907_10608651 3300020069 Bacteria 5410
285 Ga0197907_10630705 3300020069 Bacteria 855
286 Ga0197907_10728872 3300020069 Bacteria 1354
287 Ga0197907_10866496 3300020069 Bacteria 2093
288 Ga0197907_11048701 3300020069 Bacteria 882
289 Ga0197907_11113641 3300020069 Bacteria 3671
290 Ga0206356_10068051 3300020070 Bacteria 2714
291 Ga0206356_10176009 3300020070 Bacteria 1803
292 Ga0206356_10355133 3300020070 Bacteria 2299
293 Ga0206349_1224696 3300020075 Bacteria 2294
294 Ga0206349_1425530 3300020075 Bacteria 859
295 Ga0206349_1536441 3300020075 Bacteria 2934
296 Ga0206355_1124023 3300020076 Bacteria 1008
297 Ga0206355_1327778 3300020076 Bacteria 1033
298 Ga0206355_1642650 3300020076 Bacteria 1097
299 Ga0206351_10105420 3300020077 Bacteria 744
300 Ga0206351_10173414 3300020077 Bacteria 1440
301 Ga0206351_10323992 3300020077 Bacteria 3756
302 Ga0206351_10432790 3300020077 Bacteria 4040
303 Ga0206351_10445423 3300020077 Bacteria 2108
304 Ga0206351_10828683 3300020077 Bacteria 5869
305 Ga0206352_10126105 3300020078 Bacteria 3946
306 Ga0206352_10517260 3300020078 Bacteria 4910
307 Ga0206352_10633471 3300020078 Bacteria 934
308 Ga0206352_10839668 3300020078 Bacteria 636
309 Ga0206350_10125668 3300020080 Bacteria 1551
310 Ga0206350_10401678 3300020080 Bacteria 915
311 Ga0206350_10669213 3300020080 Bacteria 1056
312 Ga0206350_10713574 3300020080 Bacteria 6297
313 Ga0206350_11614803 3300020080 Bacteria 1376
314 Ga0206354_10138557 3300020081 Bacteria 1737
315 Ga0206354_10424931 3300020081 Bacteria 1559
316 Ga0206354_10566456 3300020081 Bacteria 10006
317 Ga0206354_10730064 3300020081 Bacteria 2118
318 Ga0206354_10790317 3300020081 Bacteria 1704
319 Ga0206353_10548237 3300020082 Bacteria 25106
320 Ga0206353_10555370 3300020082 Bacteria 1904
321 Ga0206353_10564495 3300020082 Bacteria 1089
322 Ga0206353_10672241 3300020082 Bacteria 1765
323 Ga0206353_11125031 3300020082 Bacteria 3899
324 Ga0206353_11189061 3300020082 Bacteria 867
325 Ga0206353_11470156 3300020082 Bacteria 2696
326 Ga0154015_1029170 3300020610 Bacteria 1085
327 Ga0154015_1252405 3300020610 Bacteria 1123
328 Ga0154015_1594405 3300020610 Bacteria 928
329 Ga0213874_10016680 3300021377 Bacteria 1960
330 Ga0213876_10253305 3300021384 Bacteria 936
331 Ga0213875_10000102 3300021388 Bacteria 96815
332 Ga0224712_10001468 3300022467 Bacteria 5439
333 Ga0224712_10020064 3300022467 Bacteria 2263
334 Ga0224712_10029020 3300022467 Bacteria 1983
335 Ga0224712_10094320 3300022467 Bacteria 1259
336 Ga0224712_10219723 3300022467 Bacteria 869
337 Ga0224712_10377046 3300022467 Bacteria 674
338 Ga0209025_1034041 3300025294 Bacteria 2338
339 Ga0209051_1000021 3300025303 Bacteria 507633
340 Ga0207713_1056599 3300025735 Bacteria 1522
341 Ga0207692_10000388 3300025898 Bacteria 15180
342 Ga0207692_10018677 3300025898 Bacteria 3117
343 Ga0207710_10104924 3300025900 Bacteria 1337
344 Ga0207688_10018768 3300025901 Bacteria 3761
345 Ga0207688_10561084 3300025901 Bacteria 718
346 Ga0207680_10192755 3300025903 Bacteria 1384
347 Ga0207680_10270423 3300025903 Bacteria 1179
348 Ga0207647_10002418 3300025904 Bacteria 14155
349 Ga0207699_10078718 3300025906 Bacteria 2037
350 Ga0207699_10394798 3300025906 Bacteria 984
351 Ga0207645_10091949 3300025907 Bacteria 1951
352 Ga0207643_10002076 3300025908 Bacteria 11033
353 Ga0207643_10532004 3300025908 Bacteria 753
354 Ga0207643_10638079 3300025908 Bacteria 687
355 Ga0207705_10000473 3300025909 Bacteria 34432
356 Ga0207705_10000656 3300025909 Bacteria 28823
357 Ga0207705_10111512 3300025909 Bacteria 2022
358 Ga0207705_10311099 3300025909 Bacteria 1209
359 Ga0207654_10011248 3300025911 Bacteria 4561
360 Ga0207707_10000151 3300025912 Bacteria 72718
361 Ga0207707_10040361 3300025912 Bacteria 4076
362 Ga0207707_10505747 3300025912 Bacteria 1030
363 Ga0207695_10673985 3300025913 Bacteria 915
364 Ga0207671_10103889 3300025914 Bacteria 2155
365 Ga0207693_10123935 3300025915 Bacteria 2030
366 Ga0207693_10219262 3300025915 Bacteria 1495
367 Ga0207663_10069925 3300025916 Bacteria 2260
368 Ga0207663_10093553 3300025916 Bacteria 2001
369 Ga0207660_10000490 3300025917 Bacteria 26377
370 Ga0207660_10051770 3300025917 Bacteria 2920
371 Ga0207660_10320012 3300025917 Bacteria 1239
372 Ga0207660_10368250 3300025917 Bacteria 1154
373 Ga0207660_10953543 3300025917 Bacteria 700
374 Ga0207662_10151718 3300025918 Bacteria 1474
375 Ga0207657_10051387 3300025919 Bacteria 3583
376 Ga0207657_10408257 3300025919 Bacteria 1068
377 Ga0207649_10002292 3300025920 Bacteria 10764
378 Ga0207652_10000244 3300025921 Bacteria 56728
379 Ga0207652_10005388 3300025921 Bacteria 10382
380 Ga0207652_10010913 3300025921 Bacteria 7322
381 Ga0207652_10053044 3300025921 Bacteria 3482
382 Ga0207652_10320133 3300025921 Bacteria 1400
383 Ga0207646_10009734 3300025922 Bacteria 9470
384 Ga0207646_10271653 3300025922 Bacteria 1532
385 Ga0207681_10704273 3300025923 Bacteria 840
386 Ga0207694_10438450 3300025924 Bacteria 1090
387 Ga0207650_10002863 3300025925 Bacteria 11917
388 Ga0207659_10028015 3300025926 Bacteria 3822
389 Ga0207659_10145250 3300025926 Bacteria 1846
390 Ga0207687_10165793 3300025927 Bacteria 1699
391 Ga0207687_10949705 3300025927 Bacteria 736
392 Ga0207687_11921989 3300025927 Bacteria 506
393 Ga0207700_10005313 3300025928 Bacteria 7686
394 Ga0207700_10255552 3300025928 Bacteria 1498
395 Ga0207664_10013288 3300025929 Bacteria 5905
396 Ga0207664_10150420 3300025929 Bacteria 1977
397 Ga0207664_10540273 3300025929 Bacteria 1045
398 Ga0207644_10005580 3300025931 Bacteria 8190
399 Ga0207644_10842072 3300025931 Bacteria 768
400 Ga0207690_10061333 3300025932 Bacteria 2556
401 Ga0207690_10182574 3300025932 Bacteria 1581
402 Ga0207706_10023491 3300025933 Bacteria 5538
403 Ga0207706_10382012 3300025933 Bacteria 1222
404 Ga0207686_10385770 3300025934 Bacteria 1064
405 Ga0207686_10497504 3300025934 Bacteria 945
406 Ga0207709_10235125 3300025935 Bacteria 1330
407 Ga0207709_10441053 3300025935 Bacteria 1004
408 Ga0207670_10036590 3300025936 Bacteria 3193
409 Ga0207669_10731406 3300025937 Bacteria 816
410 Ga0207704_10711723 3300025938 Bacteria 832
411 Ga0207665_10208117 3300025939 Bacteria 1428
412 Ga0207665_10314386 3300025939 Bacteria 1174
413 Ga0207691_10155897 3300025940 Bacteria 2005
414 Ga0207691_10166739 3300025940 Bacteria 1930
415 Ga0207689_10000187 3300025942 Bacteria 53919
416 Ga0207661_10007069 3300025944 Bacteria 7968
417 Ga0207661_10051520 3300025944 Bacteria 3285
418 Ga0207661_10259967 3300025944 Bacteria 1546
419 Ga0207661_10661371 3300025944 Bacteria 960
420 Ga0207661_11604636 3300025944 Bacteria 595
421 Ga0207679_10003356 3300025945 Bacteria 9880
422 Ga0207679_10483402 3300025945 Bacteria 1103
423 Ga0207679_10495206 3300025945 Bacteria 1090
424 Ga0207667_10464664 3300025949 Bacteria 1285
425 Ga0207712_10130884 3300025961 Bacteria 1912
426 Ga0207668_10197731 3300025972 Bacteria 1598
427 Ga0207668_10345149 3300025972 Bacteria 1243
428 Ga0207668_11488911 3300025972 Bacteria 611
429 Ga0207640_10691655 3300025981 Bacteria 873
430 Ga0207658_10013386 3300025986 Bacteria 5602
431 Ga0207658_10022887 3300025986 Bacteria 4354
432 Ga0207658_10234070 3300025986 Bacteria 1552
433 Ga0207658_11082737 3300025986 Bacteria 732
434 Ga0207677_10029455 3300026023 Bacteria 3489
435 Ga0207677_10165088 3300026023 Bacteria 1725
436 Ga0207703_10151595 3300026035 Bacteria 2022
437 Ga0207639_10086732 3300026041 Bacteria 2493
438 Ga0207678_10001304 3300026067 Bacteria 23126
439 Ga0207678_10702470 3300026067 Bacteria 890
440 Ga0207708_10258951 3300026075 Bacteria 1404
441 Ga0207708_10493775 3300026075 Bacteria 1025
442 Ga0207702_10035607 3300026078 Bacteria 4162
443 Ga0207702_10051266 3300026078 Bacteria 3486
444 Ga0207641_10012905 3300026088 Bacteria 6854
445 Ga0207641_11075322 3300026088 Bacteria 803
446 Ga0207648_10128853 3300026089 Bacteria 2226
447 Ga0207676_10004752 3300026095 Bacteria 9634
448 Ga0207676_11119889 3300026095 Bacteria 779
449 Ga0207674_10282074 3300026116 Bacteria 1609
450 Ga0207674_10343894 3300026116 Bacteria 1442
451 Ga0207674_10369428 3300026116 Bacteria 1387
452 Ga0207675_101072279 3300026118 Bacteria 825
453 Ga0207683_10003495 3300026121 Bacteria 13712
454 Ga0207683_10348221 3300026121 Bacteria 1359
455 Ga0207683_10748938 3300026121 Bacteria 906
456 Ga0207698_10011335 3300026142 Bacteria 5773
457 Ga0207698_10990795 3300026142 Bacteria 851
458 Ga0209813_10026252 3300027866 Bacteria 1683
459 Ga0209813_10054887 3300027866 Bacteria 1257
460 Ga0209974_10088590 3300027876 Bacteria 1071
461 Ga0207428_10030086 3300027907 Bacteria 4491
462 Ga0268266_10000855 3300028379 Bacteria 39694
463 Ga0268266_10091196 3300028379 Bacteria 2672
464 Ga0268266_10102032 3300028379 Bacteria 2530
465 Ga0268266_10627677 3300028379 Bacteria 1033
466 Ga0268266_11658644 3300028379 Bacteria 615
467 Ga0268265_11928816 3300028380 Bacteria 598
468 Ga0268264_10000717 3300028381 Bacteria 38073
469 Ga0268264_10415167 3300028381 Bacteria 1297
470 Ga0265336_10013779 3300028666 Bacteria 2690
471 Ga0307517_10283573 3300028786 Bacteria 942
472 Ga0265338_10001554 3300028800 Bacteria 37076
473 Ga0316177_1209821 3300030731 Bacteria 1353
474 Ga0316176_1061306 3300030732 Bacteria 5399
475 Ga0314311_1084681 3300030733 Bacteria 3338
476 Ga0314311_1113072 3300030733 Bacteria 904
477 Ga0316178_1152700 3300030735 Bacteria 703
478 Ga0316180_1121628 3300030736 Bacteria 1125
479 Ga0316182_1129288 3300030745 Bacteria 917
480 Ga0265767_102761 3300030836 Bacteria 959
481 Ga0265327_10000081 3300031251 Bacteria 205988
482 Ga0265327_10002020 3300031251 Bacteria 22893
483 Ga0265327_10027896 3300031251 Bacteria 3241
484 Ga0265327_10113483 3300031251 Bacteria 1292
485 Ga0307408_100839563 3300031548 Bacteria 837
486 Ga0316579_10185689 3300031691 Bacteria 1005
487 Ga0316576_10046001 3300031727 Bacteria 3157
488 Ga0316576_10107854 3300031727 Bacteria 2086
489 Ga0316578_10017290 3300031728 Bacteria 3921
490 Ga0307516_10665113 3300031730 Bacteria 697
491 Ga0307405_10211453 3300031731 Bacteria 1416
492 Ga0307518_10001710 3300031838 Bacteria 16204
493 Ga0307410_10092703 3300031852 Bacteria 2148
494 Ga0307407_10471088 3300031903 Bacteria 915
495 Ga0307407_10516401 3300031903 Bacteria 878
496 Ga0307407_10899419 3300031903 Bacteria 679
497 Ga0307412_10095212 3300031911 Bacteria 2093
498 Ga0307412_10243357 3300031911 Bacteria 1393
499 Ga0307412_10665408 3300031911 Bacteria 890
500 Ga0307409_100143537 3300031995 Bacteria 2061
501 Ga0307409_100216210 3300031995 Bacteria 1727
502 Ga0307409_100257831 3300031995 Bacteria 1598
503 Ga0307409_100476434 3300031995 Bacteria 1210
504 Ga0307409_101910262 3300031995 Bacteria 623
505 Ga0307416_100345455 3300032002 Bacteria 1503
506 Ga0307416_100380666 3300032002 Bacteria 1441
507 Ga0307416_100919547 3300032002 Bacteria 975
508 Ga0307411_10251063 3300032005 Bacteria 1391
509 Ga0307415_100080821 3300032126 Bacteria 2320
510 Ga0307415_100134833 3300032126 Bacteria 1876
511 Ga0307415_100171992 3300032126 Bacteria 1690
512 Ga0307415_100976632 3300032126 Bacteria 786
513 Ga0316583_10143138 3300032133 Bacteria 833
514 Ga0316585_10003099 3300032137 Bacteria 4538
515 Ga0307507_10009186 3300033179 Bacteria 13276
516 Ga0316596_1001886 3300033541 Bacteria 4382
517 Ga0373926_0134434 3300035083 Bacteria 937
518 Ga0373934_0000025 3300035086 Bacteria 49119
519 Ga0373934_0021200 3300035086 Bacteria 2503
520 Ga0373934_0098840 3300035086 Bacteria 1179
521 Ga0373923_0004992 3300035111 Bacteria 4463
522 Ga0373936_0237260 3300035113 Bacteria 812
523 Ga0373953_0002033 3300035117 Bacteria 6020
524 Ga0373953_0091134 3300035117 Bacteria 1275
525 Ga0373954_0004039 3300035118 Bacteria 6276
526 Ga0373954_0080673 3300035118 Bacteria 1554
527 Ga0373956_0000185 3300035119 Bacteria 23799
528 Ga0373956_0017925 3300035119 Bacteria 2993
529 Ga0373957_0000293 3300035120 Bacteria 12511
530 Ga0373943_0013820 3300035170 Bacteria 3650
531 Ga0373943_0036774 3300035170 Bacteria 2346
532 Ga0373955_0000237 3300035172 Bacteria 22889
533 Ga0373955_0119373 3300035172 Bacteria 1531
534 Ga0316574_0000101 3300035398 Bacteria 24989
535 Ga0316574_0006776 3300035398 Bacteria 6225
536 Ga0316574_0019054 3300035398 Bacteria 4045
537 Ga0373924_0004268 3300035410 Bacteria 4981
538 Ga0373924_0006427 3300035410 Bacteria 4212
539 Ga0373935_0048565 3300035692 Bacteria 2687
540 Ga0373935_0067374 3300035692 Bacteria 2301
541 Ga0373935_0199714 3300035692 Bacteria 1381
542 Ga0373927_0183574 3300035695 Bacteria 1372
543 Ga0373927_0615835 3300035695 Bacteria 718
544 Ga0373933_0000001 3300035724 Bacteria 228234
545 Ga0373933_0002913 3300035724 Bacteria 9555
546 Ga0373933_0042008 3300035724 Bacteria 2701
547 Ga0373947_0275547 3300035725 Bacteria 1117
548 Ga0373937_0000087 3300036401 Bacteria 85654
549 Ga0373937_0001426 3300036401 Bacteria 19986
550 Ga0316582_0007605 3300036647 Bacteria 5776
551 Ga0316584_0001043 3300036712 Bacteria 16095
552 Ga0316584_0185399 3300036712 Bacteria 1539
553 Ga0373925_0528843 3300037068 Bacteria 969
554 Ga0395900_0194724 3300037418 Bacteria 2054
555 Ga0395900_0355808 3300037418 Bacteria 1437
556 Ga0395900_0837218 3300037418 Bacteria 846
557 Ga0395900_1304358 3300037418 Bacteria 640
558 Ga0395898_0106879 3300037466 Bacteria 2684
559 Ga0395898_0596916 3300037466 Bacteria 1047
560 Ga0395898_0669904 3300037466 Bacteria 980
561 Ga0395898_1271121 3300037466 Bacteria 666
562 Ga0395905_0269311 3300037471 Bacteria 1589
563 Ga0436364_0024361 3300037853 Bacteria 1645
564 Ga0436364_0940223 3300037853 Bacteria 123217
565 Ga0395901_0014105 3300038443 Bacteria 8135
566 Ga0395901_0022089 3300038443 Bacteria 6520
567 Ga0395901_0029427 3300038443 Bacteria 5656
568 Ga0395901_0095690 3300038443 Bacteria 3112
569 Ga0395901_1310911 3300038443 Bacteria 685
570 Ga0436365_1397305 3300039437 Bacteria 676
571 Ga0439438_046980 3300041405 Bacteria 1108
572 Ga0439447_021920 3300041407 Bacteria 1678
573 Ga0439466_0137760 3300041411 Bacteria 750
574 Ga0451791_1849534 3300041451 Bacteria 548
575 Ga0451793_0052377 3300041452 Bacteria 623
576 Ga0451793_1932876 3300041452 Bacteria 558
577 Ga0451795_1629950 3300041456 Bacteria 931
578 Ga0451843_1590515 3300041509 Bacteria 741
579 Ga0451853_0584877 3300041512 Bacteria 859
580 Ga0451853_1644521 3300041512 Bacteria 670
581 Ga0451853_1897627 3300041512 Bacteria 617
582 Ga0439431_0005548 3300041997 Bacteria 2783
583 Ga0439448_0005283 3300042005 Bacteria 3680
584 Ga0439450_169893 3300042008 Bacteria 577
585 Ga0439463_014614 3300042016 Bacteria 1937
586 Ga0439446_0009340 3300042156 Bacteria 2624
587 Ga0439458_0004896 3300042157 Bacteria 3040
588 Ga0450909_028179 3300042185 Bacteria 848
589 Ga0439434_0006140 3300042435 Bacteria 3503
590 Ga0439459_0032052 3300042438 Bacteria 1075
591 Ga0450918_044740 3300042531 Bacteria 799
592 Ga0466972_0014657 3300044658 Bacteria 3924
593 Ga0466972_0020311 3300044658 Bacteria 3319
594 Ga0466972_0120626 3300044658 Bacteria 1237
595 Ga0466965_0001357 3300044683 Bacteria 9813
596 Ga0466965_0006241 3300044683 Bacteria 5393
597 Ga0466965_0258667 3300044683 Bacteria 935
598 Ga0466965_0474111 3300044683 Bacteria 699
599 Ga0466966_0154379 3300044684 Bacteria 1399
600 Ga0466966_0642177 3300044684 Bacteria 639
601 Ga0466961_0046581 3300044693 Bacteria 2773
602 Ga0466961_0165609 3300044693 Bacteria 1376
603 Ga0466961_0290484 3300044693 Bacteria 1000
604 Ga0466963_0077264 3300044694 Bacteria 2249
605 Ga0466963_0157850 3300044694 Bacteria 1578
606 Ga0466963_0251642 3300044694 Bacteria 1240
607 Ga0466963_0310667 3300044694 Bacteria 1109
608 Ga0466963_0310832 3300044694 Bacteria 1109
609 Ga0466963_0750558 3300044694 Bacteria 688
610 Ga0466963_0900181 3300044694 Bacteria 624
611 Ga0466964_0039878 3300044706 Bacteria 1894
612 Ga0466964_0043935 3300044706 Bacteria 1814
613 Ga0466964_0248163 3300044706 Bacteria 876
614 Ga0466971_0010225 3300044719 Bacteria 4099
615 Ga0466968_0079260 3300044735 Bacteria 1441
616 Ga0466970_0019209 3300044765 Bacteria 3541
617 Ga0466970_0382919 3300044765 Bacteria 801
618 Ga0466970_0436853 3300044765 Bacteria 749
619 Ga0466957_0018276 3300044842 Bacteria 4116
620 Ga0466957_0094201 3300044842 Bacteria 1880
621 Ga0466957_0172726 3300044842 Bacteria 1408
622 Ga0466957_0357030 3300044842 Bacteria 992
623 Ga0466960_0001488 3300044901 Bacteria 8545
624 Ga0466960_0001500 3300044901 Bacteria 8502
625 Ga0466960_0288613 3300044901 Bacteria 921
626 Ga0466960_0291335 3300044901 Bacteria 917
627 Ga0466960_0350482 3300044901 Bacteria 842
628 Ga0466959_0191154 3300045049 Bacteria 1429
629 Ga0466959_0365902 3300045049 Bacteria 982
630 Ga0466958_0002768 3300045836 Bacteria 8909
631 Ga0466958_0020682 3300045836 Bacteria 3840
632 Ga0466958_0150434 3300045836 Bacteria 1468
633 Ga0466967_0001887 3300045976 Bacteria 12656
634 Ga0466967_0012785 3300045976 Bacteria 6448
635 Ga0466967_0029228 3300045976 Bacteria 4610
636 Ga0466967_0043439 3300045976 Bacteria 3891
637 Ga0466967_0065799 3300045976 Bacteria 3228
638 Ga0466967_0087235 3300045976 Bacteria 2828
639 Ga0466967_0131381 3300045976 Bacteria 2325
640 Ga0466967_0177604 3300045976 Bacteria 2006
641 Ga0466967_0201091 3300045976 Bacteria 1887
642 Ga0466967_0267858 3300045976 Bacteria 1636
643 Ga0466967_0317676 3300045976 Bacteria 1501
644 Ga0466967_1107971 3300045976 Bacteria 789
645 Ga0466967_1140789 3300045976 Bacteria 777
646 Ga0495592_0000002 3300046454 Bacteria 209491
647 Ga0495592_0005811 3300046454 Bacteria 9145
648 Ga0495592_0081388 3300046454 Bacteria 2341
649 Ga0495603_0016498 3300046455 Bacteria 4469
650 Ga0495603_0033526 3300046455 Bacteria 3090
651 Ga0495629_0009112 3300046459 Bacteria 7269
652 Ga0495629_0022210 3300046459 Bacteria 4525
653 Ga0495629_0082051 3300046459 Bacteria 2250
654 Ga0495641_0004743 3300046461 Bacteria 9472
655 Ga0495641_0064410 3300046461 Bacteria 1651
656 Ga0495641_0355341 3300046461 Bacteria 663
657 Ga0495651_0000002 3300046462 Bacteria 209492
658 Ga0495651_0026865 3300046462 Bacteria 4482
659 Ga0495651_0060501 3300046462 Bacteria 2900
660 Ga0495653_0001815 3300046463 Bacteria 16827
661 Ga0495653_0036309 3300046463 Bacteria 3882
662 Ga0495653_0069805 3300046463 Bacteria 2630
663 Ga0495653_0089779 3300046463 Bacteria 2250
664 Ga0495580_0105024 3300046472 Bacteria 1963
665 Ga0495582_0007863 3300046473 Bacteria 5891
666 Ga0495639_0263348 3300046475 Bacteria 854
667 Ga0495662_0006974 3300046476 Bacteria 5614
668 Ga0495662_0159438 3300046476 Bacteria 1111
669 Ga0495664_0034672 3300046477 Bacteria 2969
670 Ga0495594_0029589 3300046499 Bacteria 2961
671 Ga0495607_0029787 3300046501 Bacteria 3358
672 Ga0495608_0000118 3300046511 Bacteria 56564
673 Ga0495608_0059867 3300046511 Bacteria 2507
674 Ga0495618_0070337 3300046514 Bacteria 2225
675 Ga0495618_0180519 3300046514 Bacteria 1341
676 Ga0495628_0000103 3300046516 Bacteria 68469
677 Ga0495628_0178997 3300046516 Bacteria 1604
678 Ga0495630_0032799 3300046517 Bacteria 3871
679 Ga0495630_0244650 3300046517 Bacteria 1370
680 Ga0495630_0474682 3300046517 Bacteria 959
681 Ga0495630_0561814 3300046517 Bacteria 875
682 Ga0495666_0011982 3300046526 Bacteria 4328
683 Ga0495652_0000091 3300046529 Bacteria 96848
684 Ga0495665_0058695 3300046531 Bacteria 2031
685 Ga0495640_0024191 3300046533 Bacteria 4419
686 Ga0495587_0000013 3300046536 Bacteria 195619
687 Ga0495645_0026680 3300046543 Bacteria 4193
688 Ga0495645_0216039 3300046543 Bacteria 1292
689 Ga0495667_0000016 3300046559 Bacteria 195635
690 Ga0495667_0003863 3300046559 Bacteria 10052
691 Ga0495667_0033817 3300046559 Bacteria 3420
692 Ga0495634_0012517 3300046642 Bacteria 6138
693 Ga0495634_0701142 3300046642 Bacteria 582
694 Ga0495635_0018288 3300046663 Bacteria 4891
695 Ga0495635_0022276 3300046663 Bacteria 4411
696 Ga0495635_0067167 3300046663 Bacteria 2459
697 Ga0495635_0490978 3300046663 Bacteria 809
698 Ga0495657_0000014 3300046675 Bacteria 195574
699 Ga0495657_0027640 3300046675 Bacteria 4000
700 Ga0495599_0000006 3300046678 Bacteria 283487
701 Ga0495599_0003147 3300046678 Bacteria 9615
702 Ga0495599_0185988 3300046678 Bacteria 1279
703 Ga0495623_0000537 3300046679 Bacteria 25204
704 Ga0495623_0014183 3300046679 Bacteria 5161
705 Ga0495623_0027659 3300046679 Bacteria 3651
706 Ga0495623_0060312 3300046679 Bacteria 2380
707 Ga0495646_0004781 3300046680 Bacteria 8551
708 Ga0495646_0005699 3300046680 Bacteria 7890
709 Ga0495647_0004220 3300046681 Bacteria 4653
710 Ga0495647_0341257 3300046681 Bacteria 681
711 Ga0495658_0186447 3300046683 Bacteria 1288
712 Ga0495669_0005292 3300046684 Bacteria 5376
713 Ga0495613_0013377 3300046689 Bacteria 6095
714 Ga0495624_0259066 3300046690 Bacteria 1051
715 Ga0495624_0323613 3300046690 Bacteria 928
716 Ga0495649_0444596 3300046694 Bacteria 648
717 Ga0495600_0003129 3300046809 Bacteria 9692
718 Ga0495600_0025754 3300046809 Bacteria 3791
719 Ga0495600_0104960 3300046809 Bacteria 1841
720 Ga0495581_0016627 3300047315 Bacteria 4276
721 Ga0495581_0020125 3300047315 Bacteria 3874
722 Ga0495581_0073409 3300047315 Bacteria 1979
723 Ga0495604_0000015 3300047317 Bacteria 195635
724 Ga0495604_0003750 3300047317 Bacteria 12100
725 Ga0495604_0004336 3300047317 Bacteria 11232
726 Ga0495604_0006697 3300047317 Bacteria 9134
727 Ga0495674_0062948 3300047319 Bacteria 3228
728 Ga0495674_0088995 3300047319 Bacteria 2639
729 Ga0495674_0244692 3300047319 Bacteria 1477
730 Ga0495676_0100184 3300047321 Bacteria 2145
731 Ga0495676_0243739 3300047321 Bacteria 1229
732 Ga0495680_0000380 3300047322 Bacteria 49632
733 Ga0495683_0000189 3300047323 Bacteria 59252
734 Ga0495675_0000648 3300047444 Bacteria 22080
735 Ga0495675_0037089 3300047444 Bacteria 3106
736 Ga0495675_0052697 3300047444 Bacteria 2583
737 Ga0495675_0078551 3300047444 Bacteria 2078
738 Ga0495684_0008195 3300047471 Bacteria 8088
739 Ga0495684_0020878 3300047471 Bacteria 5046
740 Ga0495684_0340939 3300047471 Bacteria 1066
741 Ga0495593_0004255 3300047673 Bacteria 8518
742 Ga0495593_0031232 3300047673 Bacteria 2911
743 Ga0495602_0000013 3300048088 Bacteria 195591
744 Ga0495602_0148521 3300048088 Bacteria 1845
745 Ga0495614_0163091 3300048089 Bacteria 998
746 Ga0496100_0000011 3300048903 Bacteria 190969
747 Ga0496100_0040429 3300048903 Bacteria 2967
748 Ga0496101_0000279 3300048904 Bacteria 36022
749 Ga0496101_0098276 3300048904 Bacteria 2187
750 Ga0496102_0010258 3300048905 Bacteria 8055
751 Ga0496102_0028415 3300048905 Bacteria 4995
752 Ga0496102_0125213 3300048905 Bacteria 2402
753 Ga0496102_0791367 3300048905 Bacteria 871
754 Ga0496103_0101727 3300048906 Bacteria 1819
755 Ga0496104_0016929 3300048907 Bacteria 6631
756 Ga0496104_0223850 3300048907 Bacteria 1794
757 Ga0496104_0860193 3300048907 Bacteria 812
758 Ga0496104_1010177 3300048907 Bacteria 736
759 Ga0496105_0016569 3300048908 Bacteria 5885
760 Ga0496105_0018189 3300048908 Bacteria 5642
761 Ga0496105_0235412 3300048908 Bacteria 1487
762 Ga0496106_0013771 3300048909 Bacteria 5975
763 Ga0496106_0145691 3300048909 Bacteria 1865
764 Ga0496107_0001343 3300048910 Bacteria 15104
765 Ga0496107_0021477 3300048910 Bacteria 4562
766 Ga0496107_0279325 3300048910 Bacteria 1243
767 Ga0496108_0012162 3300048911 Bacteria 6998
768 Ga0496108_0029511 3300048911 Bacteria 4542
769 Ga0496109_0000179 3300048912 Bacteria 62857
770 Ga0496109_0358060 3300048912 Bacteria 1379
771 Ga0496109_0414059 3300048912 Bacteria 1273
772 Ga0496109_1285082 3300048912 Bacteria 668
773 Ga0496109_1449996 3300048912 Bacteria 622
774 Ga0496110_0021491 3300048913 Bacteria 5465
775 Ga0496110_0027924 3300048913 Bacteria 4841
776 Ga0496110_0085957 3300048913 Bacteria 2807
777 Ga0496110_0237645 3300048913 Bacteria 1658
778 Ga0496110_0806870 3300048913 Bacteria 843
779 Ga0496111_0003662 3300048914 Bacteria 9540
780 Ga0496111_0023696 3300048914 Bacteria 4311
781 Ga0496112_0209971 3300048915 Bacteria 1904
782 Ga0496112_0707271 3300048915 Bacteria 935
783 Ga0496113_0208740 3300048916 Bacteria 1554
784 Ga0496113_0389447 3300048916 Bacteria 1119
785 Ga0496114_0003812 3300048917 Bacteria 11626
786 Ga0496114_0053410 3300048917 Bacteria 3368
787 Ga0496114_0057190 3300048917 Bacteria 3256
788 Ga0496114_0294101 3300048917 Bacteria 1433
789 Ga0496114_0324560 3300048917 Bacteria 1360
790 Ga0496114_0630216 3300048917 Bacteria 944
791 Ga0496115_0064507 3300048918 Bacteria 2957
792 Ga0496115_0345152 3300048918 Bacteria 1215
793 Ga0496115_0484963 3300048918 Bacteria 995
794 Ga0496116_0148454 3300048919 Bacteria 1306
795 Ga0496117_0038461 3300048920 Bacteria 3546
796 Ga0496118_0092036 3300048921 Bacteria 2083
797 Ga0496119_0028285 3300048922 Bacteria 3829
798 Ga0496120_0005714 3300048923 Bacteria 9810
799 Ga0496121_0000014 3300048924 Bacteria 609379
800 Ga0496122_0000084 3300048925 Bacteria 208740
801 Ga0496123_0008199 3300048926 Bacteria 9634
802 Ga0496124_0000019 3300048927 Bacteria 436995
803 Ga0496125_0000014 3300048928 Bacteria 610124
804 Ga0496126_0000017 3300048929 Bacteria 610676
805 Ga0501306_015256 3300049127 Bacteria 1021
806 Ga0501308_006849 3300049128 Bacteria 1180
807 Ga0501309_013640 3300049129 Bacteria 1083
808 Ga0501310_020126 3300049130 Bacteria 826
809 Ga0501307_006654 3300049162 Bacteria 1255
810 Ga0501311_004955 3300049527 Bacteria 1439
811 Ga0501317_008593 3300049533 Bacteria 1180
812 Ga0501317_026512 3300049533 Bacteria 818
813 Ga0501318_001413 3300049534 Bacteria 1881
814 Ga0501319_001136 3300049535 Bacteria 1477
815 Ga0501321_000627 3300049537 Bacteria 2386
816 Ga0501322_006931 3300049538 Bacteria 816
817 Ga0501323_001085 3300049539 Bacteria 2295
818 Ga0501324_002030 3300049540 Bacteria 1427
819 Ga0501325_000688 3300049541 Bacteria 1758
820 Ga0501031_0003650 3300049568 Bacteria 9906
821 Ga0501031_0304136 3300049568 Bacteria 1033
822 Ga0501032_0074653 3300049569 Bacteria 2259
823 Ga0501032_0099477 3300049569 Bacteria 1927
824 Ga0501032_0134306 3300049569 Bacteria 1631
825 Ga0501032_0233761 3300049569 Bacteria 1195
826 Ga0501032_0328178 3300049569 Bacteria 987
827 Ga0501033_0002669 3300049570 Bacteria 14983
828 Ga0501033_0048077 3300049570 Bacteria 3170
829 Ga0501033_0167383 3300049570 Bacteria 1580
830 Ga0501034_0002988 3300049571 Bacteria 19576
831 Ga0501034_0035968 3300049571 Bacteria 5021
832 Ga0501034_0228795 3300049571 Bacteria 1809
833 Ga0501034_0873124 3300049571 Bacteria 789
834 Ga0501036_0000969 3300049572 Bacteria 21651
835 Ga0501036_0015857 3300049572 Bacteria 6292
836 Ga0501036_0055657 3300049572 Bacteria 3351
837 Ga0501036_0208687 3300049572 Bacteria 1642
838 Ga0501036_0324593 3300049572 Bacteria 1286
839 Ga0501036_0493729 3300049572 Bacteria 1019
840 Ga0501036_0864117 3300049572 Bacteria 743
841 Ga0501037_0001113 3300049573 Bacteria 19944
842 Ga0501037_0031006 3300049573 Bacteria 3948
843 Ga0501037_0054327 3300049573 Bacteria 2929
844 Ga0501037_0063516 3300049573 Bacteria 2691
845 Ga0501037_0255794 3300049573 Bacteria 1225
846 Ga0501038_0013668 3300049574 Bacteria 7399
847 Ga0501038_0035313 3300049574 Bacteria 4389
848 Ga0501038_0109372 3300049574 Bacteria 2290
849 Ga0501038_0122067 3300049574 Bacteria 2147
850 Ga0501038_0137388 3300049574 Bacteria 2002
851 Ga0501038_0830146 3300049574 Bacteria 685
852 Ga0501039_0002962 3300049575 Bacteria 12708
853 Ga0501039_0066265 3300049575 Bacteria 2803
854 Ga0501039_0093748 3300049575 Bacteria 2340
855 Ga0501039_0397219 3300049575 Bacteria 1083
856 Ga0501039_0737570 3300049575 Bacteria 769
857 Ga0501039_0855910 3300049575 Bacteria 708
858 Ga0501039_1184792 3300049575 Bacteria 591
859 Ga0501041_0028069 3300049577 Bacteria 3394
860 Ga0501041_0154286 3300049577 Bacteria 1435
861 Ga0501042_0022647 3300049578 Bacteria 4389
862 Ga0501042_0027714 3300049578 Bacteria 3985
863 Ga0501042_0037806 3300049578 Bacteria 3426
864 Ga0501042_0087874 3300049578 Bacteria 2230
865 Ga0501042_0117964 3300049578 Bacteria 1910
866 Ga0501042_0189207 3300049578 Bacteria 1485
867 Ga0501042_0603936 3300049578 Bacteria 798
868 Ga0501043_0005373 3300049579 Bacteria 10344
869 Ga0501043_0040876 3300049579 Bacteria 3644
870 Ga0501043_0296988 3300049579 Bacteria 1235
871 Ga0501043_0469952 3300049579 Bacteria 943
872 Ga0501043_1215758 3300049579 Bacteria 529
873 Ga0501046_0012603 3300049580 Bacteria 7189
874 Ga0501046_0059062 3300049580 Bacteria 3005
875 Ga0501046_0415216 3300049580 Bacteria 971
876 Ga0501047_0000015 3300049581 Bacteria 307932
877 Ga0501047_0073384 3300049581 Bacteria 3294
878 Ga0501047_0214989 3300049581 Bacteria 1779
879 Ga0501047_0232510 3300049581 Bacteria 1696
880 Ga0501047_0321687 3300049581 Bacteria 1386
881 Ga0501047_0670292 3300049581 Bacteria 856
882 Ga0501048_0003907 3300049582 Bacteria 11320
883 Ga0501048_0028534 3300049582 Bacteria 4051
884 Ga0501048_0034976 3300049582 Bacteria 3620
885 Ga0501048_0055269 3300049582 Bacteria 2818
886 Ga0501048_0290415 3300049582 Bacteria 1163
887 Ga0501067_0797933 3300049583 Bacteria 532
888 Ga0501068_0081150 3300049584 Bacteria 1991
889 Ga0501068_0288397 3300049584 Bacteria 1050
890 Ga0501068_0523673 3300049584 Bacteria 770
891 Ga0501069_0070056 3300049585 Bacteria 1964
892 Ga0501069_0103529 3300049585 Bacteria 1617
893 Ga0501069_0447619 3300049585 Bacteria 767
894 Ga0501069_0800164 3300049585 Bacteria 571
895 Ga0501070_0018361 3300049586 Bacteria 5868
896 Ga0501070_0049598 3300049586 Bacteria 3486
897 Ga0501070_0425441 3300049586 Bacteria 1072
898 Ga0501070_1205284 3300049586 Bacteria 581
899 Ga0501071_0225399 3300049587 Bacteria 1411
900 Ga0501071_0433146 3300049587 Bacteria 1006
901 Ga0501071_1003811 3300049587 Bacteria 645
902 Ga0501072_0044766 3300049588 Bacteria 3480
903 Ga0501072_0072403 3300049588 Bacteria 2724
904 Ga0501072_0120059 3300049588 Bacteria 2094
905 Ga0501072_1197328 3300049588 Bacteria 590
906 Ga0501073_0010455 3300049589 Bacteria 6805
907 Ga0501073_0075878 3300049589 Bacteria 2340
908 Ga0501073_0255259 3300049589 Bacteria 1210
909 Ga0501073_1240604 3300049589 Bacteria 511
910 Ga0501074_0005245 3300049590 Bacteria 9323
911 Ga0501074_0328171 3300049590 Bacteria 1086
912 Ga0501074_0388248 3300049590 Bacteria 990
913 Ga0501074_0586729 3300049590 Bacteria 788
914 Ga0501074_0743271 3300049590 Bacteria 692
915 Ga0501075_0083788 3300049591 Bacteria 2415
916 Ga0501076_0289695 3300049592 Bacteria 1341
917 Ga0501079_0044004 3300049741 Bacteria 3446
918 Ga0501079_0355034 3300049741 Bacteria 1149
919 Ga0501079_0360662 3300049741 Bacteria 1139
920 Ga0501080_0028663 3300049742 Bacteria 5183
921 Ga0501080_0070715 3300049742 Bacteria 3246
922 Ga0501081_0063064 3300049743 Bacteria 2572
923 Ga0501081_0365825 3300049743 Bacteria 1064
924 Ga0501035_0002047 3300049822 Bacteria 20101
925 Ga0501035_0075383 3300049822 Bacteria 2983
926 Ga0501035_0867527 3300049822 Bacteria 717
927 Ga0501044_0006225 3300049823 Bacteria 13190
928 Ga0501044_0017172 3300049823 Bacteria 7765
929 Ga0501044_0090982 3300049823 Bacteria 3077
930 Ga0501044_0197724 3300049823 Bacteria 1970
931 Ga0501044_0615234 3300049823 Bacteria 978
932 Ga0501045_0123449 3300049824 Bacteria 1923
933 Ga0501045_0148940 3300049824 Bacteria 1741
934 Ga0501045_0186017 3300049824 Bacteria 1548
935 Ga0501045_0201090 3300049824 Bacteria 1484
936 nmdc:mga03683_185670_c1 3300050489 Bacteria 950
937 nmdc:mga03683_208411_c1 3300050489 Bacteria 899
938 nmdc:mga03683_37713_c1 3300050489 Bacteria 1971
939 nmdc:mga03n38_15185_c1 3300050490 Bacteria 2969
940 nmdc:mga03n38_342779_c1 3300050490 Bacteria 811
941 nmdc:mga03n38_348272_c1 3300050490 Bacteria 806
942 nmdc:mga03n38_351088_c1 3300050490 Bacteria 803
943 nmdc:mga03n38_395767_c1 3300050490 Bacteria 760
944 nmdc:mga03n38_488798_c1 3300050490 Bacteria 689
945 nmdc:mga03n38_51524_c1 3300050490 Bacteria 1839
946 nmdc:mga00v17_147997_c1 3300050491 Bacteria 1508
947 nmdc:mga00v17_186502_c1 3300050491 Bacteria 1339
948 nmdc:mga00v17_21827_c1 3300050491 Bacteria 3686
949 nmdc:mga00v17_278073_c1 3300050491 Bacteria 1087
950 nmdc:mga00v17_301922_c1 3300050491 Bacteria 1040
951 nmdc:mga00v17_31654_c1 3300050491 Bacteria 3121
952 nmdc:mga00v17_401253_c1 3300050491 Bacteria 891
953 nmdc:mga00v17_403240_c1 3300050491 Bacteria 889
954 nmdc:mga00v17_72542_c1 3300050491 Bacteria 2136
955 nmdc:mga0yw44_108427_c1 3300050492 Bacteria 1777
956 nmdc:mga0yw44_14822_c1 3300050492 Bacteria 4153
957 nmdc:mga0yw44_160589_c1 3300050492 Bacteria 1471
958 nmdc:mga0yw44_161341_c1 3300050492 Bacteria 1468
959 nmdc:mga0yw44_182003_c2 3300050492 Bacteria 963
960 nmdc:mga0yw44_18790_c1 3300050492 Bacteria 3795
961 nmdc:mga0yw44_3102_c1 3300050492 Bacteria 7286
962 nmdc:mga0yw44_320526_c1 3300050492 Bacteria 1041
963 nmdc:mga0yw44_45853_c1 3300050492 Bacteria 2623
964 nmdc:mga0yw44_68740_c1 3300050492 Bacteria 2192
965 nmdc:mga0yw44_9272_c1 3300050492 Bacteria 4961
966 nmdc:mga06z11_233607_c1 3300050494 Bacteria 1078
967 nmdc:mga06z11_503929_c1 3300050494 Bacteria 734
968 nmdc:mga06z11_88401_c1 3300050494 Bacteria 1678
969 nmdc:mga04h51_16342_c1 3300050495 Bacteria 2154
970 nmdc:mga07m45_195199_c1 3300050496 Bacteria 1177
971 nmdc:mga07m45_285954_c1 3300050496 Bacteria 959
972 nmdc:mga07m45_35624_c1 3300050496 Bacteria 2769
973 nmdc:mga07m45_46119_c1 3300050496 Bacteria 2448
974 nmdc:mga07m45_504539_c1 3300050496 Bacteria 700
975 nmdc:mga07m45_575485_c1 3300050496 Bacteria 651
976 nmdc:mga07m45_66009_c1 3300050496 Bacteria 2055
977 nmdc:mga07m45_76768_c1 3300050496 Bacteria 1905
978 nmdc:mga05p37_18110_c1 3300050507 Bacteria 8509
979 nmdc:mga05p37_80286_c1 3300050507 Bacteria 4018
980 nmdc:mga09592_109785_c1 3300050508 Bacteria 2366
981 nmdc:mga09592_1569591_c1 3300050508 Bacteria 534
982 nmdc:mga0qj67_301391_c1 3300050509 Bacteria 1298
983 nmdc:mga06r32_407330_c1 3300050510 Bacteria 1342
984 nmdc:mga06r32_5495_c1 3300050510 Bacteria 11415
985 nmdc:mga08y16_64549_c1 3300050511 Bacteria 3823
986 nmdc:mga0n895_16639_c1 3300050512 Bacteria 6754
987 nmdc:mga0rr50_479314_c1 3300050513 Bacteria 1056
988 nmdc:mga0rr50_57179_c1 3300050513 Bacteria 2917
989 nmdc:mga08x19_41574_c1 3300050514 Bacteria 2928
990 nmdc:mga08x19_61574_c1 3300050514 Bacteria 2433
991 nmdc:mga0a205_10407_c1 3300050515 Bacteria 8548
992 nmdc:mga0a205_37369_c1 3300050515 Bacteria 4670
993 nmdc:mga0sz30_34731_c1 3300050516 Bacteria 2101
994 Ga0495601_0056077 3300053077 Bacteria 2495
995 Ga0495601_0061101 3300053077 Bacteria 2392
996 Ga0495601_0586989 3300053077 Bacteria 715
997 Ga0495612_0096725 3300053078 Bacteria 1254
998 Ga0495595_0002322 3300053084 Bacteria 7419
999 Ga0495595_0016048 3300053084 Bacteria 3199
1000 Ga0495619_0008690 3300053085 Bacteria 6424
1001 Ga0495619_0050165 3300053085 Bacteria 2754
1002 Ga0495619_0158163 3300053085 Bacteria 1564
1003 Ga0500643_000213 3300053087 Bacteria 54707
1004 Ga0500644_0000047 3300053088 Bacteria 73844
1005 Ga0500564_189310 3300053138 Bacteria 853
1006 Ga0500568_0227762 3300053139 Bacteria 680
1007 Ga0500573_0008093 3300053140 Bacteria 5780
1008 Ga0501084_0032537 3300054114 Bacteria 4362
1009 Ga0587073_0042208 3300059492 Bacteria 999
1010 Ga0587085_055491 3300059506 Bacteria 734
1011 Ga0587106_077786 3300059605 Bacteria 641
1012 Ga0587122_047678 3300059628 Bacteria 549
1013 Ga0587128_081436 3300059630 Bacteria 649
1014 Ga0587068_097649 3300059641 Bacteria 613
1015 Ga0587072_041075 3300059643 Bacteria 899
1016 Ga0587072_100754 3300059643 Bacteria 648
1017 Ga0587079_040168 3300059647 Bacteria 941
1018 Ga0587079_118660 3300059647 Bacteria 652
1019 Ga0587107_093191 3300059652 Bacteria 585
1020 Ga0501082_0099545 3300060353 Bacteria 2514
1021 Ga0501082_0216096 3300060353 Bacteria 1668
1022 Ga0466962_0010540 3300061719 Bacteria 4447
1023 Ga0466962_0028704 3300061719 Bacteria 2664
1024 Ga0466962_0139648 3300061719 Bacteria 1173
1025 Ga0530510_0114639 3300061734 Bacteria 1975

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0131381 Ga0466967_0131381_790_1302 136
2 3300013296 Ga0157374_10206169 Ga0157374_102061692 139
3 3300031251 Ga0265327_10000081 Ga0265327_10000081149 139
4 iso_pu_bacteria 2731639228 2731905508 139
5 iso_pu_bacteria 2751185725 2753034953 139
6 iso_pu_bacteria 2887478801 2887481316 139
7 iso_pu_bacteria 8001781756 8001789778 139
8 3300005337 Ga0070682_100452214 Ga0070682_1004522142 140
9 3300005341 Ga0070691_10584877 Ga0070691_105848771 140
10 3300005535 Ga0070684_100723193 Ga0070684_1007231932 140
11 3300005616 Ga0068852_100988807 Ga0068852_1009888072 140
12 3300005840 Ga0068870_10403656 Ga0068870_104036562 140
13 3300005937 Ga0081455_10008050 Ga0081455_100080509 140
14 3300006038 Ga0075365_10814805 Ga0075365_108148052 140
15 3300013104 Ga0157370_10429914 Ga0157370_104299142 140
16 3300013105 Ga0157369_10295849 Ga0157369_102958492 140
17 3300013308 Ga0157375_10034623 Ga0157375_100346236 140
18 3300014325 Ga0163163_11032346 Ga0163163_110323462 140
19 3300014326 Ga0157380_10165169 Ga0157380_101651694 140
20 3300017792 Ga0163161_10142069 Ga0163161_101420692 140
21 3300025901 Ga0207688_10561084 Ga0207688_105610842 140
22 3300025908 Ga0207643_10532004 Ga0207643_105320042 140
23 3300025926 Ga0207659_10145250 Ga0207659_101452502 140
24 3300025944 Ga0207661_11604636 Ga0207661_116046362 140
25 3300026095 Ga0207676_11119889 Ga0207676_111198891 140
26 3300026142 Ga0207698_10990795 Ga0207698_109907952 140
27 3300031251 Ga0265327_10027896 Ga0265327_100278963 140
28 3300031727 Ga0316576_10046001 Ga0316576_100460014 140
29 3300031728 Ga0316578_10017290 Ga0316578_100172901 140
30 3300032137 Ga0316585_10003099 Ga0316585_100030992 140
31 3300033541 Ga0316596_1001886 Ga0316596_10018863 140
32 3300035398 Ga0316574_0006776 Ga0316574_0006776_4707_5153 140
33 3300036647 Ga0316582_0007605 Ga0316582_0007605_1057_1503 140
34 3300036712 Ga0316584_0001043 Ga0316584_0001043_14689_15135 140
35 3300041509 Ga0451843_1590515 Ga0451843_1590515_149_595 140
36 3300041512 Ga0451853_0584877 Ga0451853_0584877_389_835 140
37 3300042185 Ga0450909_028179 Ga0450909_028179_182_628 140
38 3300042531 Ga0450918_044740 Ga0450918_044740_132_578 140
39 3300046517 Ga0495630_0474682 Ga0495630_0474682_13_450 140
40 3300048907 Ga0496104_0223850 Ga0496104_0223850_866_1306 140
41 3300048908 Ga0496105_0016569 Ga0496105_0016569_4096_4536 140
42 3300048912 Ga0496109_0414059 Ga0496109_0414059_302_742 140
43 3300048913 Ga0496110_0085957 Ga0496110_0085957_1657_2097 140
44 3300048914 Ga0496111_0023696 Ga0496111_0023696_3604_4044 140
45 3300048916 Ga0496113_0389447 Ga0496113_0389447_297_737 140
46 3300048917 Ga0496114_0057190 Ga0496114_0057190_616_1056 140
47 3300048917 Ga0496114_0324560 Ga0496114_0324560_474_914 140
48 3300050509 nmdc:mga0qj67_301391_c1 nmdc:mga0qj67_301391_c1_93_533 140
49 3300050510 nmdc:mga06r32_5495_c1 nmdc:mga06r32_5495_c1_958_1398 140
50 iso_pu_bacteria 2773857762 2774392139 140
51 iso_pu_bacteria 2808606439 2809195925 140
52 iso_pu_bacteria 2891968417 2891970428 140
53 3300005440 Ga0070705_100013596 Ga0070705_1000135964 141
54 3300005457 Ga0070662_100530031 Ga0070662_1005300312 141
55 3300005578 Ga0068854_100324875 Ga0068854_1003248752 141
56 3300005615 Ga0070702_100000821 Ga0070702_1000008215 141
57 3300005615 Ga0070702_100444918 Ga0070702_1004449182 141
58 3300006881 Ga0068865_100147964 Ga0068865_1001479642 141
59 3300009148 Ga0105243_10111333 Ga0105243_101113334 141
60 3300009148 Ga0105243_11886853 Ga0105243_118868532 141
61 3300009176 Ga0105242_10006011 Ga0105242_100060112 141
62 3300009553 Ga0105249_10023032 Ga0105249_100230326 141
63 3300013297 Ga0157378_10227778 Ga0157378_102277782 141
64 3300013306 Ga0163162_10019250 Ga0163162_100192505 141
65 3300017792 Ga0163161_10029059 Ga0163161_100290593 141
66 3300025924 Ga0207694_10438450 Ga0207694_104384502 141
67 3300025931 Ga0207644_10842072 Ga0207644_108420722 141
68 3300025935 Ga0207709_10235125 Ga0207709_102351252 141
69 3300025961 Ga0207712_10130884 Ga0207712_101308842 141
70 3300026121 Ga0207683_10348221 Ga0207683_103482213 141
71 3300037466 Ga0395898_0596916 Ga0395898_0596916_153_614 141
72 3300048907 Ga0496104_1010177 Ga0496104_1010177_264_710 141
73 3300005347 Ga0070668_100051232 Ga0070668_1000512323 142
74 3300005367 Ga0070667_100071409 Ga0070667_1000714095 142
75 3300005455 Ga0070663_100010788 Ga0070663_1000107884 142
76 3300005615 Ga0070702_100950227 Ga0070702_1009502272 142
77 3300005616 Ga0068852_101979930 Ga0068852_1019799301 142
78 3300005840 Ga0068870_10778447 Ga0068870_107784472 142
79 3300005841 Ga0068863_100838580 Ga0068863_1008385802 142
80 3300005843 Ga0068860_100000311 Ga0068860_10000031173 142
81 3300006038 Ga0075365_10009055 Ga0075365_100090553 142
82 3300006038 Ga0075365_10027959 Ga0075365_100279595 142
83 3300006038 Ga0075365_10037167 Ga0075365_100371675 142
84 3300006038 Ga0075365_10043679 Ga0075365_100436794 142
85 3300006038 Ga0075365_10281346 Ga0075365_102813462 142
86 3300006042 Ga0075368_10000188 Ga0075368_1000018812 142
87 3300006042 Ga0075368_10013720 Ga0075368_100137203 142
88 3300006042 Ga0075368_10119014 Ga0075368_101190142 142
89 3300006048 Ga0075363_100006379 Ga0075363_1000063792 142
90 3300006048 Ga0075363_100016364 Ga0075363_1000163645 142
91 3300006048 Ga0075363_100085108 Ga0075363_1000851081 142
92 3300006048 Ga0075363_100167151 Ga0075363_1001671513 142
93 3300006051 Ga0075364_10013400 Ga0075364_100134002 142
94 3300006051 Ga0075364_10015654 Ga0075364_100156545 142
95 3300006051 Ga0075364_10123355 Ga0075364_101233552 142
96 3300006051 Ga0075364_10311184 Ga0075364_103111842 142
97 3300006177 Ga0075362_10010752 Ga0075362_100107525 142
98 3300006177 Ga0075362_10183797 Ga0075362_101837972 142
99 3300006178 Ga0075367_10004589 Ga0075367_100045894 142
100 3300006178 Ga0075367_10027120 Ga0075367_100271205 142
101 3300006178 Ga0075367_10358481 Ga0075367_103584812 142
102 3300006353 Ga0075370_10009317 Ga0075370_100093176 142
103 3300006353 Ga0075370_10041500 Ga0075370_100415002 142
104 3300006353 Ga0075370_10065848 Ga0075370_100658482 142
105 3300006353 Ga0075370_10175446 Ga0075370_101754463 142
106 3300006353 Ga0075370_10205429 Ga0075370_102054293 142
107 3300006353 Ga0075370_10388409 Ga0075370_103884092 142
108 3300009094 Ga0111539_12281488 Ga0111539_122814882 142
109 3300009148 Ga0105243_10601421 Ga0105243_106014212 142
110 3300009148 Ga0105243_10851185 Ga0105243_108511852 142
111 3300013308 Ga0157375_10879156 Ga0157375_108791562 142
112 3300013308 Ga0157375_11316920 Ga0157375_113169202 142
113 3300014745 Ga0157377_11026102 Ga0157377_110261021 142
114 3300014968 Ga0157379_11268113 Ga0157379_112681132 142
115 3300025908 Ga0207643_10638079 Ga0207643_106380792 142
116 3300025986 Ga0207658_10013386 Ga0207658_100133867 142
117 3300025986 Ga0207658_10022887 Ga0207658_100228874 142
118 3300027866 Ga0209813_10026252 Ga0209813_100262522 142
119 3300027866 Ga0209813_10054887 Ga0209813_100548872 142
120 3300028381 Ga0268264_10000717 Ga0268264_1000071738 142
121 3300030733 Ga0314311_1113072 Ga0314311_11130722 142
122 3300030745 Ga0316182_1129288 Ga0316182_11292882 142
123 3300031251 Ga0265327_10002020 Ga0265327_100020207 142
124 3300031730 Ga0307516_10665113 Ga0307516_106651131 142
125 3300031903 Ga0307407_10471088 Ga0307407_104710881 142
126 3300031911 Ga0307412_10243357 Ga0307412_102433572 142
127 3300031995 Ga0307409_100476434 Ga0307409_1004764342 142
128 3300037418 Ga0395900_0355808 Ga0395900_0355808_977_1423 142
129 3300037466 Ga0395898_0669904 Ga0395898_0669904_415_861 142
130 3300039437 Ga0436365_1397305 Ga0436365_1397305_44_490 142
131 3300041452 Ga0451793_0052377 Ga0451793_0052377_92_547 142
132 3300041456 Ga0451795_1629950 Ga0451795_1629950_161_607 142
133 3300048905 Ga0496102_0791367 Ga0496102_0791367_376_819 142
134 3300048913 Ga0496110_0237645 Ga0496110_0237645_991_1437 142
135 3300048917 Ga0496114_0053410 Ga0496114_0053410_1264_1710 142
136 3300049533 Ga0501317_026512 Ga0501317_026512_278_724 142
137 3300049569 Ga0501032_0134306 Ga0501032_0134306_703_1146 142
138 3300049572 Ga0501036_0208687 Ga0501036_0208687_94_540 142
139 3300049573 Ga0501037_0255794 Ga0501037_0255794_559_1005 142
140 3300049578 Ga0501042_0603936 Ga0501042_0603936_87_551 142
141 3300049579 Ga0501043_0469952 Ga0501043_0469952_28_471 142
142 3300049581 Ga0501047_0000015 Ga0501047_0000015_245870_246313 142
143 3300049586 Ga0501070_1205284 Ga0501070_1205284_108_563 142
144 3300049588 Ga0501072_0120059 Ga0501072_0120059_1545_1991 142
145 3300049588 Ga0501072_1197328 Ga0501072_1197328_34_480 142
146 3300049824 Ga0501045_0186017 Ga0501045_0186017_119_565 142
147 3300050489 nmdc:mga03683_185670_c1 nmdc:mga03683_185670_c1_186_632 142
148 3300050489 nmdc:mga03683_37713_c1 nmdc:mga03683_37713_c1_1514_1960 142
149 3300050490 nmdc:mga03n38_15185_c1 nmdc:mga03n38_15185_c1_1629_2075 142
150 3300050490 nmdc:mga03n38_348272_c1 nmdc:mga03n38_348272_c1_318_764 142
151 3300050490 nmdc:mga03n38_395767_c1 nmdc:mga03n38_395767_c1_178_624 142
152 3300050490 nmdc:mga03n38_488798_c1 nmdc:mga03n38_488798_c1_25_468 142
153 3300050490 nmdc:mga03n38_51524_c1 nmdc:mga03n38_51524_c1_576_1022 142
154 3300050491 nmdc:mga00v17_147997_c1 nmdc:mga00v17_147997_c1_765_1208 142
155 3300050491 nmdc:mga00v17_21827_c1 nmdc:mga00v17_21827_c1_2313_2759 142
156 3300050491 nmdc:mga00v17_278073_c1 nmdc:mga00v17_278073_c1_627_1073 142
157 3300050491 nmdc:mga00v17_31654_c1 nmdc:mga00v17_31654_c1_292_738 142
158 3300050491 nmdc:mga00v17_401253_c1 nmdc:mga00v17_401253_c1_94_540 142
159 3300050491 nmdc:mga00v17_403240_c1 nmdc:mga00v17_403240_c1_264_710 142
160 3300050492 nmdc:mga0yw44_108427_c1 nmdc:mga0yw44_108427_c1_633_1079 142
161 3300050492 nmdc:mga0yw44_14822_c1 nmdc:mga0yw44_14822_c1_1106_1549 142
162 3300050492 nmdc:mga0yw44_160589_c1 nmdc:mga0yw44_160589_c1_241_687 142
163 3300050492 nmdc:mga0yw44_161341_c1 nmdc:mga0yw44_161341_c1_926_1372 142
164 3300050492 nmdc:mga0yw44_182003_c2 nmdc:mga0yw44_182003_c2_373_819 142
165 3300050492 nmdc:mga0yw44_18790_c1 nmdc:mga0yw44_18790_c1_1649_2092 142
166 3300050492 nmdc:mga0yw44_3102_c1 nmdc:mga0yw44_3102_c1_2516_2962 142
167 3300050492 nmdc:mga0yw44_45853_c1 nmdc:mga0yw44_45853_c1_375_821 142
168 3300050492 nmdc:mga0yw44_68740_c1 nmdc:mga0yw44_68740_c1_758_1204 142
169 3300050492 nmdc:mga0yw44_9272_c1 nmdc:mga0yw44_9272_c1_4139_4585 142
170 3300050494 nmdc:mga06z11_233607_c1 nmdc:mga06z11_233607_c1_203_646 142
171 3300050494 nmdc:mga06z11_503929_c1 nmdc:mga06z11_503929_c1_51_497 142
172 3300050494 nmdc:mga06z11_88401_c1 nmdc:mga06z11_88401_c1_447_893 142
173 3300050495 nmdc:mga04h51_16342_c1 nmdc:mga04h51_16342_c1_1085_1531 142
174 3300050496 nmdc:mga07m45_195199_c1 nmdc:mga07m45_195199_c1_396_842 142
175 3300050496 nmdc:mga07m45_285954_c1 nmdc:mga07m45_285954_c1_73_519 142
176 3300050496 nmdc:mga07m45_35624_c1 nmdc:mga07m45_35624_c1_1699_2145 142
177 3300050496 nmdc:mga07m45_46119_c1 nmdc:mga07m45_46119_c1_1547_1993 142
178 3300050496 nmdc:mga07m45_504539_c1 nmdc:mga07m45_504539_c1_188_634 142
179 3300050496 nmdc:mga07m45_575485_c1 nmdc:mga07m45_575485_c1_65_508 142
180 3300050496 nmdc:mga07m45_66009_c1 nmdc:mga07m45_66009_c1_921_1367 142
181 3300050496 nmdc:mga07m45_76768_c1 nmdc:mga07m45_76768_c1_1169_1612 142
182 3300053088 Ga0500644_0000047 Ga0500644_0000047_39343_39789 142
183 3300053139 Ga0500568_0227762 Ga0500568_0227762_69_515 142
184 iso_pu_bacteria 2643221576 2643891812 142
185 iso_pu_bacteria 2643221590 2643960861 142
186 iso_pu_bacteria 2643221604 2644035621 142
187 iso_pu_bacteria 2811994878 2812351925 142
188 iso_pu_bacteria 2995463766 2995464902 142
189 3300005353 Ga0070669_100596216 Ga0070669_1005962162 143
190 3300005366 Ga0070659_100740895 Ga0070659_1007408952 143
191 3300005535 Ga0070684_100255879 Ga0070684_1002558792 143
192 3300005535 Ga0070684_101177679 Ga0070684_1011776792 143
193 3300005564 Ga0070664_100454083 Ga0070664_1004540832 143
194 3300005719 Ga0068861_100217178 Ga0068861_1002171782 143
195 3300006038 Ga0075365_10525721 Ga0075365_105257211 143
196 3300006178 Ga0075367_10429354 Ga0075367_104293541 143
197 3300009093 Ga0105240_12490951 Ga0105240_124909511 143
198 3300009553 Ga0105249_11295545 Ga0105249_112955452 143
199 3300009553 Ga0105249_13501888 Ga0105249_135018881 143
200 3300011119 Ga0105246_10466911 Ga0105246_104669112 143
201 3300014497 Ga0182008_10321853 Ga0182008_103218531 143
202 3300014745 Ga0157377_10206301 Ga0157377_102063012 143
203 3300020069 Ga0197907_11113641 Ga0197907_111136413 143
204 3300020070 Ga0206356_10068051 Ga0206356_100680513 143
205 3300020075 Ga0206349_1536441 Ga0206349_15364413 143
206 3300020076 Ga0206355_1124023 Ga0206355_11240231 143
207 3300020076 Ga0206355_1642650 Ga0206355_16426502 143
208 3300020077 Ga0206351_10432790 Ga0206351_104327903 143
209 3300020077 Ga0206351_10445423 Ga0206351_104454232 143
210 3300020078 Ga0206352_10517260 Ga0206352_105172604 143
211 3300020080 Ga0206350_10713574 Ga0206350_107135747 143
212 3300020081 Ga0206354_10730064 Ga0206354_107300642 143
213 3300020081 Ga0206354_10790317 Ga0206354_107903173 143
214 3300020082 Ga0206353_11125031 Ga0206353_111250314 143
215 3300020610 Ga0154015_1594405 Ga0154015_15944052 143
216 3300022467 Ga0224712_10001468 Ga0224712_100014684 143
217 3300025934 Ga0207686_10497504 Ga0207686_104975041 143
218 3300025935 Ga0207709_10441053 Ga0207709_104410532 143
219 3300025939 Ga0207665_10314386 Ga0207665_103143862 143
220 3300025940 Ga0207691_10166739 Ga0207691_101667393 143
221 3300025944 Ga0207661_10051520 Ga0207661_100515202 143
222 3300025945 Ga0207679_10483402 Ga0207679_104834022 143
223 3300025945 Ga0207679_10495206 Ga0207679_104952062 143
224 3300025972 Ga0207668_11488911 Ga0207668_114889112 143
225 3300026118 Ga0207675_101072279 Ga0207675_1010722792 143
226 3300031903 Ga0307407_10516401 Ga0307407_105164012 143
227 3300031911 Ga0307412_10665408 Ga0307412_106654082 143
228 3300031995 Ga0307409_100216210 Ga0307409_1002162102 143
229 3300031995 Ga0307409_101910262 Ga0307409_1019102622 143
230 3300032002 Ga0307416_100380666 Ga0307416_1003806662 143
231 3300032005 Ga0307411_10251063 Ga0307411_102510632 143
232 3300032126 Ga0307415_100134833 Ga0307415_1001348333 143
233 3300037068 Ga0373925_0528843 Ga0373925_0528843_474_944 143
234 3300041451 Ga0451791_1849534 Ga0451791_1849534_56_511 143
235 3300041512 Ga0451853_1897627 Ga0451853_1897627_112_567 143
236 3300044842 Ga0466957_0172726 Ga0466957_0172726_426_872 143
237 3300044901 Ga0466960_0291335 Ga0466960_0291335_441_887 143
238 3300045836 Ga0466958_0150434 Ga0466958_0150434_576_1022 143
239 3300045976 Ga0466967_0012785 Ga0466967_0012785_3466_3945 143
240 3300046455 Ga0495603_0016498 Ga0495603_0016498_591_1061 143
241 3300047319 Ga0495674_0244692 Ga0495674_0244692_930_1400 143
242 3300048089 Ga0495614_0163091 Ga0495614_0163091_149_619 143
243 3300048913 Ga0496110_0806870 Ga0496110_0806870_362_811 143
244 3300049127 Ga0501306_015256 Ga0501306_015256_329_775 143
245 3300049129 Ga0501309_013640 Ga0501309_013640_349_795 143
246 3300049535 Ga0501319_001136 Ga0501319_001136_384_830 143
247 3300049539 Ga0501323_001085 Ga0501323_001085_1348_1794 143
248 3300049540 Ga0501324_002030 Ga0501324_002030_616_1062 143
249 3300049541 Ga0501325_000688 Ga0501325_000688_632_1078 143
250 3300049574 Ga0501038_0830146 Ga0501038_0830146_62_514 143
251 3300049575 Ga0501039_0397219 Ga0501039_0397219_129_581 143
252 3300049575 Ga0501039_1184792 Ga0501039_1184792_90_545 143
253 3300049578 Ga0501042_0189207 Ga0501042_0189207_882_1334 143
254 3300049581 Ga0501047_0073384 Ga0501047_0073384_986_1441 143
255 3300049582 Ga0501048_0290415 Ga0501048_0290415_439_894 143
256 3300049585 Ga0501069_0800164 Ga0501069_0800164_17_469 143
257 3300049588 Ga0501072_0044766 Ga0501072_0044766_1817_2269 143
258 3300049589 Ga0501073_1240604 Ga0501073_1240604_43_498 143
259 3300049590 Ga0501074_0388248 Ga0501074_0388248_173_625 143
260 3300049590 Ga0501074_0586729 Ga0501074_0586729_228_680 143
261 3300049592 Ga0501076_0289695 Ga0501076_0289695_624_1076 143
262 3300049741 Ga0501079_0360662 Ga0501079_0360662_609_1061 143
263 3300049743 Ga0501081_0365825 Ga0501081_0365825_177_629 143
264 3300049823 Ga0501044_0197724 Ga0501044_0197724_22_477 143
265 3300050490 nmdc:mga03n38_342779_c1 nmdc:mga03n38_342779_c1_65_514 143
266 3300059647 Ga0587079_040168 Ga0587079_040168_72_524 143
267 3300060353 Ga0501082_0099545 Ga0501082_0099545_1654_2106 143
268 3300061719 Ga0466962_0139648 Ga0466962_0139648_699_1145 143
269 iso_pu_bacteria 2547132424 2548696690 143
270 iso_pu_bacteria 2551306166 2552108781 143
271 iso_pu_bacteria 2585427649 2586062253 143
272 iso_pu_bacteria 2643221692 2644512394 143
273 iso_pu_bacteria 2738541264 2738668157 143
274 iso_pu_bacteria 2738541305 2738868272 143
275 iso_pu_bacteria 2738541356 2739147227 143
276 iso_pu_bacteria 2808606522 2809588573 143
277 iso_pu_bacteria 2899359706 2899365257 143
278 iso_pu_bacteria 2915768154 2915770285 143
279 iso_pu_bacteria 2917736166 2917739459 143
280 iso_pu_bacteria 2919713450 2919717689 143
281 iso_pu_bacteria 8003314358 8003323847 143
282 3300001977 JGI24746J21847_1041170 JGI24746J21847_10411701 144
283 3300001979 JGI24740J21852_10017776 JGI24740J21852_100177764 144
284 3300002067 JGI24735J21928_10016670 JGI24735J21928_100166704 144
285 3300005327 Ga0070658_10077548 Ga0070658_100775483 144
286 3300005336 Ga0070680_100533021 Ga0070680_1005330212 144
287 3300005337 Ga0070682_100477806 Ga0070682_1004778062 144
288 3300005340 Ga0070689_101107990 Ga0070689_1011079902 144
289 3300005437 Ga0070710_10000801 Ga0070710_100008016 144
290 3300005438 Ga0070701_10456633 Ga0070701_104566332 144
291 3300005441 Ga0070700_100979137 Ga0070700_1009791371 144
292 3300005455 Ga0070663_101357361 Ga0070663_1013573611 144
293 3300005456 Ga0070678_100219979 Ga0070678_1002199792 144
294 3300005459 Ga0068867_100526755 Ga0068867_1005267551 144
295 3300005466 Ga0070685_10272009 Ga0070685_102720092 144
296 3300005530 Ga0070679_100012491 Ga0070679_1000124916 144
297 3300005544 Ga0070686_100548446 Ga0070686_1005484461 144
298 3300005548 Ga0070665_100029684 Ga0070665_1000296846 144
299 3300005577 Ga0068857_100280058 Ga0068857_1002800582 144
300 3300005719 Ga0068861_101590455 Ga0068861_1015904551 144
301 3300005985 Ga0081539_10024421 Ga0081539_100244213 144
302 3300009098 Ga0105245_11194175 Ga0105245_111941752 144
303 3300009177 Ga0105248_11343235 Ga0105248_113432352 144
304 3300009553 Ga0105249_10831962 Ga0105249_108319622 144
305 3300011119 Ga0105246_10117793 Ga0105246_101177932 144
306 3300011119 Ga0105246_10184398 Ga0105246_101843982 144
307 3300013306 Ga0163162_10689326 Ga0163162_106893262 144
308 3300013307 Ga0157372_11700200 Ga0157372_117002002 144
309 3300013308 Ga0157375_10160740 Ga0157375_101607402 144
310 3300013308 Ga0157375_10643094 Ga0157375_106430942 144
311 3300014326 Ga0157380_12189714 Ga0157380_121897142 144
312 3300014497 Ga0182008_10040061 Ga0182008_100400613 144
313 3300014497 Ga0182008_10558235 Ga0182008_105582352 144
314 3300015261 Ga0182006_1249420 Ga0182006_12494202 144
315 3300017792 Ga0163161_10269852 Ga0163161_102698522 144
316 3300020069 Ga0197907_10630705 Ga0197907_106307052 144
317 3300020082 Ga0206353_10672241 Ga0206353_106722412 144
318 3300021384 Ga0213876_10253305 Ga0213876_102533052 144
319 3300025898 Ga0207692_10000388 Ga0207692_1000038814 144
320 3300025904 Ga0207647_10002418 Ga0207647_100024183 144
321 3300025909 Ga0207705_10000473 Ga0207705_100004732 144
322 3300025909 Ga0207705_10311099 Ga0207705_103110993 144
323 3300025917 Ga0207660_10368250 Ga0207660_103682502 144
324 3300025919 Ga0207657_10051387 Ga0207657_100513872 144
325 3300025919 Ga0207657_10408257 Ga0207657_104082572 144
326 3300025921 Ga0207652_10010913 Ga0207652_100109136 144
327 3300025921 Ga0207652_10320133 Ga0207652_103201332 144
328 3300025927 Ga0207687_10165793 Ga0207687_101657933 144
329 3300025927 Ga0207687_10949705 Ga0207687_109497052 144
330 3300025937 Ga0207669_10731406 Ga0207669_107314062 144
331 3300025938 Ga0207704_10711723 Ga0207704_107117232 144
332 3300025944 Ga0207661_10661371 Ga0207661_106613712 144
333 3300025972 Ga0207668_10345149 Ga0207668_103451492 144
334 3300026075 Ga0207708_10493775 Ga0207708_104937752 144
335 3300026116 Ga0207674_10282074 Ga0207674_102820742 144
336 3300026121 Ga0207683_10748938 Ga0207683_107489382 144
337 3300027876 Ga0209974_10088590 Ga0209974_100885903 144
338 3300028379 Ga0268266_10000855 Ga0268266_1000085510 144
339 3300028380 Ga0268265_11928816 Ga0268265_119288161 144
340 3300028786 Ga0307517_10283573 Ga0307517_102835732 144
341 3300030731 Ga0316177_1209821 Ga0316177_12098212 144
342 3300030732 Ga0316176_1061306 Ga0316176_106130614 144
343 3300030733 Ga0314311_1084681 Ga0314311_10846816 144
344 3300030735 Ga0316178_1152700 Ga0316178_11527002 144
345 3300030736 Ga0316180_1121628 Ga0316180_11216282 144
346 3300038443 Ga0395901_0095690 Ga0395901_0095690_672_1148 144
347 3300041405 Ga0439438_046980 Ga0439438_046980_496_960 144
348 3300041407 Ga0439447_021920 Ga0439447_021920_1121_1576 144
349 3300041411 Ga0439466_0137760 Ga0439466_0137760_152_607 144
350 3300041452 Ga0451793_1932876 Ga0451793_1932876_32_520 144
351 3300041997 Ga0439431_0005548 Ga0439431_0005548_2031_2495 144
352 3300042156 Ga0439446_0009340 Ga0439446_0009340_381_845 144
353 3300042435 Ga0439434_0006140 Ga0439434_0006140_195_659 144
354 3300044658 Ga0466972_0014657 Ga0466972_0014657_574_1014 144
355 3300044683 Ga0466965_0006241 Ga0466965_0006241_2667_3107 144
356 3300044684 Ga0466966_0154379 Ga0466966_0154379_788_1246 144
357 3300044684 Ga0466966_0642177 Ga0466966_0642177_143_589 144
358 3300044694 Ga0466963_0310667 Ga0466963_0310667_381_833 144
359 3300044694 Ga0466963_0750558 Ga0466963_0750558_69_521 144
360 3300044706 Ga0466964_0039878 Ga0466964_0039878_1099_1551 144
361 3300044706 Ga0466964_0248163 Ga0466964_0248163_246_698 144
362 3300044901 Ga0466960_0001500 Ga0466960_0001500_3547_3987 144
363 3300045049 Ga0466959_0191154 Ga0466959_0191154_313_768 144
364 3300045976 Ga0466967_0001887 Ga0466967_0001887_9820_10272 144
365 3300045976 Ga0466967_0029228 Ga0466967_0029228_2678_3130 144
366 3300045976 Ga0466967_0177604 Ga0466967_0177604_766_1218 144
367 3300045976 Ga0466967_0317676 Ga0466967_0317676_832_1284 144
368 3300046461 Ga0495641_0355341 Ga0495641_0355341_168_629 144
369 3300046684 Ga0495669_0005292 Ga0495669_0005292_4173_4622 144
370 3300046694 Ga0495649_0444596 Ga0495649_0444596_97_579 144
371 3300048910 Ga0496107_0279325 Ga0496107_0279325_10_462 144
372 3300048912 Ga0496109_1449996 Ga0496109_1449996_76_537 144
373 3300049568 Ga0501031_0003650 Ga0501031_0003650_1956_2411 144
374 3300049568 Ga0501031_0304136 Ga0501031_0304136_117_566 144
375 3300049569 Ga0501032_0074653 Ga0501032_0074653_1420_1875 144
376 3300049569 Ga0501032_0233761 Ga0501032_0233761_146_595 144
377 3300049570 Ga0501033_0002669 Ga0501033_0002669_12572_13027 144
378 3300049571 Ga0501034_0228795 Ga0501034_0228795_341_796 144
379 3300049572 Ga0501036_0055657 Ga0501036_0055657_2449_2898 144
380 3300049572 Ga0501036_0324593 Ga0501036_0324593_668_1123 144
381 3300049572 Ga0501036_0864117 Ga0501036_0864117_250_705 144
382 3300049573 Ga0501037_0001113 Ga0501037_0001113_15171_15626 144
383 3300049573 Ga0501037_0054327 Ga0501037_0054327_34_483 144
384 3300049574 Ga0501038_0109372 Ga0501038_0109372_1251_1706 144
385 3300049574 Ga0501038_0122067 Ga0501038_0122067_747_1196 144
386 3300049575 Ga0501039_0002962 Ga0501039_0002962_10925_11380 144
387 3300049575 Ga0501039_0737570 Ga0501039_0737570_194_643 144
388 3300049575 Ga0501039_0855910 Ga0501039_0855910_62_517 144
389 3300049577 Ga0501041_0028069 Ga0501041_0028069_522_971 144
390 3300049578 Ga0501042_0022647 Ga0501042_0022647_3867_4316 144
391 3300049578 Ga0501042_0027714 Ga0501042_0027714_912_1388 144
392 3300049578 Ga0501042_0087874 Ga0501042_0087874_769_1224 144
393 3300049579 Ga0501043_0040876 Ga0501043_0040876_283_738 144
394 3300049579 Ga0501043_1215758 Ga0501043_1215758_61_516 144
395 3300049580 Ga0501046_0012603 Ga0501046_0012603_4729_5184 144
396 3300049580 Ga0501046_0059062 Ga0501046_0059062_1330_1785 144
397 3300049582 Ga0501048_0003907 Ga0501048_0003907_7410_7859 144
398 3300049582 Ga0501048_0055269 Ga0501048_0055269_1162_1617 144
399 3300049583 Ga0501067_0797933 Ga0501067_0797933_24_464 144
400 3300049584 Ga0501068_0081150 Ga0501068_0081150_117_566 144
401 3300049584 Ga0501068_0288397 Ga0501068_0288397_346_786 144
402 3300049585 Ga0501069_0070056 Ga0501069_0070056_59_508 144
403 3300049586 Ga0501070_0018361 Ga0501070_0018361_4301_4756 144
404 3300049587 Ga0501071_0225399 Ga0501071_0225399_637_1086 144
405 3300049587 Ga0501071_0433146 Ga0501071_0433146_230_706 144
406 3300049587 Ga0501071_1003811 Ga0501071_1003811_24_476 144
407 3300049588 Ga0501072_0072403 Ga0501072_0072403_1547_1996 144
408 3300049589 Ga0501073_0255259 Ga0501073_0255259_427_876 144
409 3300049590 Ga0501074_0328171 Ga0501074_0328171_448_897 144
410 3300049590 Ga0501074_0743271 Ga0501074_0743271_21_476 144
411 3300049591 Ga0501075_0083788 Ga0501075_0083788_1256_1705 144
412 3300049741 Ga0501079_0044004 Ga0501079_0044004_1748_2197 144
413 3300049742 Ga0501080_0028663 Ga0501080_0028663_2856_3311 144
414 3300049742 Ga0501080_0070715 Ga0501080_0070715_1032_1481 144
415 3300049743 Ga0501081_0063064 Ga0501081_0063064_1347_1796 144
416 3300049822 Ga0501035_0075383 Ga0501035_0075383_2219_2674 144
417 3300049822 Ga0501035_0867527 Ga0501035_0867527_180_629 144
418 3300049823 Ga0501044_0090982 Ga0501044_0090982_959_1414 144
419 3300049824 Ga0501045_0148940 Ga0501045_0148940_529_984 144
420 3300049824 Ga0501045_0201090 Ga0501045_0201090_899_1348 144
421 3300050491 nmdc:mga00v17_301922_c1 nmdc:mga00v17_301922_c1_357_809 144
422 3300053138 Ga0500564_189310 Ga0500564_189310_141_590 144
423 3300054114 Ga0501084_0032537 Ga0501084_0032537_342_791 144
424 3300059492 Ga0587073_0042208 Ga0587073_0042208_282_743 144
425 3300060353 Ga0501082_0216096 Ga0501082_0216096_306_755 144
426 3300061734 Ga0530510_0114639 Ga0530510_0114639_1451_1900 144
427 iso_pu_bacteria 2795385470 2795786671 144
428 iso_pu_bacteria 2866612099 2866614583 144
429 iso_pu_bacteria 2870782633 2870785313 144
430 3300005336 Ga0070680_101286282 Ga0070680_1012862821 145
431 3300005339 Ga0070660_100282263 Ga0070660_1002822632 145
432 3300005458 Ga0070681_10088899 Ga0070681_100888995 145
433 3300005530 Ga0070679_100190367 Ga0070679_1001903673 145
434 3300006038 Ga0075365_10427097 Ga0075365_104270972 145
435 3300006051 Ga0075364_10323784 Ga0075364_103237841 145
436 3300006173 Ga0070716_100327919 Ga0070716_1003279192 145
437 3300009011 Ga0105251_10046840 Ga0105251_100468402 145
438 3300009545 Ga0105237_10111283 Ga0105237_101112832 145
439 3300010375 Ga0105239_10027014 Ga0105239_100270147 145
440 3300013307 Ga0157372_10563282 Ga0157372_105632822 145
441 3300013308 Ga0157375_10379131 Ga0157375_103791313 145
442 3300014326 Ga0157380_13062449 Ga0157380_130624491 145
443 3300022467 Ga0224712_10094320 Ga0224712_100943202 145
444 3300025917 Ga0207660_10953543 Ga0207660_109535432 145
445 3300025921 Ga0207652_10053044 Ga0207652_100530442 145
446 3300025986 Ga0207658_10234070 Ga0207658_102340702 145
447 3300031727 Ga0316576_10107854 Ga0316576_101078542 145
448 3300032126 Ga0307415_100976632 Ga0307415_1009766322 145
449 3300035398 Ga0316574_0019054 Ga0316574_0019054_2349_2795 145
450 3300044901 Ga0466960_0001488 Ga0466960_0001488_4888_5343 145
451 3300045976 Ga0466967_0087235 Ga0466967_0087235_1013_1507 145
452 3300045976 Ga0466967_1107971 Ga0466967_1107971_178_633 145
453 3300046476 Ga0495662_0159438 Ga0495662_0159438_564_1016 145
454 3300046499 Ga0495594_0029589 Ga0495594_0029589_126_578 145
455 3300046501 Ga0495607_0029787 Ga0495607_0029787_2435_2926 145
456 3300046679 Ga0495623_0027659 Ga0495623_0027659_1228_1680 145
457 3300047317 Ga0495604_0004336 Ga0495604_0004336_6557_7009 145
458 3300047323 Ga0495683_0000189 Ga0495683_0000189_4489_4980 145
459 3300047444 Ga0495675_0052697 Ga0495675_0052697_249_701 145
460 3300048903 Ga0496100_0000011 Ga0496100_0000011_150589_151071 145
461 3300048904 Ga0496101_0000279 Ga0496101_0000279_4226_4708 145
462 3300048905 Ga0496102_0010258 Ga0496102_0010258_266_748 145
463 3300048906 Ga0496103_0101727 Ga0496103_0101727_1072_1554 145
464 3300048909 Ga0496106_0013771 Ga0496106_0013771_4748_5230 145
465 3300048910 Ga0496107_0001343 Ga0496107_0001343_1408_1890 145
466 3300048911 Ga0496108_0029511 Ga0496108_0029511_3604_4086 145
467 3300048912 Ga0496109_0000179 Ga0496109_0000179_31068_31550 145
468 3300048913 Ga0496110_0027924 Ga0496110_0027924_1624_2106 145
469 3300048916 Ga0496113_0208740 Ga0496113_0208740_101_583 145
470 3300048917 Ga0496114_0003812 Ga0496114_0003812_7831_8313 145
471 3300048918 Ga0496115_0064507 Ga0496115_0064507_600_1082 145
472 3300048919 Ga0496116_0148454 Ga0496116_0148454_266_748 145
473 3300048920 Ga0496117_0038461 Ga0496117_0038461_2288_2770 145
474 3300048921 Ga0496118_0092036 Ga0496118_0092036_777_1259 145
475 3300048922 Ga0496119_0028285 Ga0496119_0028285_686_1168 145
476 3300048923 Ga0496120_0005714 Ga0496120_0005714_8125_8607 145
477 3300048924 Ga0496121_0000014 Ga0496121_0000014_405199_405681 145
478 3300048925 Ga0496122_0000084 Ga0496122_0000084_205950_206432 145
479 3300048926 Ga0496123_0008199 Ga0496123_0008199_1264_1746 145
480 3300048927 Ga0496124_0000019 Ga0496124_0000019_405199_405681 145
481 3300048928 Ga0496125_0000014 Ga0496125_0000014_405199_405681 145
482 3300048929 Ga0496126_0000017 Ga0496126_0000017_204996_205478 145
483 3300049128 Ga0501308_006849 Ga0501308_006849_685_1143 145
484 3300049538 Ga0501322_006931 Ga0501322_006931_75_539 145
485 3300049569 Ga0501032_0328178 Ga0501032_0328178_329_787 145
486 3300049570 Ga0501033_0167383 Ga0501033_0167383_1039_1497 145
487 3300049571 Ga0501034_0002988 Ga0501034_0002988_7188_7646 145
488 3300049571 Ga0501034_0873124 Ga0501034_0873124_184_675 145
489 3300049572 Ga0501036_0015857 Ga0501036_0015857_4011_4469 145
490 3300049573 Ga0501037_0031006 Ga0501037_0031006_1812_2270 145
491 3300049574 Ga0501038_0013668 Ga0501038_0013668_142_600 145
492 3300049575 Ga0501039_0066265 Ga0501039_0066265_142_597 145
493 3300049577 Ga0501041_0154286 Ga0501041_0154286_299_757 145
494 3300049578 Ga0501042_0117964 Ga0501042_0117964_1268_1726 145
495 3300049579 Ga0501043_0296988 Ga0501043_0296988_506_964 145
496 3300049581 Ga0501047_0321687 Ga0501047_0321687_222_680 145
497 3300049581 Ga0501047_0670292 Ga0501047_0670292_93_584 145
498 3300049582 Ga0501048_0034976 Ga0501048_0034976_1120_1578 145
499 3300049585 Ga0501069_0447619 Ga0501069_0447619_169_660 145
500 3300049589 Ga0501073_0075878 Ga0501073_0075878_1001_1459 145
501 3300049741 Ga0501079_0355034 Ga0501079_0355034_250_717 145
502 3300049822 Ga0501035_0002047 Ga0501035_0002047_16453_16911 145
503 3300049823 Ga0501044_0006225 Ga0501044_0006225_12620_13078 145
504 3300050491 nmdc:mga00v17_186502_c1 nmdc:mga00v17_186502_c1_421_876 145
505 3300050492 nmdc:mga0yw44_320526_c1 nmdc:mga0yw44_320526_c1_441_896 145
506 3300053140 Ga0500573_0008093 Ga0500573_0008093_579_1031 145
507 3300059628 Ga0587122_047678 Ga0587122_047678_68_529 145
508 3300059630 Ga0587128_081436 Ga0587128_081436_105_563 145
509 iso_pu_bacteria 2643221561 2643826031 145
510 iso_pu_bacteria 2643221696 2644532019 145
511 3300005329 Ga0070683_101289123 Ga0070683_1012891232 146
512 3300005458 Ga0070681_10926973 Ga0070681_109269732 146
513 3300005466 Ga0070685_10024015 Ga0070685_100240152 146
514 3300005543 Ga0070672_101151148 Ga0070672_1011511482 146
515 3300005546 Ga0070696_100497480 Ga0070696_1004974801 146
516 3300005985 Ga0081539_10078617 Ga0081539_100786172 146
517 3300006048 Ga0075363_100159700 Ga0075363_1001597002 146
518 3300006051 Ga0075364_10149999 Ga0075364_101499993 146
519 3300006177 Ga0075362_10063831 Ga0075362_100638312 146
520 3300009098 Ga0105245_11874486 Ga0105245_118744861 146
521 3300013105 Ga0157369_10001259 Ga0157369_100012592 146
522 3300013296 Ga0157374_10325781 Ga0157374_103257812 146
523 3300013306 Ga0163162_10677252 Ga0163162_106772522 146
524 3300013308 Ga0157375_11001806 Ga0157375_110018062 146
525 3300019192 Ga0184603_133284 Ga0184603_1332842 146
526 3300020069 Ga0197907_11048701 Ga0197907_110487011 146
527 3300020078 Ga0206352_10839668 Ga0206352_108396682 146
528 3300020081 Ga0206354_10138557 Ga0206354_101385572 146
529 3300020082 Ga0206353_10564495 Ga0206353_105644952 146
530 3300020082 Ga0206353_11470156 Ga0206353_114701562 146
531 3300021377 Ga0213874_10016680 Ga0213874_100166802 146
532 3300022467 Ga0224712_10377046 Ga0224712_103770461 146
533 3300025294 Ga0209025_1034041 Ga0209025_10340412 146
534 3300025735 Ga0207713_1056599 Ga0207713_10565993 146
535 3300025912 Ga0207707_10505747 Ga0207707_105057472 146
536 3300025986 Ga0207658_11082737 Ga0207658_110827372 146
537 3300026088 Ga0207641_11075322 Ga0207641_110753222 146
538 3300026089 Ga0207648_10128853 Ga0207648_101288533 146
539 3300026116 Ga0207674_10369428 Ga0207674_103694282 146
540 3300028379 Ga0268266_10102032 Ga0268266_101020322 146
541 3300028379 Ga0268266_11658644 Ga0268266_116586442 146
542 3300030836 Ga0265767_102761 Ga0265767_1027612 146
543 3300035170 Ga0373943_0036774 Ga0373943_0036774_1692_2150 146
544 3300037418 Ga0395900_0837218 Ga0395900_0837218_156_620 146
545 3300038443 Ga0395901_0014105 Ga0395901_0014105_3884_4351 146
546 3300038443 Ga0395901_0022089 Ga0395901_0022089_834_1298 146
547 3300044658 Ga0466972_0120626 Ga0466972_0120626_294_761 146
548 3300044683 Ga0466965_0474111 Ga0466965_0474111_127_600 146
549 3300044694 Ga0466963_0157850 Ga0466963_0157850_1031_1561 146
550 3300044694 Ga0466963_0251642 Ga0466963_0251642_557_1033 146
551 3300044694 Ga0466963_0310832 Ga0466963_0310832_612_1067 146
552 3300044765 Ga0466970_0436853 Ga0466970_0436853_21_494 146
553 3300044901 Ga0466960_0288613 Ga0466960_0288613_50_523 146
554 3300045976 Ga0466967_0267858 Ga0466967_0267858_877_1344 146
555 3300046459 Ga0495629_0009112 Ga0495629_0009112_3953_4411 146
556 3300046459 Ga0495629_0082051 Ga0495629_0082051_933_1412 146
557 3300046472 Ga0495580_0105024 Ga0495580_0105024_589_1068 146
558 3300046642 Ga0495634_0701142 Ga0495634_0701142_21_500 146
559 3300046663 Ga0495635_0490978 Ga0495635_0490978_87_554 146
560 3300046681 Ga0495647_0341257 Ga0495647_0341257_20_463 146
561 3300046690 Ga0495624_0259066 Ga0495624_0259066_458_937 146
562 3300047315 Ga0495581_0020125 Ga0495581_0020125_3333_3812 146
563 3300047317 Ga0495604_0006697 Ga0495604_0006697_3665_4123 146
564 3300047673 Ga0495593_0004255 Ga0495593_0004255_4424_4903 146
565 3300048907 Ga0496104_0860193 Ga0496104_0860193_103_564 146
566 3300048912 Ga0496109_0358060 Ga0496109_0358060_534_1001 146
567 3300048917 Ga0496114_0630216 Ga0496114_0630216_203_670 146
568 3300048918 Ga0496115_0345152 Ga0496115_0345152_492_953 146
569 3300049569 Ga0501032_0099477 Ga0501032_0099477_1073_1549 146
570 3300049586 Ga0501070_0049598 Ga0501070_0049598_2436_2921 146
571 3300049823 Ga0501044_0615234 Ga0501044_0615234_172_648 146
572 3300050489 nmdc:mga03683_208411_c1 nmdc:mga03683_208411_c1_380_862 146
573 3300050490 nmdc:mga03n38_351088_c1 nmdc:mga03n38_351088_c1_18_500 146
574 3300050491 nmdc:mga00v17_72542_c1 nmdc:mga00v17_72542_c1_1474_1944 146
575 3300053085 Ga0495619_0050165 Ga0495619_0050165_1572_2039 146
576 3300053087 Ga0500643_000213 Ga0500643_000213_12655_13098 146
577 3300059643 Ga0587072_041075 Ga0587072_041075_234_734 146
578 3300059647 Ga0587079_118660 Ga0587079_118660_64_537 146
579 3300003659 JGI25404J52841_10056937 JGI25404J52841_100569372 147
580 3300003792 Ga0055540_1000036 Ga0055540_1000036111 147
581 3300005327 Ga0070658_10100554 Ga0070658_101005543 147
582 3300005335 Ga0070666_10191540 Ga0070666_101915403 147
583 3300005338 Ga0068868_100384083 Ga0068868_1003840832 147
584 3300005340 Ga0070689_100580593 Ga0070689_1005805932 147
585 3300005435 Ga0070714_100130112 Ga0070714_1001301122 147
586 3300005455 Ga0070663_100419915 Ga0070663_1004199151 147
587 3300005459 Ga0068867_100189074 Ga0068867_1001890741 147
588 3300005535 Ga0070684_100573619 Ga0070684_1005736192 147
589 3300005577 Ga0068857_100325556 Ga0068857_1003255562 147
590 3300005617 Ga0068859_100126212 Ga0068859_1001262124 147
591 3300005844 Ga0068862_100990174 Ga0068862_1009901742 147
592 3300005983 Ga0081540_1000117 Ga0081540_10001177 147
593 3300005983 Ga0081540_1051895 Ga0081540_10518952 147
594 3300006175 Ga0070712_100113997 Ga0070712_1001139972 147
595 3300006844 Ga0075428_100421995 Ga0075428_1004219952 147
596 3300006914 Ga0075436_100013538 Ga0075436_1000135386 147
597 3300006931 Ga0097620_100126211 Ga0097620_1001262114 147
598 3300009094 Ga0111539_10050843 Ga0111539_100508434 147
599 3300009098 Ga0105245_11047374 Ga0105245_110473742 147
600 3300009147 Ga0114129_10004172 Ga0114129_100041726 147
601 3300009174 Ga0105241_10209893 Ga0105241_102098932 147
602 3300010159 Ga0099796_10188361 Ga0099796_101883612 147
603 3300010375 Ga0105239_12452413 Ga0105239_124524132 147
604 3300011119 Ga0105246_11000288 Ga0105246_110002882 147
605 3300013105 Ga0157369_10020619 Ga0157369_100206191 147
606 3300013296 Ga0157374_11395321 Ga0157374_113953211 147
607 3300013306 Ga0163162_11366363 Ga0163162_113663632 147
608 3300013307 Ga0157372_10863301 Ga0157372_108633012 147
609 3300014969 Ga0157376_10274463 Ga0157376_102744633 147
610 3300021388 Ga0213875_10000102 Ga0213875_1000010230 147
611 3300022467 Ga0224712_10219723 Ga0224712_102197232 147
612 3300025303 Ga0209051_1000021 Ga0209051_1000021460 147
613 3300025903 Ga0207680_10270423 Ga0207680_102704232 147
614 3300025927 Ga0207687_11921989 Ga0207687_119219891 147
615 3300025929 Ga0207664_10150420 Ga0207664_101504202 147
616 3300025933 Ga0207706_10382012 Ga0207706_103820122 147
617 3300025972 Ga0207668_10197731 Ga0207668_101977313 147
618 3300026023 Ga0207677_10165088 Ga0207677_101650882 147
619 3300026116 Ga0207674_10343894 Ga0207674_103438942 147
620 3300031251 Ga0265327_10113483 Ga0265327_101134832 147
621 3300031548 Ga0307408_100839563 Ga0307408_1008395632 147
622 3300031691 Ga0316579_10185689 Ga0316579_101856892 147
623 3300031731 Ga0307405_10211453 Ga0307405_102114532 147
624 3300031838 Ga0307518_10001710 Ga0307518_100017107 147
625 3300031852 Ga0307410_10092703 Ga0307410_100927032 147
626 3300031911 Ga0307412_10095212 Ga0307412_100952122 147
627 3300031995 Ga0307409_100143537 Ga0307409_1001435372 147
628 3300031995 Ga0307409_100257831 Ga0307409_1002578312 147
629 3300032002 Ga0307416_100345455 Ga0307416_1003454552 147
630 3300032002 Ga0307416_100919547 Ga0307416_1009195471 147
631 3300032126 Ga0307415_100080821 Ga0307415_1000808212 147
632 3300032126 Ga0307415_100171992 Ga0307415_1001719923 147
633 3300032133 Ga0316583_10143138 Ga0316583_101431382 147
634 3300033179 Ga0307507_10009186 Ga0307507_100091868 147
635 3300035083 Ga0373926_0134434 Ga0373926_0134434_78_539 147
636 3300035086 Ga0373934_0021200 Ga0373934_0021200_1171_1626 147
637 3300035086 Ga0373934_0098840 Ga0373934_0098840_676_1137 147
638 3300035117 Ga0373953_0091134 Ga0373953_0091134_45_506 147
639 3300035118 Ga0373954_0080673 Ga0373954_0080673_45_506 147
640 3300035119 Ga0373956_0017925 Ga0373956_0017925_1062_1523 147
641 3300035170 Ga0373943_0013820 Ga0373943_0013820_39_500 147
642 3300035172 Ga0373955_0119373 Ga0373955_0119373_290_751 147
643 3300035398 Ga0316574_0000101 Ga0316574_0000101_14303_14749 147
644 3300035410 Ga0373924_0004268 Ga0373924_0004268_1586_2047 147
645 3300035692 Ga0373935_0048565 Ga0373935_0048565_1622_2083 147
646 3300035692 Ga0373935_0067374 Ga0373935_0067374_1536_1997 147
647 3300035695 Ga0373927_0183574 Ga0373927_0183574_21_482 147
648 3300035724 Ga0373933_0002913 Ga0373933_0002913_3676_4137 147
649 3300035724 Ga0373933_0042008 Ga0373933_0042008_357_812 147
650 3300035725 Ga0373947_0275547 Ga0373947_0275547_209_670 147
651 3300036401 Ga0373937_0001426 Ga0373937_0001426_46_507 147
652 3300036712 Ga0316584_0185399 Ga0316584_0185399_59_505 147
653 3300037418 Ga0395900_0194724 Ga0395900_0194724_1157_1669 147
654 3300037466 Ga0395898_0106879 Ga0395898_0106879_266_778 147
655 3300037471 Ga0395905_0269311 Ga0395905_0269311_75_587 147
656 3300037853 Ga0436364_0940223 Ga0436364_0940223_106741_107208 147
657 3300038443 Ga0395901_0029427 Ga0395901_0029427_4465_4977 147
658 3300044658 Ga0466972_0020311 Ga0466972_0020311_2304_2771 147
659 3300044683 Ga0466965_0001357 Ga0466965_0001357_3618_4085 147
660 3300044693 Ga0466961_0165609 Ga0466961_0165609_723_1190 147
661 3300044693 Ga0466961_0290484 Ga0466961_0290484_159_620 147
662 3300044694 Ga0466963_0077264 Ga0466963_0077264_593_1060 147
663 3300044706 Ga0466964_0043935 Ga0466964_0043935_820_1287 147
664 3300044719 Ga0466971_0010225 Ga0466971_0010225_1935_2402 147
665 3300044735 Ga0466968_0079260 Ga0466968_0079260_486_929 147
666 3300044765 Ga0466970_0019209 Ga0466970_0019209_666_1133 147
667 3300044765 Ga0466970_0382919 Ga0466970_0382919_276_737 147
668 3300044842 Ga0466957_0357030 Ga0466957_0357030_461_928 147
669 3300044901 Ga0466960_0350482 Ga0466960_0350482_37_504 147
670 3300045049 Ga0466959_0365902 Ga0466959_0365902_384_845 147
671 3300045836 Ga0466958_0020682 Ga0466958_0020682_1217_1684 147
672 3300045976 Ga0466967_0043439 Ga0466967_0043439_2421_2888 147
673 3300045976 Ga0466967_0201091 Ga0466967_0201091_1273_1761 147
674 3300045976 Ga0466967_1140789 Ga0466967_1140789_115_576 147
675 3300046454 Ga0495592_0005811 Ga0495592_0005811_6227_6688 147
676 3300046454 Ga0495592_0081388 Ga0495592_0081388_645_1100 147
677 3300046455 Ga0495603_0033526 Ga0495603_0033526_66_527 147
678 3300046459 Ga0495629_0022210 Ga0495629_0022210_2031_2492 147
679 3300046461 Ga0495641_0004743 Ga0495641_0004743_5948_6409 147
680 3300046461 Ga0495641_0064410 Ga0495641_0064410_187_648 147
681 3300046462 Ga0495651_0026865 Ga0495651_0026865_1264_1725 147
682 3300046462 Ga0495651_0060501 Ga0495651_0060501_1899_2354 147
683 3300046463 Ga0495653_0036309 Ga0495653_0036309_3355_3816 147
684 3300046463 Ga0495653_0069805 Ga0495653_0069805_538_993 147
685 3300046463 Ga0495653_0089779 Ga0495653_0089779_305_766 147
686 3300046473 Ga0495582_0007863 Ga0495582_0007863_3653_4114 147
687 3300046475 Ga0495639_0263348 Ga0495639_0263348_371_832 147
688 3300046476 Ga0495662_0006974 Ga0495662_0006974_258_719 147
689 3300046477 Ga0495664_0034672 Ga0495664_0034672_2463_2924 147
690 3300046511 Ga0495608_0059867 Ga0495608_0059867_1742_2203 147
691 3300046514 Ga0495618_0070337 Ga0495618_0070337_1590_2051 147
692 3300046514 Ga0495618_0180519 Ga0495618_0180519_842_1297 147
693 3300046516 Ga0495628_0178997 Ga0495628_0178997_1098_1559 147
694 3300046517 Ga0495630_0032799 Ga0495630_0032799_3254_3715 147
695 3300046517 Ga0495630_0244650 Ga0495630_0244650_733_1194 147
696 3300046517 Ga0495630_0561814 Ga0495630_0561814_214_669 147
697 3300046526 Ga0495666_0011982 Ga0495666_0011982_3641_4102 147
698 3300046531 Ga0495665_0058695 Ga0495665_0058695_1424_1885 147
699 3300046533 Ga0495640_0024191 Ga0495640_0024191_2004_2465 147
700 3300046543 Ga0495645_0026680 Ga0495645_0026680_209_670 147
701 3300046543 Ga0495645_0216039 Ga0495645_0216039_570_1031 147
702 3300046559 Ga0495667_0003863 Ga0495667_0003863_1049_1504 147
703 3300046559 Ga0495667_0033817 Ga0495667_0033817_96_557 147
704 3300046642 Ga0495634_0012517 Ga0495634_0012517_3651_4112 147
705 3300046663 Ga0495635_0018288 Ga0495635_0018288_917_1378 147
706 3300046663 Ga0495635_0022276 Ga0495635_0022276_2119_2574 147
707 3300046663 Ga0495635_0067167 Ga0495635_0067167_734_1195 147
708 3300046675 Ga0495657_0027640 Ga0495657_0027640_1537_1998 147
709 3300046678 Ga0495599_0003147 Ga0495599_0003147_4341_4802 147
710 3300046678 Ga0495599_0185988 Ga0495599_0185988_384_845 147
711 3300046679 Ga0495623_0014183 Ga0495623_0014183_2578_3039 147
712 3300046679 Ga0495623_0060312 Ga0495623_0060312_1393_1848 147
713 3300046680 Ga0495646_0004781 Ga0495646_0004781_3372_3833 147
714 3300046681 Ga0495647_0004220 Ga0495647_0004220_512_973 147
715 3300046683 Ga0495658_0186447 Ga0495658_0186447_385_846 147
716 3300046689 Ga0495613_0013377 Ga0495613_0013377_3709_4170 147
717 3300046690 Ga0495624_0323613 Ga0495624_0323613_389_850 147
718 3300046809 Ga0495600_0025754 Ga0495600_0025754_2518_2979 147
719 3300046809 Ga0495600_0104960 Ga0495600_0104960_684_1139 147
720 3300047315 Ga0495581_0016627 Ga0495581_0016627_2757_3218 147
721 3300047315 Ga0495581_0073409 Ga0495581_0073409_551_1012 147
722 3300047317 Ga0495604_0003750 Ga0495604_0003750_6579_7034 147
723 3300047319 Ga0495674_0062948 Ga0495674_0062948_2463_2924 147
724 3300047319 Ga0495674_0088995 Ga0495674_0088995_1808_2269 147
725 3300047321 Ga0495676_0100184 Ga0495676_0100184_1499_1960 147
726 3300047321 Ga0495676_0243739 Ga0495676_0243739_675_1136 147
727 3300047444 Ga0495675_0037089 Ga0495675_0037089_1467_1922 147
728 3300047444 Ga0495675_0078551 Ga0495675_0078551_1573_2034 147
729 3300047471 Ga0495684_0008195 Ga0495684_0008195_3149_3604 147
730 3300047471 Ga0495684_0020878 Ga0495684_0020878_949_1410 147
731 3300047471 Ga0495684_0340939 Ga0495684_0340939_147_608 147
732 3300047673 Ga0495593_0031232 Ga0495593_0031232_733_1194 147
733 3300048088 Ga0495602_0148521 Ga0495602_0148521_1339_1800 147
734 3300049130 Ga0501310_020126 Ga0501310_020126_58_537 147
735 3300049162 Ga0501307_006654 Ga0501307_006654_43_525 147
736 3300049527 Ga0501311_004955 Ga0501311_004955_85_567 147
737 3300049533 Ga0501317_008593 Ga0501317_008593_333_812 147
738 3300049534 Ga0501318_001413 Ga0501318_001413_878_1360 147
739 3300049537 Ga0501321_000627 Ga0501321_000627_666_1148 147
740 3300049571 Ga0501034_0035968 Ga0501034_0035968_1941_2384 147
741 3300049572 Ga0501036_0000969 Ga0501036_0000969_10294_10737 147
742 3300049572 Ga0501036_0493729 Ga0501036_0493729_334_810 147
743 3300049573 Ga0501037_0063516 Ga0501037_0063516_1230_1673 147
744 3300049574 Ga0501038_0035313 Ga0501038_0035313_392_835 147
745 3300049574 Ga0501038_0137388 Ga0501038_0137388_549_1058 147
746 3300049575 Ga0501039_0093748 Ga0501039_0093748_858_1301 147
747 3300049578 Ga0501042_0037806 Ga0501042_0037806_1136_1579 147
748 3300049579 Ga0501043_0005373 Ga0501043_0005373_6260_6703 147
749 3300049580 Ga0501046_0415216 Ga0501046_0415216_129_572 147
750 3300049581 Ga0501047_0214989 Ga0501047_0214989_1009_1452 147
751 3300049582 Ga0501048_0028534 Ga0501048_0028534_1172_1615 147
752 3300049584 Ga0501068_0523673 Ga0501068_0523673_110_586 147
753 3300049586 Ga0501070_0425441 Ga0501070_0425441_207_668 147
754 3300049589 Ga0501073_0010455 Ga0501073_0010455_1108_1551 147
755 3300049590 Ga0501074_0005245 Ga0501074_0005245_4804_5247 147
756 3300049823 Ga0501044_0017172 Ga0501044_0017172_2740_3183 147
757 3300049824 Ga0501045_0123449 Ga0501045_0123449_855_1331 147
758 3300050507 nmdc:mga05p37_18110_c1 nmdc:mga05p37_18110_c1_4396_4857 147
759 3300050508 nmdc:mga09592_1569591_c1 nmdc:mga09592_1569591_c1_50_511 147
760 3300050511 nmdc:mga08y16_64549_c1 nmdc:mga08y16_64549_c1_1272_1733 147
761 3300050514 nmdc:mga08x19_61574_c1 nmdc:mga08x19_61574_c1_1922_2383 147
762 3300050515 nmdc:mga0a205_37369_c1 nmdc:mga0a205_37369_c1_3724_4185 147
763 3300053077 Ga0495601_0056077 Ga0495601_0056077_1214_1675 147
764 3300053077 Ga0495601_0586989 Ga0495601_0586989_46_507 147
765 3300053078 Ga0495612_0096725 Ga0495612_0096725_250_711 147
766 3300053084 Ga0495595_0016048 Ga0495595_0016048_1731_2192 147
767 3300053085 Ga0495619_0008690 Ga0495619_0008690_4289_4738 147
768 3300053085 Ga0495619_0158163 Ga0495619_0158163_896_1351 147
769 3300059506 Ga0587085_055491 Ga0587085_055491_237_698 147
770 3300059605 Ga0587106_077786 Ga0587106_077786_44_505 147
771 3300059643 Ga0587072_100754 Ga0587072_100754_66_515 147
772 3300059652 Ga0587107_093191 Ga0587107_093191_48_497 147
773 3300061719 Ga0466962_0010540 Ga0466962_0010540_1262_1729 147
774 iso_pu_bacteria 2684623035 2686538513 147
775 iso_pu_bacteria 2895880812 2895885674 147
776 3300004799 Ga0058863_11868134 Ga0058863_118681343 148
777 3300005327 Ga0070658_10000603 Ga0070658_1000060317 148
778 3300005329 Ga0070683_100328580 Ga0070683_1003285802 148
779 3300005336 Ga0070680_100000622 Ga0070680_1000006226 148
780 3300005434 Ga0070709_10121217 Ga0070709_101212172 148
781 3300005435 Ga0070714_100003855 Ga0070714_1000038557 148
782 3300005436 Ga0070713_100007332 Ga0070713_1000073327 148
783 3300005437 Ga0070710_10034672 Ga0070710_100346723 148
784 3300005439 Ga0070711_100392882 Ga0070711_1003928821 148
785 3300005458 Ga0070681_10000561 Ga0070681_1000056113 148
786 3300005468 Ga0070707_100181398 Ga0070707_1001813983 148
787 3300005530 Ga0070679_100000912 Ga0070679_10000091210 148
788 3300005536 Ga0070697_100015765 Ga0070697_1000157653 148
789 3300005549 Ga0070704_100281570 Ga0070704_1002815703 148
790 3300006028 Ga0070717_10069655 Ga0070717_100696551 148
791 3300006175 Ga0070712_100119096 Ga0070712_1001190962 148
792 3300009101 Ga0105247_10313276 Ga0105247_103132762 148
793 3300013104 Ga0157370_10620900 Ga0157370_106209001 148
794 3300013105 Ga0157369_10158228 Ga0157369_101582282 148
795 3300013307 Ga0157372_10344977 Ga0157372_103449772 148
796 3300013307 Ga0157372_10544157 Ga0157372_105441572 148
797 3300013307 Ga0157372_11011355 Ga0157372_110113551 148
798 3300013308 Ga0157375_10732980 Ga0157375_107329803 148
799 3300014326 Ga0157380_10957883 Ga0157380_109578832 148
800 3300014326 Ga0157380_12678787 Ga0157380_126787871 148
801 3300020069 Ga0197907_10307493 Ga0197907_103074933 148
802 3300020069 Ga0197907_10608651 Ga0197907_106086515 148
803 3300020070 Ga0206356_10176009 Ga0206356_101760092 148
804 3300020075 Ga0206349_1224696 Ga0206349_12246962 148
805 3300020077 Ga0206351_10105420 Ga0206351_101054201 148
806 3300020077 Ga0206351_10828683 Ga0206351_108286833 148
807 3300020078 Ga0206352_10633471 Ga0206352_106334712 148
808 3300020080 Ga0206350_10401678 Ga0206350_104016782 148
809 3300020080 Ga0206350_10669213 Ga0206350_106692132 148
810 3300020081 Ga0206354_10566456 Ga0206354_105664569 148
811 3300020082 Ga0206353_10548237 Ga0206353_105482374 148
812 3300020610 Ga0154015_1029170 Ga0154015_10291702 148
813 3300020610 Ga0154015_1252405 Ga0154015_12524051 148
814 3300022467 Ga0224712_10029020 Ga0224712_100290203 148
815 3300025898 Ga0207692_10018677 Ga0207692_100186775 148
816 3300025900 Ga0207710_10104924 Ga0207710_101049241 148
817 3300025906 Ga0207699_10078718 Ga0207699_100787183 148
818 3300025909 Ga0207705_10000656 Ga0207705_1000065610 148
819 3300025912 Ga0207707_10000151 Ga0207707_1000015144 148
820 3300025915 Ga0207693_10123935 Ga0207693_101239352 148
821 3300025916 Ga0207663_10093553 Ga0207663_100935532 148
822 3300025917 Ga0207660_10000490 Ga0207660_1000049024 148
823 3300025921 Ga0207652_10000244 Ga0207652_1000024457 148
824 3300025922 Ga0207646_10009734 Ga0207646_1000973410 148
825 3300025928 Ga0207700_10005313 Ga0207700_100053132 148
826 3300025929 Ga0207664_10013288 Ga0207664_100132884 148
827 3300025932 Ga0207690_10182574 Ga0207690_101825743 148
828 3300025944 Ga0207661_10259967 Ga0207661_102599672 148
829 3300026067 Ga0207678_10702470 Ga0207678_107024702 148
830 3300041512 Ga0451853_1644521 Ga0451853_1644521_193_657 148
831 3300044693 Ga0466961_0046581 Ga0466961_0046581_1661_2110 148
832 3300048905 Ga0496102_0125213 Ga0496102_0125213_1401_1886 148
833 3300048908 Ga0496105_0235412 Ga0496105_0235412_647_1132 148
834 3300048912 Ga0496109_1285082 Ga0496109_1285082_174_623 148
835 3300048917 Ga0496114_0294101 Ga0496114_0294101_207_656 148
836 3300049570 Ga0501033_0048077 Ga0501033_0048077_1764_2252 148
837 3300049581 Ga0501047_0232510 Ga0501047_0232510_591_1088 148
838 3300049585 Ga0501069_0103529 Ga0501069_0103529_488_985 148
839 3300050513 nmdc:mga0rr50_479314_c1 nmdc:mga0rr50_479314_c1_297_812 148
840 3300050516 nmdc:mga0sz30_34731_c1 nmdc:mga0sz30_34731_c1_1185_1667 148
841 3300005937 Ga0081455_10194202 Ga0081455_101942022 149
842 3300020069 Ga0197907_10728872 Ga0197907_107288722 149
843 3300020077 Ga0206351_10173414 Ga0206351_101734143 149
844 3300020080 Ga0206350_11614803 Ga0206350_116148032 149
845 3300020081 Ga0206354_10424931 Ga0206354_104249312 149
846 3300020082 Ga0206353_10555370 Ga0206353_105553703 149
847 3300022467 Ga0224712_10020064 Ga0224712_100200643 149
848 3300025917 Ga0207660_10320012 Ga0207660_103200122 149
849 3300026075 Ga0207708_10258951 Ga0207708_102589512 149
850 3300028379 Ga0268266_10627677 Ga0268266_106276772 149
851 3300044683 Ga0466965_0258667 Ga0466965_0258667_133_630 149
852 3300044694 Ga0466963_0900181 Ga0466963_0900181_83_580 149
853 3300044842 Ga0466957_0018276 Ga0466957_0018276_78_575 149
854 3300044842 Ga0466957_0094201 Ga0466957_0094201_10_507 149
855 3300045836 Ga0466958_0002768 Ga0466958_0002768_8272_8769 149
856 3300045976 Ga0466967_0065799 Ga0466967_0065799_1364_1861 149
857 3300061719 Ga0466962_0028704 Ga0466962_0028704_1860_2357 149
858 3300004799 Ga0058863_11885469 Ga0058863_118854692 150
859 3300004800 Ga0058861_11963846 Ga0058861_119638462 150
860 3300004803 Ga0058862_12752443 Ga0058862_127524433 150
861 3300005834 Ga0068851_10021990 Ga0068851_100219902 150
862 3300009147 Ga0114129_10241311 Ga0114129_102413114 150
863 3300010375 Ga0105239_11304588 Ga0105239_113045882 150
864 3300014497 Ga0182008_10046941 Ga0182008_100469412 150
865 3300017792 Ga0163161_11233663 Ga0163161_112336631 150
866 3300020076 Ga0206355_1327778 Ga0206355_13277782 150
867 3300025923 Ga0207681_10704273 Ga0207681_107042732 150
868 3300035086 Ga0373934_0000025 Ga0373934_0000025_45646_46125 150
869 3300035111 Ga0373923_0004992 Ga0373923_0004992_1444_1923 150
870 3300035113 Ga0373936_0237260 Ga0373936_0237260_121_600 150
871 3300035117 Ga0373953_0002033 Ga0373953_0002033_1192_1671 150
872 3300035118 Ga0373954_0004039 Ga0373954_0004039_2211_2690 150
873 3300035119 Ga0373956_0000185 Ga0373956_0000185_5545_6024 150
874 3300035120 Ga0373957_0000293 Ga0373957_0000293_2391_2870 150
875 3300035172 Ga0373955_0000237 Ga0373955_0000237_4550_5029 150
876 3300035410 Ga0373924_0006427 Ga0373924_0006427_2972_3451 150
877 3300035692 Ga0373935_0199714 Ga0373935_0199714_700_1179 150
878 3300035724 Ga0373933_0000001 Ga0373933_0000001_163350_163829 150
879 3300036401 Ga0373937_0000087 Ga0373937_0000087_43404_43883 150
880 3300037418 Ga0395900_1304358 Ga0395900_1304358_104_556 150
881 3300037466 Ga0395898_1271121 Ga0395898_1271121_48_500 150
882 3300042005 Ga0439448_0005283 Ga0439448_0005283_491_943 150
883 3300042008 Ga0439450_169893 Ga0439450_169893_114_566 150
884 3300042016 Ga0439463_014614 Ga0439463_014614_1095_1547 150
885 3300042157 Ga0439458_0004896 Ga0439458_0004896_427_879 150
886 3300042438 Ga0439459_0032052 Ga0439459_0032052_440_892 150
887 3300046454 Ga0495592_0000002 Ga0495592_0000002_163380_163859 150
888 3300046462 Ga0495651_0000002 Ga0495651_0000002_45635_46114 150
889 3300046463 Ga0495653_0001815 Ga0495653_0001815_5352_5831 150
890 3300046511 Ga0495608_0000118 Ga0495608_0000118_45650_46129 150
891 3300046516 Ga0495628_0000103 Ga0495628_0000103_40093_40572 150
892 3300046529 Ga0495652_0000091 Ga0495652_0000091_19327_19806 150
893 3300046536 Ga0495587_0000013 Ga0495587_0000013_149511_149990 150
894 3300046559 Ga0495667_0000016 Ga0495667_0000016_149516_149995 150
895 3300046675 Ga0495657_0000014 Ga0495657_0000014_45581_46060 150
896 3300046678 Ga0495599_0000006 Ga0495599_0000006_163798_164277 150
897 3300046679 Ga0495623_0000537 Ga0495623_0000537_4097_4576 150
898 3300046680 Ga0495646_0005699 Ga0495646_0005699_4605_5084 150
899 3300046809 Ga0495600_0003129 Ga0495600_0003129_4908_5387 150
900 3300047317 Ga0495604_0000015 Ga0495604_0000015_149497_149976 150
901 3300047322 Ga0495680_0000380 Ga0495680_0000380_45625_46104 150
902 3300047444 Ga0495675_0000648 Ga0495675_0000648_4260_4739 150
903 3300048088 Ga0495602_0000013 Ga0495602_0000013_149494_149973 150
904 3300048915 Ga0496112_0209971 Ga0496112_0209971_125_577 150
905 3300048915 Ga0496112_0707271 Ga0496112_0707271_15_467 150
906 3300050507 nmdc:mga05p37_80286_c1 nmdc:mga05p37_80286_c1_3111_3563 150
907 3300050514 nmdc:mga08x19_41574_c1 nmdc:mga08x19_41574_c1_2404_2856 150
908 3300053077 Ga0495601_0061101 Ga0495601_0061101_1046_1525 150
909 3300053084 Ga0495595_0002322 Ga0495595_0002322_3515_3994 150
910 3300005434 Ga0070709_10095206 Ga0070709_100952063 151
911 3300005436 Ga0070713_100450429 Ga0070713_1004504292 151
912 3300005439 Ga0070711_100151929 Ga0070711_1001519293 151
913 3300006173 Ga0070716_100546892 Ga0070716_1005468922 151
914 3300025906 Ga0207699_10394798 Ga0207699_103947982 151
915 3300025915 Ga0207693_10219262 Ga0207693_102192622 151
916 3300025916 Ga0207663_10069925 Ga0207663_100699252 151
917 3300025928 Ga0207700_10255552 Ga0207700_102555522 151
918 3300025929 Ga0207664_10540273 Ga0207664_105402732 151
919 3300025939 Ga0207665_10208117 Ga0207665_102081172 151
920 3300026078 Ga0207702_10051266 Ga0207702_100512664 151
921 3300035695 Ga0373927_0615835 Ga0373927_0615835_244_699 151
922 3300059641 Ga0587068_097649 Ga0587068_097649_13_474 151
923 3300005467 Ga0070706_100518750 Ga0070706_1005187501 152
924 3300005468 Ga0070707_100212173 Ga0070707_1002121732 152
925 3300025922 Ga0207646_10271653 Ga0207646_102716532 152
926 3300028666 Ga0265336_10013779 Ga0265336_100137792 152
927 3300028800 Ga0265338_10001554 Ga0265338_1000155410 152
928 3300037853 Ga0436364_0024361 Ga0436364_0024361_657_1136 152
929 iso_pu_bacteria 2687453743 2689990105 152
930 3300031903 Ga0307407_10899419 Ga0307407_108994192 154
931 3300001915 JGI24741J21665_1013336 JGI24741J21665_10133362 168
932 3300005327 Ga0070658_10043896 Ga0070658_100438962 168
933 3300005330 Ga0070690_100062889 Ga0070690_1000628892 168
934 3300005331 Ga0070670_100003677 Ga0070670_10000367710 168
935 3300005334 Ga0068869_100001245 Ga0068869_10000124511 168
936 3300005335 Ga0070666_10060956 Ga0070666_100609562 168
937 3300005336 Ga0070680_100092433 Ga0070680_1000924332 168
938 3300005337 Ga0070682_100107994 Ga0070682_1001079942 168
939 3300005338 Ga0068868_100007359 Ga0068868_1000073596 168
940 3300005339 Ga0070660_100113719 Ga0070660_1001137194 168
941 3300005341 Ga0070691_10028714 Ga0070691_100287142 168
942 3300005344 Ga0070661_100534814 Ga0070661_1005348142 168
943 3300005345 Ga0070692_10002493 Ga0070692_100024935 168
944 3300005354 Ga0070675_100013556 Ga0070675_1000135565 168
945 3300005355 Ga0070671_100002954 Ga0070671_10000295411 168
946 3300005364 Ga0070673_100008126 Ga0070673_1000081266 168
947 3300005440 Ga0070705_100186024 Ga0070705_1001860242 168
948 3300005441 Ga0070700_100036519 Ga0070700_1000365192 168
949 3300005455 Ga0070663_100003424 Ga0070663_1000034246 168
950 3300005456 Ga0070678_100010655 Ga0070678_1000106552 168
951 3300005457 Ga0070662_100086108 Ga0070662_1000861082 168
952 3300005458 Ga0070681_10076299 Ga0070681_100762993 168
953 3300005530 Ga0070679_100679147 Ga0070679_1006791472 168
954 3300005539 Ga0068853_100408167 Ga0068853_1004081672 168
955 3300005543 Ga0070672_100416782 Ga0070672_1004167822 168
956 3300005544 Ga0070686_100276370 Ga0070686_1002763701 168
957 3300005546 Ga0070696_100718182 Ga0070696_1007181821 168
958 3300005547 Ga0070693_100179727 Ga0070693_1001797272 168
959 3300005578 Ga0068854_100047428 Ga0068854_1000474282 168
960 3300005615 Ga0070702_100002847 Ga0070702_1000028476 168
961 3300005616 Ga0068852_100064041 Ga0068852_1000640412 168
962 3300005617 Ga0068859_100071646 Ga0068859_1000716462 168
963 3300005618 Ga0068864_100178627 Ga0068864_1001786273 168
964 3300005719 Ga0068861_100727552 Ga0068861_1007275521 168
965 3300005840 Ga0068870_10001037 Ga0068870_1000103710 168
966 3300005841 Ga0068863_100006203 Ga0068863_10000620311 168
967 3300005842 Ga0068858_100048458 Ga0068858_1000484583 168
968 3300005843 Ga0068860_100614801 Ga0068860_1006148012 168
969 3300006237 Ga0097621_100006415 Ga0097621_1000064157 168
970 3300006844 Ga0075428_100111063 Ga0075428_1001110632 168
971 3300006847 Ga0075431_100049848 Ga0075431_1000498484 168
972 3300006852 Ga0075433_10005579 Ga0075433_100055796 168
973 3300006871 Ga0075434_100002856 Ga0075434_10000285613 168
974 3300006880 Ga0075429_100453458 Ga0075429_1004534582 168
975 3300006881 Ga0068865_100363383 Ga0068865_1003633832 168
976 3300006914 Ga0075436_100002169 Ga0075436_1000021692 168
977 3300006931 Ga0097620_100071648 Ga0097620_1000716485 168
978 3300007076 Ga0075435_100006462 Ga0075435_1000064627 168
979 3300009011 Ga0105251_10008366 Ga0105251_100083663 168
980 3300009093 Ga0105240_11127137 Ga0105240_111271372 168
981 3300009094 Ga0111539_10017516 Ga0111539_100175168 168
982 3300009098 Ga0105245_10075606 Ga0105245_100756062 168
983 3300009148 Ga0105243_10144836 Ga0105243_101448362 168
984 3300009174 Ga0105241_10092283 Ga0105241_100922834 168
985 3300009177 Ga0105248_10054024 Ga0105248_100540242 168
986 3300009551 Ga0105238_10199060 Ga0105238_101990602 168
987 3300011119 Ga0105246_10022876 Ga0105246_100228766 168
988 3300013100 Ga0157373_10070352 Ga0157373_100703525 168
989 3300013102 Ga0157371_10097728 Ga0157371_100977282 168
990 3300013104 Ga0157370_10025448 Ga0157370_100254486 168
991 3300013105 Ga0157369_10650809 Ga0157369_106508092 168
992 3300013306 Ga0163162_10396978 Ga0163162_103969783 168
993 3300013307 Ga0157372_10028842 Ga0157372_100288426 168
994 3300013308 Ga0157375_10219689 Ga0157375_102196893 168
995 3300014968 Ga0157379_10134130 Ga0157379_101341302 168
996 3300014969 Ga0157376_10066159 Ga0157376_100661594 168
997 3300020069 Ga0197907_10866496 Ga0197907_108664963 168
998 3300020070 Ga0206356_10355133 Ga0206356_103551334 168
999 3300020075 Ga0206349_1425530 Ga0206349_14255302 168
1000 3300020077 Ga0206351_10323992 Ga0206351_103239925 168
1001 3300020078 Ga0206352_10126105 Ga0206352_101261055 168
1002 3300020080 Ga0206350_10125668 Ga0206350_101256682 168
1003 3300020082 Ga0206353_11189061 Ga0206353_111890612 168
1004 3300025901 Ga0207688_10018768 Ga0207688_100187684 168
1005 3300025903 Ga0207680_10192755 Ga0207680_101927552 168
1006 3300025907 Ga0207645_10091949 Ga0207645_100919492 168
1007 3300025908 Ga0207643_10002076 Ga0207643_1000207610 168
1008 3300025909 Ga0207705_10111512 Ga0207705_101115122 168
1009 3300025911 Ga0207654_10011248 Ga0207654_100112485 168
1010 3300025912 Ga0207707_10040361 Ga0207707_100403613 168
1011 3300025913 Ga0207695_10673985 Ga0207695_106739852 168
1012 3300025914 Ga0207671_10103889 Ga0207671_101038893 168
1013 3300025917 Ga0207660_10051770 Ga0207660_100517704 168
1014 3300025918 Ga0207662_10151718 Ga0207662_101517182 168
1015 3300025920 Ga0207649_10002292 Ga0207649_1000229210 168
1016 3300025921 Ga0207652_10005388 Ga0207652_1000538810 168
1017 3300025925 Ga0207650_10002863 Ga0207650_1000286310 168
1018 3300025926 Ga0207659_10028015 Ga0207659_100280153 168
1019 3300025931 Ga0207644_10005580 Ga0207644_100055804 168
1020 3300025932 Ga0207690_10061333 Ga0207690_100613332 168
1021 3300025933 Ga0207706_10023491 Ga0207706_100234916 168
1022 3300025934 Ga0207686_10385770 Ga0207686_103857701 168
1023 3300025936 Ga0207670_10036590 Ga0207670_100365902 168
1024 3300025940 Ga0207691_10155897 Ga0207691_101558972 168
1025 3300025942 Ga0207689_10000187 Ga0207689_1000018727 168
1026 3300025944 Ga0207661_10007069 Ga0207661_100070697 168
1027 3300025945 Ga0207679_10003356 Ga0207679_100033566 168
1028 3300025949 Ga0207667_10464664 Ga0207667_104646642 168
1029 3300025981 Ga0207640_10691655 Ga0207640_106916552 168
1030 3300026023 Ga0207677_10029455 Ga0207677_100294553 168
1031 3300026035 Ga0207703_10151595 Ga0207703_101515953 168
1032 3300026041 Ga0207639_10086732 Ga0207639_100867322 168
1033 3300026067 Ga0207678_10001304 Ga0207678_100013048 168
1034 3300026078 Ga0207702_10035607 Ga0207702_100356072 168
1035 3300026088 Ga0207641_10012905 Ga0207641_100129058 168
1036 3300026095 Ga0207676_10004752 Ga0207676_100047524 168
1037 3300026121 Ga0207683_10003495 Ga0207683_100034956 168
1038 3300026142 Ga0207698_10011335 Ga0207698_100113353 168
1039 3300027907 Ga0207428_10030086 Ga0207428_100300866 168
1040 3300028379 Ga0268266_10091196 Ga0268266_100911963 168
1041 3300028381 Ga0268264_10415167 Ga0268264_104151672 168
1042 3300038443 Ga0395901_1310911 Ga0395901_1310911_33_575 168
1043 3300048903 Ga0496100_0040429 Ga0496100_0040429_2415_2957 168
1044 3300048904 Ga0496101_0098276 Ga0496101_0098276_315_857 168
1045 3300048905 Ga0496102_0028415 Ga0496102_0028415_2701_3243 168
1046 3300048907 Ga0496104_0016929 Ga0496104_0016929_1016_1558 168
1047 3300048908 Ga0496105_0018189 Ga0496105_0018189_2523_3065 168
1048 3300048909 Ga0496106_0145691 Ga0496106_0145691_308_850 168
1049 3300048910 Ga0496107_0021477 Ga0496107_0021477_222_764 168
1050 3300048911 Ga0496108_0012162 Ga0496108_0012162_2477_3019 168
1051 3300048913 Ga0496110_0021491 Ga0496110_0021491_4306_4848 168
1052 3300048914 Ga0496111_0003662 Ga0496111_0003662_1673_2215 168
1053 3300048918 Ga0496115_0484963 Ga0496115_0484963_364_906 168
1054 3300050508 nmdc:mga09592_109785_c1 nmdc:mga09592_109785_c1_1672_2214 168
1055 3300050510 nmdc:mga06r32_407330_c1 nmdc:mga06r32_407330_c1_243_785 168
1056 3300050512 nmdc:mga0n895_16639_c1 nmdc:mga0n895_16639_c1_3429_3971 168
1057 3300050513 nmdc:mga0rr50_57179_c1 nmdc:mga0rr50_57179_c1_774_1316 168
1058 3300050515 nmdc:mga0a205_10407_c1 nmdc:mga0a205_10407_c1_2238_2780 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01592

NifU_N

NifU-like N terminal domain

6

128

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jzw-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9592 3 138
8odq-assembly1.cif.gz_C sufs-sufu complex from mycobacterium tuberculosis 0.9499 2 144
2qq4-assembly2.cif.gz_D crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8 0.9466 1 138
6jzw-assembly3.cif.gz_C crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9428 3 141
6jzw-assembly2.cif.gz_B crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9354 3 138
ID Description Score Start End Superfamily
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.993 2 152 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9611 1 139 3.90.1010.10
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9552 2 152 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9475 1 139 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9034 2 138 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A7Y9RW40-F1-model_v4 Nitrogen fixation NifU-like protein 0.9946 3 149 GO:0005506
GO:0016226
GO:0051536
AF-A0A7Y9AVG4-F1-model_v4 Nitrogen fixation NifU-like protein 0.9933 6 142 GO:0005506
GO:0016226
GO:0051536
AF-A0A1Q7AXU5-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9931 1 149 GO:0005506
GO:0016226
GO:0051536
AF-A0A5B1M9N4-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.993 3 143 GO:0005506
GO:0016226
GO:0051536
AF-A0A1X0DFB0-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9928 1 152 GO:0005506
GO:0016226
GO:0051536

Feature Viewer

pLDDT pTM Quality
90.23 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map