F489226
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1058 | 487 | 1025 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10075606|Ga0105245_100756062 |
| Length | 180 |
| Sequence | VKLDSLYQEIILDHYKHPHRRGLREPFDAEVHHVNPTCGDEVTLRVKVSDGVVEDVSYDGAGCSISQASTSVLTDLVVGKPVEEAVAVQEEFLRLMQSKGTLEPDEEVLEDAVAFAGVSKYPSRVKCALLGWMAWKDATAQAVQREGAASEXXXSQRDRGVTRAARPALAPAGLSEEGTQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 2 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 3 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 4 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 5 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 6 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 7 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 8 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 9 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 10 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 11 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 12 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 13 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 14 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 15 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 16 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 17 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 18 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 19 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 20 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 21 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 22 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 23 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 24 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 25 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 26 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 27 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 28 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 29 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 30 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 31 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 32 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 33 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 34 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 35 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 36 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 37 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 39 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 40 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 46 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 50 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 82 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 90 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 98 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 99 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 100 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 101 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 102 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 103 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 104 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 105 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 110 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 113 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 117 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 118 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 119 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 120 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 121 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 122 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 123 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 125 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 139 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 153 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 157 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 163 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 170 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 171 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 172 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 243 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 245 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 246 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 247 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 248 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 249 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 250 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 252 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 253 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 254 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 255 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 256 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 257 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 258 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 259 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 260 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 261 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 262 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 263 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 264 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 265 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 266 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 267 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 268 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 269 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 271 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 274 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 275 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 278 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 279 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 281 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 282 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 283 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 284 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 285 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 286 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 288 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 289 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 291 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 292 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 293 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 294 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 295 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 296 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 297 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 298 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 299 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 300 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 301 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 302 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 303 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 304 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 305 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 306 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 307 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 308 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 309 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 310 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 311 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 312 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 313 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 314 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 315 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 316 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 317 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 318 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 319 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 320 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 321 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 322 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 323 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 324 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 325 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 326 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 327 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 328 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 379 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 380 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 381 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 382 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 383 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 384 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 387 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 388 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 389 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 390 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 391 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 392 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 393 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 394 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 395 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 396 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 397 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 398 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 399 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 400 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 401 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 402 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 403 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 448 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 449 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 450 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 451 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 452 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 453 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 454 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 464 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 469 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 470 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 471 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 472 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 473 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 475 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 476 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 477 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 478 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 485 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 486 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 487 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.85 |
| Metatranscriptomes | 8.03 |
| Isolates | 3.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.32 |
| Nodule | 0.09 |
| Rhizoplane | 4.91 |
| Rhizosphere | 81.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1013336 | 3300001915 | Bacteria | 1396 |
| 2 | JGI24746J21847_1041170 | 3300001977 | Bacteria | 643 |
| 3 | JGI24740J21852_10017776 | 3300001979 | Bacteria | 2535 |
| 4 | JGI24735J21928_10016670 | 3300002067 | Bacteria | 2276 |
| 5 | JGI25404J52841_10056937 | 3300003659 | Bacteria | 820 |
| 6 | Ga0055540_1000036 | 3300003792 | Bacteria | 164285 |
| 7 | Ga0058863_11868134 | 3300004799 | Bacteria | 1356 |
| 8 | Ga0058863_11885469 | 3300004799 | Bacteria | 1114 |
| 9 | Ga0058861_11963846 | 3300004800 | Bacteria | 1082 |
| 10 | Ga0058862_12752443 | 3300004803 | Bacteria | 1202 |
| 11 | Ga0070658_10000603 | 3300005327 | Bacteria | 31119 |
| 12 | Ga0070658_10043896 | 3300005327 | Bacteria | 3612 |
| 13 | Ga0070658_10077548 | 3300005327 | Bacteria | 2726 |
| 14 | Ga0070658_10100554 | 3300005327 | Bacteria | 2390 |
| 15 | Ga0070683_100328580 | 3300005329 | Bacteria | 1456 |
| 16 | Ga0070683_101289123 | 3300005329 | Bacteria | 702 |
| 17 | Ga0070690_100062889 | 3300005330 | Bacteria | 2394 |
| 18 | Ga0070670_100003677 | 3300005331 | Bacteria | 12782 |
| 19 | Ga0068869_100001245 | 3300005334 | Bacteria | 15028 |
| 20 | Ga0070666_10060956 | 3300005335 | Bacteria | 2554 |
| 21 | Ga0070666_10191540 | 3300005335 | Bacteria | 1437 |
| 22 | Ga0070680_100000622 | 3300005336 | Bacteria | 24598 |
| 23 | Ga0070680_100092433 | 3300005336 | Bacteria | 2505 |
| 24 | Ga0070680_100533021 | 3300005336 | Bacteria | 1006 |
| 25 | Ga0070680_101286282 | 3300005336 | Bacteria | 633 |
| 26 | Ga0070682_100107994 | 3300005337 | Bacteria | 1849 |
| 27 | Ga0070682_100452214 | 3300005337 | Bacteria | 984 |
| 28 | Ga0070682_100477806 | 3300005337 | Bacteria | 960 |
| 29 | Ga0068868_100007359 | 3300005338 | Bacteria | 7840 |
| 30 | Ga0068868_100384083 | 3300005338 | Bacteria | 1209 |
| 31 | Ga0070660_100113719 | 3300005339 | Bacteria | 2155 |
| 32 | Ga0070660_100282263 | 3300005339 | Bacteria | 1359 |
| 33 | Ga0070689_100580593 | 3300005340 | Bacteria | 969 |
| 34 | Ga0070689_101107990 | 3300005340 | Bacteria | 708 |
| 35 | Ga0070691_10028714 | 3300005341 | Bacteria | 2601 |
| 36 | Ga0070691_10584877 | 3300005341 | Bacteria | 657 |
| 37 | Ga0070661_100534814 | 3300005344 | Bacteria | 941 |
| 38 | Ga0070692_10002493 | 3300005345 | Bacteria | 7163 |
| 39 | Ga0070668_100051232 | 3300005347 | Bacteria | 3180 |
| 40 | Ga0070669_100596216 | 3300005353 | Bacteria | 925 |
| 41 | Ga0070675_100013556 | 3300005354 | Bacteria | 6409 |
| 42 | Ga0070671_100002954 | 3300005355 | Bacteria | 13219 |
| 43 | Ga0070673_100008126 | 3300005364 | Bacteria | 6961 |
| 44 | Ga0070659_100740895 | 3300005366 | Bacteria | 852 |
| 45 | Ga0070667_100071409 | 3300005367 | Bacteria | 2957 |
| 46 | Ga0070709_10095206 | 3300005434 | Bacteria | 1972 |
| 47 | Ga0070709_10121217 | 3300005434 | Bacteria | 1773 |
| 48 | Ga0070714_100003855 | 3300005435 | Bacteria | 11262 |
| 49 | Ga0070714_100130112 | 3300005435 | Bacteria | 2249 |
| 50 | Ga0070713_100007332 | 3300005436 | Bacteria | 7729 |
| 51 | Ga0070713_100450429 | 3300005436 | Bacteria | 1209 |
| 52 | Ga0070710_10000801 | 3300005437 | Bacteria | 15102 |
| 53 | Ga0070710_10034672 | 3300005437 | Bacteria | 2747 |
| 54 | Ga0070701_10456633 | 3300005438 | Bacteria | 821 |
| 55 | Ga0070711_100151929 | 3300005439 | Bacteria | 1747 |
| 56 | Ga0070711_100392882 | 3300005439 | Bacteria | 1124 |
| 57 | Ga0070705_100013596 | 3300005440 | Bacteria | 4167 |
| 58 | Ga0070705_100186024 | 3300005440 | Bacteria | 1411 |
| 59 | Ga0070700_100036519 | 3300005441 | Bacteria | 2981 |
| 60 | Ga0070700_100979137 | 3300005441 | Bacteria | 694 |
| 61 | Ga0070663_100003424 | 3300005455 | Bacteria | 9156 |
| 62 | Ga0070663_100010788 | 3300005455 | Bacteria | 5704 |
| 63 | Ga0070663_100419915 | 3300005455 | Bacteria | 1097 |
| 64 | Ga0070663_101357361 | 3300005455 | Bacteria | 628 |
| 65 | Ga0070678_100010655 | 3300005456 | Bacteria | 5629 |
| 66 | Ga0070678_100219979 | 3300005456 | Bacteria | 1578 |
| 67 | Ga0070662_100086108 | 3300005457 | Bacteria | 2350 |
| 68 | Ga0070662_100530031 | 3300005457 | Bacteria | 985 |
| 69 | Ga0070681_10000561 | 3300005458 | Bacteria | 30603 |
| 70 | Ga0070681_10076299 | 3300005458 | Bacteria | 3310 |
| 71 | Ga0070681_10088899 | 3300005458 | Bacteria | 3041 |
| 72 | Ga0070681_10926973 | 3300005458 | Bacteria | 790 |
| 73 | Ga0068867_100189074 | 3300005459 | Bacteria | 1642 |
| 74 | Ga0068867_100526755 | 3300005459 | Bacteria | 1020 |
| 75 | Ga0070685_10024015 | 3300005466 | Bacteria | 3345 |
| 76 | Ga0070685_10272009 | 3300005466 | Bacteria | 1131 |
| 77 | Ga0070706_100518750 | 3300005467 | Bacteria | 1108 |
| 78 | Ga0070707_100181398 | 3300005468 | Bacteria | 2052 |
| 79 | Ga0070707_100212173 | 3300005468 | Bacteria | 1887 |
| 80 | Ga0070679_100000912 | 3300005530 | Bacteria | 25636 |
| 81 | Ga0070679_100012491 | 3300005530 | Bacteria | 8118 |
| 82 | Ga0070679_100190367 | 3300005530 | Bacteria | 2021 |
| 83 | Ga0070679_100679147 | 3300005530 | Bacteria | 972 |
| 84 | Ga0070684_100255879 | 3300005535 | Bacteria | 1601 |
| 85 | Ga0070684_100573619 | 3300005535 | Bacteria | 1048 |
| 86 | Ga0070684_100723193 | 3300005535 | Bacteria | 929 |
| 87 | Ga0070684_101177679 | 3300005535 | Bacteria | 721 |
| 88 | Ga0070697_100015765 | 3300005536 | Bacteria | 5935 |
| 89 | Ga0068853_100408167 | 3300005539 | Bacteria | 1272 |
| 90 | Ga0070672_100416782 | 3300005543 | Bacteria | 1153 |
| 91 | Ga0070672_101151148 | 3300005543 | Bacteria | 690 |
| 92 | Ga0070686_100276370 | 3300005544 | Bacteria | 1237 |
| 93 | Ga0070686_100548446 | 3300005544 | Bacteria | 904 |
| 94 | Ga0070696_100497480 | 3300005546 | Bacteria | 969 |
| 95 | Ga0070696_100718182 | 3300005546 | Bacteria | 816 |
| 96 | Ga0070693_100179727 | 3300005547 | Bacteria | 1361 |
| 97 | Ga0070665_100029684 | 3300005548 | Bacteria | 5502 |
| 98 | Ga0070704_100281570 | 3300005549 | Bacteria | 1378 |
| 99 | Ga0070664_100454083 | 3300005564 | Bacteria | 1177 |
| 100 | Ga0068857_100280058 | 3300005577 | Bacteria | 1534 |
| 101 | Ga0068857_100325556 | 3300005577 | Bacteria | 1420 |
| 102 | Ga0068854_100047428 | 3300005578 | Bacteria | 3061 |
| 103 | Ga0068854_100324875 | 3300005578 | Bacteria | 1252 |
| 104 | Ga0070702_100000821 | 3300005615 | Bacteria | 11927 |
| 105 | Ga0070702_100002847 | 3300005615 | Bacteria | 7590 |
| 106 | Ga0070702_100444918 | 3300005615 | Bacteria | 939 |
| 107 | Ga0070702_100950227 | 3300005615 | Bacteria | 677 |
| 108 | Ga0068852_100064041 | 3300005616 | Bacteria | 3203 |
| 109 | Ga0068852_100988807 | 3300005616 | Bacteria | 860 |
| 110 | Ga0068852_101979930 | 3300005616 | Bacteria | 605 |
| 111 | Ga0068859_100071646 | 3300005617 | Bacteria | 3502 |
| 112 | Ga0068859_100126212 | 3300005617 | Bacteria | 2628 |
| 113 | Ga0068864_100178627 | 3300005618 | Bacteria | 1939 |
| 114 | Ga0068861_100217178 | 3300005719 | Bacteria | 1614 |
| 115 | Ga0068861_100727552 | 3300005719 | Bacteria | 925 |
| 116 | Ga0068861_101590455 | 3300005719 | Bacteria | 644 |
| 117 | Ga0068851_10021990 | 3300005834 | Bacteria | 3101 |
| 118 | Ga0068870_10001037 | 3300005840 | Bacteria | 10970 |
| 119 | Ga0068870_10403656 | 3300005840 | Bacteria | 890 |
| 120 | Ga0068870_10778447 | 3300005840 | Bacteria | 667 |
| 121 | Ga0068863_100006203 | 3300005841 | Bacteria | 11727 |
| 122 | Ga0068863_100838580 | 3300005841 | Bacteria | 918 |
| 123 | Ga0068858_100048458 | 3300005842 | Bacteria | 3937 |
| 124 | Ga0068860_100000311 | 3300005843 | Bacteria | 66954 |
| 125 | Ga0068860_100614801 | 3300005843 | Bacteria | 1093 |
| 126 | Ga0068862_100990174 | 3300005844 | Bacteria | 831 |
| 127 | Ga0081455_10008050 | 3300005937 | Bacteria | 11010 |
| 128 | Ga0081455_10194202 | 3300005937 | Bacteria | 1526 |
| 129 | Ga0081540_1000117 | 3300005983 | Bacteria | 84123 |
| 130 | Ga0081540_1051895 | 3300005983 | Bacteria | 2024 |
| 131 | Ga0081539_10024421 | 3300005985 | Bacteria | 3921 |
| 132 | Ga0081539_10078617 | 3300005985 | Bacteria | 1741 |
| 133 | Ga0070717_10069655 | 3300006028 | Bacteria | 2930 |
| 134 | Ga0075365_10009055 | 3300006038 | Bacteria | 5694 |
| 135 | Ga0075365_10027959 | 3300006038 | Bacteria | 3592 |
| 136 | Ga0075365_10037167 | 3300006038 | Bacteria | 3160 |
| 137 | Ga0075365_10043679 | 3300006038 | Bacteria | 2934 |
| 138 | Ga0075365_10281346 | 3300006038 | Bacteria | 1170 |
| 139 | Ga0075365_10427097 | 3300006038 | Bacteria | 935 |
| 140 | Ga0075365_10525721 | 3300006038 | Bacteria | 836 |
| 141 | Ga0075365_10814805 | 3300006038 | Bacteria | 659 |
| 142 | Ga0075368_10000188 | 3300006042 | Bacteria | 16897 |
| 143 | Ga0075368_10013720 | 3300006042 | Bacteria | 2979 |
| 144 | Ga0075368_10119014 | 3300006042 | Bacteria | 1093 |
| 145 | Ga0075363_100006379 | 3300006048 | Bacteria | 5347 |
| 146 | Ga0075363_100016364 | 3300006048 | Bacteria | 3663 |
| 147 | Ga0075363_100085108 | 3300006048 | Bacteria | 1734 |
| 148 | Ga0075363_100159700 | 3300006048 | Bacteria | 1276 |
| 149 | Ga0075363_100167151 | 3300006048 | Bacteria | 1247 |
| 150 | Ga0075364_10013400 | 3300006051 | Bacteria | 5038 |
| 151 | Ga0075364_10015654 | 3300006051 | Bacteria | 4706 |
| 152 | Ga0075364_10123355 | 3300006051 | Bacteria | 1735 |
| 153 | Ga0075364_10149999 | 3300006051 | Bacteria | 1571 |
| 154 | Ga0075364_10311184 | 3300006051 | Bacteria | 1072 |
| 155 | Ga0075364_10323784 | 3300006051 | Bacteria | 1050 |
| 156 | Ga0070716_100327919 | 3300006173 | Bacteria | 1075 |
| 157 | Ga0070716_100546892 | 3300006173 | Bacteria | 863 |
| 158 | Ga0070712_100113997 | 3300006175 | Bacteria | 2023 |
| 159 | Ga0070712_100119096 | 3300006175 | Bacteria | 1984 |
| 160 | Ga0075362_10010752 | 3300006177 | Bacteria | 3584 |
| 161 | Ga0075362_10063831 | 3300006177 | Bacteria | 1671 |
| 162 | Ga0075362_10183797 | 3300006177 | Bacteria | 1014 |
| 163 | Ga0075367_10004589 | 3300006178 | Bacteria | 6759 |
| 164 | Ga0075367_10027120 | 3300006178 | Bacteria | 3255 |
| 165 | Ga0075367_10358481 | 3300006178 | Bacteria | 921 |
| 166 | Ga0075367_10429354 | 3300006178 | Bacteria | 837 |
| 167 | Ga0097621_100006415 | 3300006237 | Bacteria | 8350 |
| 168 | Ga0075370_10009317 | 3300006353 | Bacteria | 5095 |
| 169 | Ga0075370_10041500 | 3300006353 | Bacteria | 2597 |
| 170 | Ga0075370_10065848 | 3300006353 | Bacteria | 2066 |
| 171 | Ga0075370_10175446 | 3300006353 | Bacteria | 1261 |
| 172 | Ga0075370_10205429 | 3300006353 | Bacteria | 1162 |
| 173 | Ga0075370_10388409 | 3300006353 | Bacteria | 836 |
| 174 | Ga0075428_100111063 | 3300006844 | Bacteria | 2987 |
| 175 | Ga0075428_100421995 | 3300006844 | Bacteria | 1429 |
| 176 | Ga0075431_100049848 | 3300006847 | Bacteria | 4317 |
| 177 | Ga0075433_10005579 | 3300006852 | Bacteria | 9885 |
| 178 | Ga0075434_100002856 | 3300006871 | Bacteria | 15319 |
| 179 | Ga0075429_100453458 | 3300006880 | Bacteria | 1124 |
| 180 | Ga0068865_100147964 | 3300006881 | Bacteria | 1778 |
| 181 | Ga0068865_100363383 | 3300006881 | Bacteria | 1176 |
| 182 | Ga0075436_100002169 | 3300006914 | Bacteria | 13525 |
| 183 | Ga0075436_100013538 | 3300006914 | Bacteria | 5587 |
| 184 | Ga0097620_100071648 | 3300006931 | Bacteria | 3502 |
| 185 | Ga0097620_100126211 | 3300006931 | Bacteria | 2628 |
| 186 | Ga0075435_100006462 | 3300007076 | Bacteria | 8291 |
| 187 | Ga0105251_10008366 | 3300009011 | Bacteria | 6239 |
| 188 | Ga0105251_10046840 | 3300009011 | Bacteria | 2080 |
| 189 | Ga0105240_11127137 | 3300009093 | Bacteria | 834 |
| 190 | Ga0105240_12490951 | 3300009093 | Bacteria | 535 |
| 191 | Ga0111539_10017516 | 3300009094 | Bacteria | 8869 |
| 192 | Ga0111539_10050843 | 3300009094 | Bacteria | 4938 |
| 193 | Ga0111539_12281488 | 3300009094 | Bacteria | 628 |
| 194 | Ga0105245_10075606 | 3300009098 | Bacteria | 3067 |
| 195 | Ga0105245_11047374 | 3300009098 | Bacteria | 861 |
| 196 | Ga0105245_11194175 | 3300009098 | Bacteria | 809 |
| 197 | Ga0105245_11874486 | 3300009098 | Bacteria | 653 |
| 198 | Ga0105247_10313276 | 3300009101 | Bacteria | 1092 |
| 199 | Ga0114129_10004172 | 3300009147 | Bacteria | 20410 |
| 200 | Ga0114129_10241311 | 3300009147 | Bacteria | 2429 |
| 201 | Ga0105243_10111333 | 3300009148 | Bacteria | 2291 |
| 202 | Ga0105243_10144836 | 3300009148 | Bacteria | 2032 |
| 203 | Ga0105243_10601421 | 3300009148 | Bacteria | 1059 |
| 204 | Ga0105243_10851185 | 3300009148 | Bacteria | 903 |
| 205 | Ga0105243_11886853 | 3300009148 | Bacteria | 630 |
| 206 | Ga0105241_10092283 | 3300009174 | Bacteria | 2391 |
| 207 | Ga0105241_10209893 | 3300009174 | Bacteria | 1631 |
| 208 | Ga0105242_10006011 | 3300009176 | Bacteria | 9358 |
| 209 | Ga0105248_10054024 | 3300009177 | Bacteria | 4505 |
| 210 | Ga0105248_11343235 | 3300009177 | Bacteria | 809 |
| 211 | Ga0105237_10111283 | 3300009545 | Bacteria | 2730 |
| 212 | Ga0105238_10199060 | 3300009551 | Bacteria | 1979 |
| 213 | Ga0105249_10023032 | 3300009553 | Bacteria | 5584 |
| 214 | Ga0105249_10831962 | 3300009553 | Bacteria | 988 |
| 215 | Ga0105249_11295545 | 3300009553 | Bacteria | 800 |
| 216 | Ga0105249_13501888 | 3300009553 | Bacteria | 505 |
| 217 | Ga0099796_10188361 | 3300010159 | Bacteria | 831 |
| 218 | Ga0105239_10027014 | 3300010375 | Bacteria | 6318 |
| 219 | Ga0105239_11304588 | 3300010375 | Bacteria | 837 |
| 220 | Ga0105239_12452413 | 3300010375 | Bacteria | 608 |
| 221 | Ga0105246_10022876 | 3300011119 | Bacteria | 4039 |
| 222 | Ga0105246_10117793 | 3300011119 | Bacteria | 1963 |
| 223 | Ga0105246_10184398 | 3300011119 | Bacteria | 1610 |
| 224 | Ga0105246_10466911 | 3300011119 | Bacteria | 1064 |
| 225 | Ga0105246_11000288 | 3300011119 | Bacteria | 757 |
| 226 | Ga0157373_10070352 | 3300013100 | Bacteria | 2472 |
| 227 | Ga0157371_10097728 | 3300013102 | Bacteria | 2082 |
| 228 | Ga0157370_10025448 | 3300013104 | Bacteria | 5858 |
| 229 | Ga0157370_10429914 | 3300013104 | Bacteria | 1214 |
| 230 | Ga0157370_10620900 | 3300013104 | Bacteria | 989 |
| 231 | Ga0157369_10001259 | 3300013105 | Bacteria | 31492 |
| 232 | Ga0157369_10020619 | 3300013105 | Bacteria | 7370 |
| 233 | Ga0157369_10158228 | 3300013105 | Bacteria | 2392 |
| 234 | Ga0157369_10295849 | 3300013105 | Bacteria | 1685 |
| 235 | Ga0157369_10650809 | 3300013105 | Bacteria | 1087 |
| 236 | Ga0157374_10206169 | 3300013296 | Bacteria | 1927 |
| 237 | Ga0157374_10325781 | 3300013296 | Bacteria | 1523 |
| 238 | Ga0157374_11395321 | 3300013296 | Bacteria | 723 |
| 239 | Ga0157378_10227778 | 3300013297 | Bacteria | 1774 |
| 240 | Ga0163162_10019250 | 3300013306 | Bacteria | 6693 |
| 241 | Ga0163162_10396978 | 3300013306 | Bacteria | 1512 |
| 242 | Ga0163162_10677252 | 3300013306 | Bacteria | 1154 |
| 243 | Ga0163162_10689326 | 3300013306 | Bacteria | 1144 |
| 244 | Ga0163162_11366363 | 3300013306 | Bacteria | 806 |
| 245 | Ga0157372_10028842 | 3300013307 | Bacteria | 6058 |
| 246 | Ga0157372_10344977 | 3300013307 | Bacteria | 1735 |
| 247 | Ga0157372_10544157 | 3300013307 | Bacteria | 1353 |
| 248 | Ga0157372_10563282 | 3300013307 | Bacteria | 1328 |
| 249 | Ga0157372_10863301 | 3300013307 | Bacteria | 1050 |
| 250 | Ga0157372_11011355 | 3300013307 | Bacteria | 963 |
| 251 | Ga0157372_11700200 | 3300013307 | Bacteria | 726 |
| 252 | Ga0157375_10034623 | 3300013308 | Bacteria | 4813 |
| 253 | Ga0157375_10160740 | 3300013308 | Bacteria | 2388 |
| 254 | Ga0157375_10219689 | 3300013308 | Bacteria | 2059 |
| 255 | Ga0157375_10379131 | 3300013308 | Bacteria | 1581 |
| 256 | Ga0157375_10643094 | 3300013308 | Bacteria | 1217 |
| 257 | Ga0157375_10732980 | 3300013308 | Bacteria | 1141 |
| 258 | Ga0157375_10879156 | 3300013308 | Bacteria | 1041 |
| 259 | Ga0157375_11001806 | 3300013308 | Bacteria | 975 |
| 260 | Ga0157375_11316920 | 3300013308 | Bacteria | 849 |
| 261 | Ga0163163_11032346 | 3300014325 | Bacteria | 885 |
| 262 | Ga0157380_10165169 | 3300014326 | Bacteria | 1928 |
| 263 | Ga0157380_10957883 | 3300014326 | Bacteria | 886 |
| 264 | Ga0157380_12189714 | 3300014326 | Bacteria | 616 |
| 265 | Ga0157380_12678787 | 3300014326 | Bacteria | 565 |
| 266 | Ga0157380_13062449 | 3300014326 | Bacteria | 533 |
| 267 | Ga0182008_10040061 | 3300014497 | Bacteria | 2340 |
| 268 | Ga0182008_10046941 | 3300014497 | Bacteria | 2146 |
| 269 | Ga0182008_10321853 | 3300014497 | Bacteria | 814 |
| 270 | Ga0182008_10558235 | 3300014497 | Bacteria | 637 |
| 271 | Ga0157377_10206301 | 3300014745 | Bacteria | 1251 |
| 272 | Ga0157377_11026102 | 3300014745 | Bacteria | 626 |
| 273 | Ga0157379_10134130 | 3300014968 | Bacteria | 2230 |
| 274 | Ga0157379_11268113 | 3300014968 | Bacteria | 711 |
| 275 | Ga0157376_10066159 | 3300014969 | Bacteria | 3054 |
| 276 | Ga0157376_10274463 | 3300014969 | Bacteria | 1585 |
| 277 | Ga0182006_1249420 | 3300015261 | Bacteria | 583 |
| 278 | Ga0163161_10029059 | 3300017792 | Bacteria | 3929 |
| 279 | Ga0163161_10142069 | 3300017792 | Bacteria | 1818 |
| 280 | Ga0163161_10269852 | 3300017792 | Bacteria | 1331 |
| 281 | Ga0163161_11233663 | 3300017792 | Bacteria | 648 |
| 282 | Ga0184603_133284 | 3300019192 | Bacteria | 765 |
| 283 | Ga0197907_10307493 | 3300020069 | Bacteria | 6708 |
| 284 | Ga0197907_10608651 | 3300020069 | Bacteria | 5410 |
| 285 | Ga0197907_10630705 | 3300020069 | Bacteria | 855 |
| 286 | Ga0197907_10728872 | 3300020069 | Bacteria | 1354 |
| 287 | Ga0197907_10866496 | 3300020069 | Bacteria | 2093 |
| 288 | Ga0197907_11048701 | 3300020069 | Bacteria | 882 |
| 289 | Ga0197907_11113641 | 3300020069 | Bacteria | 3671 |
| 290 | Ga0206356_10068051 | 3300020070 | Bacteria | 2714 |
| 291 | Ga0206356_10176009 | 3300020070 | Bacteria | 1803 |
| 292 | Ga0206356_10355133 | 3300020070 | Bacteria | 2299 |
| 293 | Ga0206349_1224696 | 3300020075 | Bacteria | 2294 |
| 294 | Ga0206349_1425530 | 3300020075 | Bacteria | 859 |
| 295 | Ga0206349_1536441 | 3300020075 | Bacteria | 2934 |
| 296 | Ga0206355_1124023 | 3300020076 | Bacteria | 1008 |
| 297 | Ga0206355_1327778 | 3300020076 | Bacteria | 1033 |
| 298 | Ga0206355_1642650 | 3300020076 | Bacteria | 1097 |
| 299 | Ga0206351_10105420 | 3300020077 | Bacteria | 744 |
| 300 | Ga0206351_10173414 | 3300020077 | Bacteria | 1440 |
| 301 | Ga0206351_10323992 | 3300020077 | Bacteria | 3756 |
| 302 | Ga0206351_10432790 | 3300020077 | Bacteria | 4040 |
| 303 | Ga0206351_10445423 | 3300020077 | Bacteria | 2108 |
| 304 | Ga0206351_10828683 | 3300020077 | Bacteria | 5869 |
| 305 | Ga0206352_10126105 | 3300020078 | Bacteria | 3946 |
| 306 | Ga0206352_10517260 | 3300020078 | Bacteria | 4910 |
| 307 | Ga0206352_10633471 | 3300020078 | Bacteria | 934 |
| 308 | Ga0206352_10839668 | 3300020078 | Bacteria | 636 |
| 309 | Ga0206350_10125668 | 3300020080 | Bacteria | 1551 |
| 310 | Ga0206350_10401678 | 3300020080 | Bacteria | 915 |
| 311 | Ga0206350_10669213 | 3300020080 | Bacteria | 1056 |
| 312 | Ga0206350_10713574 | 3300020080 | Bacteria | 6297 |
| 313 | Ga0206350_11614803 | 3300020080 | Bacteria | 1376 |
| 314 | Ga0206354_10138557 | 3300020081 | Bacteria | 1737 |
| 315 | Ga0206354_10424931 | 3300020081 | Bacteria | 1559 |
| 316 | Ga0206354_10566456 | 3300020081 | Bacteria | 10006 |
| 317 | Ga0206354_10730064 | 3300020081 | Bacteria | 2118 |
| 318 | Ga0206354_10790317 | 3300020081 | Bacteria | 1704 |
| 319 | Ga0206353_10548237 | 3300020082 | Bacteria | 25106 |
| 320 | Ga0206353_10555370 | 3300020082 | Bacteria | 1904 |
| 321 | Ga0206353_10564495 | 3300020082 | Bacteria | 1089 |
| 322 | Ga0206353_10672241 | 3300020082 | Bacteria | 1765 |
| 323 | Ga0206353_11125031 | 3300020082 | Bacteria | 3899 |
| 324 | Ga0206353_11189061 | 3300020082 | Bacteria | 867 |
| 325 | Ga0206353_11470156 | 3300020082 | Bacteria | 2696 |
| 326 | Ga0154015_1029170 | 3300020610 | Bacteria | 1085 |
| 327 | Ga0154015_1252405 | 3300020610 | Bacteria | 1123 |
| 328 | Ga0154015_1594405 | 3300020610 | Bacteria | 928 |
| 329 | Ga0213874_10016680 | 3300021377 | Bacteria | 1960 |
| 330 | Ga0213876_10253305 | 3300021384 | Bacteria | 936 |
| 331 | Ga0213875_10000102 | 3300021388 | Bacteria | 96815 |
| 332 | Ga0224712_10001468 | 3300022467 | Bacteria | 5439 |
| 333 | Ga0224712_10020064 | 3300022467 | Bacteria | 2263 |
| 334 | Ga0224712_10029020 | 3300022467 | Bacteria | 1983 |
| 335 | Ga0224712_10094320 | 3300022467 | Bacteria | 1259 |
| 336 | Ga0224712_10219723 | 3300022467 | Bacteria | 869 |
| 337 | Ga0224712_10377046 | 3300022467 | Bacteria | 674 |
| 338 | Ga0209025_1034041 | 3300025294 | Bacteria | 2338 |
| 339 | Ga0209051_1000021 | 3300025303 | Bacteria | 507633 |
| 340 | Ga0207713_1056599 | 3300025735 | Bacteria | 1522 |
| 341 | Ga0207692_10000388 | 3300025898 | Bacteria | 15180 |
| 342 | Ga0207692_10018677 | 3300025898 | Bacteria | 3117 |
| 343 | Ga0207710_10104924 | 3300025900 | Bacteria | 1337 |
| 344 | Ga0207688_10018768 | 3300025901 | Bacteria | 3761 |
| 345 | Ga0207688_10561084 | 3300025901 | Bacteria | 718 |
| 346 | Ga0207680_10192755 | 3300025903 | Bacteria | 1384 |
| 347 | Ga0207680_10270423 | 3300025903 | Bacteria | 1179 |
| 348 | Ga0207647_10002418 | 3300025904 | Bacteria | 14155 |
| 349 | Ga0207699_10078718 | 3300025906 | Bacteria | 2037 |
| 350 | Ga0207699_10394798 | 3300025906 | Bacteria | 984 |
| 351 | Ga0207645_10091949 | 3300025907 | Bacteria | 1951 |
| 352 | Ga0207643_10002076 | 3300025908 | Bacteria | 11033 |
| 353 | Ga0207643_10532004 | 3300025908 | Bacteria | 753 |
| 354 | Ga0207643_10638079 | 3300025908 | Bacteria | 687 |
| 355 | Ga0207705_10000473 | 3300025909 | Bacteria | 34432 |
| 356 | Ga0207705_10000656 | 3300025909 | Bacteria | 28823 |
| 357 | Ga0207705_10111512 | 3300025909 | Bacteria | 2022 |
| 358 | Ga0207705_10311099 | 3300025909 | Bacteria | 1209 |
| 359 | Ga0207654_10011248 | 3300025911 | Bacteria | 4561 |
| 360 | Ga0207707_10000151 | 3300025912 | Bacteria | 72718 |
| 361 | Ga0207707_10040361 | 3300025912 | Bacteria | 4076 |
| 362 | Ga0207707_10505747 | 3300025912 | Bacteria | 1030 |
| 363 | Ga0207695_10673985 | 3300025913 | Bacteria | 915 |
| 364 | Ga0207671_10103889 | 3300025914 | Bacteria | 2155 |
| 365 | Ga0207693_10123935 | 3300025915 | Bacteria | 2030 |
| 366 | Ga0207693_10219262 | 3300025915 | Bacteria | 1495 |
| 367 | Ga0207663_10069925 | 3300025916 | Bacteria | 2260 |
| 368 | Ga0207663_10093553 | 3300025916 | Bacteria | 2001 |
| 369 | Ga0207660_10000490 | 3300025917 | Bacteria | 26377 |
| 370 | Ga0207660_10051770 | 3300025917 | Bacteria | 2920 |
| 371 | Ga0207660_10320012 | 3300025917 | Bacteria | 1239 |
| 372 | Ga0207660_10368250 | 3300025917 | Bacteria | 1154 |
| 373 | Ga0207660_10953543 | 3300025917 | Bacteria | 700 |
| 374 | Ga0207662_10151718 | 3300025918 | Bacteria | 1474 |
| 375 | Ga0207657_10051387 | 3300025919 | Bacteria | 3583 |
| 376 | Ga0207657_10408257 | 3300025919 | Bacteria | 1068 |
| 377 | Ga0207649_10002292 | 3300025920 | Bacteria | 10764 |
| 378 | Ga0207652_10000244 | 3300025921 | Bacteria | 56728 |
| 379 | Ga0207652_10005388 | 3300025921 | Bacteria | 10382 |
| 380 | Ga0207652_10010913 | 3300025921 | Bacteria | 7322 |
| 381 | Ga0207652_10053044 | 3300025921 | Bacteria | 3482 |
| 382 | Ga0207652_10320133 | 3300025921 | Bacteria | 1400 |
| 383 | Ga0207646_10009734 | 3300025922 | Bacteria | 9470 |
| 384 | Ga0207646_10271653 | 3300025922 | Bacteria | 1532 |
| 385 | Ga0207681_10704273 | 3300025923 | Bacteria | 840 |
| 386 | Ga0207694_10438450 | 3300025924 | Bacteria | 1090 |
| 387 | Ga0207650_10002863 | 3300025925 | Bacteria | 11917 |
| 388 | Ga0207659_10028015 | 3300025926 | Bacteria | 3822 |
| 389 | Ga0207659_10145250 | 3300025926 | Bacteria | 1846 |
| 390 | Ga0207687_10165793 | 3300025927 | Bacteria | 1699 |
| 391 | Ga0207687_10949705 | 3300025927 | Bacteria | 736 |
| 392 | Ga0207687_11921989 | 3300025927 | Bacteria | 506 |
| 393 | Ga0207700_10005313 | 3300025928 | Bacteria | 7686 |
| 394 | Ga0207700_10255552 | 3300025928 | Bacteria | 1498 |
| 395 | Ga0207664_10013288 | 3300025929 | Bacteria | 5905 |
| 396 | Ga0207664_10150420 | 3300025929 | Bacteria | 1977 |
| 397 | Ga0207664_10540273 | 3300025929 | Bacteria | 1045 |
| 398 | Ga0207644_10005580 | 3300025931 | Bacteria | 8190 |
| 399 | Ga0207644_10842072 | 3300025931 | Bacteria | 768 |
| 400 | Ga0207690_10061333 | 3300025932 | Bacteria | 2556 |
| 401 | Ga0207690_10182574 | 3300025932 | Bacteria | 1581 |
| 402 | Ga0207706_10023491 | 3300025933 | Bacteria | 5538 |
| 403 | Ga0207706_10382012 | 3300025933 | Bacteria | 1222 |
| 404 | Ga0207686_10385770 | 3300025934 | Bacteria | 1064 |
| 405 | Ga0207686_10497504 | 3300025934 | Bacteria | 945 |
| 406 | Ga0207709_10235125 | 3300025935 | Bacteria | 1330 |
| 407 | Ga0207709_10441053 | 3300025935 | Bacteria | 1004 |
| 408 | Ga0207670_10036590 | 3300025936 | Bacteria | 3193 |
| 409 | Ga0207669_10731406 | 3300025937 | Bacteria | 816 |
| 410 | Ga0207704_10711723 | 3300025938 | Bacteria | 832 |
| 411 | Ga0207665_10208117 | 3300025939 | Bacteria | 1428 |
| 412 | Ga0207665_10314386 | 3300025939 | Bacteria | 1174 |
| 413 | Ga0207691_10155897 | 3300025940 | Bacteria | 2005 |
| 414 | Ga0207691_10166739 | 3300025940 | Bacteria | 1930 |
| 415 | Ga0207689_10000187 | 3300025942 | Bacteria | 53919 |
| 416 | Ga0207661_10007069 | 3300025944 | Bacteria | 7968 |
| 417 | Ga0207661_10051520 | 3300025944 | Bacteria | 3285 |
| 418 | Ga0207661_10259967 | 3300025944 | Bacteria | 1546 |
| 419 | Ga0207661_10661371 | 3300025944 | Bacteria | 960 |
| 420 | Ga0207661_11604636 | 3300025944 | Bacteria | 595 |
| 421 | Ga0207679_10003356 | 3300025945 | Bacteria | 9880 |
| 422 | Ga0207679_10483402 | 3300025945 | Bacteria | 1103 |
| 423 | Ga0207679_10495206 | 3300025945 | Bacteria | 1090 |
| 424 | Ga0207667_10464664 | 3300025949 | Bacteria | 1285 |
| 425 | Ga0207712_10130884 | 3300025961 | Bacteria | 1912 |
| 426 | Ga0207668_10197731 | 3300025972 | Bacteria | 1598 |
| 427 | Ga0207668_10345149 | 3300025972 | Bacteria | 1243 |
| 428 | Ga0207668_11488911 | 3300025972 | Bacteria | 611 |
| 429 | Ga0207640_10691655 | 3300025981 | Bacteria | 873 |
| 430 | Ga0207658_10013386 | 3300025986 | Bacteria | 5602 |
| 431 | Ga0207658_10022887 | 3300025986 | Bacteria | 4354 |
| 432 | Ga0207658_10234070 | 3300025986 | Bacteria | 1552 |
| 433 | Ga0207658_11082737 | 3300025986 | Bacteria | 732 |
| 434 | Ga0207677_10029455 | 3300026023 | Bacteria | 3489 |
| 435 | Ga0207677_10165088 | 3300026023 | Bacteria | 1725 |
| 436 | Ga0207703_10151595 | 3300026035 | Bacteria | 2022 |
| 437 | Ga0207639_10086732 | 3300026041 | Bacteria | 2493 |
| 438 | Ga0207678_10001304 | 3300026067 | Bacteria | 23126 |
| 439 | Ga0207678_10702470 | 3300026067 | Bacteria | 890 |
| 440 | Ga0207708_10258951 | 3300026075 | Bacteria | 1404 |
| 441 | Ga0207708_10493775 | 3300026075 | Bacteria | 1025 |
| 442 | Ga0207702_10035607 | 3300026078 | Bacteria | 4162 |
| 443 | Ga0207702_10051266 | 3300026078 | Bacteria | 3486 |
| 444 | Ga0207641_10012905 | 3300026088 | Bacteria | 6854 |
| 445 | Ga0207641_11075322 | 3300026088 | Bacteria | 803 |
| 446 | Ga0207648_10128853 | 3300026089 | Bacteria | 2226 |
| 447 | Ga0207676_10004752 | 3300026095 | Bacteria | 9634 |
| 448 | Ga0207676_11119889 | 3300026095 | Bacteria | 779 |
| 449 | Ga0207674_10282074 | 3300026116 | Bacteria | 1609 |
| 450 | Ga0207674_10343894 | 3300026116 | Bacteria | 1442 |
| 451 | Ga0207674_10369428 | 3300026116 | Bacteria | 1387 |
| 452 | Ga0207675_101072279 | 3300026118 | Bacteria | 825 |
| 453 | Ga0207683_10003495 | 3300026121 | Bacteria | 13712 |
| 454 | Ga0207683_10348221 | 3300026121 | Bacteria | 1359 |
| 455 | Ga0207683_10748938 | 3300026121 | Bacteria | 906 |
| 456 | Ga0207698_10011335 | 3300026142 | Bacteria | 5773 |
| 457 | Ga0207698_10990795 | 3300026142 | Bacteria | 851 |
| 458 | Ga0209813_10026252 | 3300027866 | Bacteria | 1683 |
| 459 | Ga0209813_10054887 | 3300027866 | Bacteria | 1257 |
| 460 | Ga0209974_10088590 | 3300027876 | Bacteria | 1071 |
| 461 | Ga0207428_10030086 | 3300027907 | Bacteria | 4491 |
| 462 | Ga0268266_10000855 | 3300028379 | Bacteria | 39694 |
| 463 | Ga0268266_10091196 | 3300028379 | Bacteria | 2672 |
| 464 | Ga0268266_10102032 | 3300028379 | Bacteria | 2530 |
| 465 | Ga0268266_10627677 | 3300028379 | Bacteria | 1033 |
| 466 | Ga0268266_11658644 | 3300028379 | Bacteria | 615 |
| 467 | Ga0268265_11928816 | 3300028380 | Bacteria | 598 |
| 468 | Ga0268264_10000717 | 3300028381 | Bacteria | 38073 |
| 469 | Ga0268264_10415167 | 3300028381 | Bacteria | 1297 |
| 470 | Ga0265336_10013779 | 3300028666 | Bacteria | 2690 |
| 471 | Ga0307517_10283573 | 3300028786 | Bacteria | 942 |
| 472 | Ga0265338_10001554 | 3300028800 | Bacteria | 37076 |
| 473 | Ga0316177_1209821 | 3300030731 | Bacteria | 1353 |
| 474 | Ga0316176_1061306 | 3300030732 | Bacteria | 5399 |
| 475 | Ga0314311_1084681 | 3300030733 | Bacteria | 3338 |
| 476 | Ga0314311_1113072 | 3300030733 | Bacteria | 904 |
| 477 | Ga0316178_1152700 | 3300030735 | Bacteria | 703 |
| 478 | Ga0316180_1121628 | 3300030736 | Bacteria | 1125 |
| 479 | Ga0316182_1129288 | 3300030745 | Bacteria | 917 |
| 480 | Ga0265767_102761 | 3300030836 | Bacteria | 959 |
| 481 | Ga0265327_10000081 | 3300031251 | Bacteria | 205988 |
| 482 | Ga0265327_10002020 | 3300031251 | Bacteria | 22893 |
| 483 | Ga0265327_10027896 | 3300031251 | Bacteria | 3241 |
| 484 | Ga0265327_10113483 | 3300031251 | Bacteria | 1292 |
| 485 | Ga0307408_100839563 | 3300031548 | Bacteria | 837 |
| 486 | Ga0316579_10185689 | 3300031691 | Bacteria | 1005 |
| 487 | Ga0316576_10046001 | 3300031727 | Bacteria | 3157 |
| 488 | Ga0316576_10107854 | 3300031727 | Bacteria | 2086 |
| 489 | Ga0316578_10017290 | 3300031728 | Bacteria | 3921 |
| 490 | Ga0307516_10665113 | 3300031730 | Bacteria | 697 |
| 491 | Ga0307405_10211453 | 3300031731 | Bacteria | 1416 |
| 492 | Ga0307518_10001710 | 3300031838 | Bacteria | 16204 |
| 493 | Ga0307410_10092703 | 3300031852 | Bacteria | 2148 |
| 494 | Ga0307407_10471088 | 3300031903 | Bacteria | 915 |
| 495 | Ga0307407_10516401 | 3300031903 | Bacteria | 878 |
| 496 | Ga0307407_10899419 | 3300031903 | Bacteria | 679 |
| 497 | Ga0307412_10095212 | 3300031911 | Bacteria | 2093 |
| 498 | Ga0307412_10243357 | 3300031911 | Bacteria | 1393 |
| 499 | Ga0307412_10665408 | 3300031911 | Bacteria | 890 |
| 500 | Ga0307409_100143537 | 3300031995 | Bacteria | 2061 |
| 501 | Ga0307409_100216210 | 3300031995 | Bacteria | 1727 |
| 502 | Ga0307409_100257831 | 3300031995 | Bacteria | 1598 |
| 503 | Ga0307409_100476434 | 3300031995 | Bacteria | 1210 |
| 504 | Ga0307409_101910262 | 3300031995 | Bacteria | 623 |
| 505 | Ga0307416_100345455 | 3300032002 | Bacteria | 1503 |
| 506 | Ga0307416_100380666 | 3300032002 | Bacteria | 1441 |
| 507 | Ga0307416_100919547 | 3300032002 | Bacteria | 975 |
| 508 | Ga0307411_10251063 | 3300032005 | Bacteria | 1391 |
| 509 | Ga0307415_100080821 | 3300032126 | Bacteria | 2320 |
| 510 | Ga0307415_100134833 | 3300032126 | Bacteria | 1876 |
| 511 | Ga0307415_100171992 | 3300032126 | Bacteria | 1690 |
| 512 | Ga0307415_100976632 | 3300032126 | Bacteria | 786 |
| 513 | Ga0316583_10143138 | 3300032133 | Bacteria | 833 |
| 514 | Ga0316585_10003099 | 3300032137 | Bacteria | 4538 |
| 515 | Ga0307507_10009186 | 3300033179 | Bacteria | 13276 |
| 516 | Ga0316596_1001886 | 3300033541 | Bacteria | 4382 |
| 517 | Ga0373926_0134434 | 3300035083 | Bacteria | 937 |
| 518 | Ga0373934_0000025 | 3300035086 | Bacteria | 49119 |
| 519 | Ga0373934_0021200 | 3300035086 | Bacteria | 2503 |
| 520 | Ga0373934_0098840 | 3300035086 | Bacteria | 1179 |
| 521 | Ga0373923_0004992 | 3300035111 | Bacteria | 4463 |
| 522 | Ga0373936_0237260 | 3300035113 | Bacteria | 812 |
| 523 | Ga0373953_0002033 | 3300035117 | Bacteria | 6020 |
| 524 | Ga0373953_0091134 | 3300035117 | Bacteria | 1275 |
| 525 | Ga0373954_0004039 | 3300035118 | Bacteria | 6276 |
| 526 | Ga0373954_0080673 | 3300035118 | Bacteria | 1554 |
| 527 | Ga0373956_0000185 | 3300035119 | Bacteria | 23799 |
| 528 | Ga0373956_0017925 | 3300035119 | Bacteria | 2993 |
| 529 | Ga0373957_0000293 | 3300035120 | Bacteria | 12511 |
| 530 | Ga0373943_0013820 | 3300035170 | Bacteria | 3650 |
| 531 | Ga0373943_0036774 | 3300035170 | Bacteria | 2346 |
| 532 | Ga0373955_0000237 | 3300035172 | Bacteria | 22889 |
| 533 | Ga0373955_0119373 | 3300035172 | Bacteria | 1531 |
| 534 | Ga0316574_0000101 | 3300035398 | Bacteria | 24989 |
| 535 | Ga0316574_0006776 | 3300035398 | Bacteria | 6225 |
| 536 | Ga0316574_0019054 | 3300035398 | Bacteria | 4045 |
| 537 | Ga0373924_0004268 | 3300035410 | Bacteria | 4981 |
| 538 | Ga0373924_0006427 | 3300035410 | Bacteria | 4212 |
| 539 | Ga0373935_0048565 | 3300035692 | Bacteria | 2687 |
| 540 | Ga0373935_0067374 | 3300035692 | Bacteria | 2301 |
| 541 | Ga0373935_0199714 | 3300035692 | Bacteria | 1381 |
| 542 | Ga0373927_0183574 | 3300035695 | Bacteria | 1372 |
| 543 | Ga0373927_0615835 | 3300035695 | Bacteria | 718 |
| 544 | Ga0373933_0000001 | 3300035724 | Bacteria | 228234 |
| 545 | Ga0373933_0002913 | 3300035724 | Bacteria | 9555 |
| 546 | Ga0373933_0042008 | 3300035724 | Bacteria | 2701 |
| 547 | Ga0373947_0275547 | 3300035725 | Bacteria | 1117 |
| 548 | Ga0373937_0000087 | 3300036401 | Bacteria | 85654 |
| 549 | Ga0373937_0001426 | 3300036401 | Bacteria | 19986 |
| 550 | Ga0316582_0007605 | 3300036647 | Bacteria | 5776 |
| 551 | Ga0316584_0001043 | 3300036712 | Bacteria | 16095 |
| 552 | Ga0316584_0185399 | 3300036712 | Bacteria | 1539 |
| 553 | Ga0373925_0528843 | 3300037068 | Bacteria | 969 |
| 554 | Ga0395900_0194724 | 3300037418 | Bacteria | 2054 |
| 555 | Ga0395900_0355808 | 3300037418 | Bacteria | 1437 |
| 556 | Ga0395900_0837218 | 3300037418 | Bacteria | 846 |
| 557 | Ga0395900_1304358 | 3300037418 | Bacteria | 640 |
| 558 | Ga0395898_0106879 | 3300037466 | Bacteria | 2684 |
| 559 | Ga0395898_0596916 | 3300037466 | Bacteria | 1047 |
| 560 | Ga0395898_0669904 | 3300037466 | Bacteria | 980 |
| 561 | Ga0395898_1271121 | 3300037466 | Bacteria | 666 |
| 562 | Ga0395905_0269311 | 3300037471 | Bacteria | 1589 |
| 563 | Ga0436364_0024361 | 3300037853 | Bacteria | 1645 |
| 564 | Ga0436364_0940223 | 3300037853 | Bacteria | 123217 |
| 565 | Ga0395901_0014105 | 3300038443 | Bacteria | 8135 |
| 566 | Ga0395901_0022089 | 3300038443 | Bacteria | 6520 |
| 567 | Ga0395901_0029427 | 3300038443 | Bacteria | 5656 |
| 568 | Ga0395901_0095690 | 3300038443 | Bacteria | 3112 |
| 569 | Ga0395901_1310911 | 3300038443 | Bacteria | 685 |
| 570 | Ga0436365_1397305 | 3300039437 | Bacteria | 676 |
| 571 | Ga0439438_046980 | 3300041405 | Bacteria | 1108 |
| 572 | Ga0439447_021920 | 3300041407 | Bacteria | 1678 |
| 573 | Ga0439466_0137760 | 3300041411 | Bacteria | 750 |
| 574 | Ga0451791_1849534 | 3300041451 | Bacteria | 548 |
| 575 | Ga0451793_0052377 | 3300041452 | Bacteria | 623 |
| 576 | Ga0451793_1932876 | 3300041452 | Bacteria | 558 |
| 577 | Ga0451795_1629950 | 3300041456 | Bacteria | 931 |
| 578 | Ga0451843_1590515 | 3300041509 | Bacteria | 741 |
| 579 | Ga0451853_0584877 | 3300041512 | Bacteria | 859 |
| 580 | Ga0451853_1644521 | 3300041512 | Bacteria | 670 |
| 581 | Ga0451853_1897627 | 3300041512 | Bacteria | 617 |
| 582 | Ga0439431_0005548 | 3300041997 | Bacteria | 2783 |
| 583 | Ga0439448_0005283 | 3300042005 | Bacteria | 3680 |
| 584 | Ga0439450_169893 | 3300042008 | Bacteria | 577 |
| 585 | Ga0439463_014614 | 3300042016 | Bacteria | 1937 |
| 586 | Ga0439446_0009340 | 3300042156 | Bacteria | 2624 |
| 587 | Ga0439458_0004896 | 3300042157 | Bacteria | 3040 |
| 588 | Ga0450909_028179 | 3300042185 | Bacteria | 848 |
| 589 | Ga0439434_0006140 | 3300042435 | Bacteria | 3503 |
| 590 | Ga0439459_0032052 | 3300042438 | Bacteria | 1075 |
| 591 | Ga0450918_044740 | 3300042531 | Bacteria | 799 |
| 592 | Ga0466972_0014657 | 3300044658 | Bacteria | 3924 |
| 593 | Ga0466972_0020311 | 3300044658 | Bacteria | 3319 |
| 594 | Ga0466972_0120626 | 3300044658 | Bacteria | 1237 |
| 595 | Ga0466965_0001357 | 3300044683 | Bacteria | 9813 |
| 596 | Ga0466965_0006241 | 3300044683 | Bacteria | 5393 |
| 597 | Ga0466965_0258667 | 3300044683 | Bacteria | 935 |
| 598 | Ga0466965_0474111 | 3300044683 | Bacteria | 699 |
| 599 | Ga0466966_0154379 | 3300044684 | Bacteria | 1399 |
| 600 | Ga0466966_0642177 | 3300044684 | Bacteria | 639 |
| 601 | Ga0466961_0046581 | 3300044693 | Bacteria | 2773 |
| 602 | Ga0466961_0165609 | 3300044693 | Bacteria | 1376 |
| 603 | Ga0466961_0290484 | 3300044693 | Bacteria | 1000 |
| 604 | Ga0466963_0077264 | 3300044694 | Bacteria | 2249 |
| 605 | Ga0466963_0157850 | 3300044694 | Bacteria | 1578 |
| 606 | Ga0466963_0251642 | 3300044694 | Bacteria | 1240 |
| 607 | Ga0466963_0310667 | 3300044694 | Bacteria | 1109 |
| 608 | Ga0466963_0310832 | 3300044694 | Bacteria | 1109 |
| 609 | Ga0466963_0750558 | 3300044694 | Bacteria | 688 |
| 610 | Ga0466963_0900181 | 3300044694 | Bacteria | 624 |
| 611 | Ga0466964_0039878 | 3300044706 | Bacteria | 1894 |
| 612 | Ga0466964_0043935 | 3300044706 | Bacteria | 1814 |
| 613 | Ga0466964_0248163 | 3300044706 | Bacteria | 876 |
| 614 | Ga0466971_0010225 | 3300044719 | Bacteria | 4099 |
| 615 | Ga0466968_0079260 | 3300044735 | Bacteria | 1441 |
| 616 | Ga0466970_0019209 | 3300044765 | Bacteria | 3541 |
| 617 | Ga0466970_0382919 | 3300044765 | Bacteria | 801 |
| 618 | Ga0466970_0436853 | 3300044765 | Bacteria | 749 |
| 619 | Ga0466957_0018276 | 3300044842 | Bacteria | 4116 |
| 620 | Ga0466957_0094201 | 3300044842 | Bacteria | 1880 |
| 621 | Ga0466957_0172726 | 3300044842 | Bacteria | 1408 |
| 622 | Ga0466957_0357030 | 3300044842 | Bacteria | 992 |
| 623 | Ga0466960_0001488 | 3300044901 | Bacteria | 8545 |
| 624 | Ga0466960_0001500 | 3300044901 | Bacteria | 8502 |
| 625 | Ga0466960_0288613 | 3300044901 | Bacteria | 921 |
| 626 | Ga0466960_0291335 | 3300044901 | Bacteria | 917 |
| 627 | Ga0466960_0350482 | 3300044901 | Bacteria | 842 |
| 628 | Ga0466959_0191154 | 3300045049 | Bacteria | 1429 |
| 629 | Ga0466959_0365902 | 3300045049 | Bacteria | 982 |
| 630 | Ga0466958_0002768 | 3300045836 | Bacteria | 8909 |
| 631 | Ga0466958_0020682 | 3300045836 | Bacteria | 3840 |
| 632 | Ga0466958_0150434 | 3300045836 | Bacteria | 1468 |
| 633 | Ga0466967_0001887 | 3300045976 | Bacteria | 12656 |
| 634 | Ga0466967_0012785 | 3300045976 | Bacteria | 6448 |
| 635 | Ga0466967_0029228 | 3300045976 | Bacteria | 4610 |
| 636 | Ga0466967_0043439 | 3300045976 | Bacteria | 3891 |
| 637 | Ga0466967_0065799 | 3300045976 | Bacteria | 3228 |
| 638 | Ga0466967_0087235 | 3300045976 | Bacteria | 2828 |
| 639 | Ga0466967_0131381 | 3300045976 | Bacteria | 2325 |
| 640 | Ga0466967_0177604 | 3300045976 | Bacteria | 2006 |
| 641 | Ga0466967_0201091 | 3300045976 | Bacteria | 1887 |
| 642 | Ga0466967_0267858 | 3300045976 | Bacteria | 1636 |
| 643 | Ga0466967_0317676 | 3300045976 | Bacteria | 1501 |
| 644 | Ga0466967_1107971 | 3300045976 | Bacteria | 789 |
| 645 | Ga0466967_1140789 | 3300045976 | Bacteria | 777 |
| 646 | Ga0495592_0000002 | 3300046454 | Bacteria | 209491 |
| 647 | Ga0495592_0005811 | 3300046454 | Bacteria | 9145 |
| 648 | Ga0495592_0081388 | 3300046454 | Bacteria | 2341 |
| 649 | Ga0495603_0016498 | 3300046455 | Bacteria | 4469 |
| 650 | Ga0495603_0033526 | 3300046455 | Bacteria | 3090 |
| 651 | Ga0495629_0009112 | 3300046459 | Bacteria | 7269 |
| 652 | Ga0495629_0022210 | 3300046459 | Bacteria | 4525 |
| 653 | Ga0495629_0082051 | 3300046459 | Bacteria | 2250 |
| 654 | Ga0495641_0004743 | 3300046461 | Bacteria | 9472 |
| 655 | Ga0495641_0064410 | 3300046461 | Bacteria | 1651 |
| 656 | Ga0495641_0355341 | 3300046461 | Bacteria | 663 |
| 657 | Ga0495651_0000002 | 3300046462 | Bacteria | 209492 |
| 658 | Ga0495651_0026865 | 3300046462 | Bacteria | 4482 |
| 659 | Ga0495651_0060501 | 3300046462 | Bacteria | 2900 |
| 660 | Ga0495653_0001815 | 3300046463 | Bacteria | 16827 |
| 661 | Ga0495653_0036309 | 3300046463 | Bacteria | 3882 |
| 662 | Ga0495653_0069805 | 3300046463 | Bacteria | 2630 |
| 663 | Ga0495653_0089779 | 3300046463 | Bacteria | 2250 |
| 664 | Ga0495580_0105024 | 3300046472 | Bacteria | 1963 |
| 665 | Ga0495582_0007863 | 3300046473 | Bacteria | 5891 |
| 666 | Ga0495639_0263348 | 3300046475 | Bacteria | 854 |
| 667 | Ga0495662_0006974 | 3300046476 | Bacteria | 5614 |
| 668 | Ga0495662_0159438 | 3300046476 | Bacteria | 1111 |
| 669 | Ga0495664_0034672 | 3300046477 | Bacteria | 2969 |
| 670 | Ga0495594_0029589 | 3300046499 | Bacteria | 2961 |
| 671 | Ga0495607_0029787 | 3300046501 | Bacteria | 3358 |
| 672 | Ga0495608_0000118 | 3300046511 | Bacteria | 56564 |
| 673 | Ga0495608_0059867 | 3300046511 | Bacteria | 2507 |
| 674 | Ga0495618_0070337 | 3300046514 | Bacteria | 2225 |
| 675 | Ga0495618_0180519 | 3300046514 | Bacteria | 1341 |
| 676 | Ga0495628_0000103 | 3300046516 | Bacteria | 68469 |
| 677 | Ga0495628_0178997 | 3300046516 | Bacteria | 1604 |
| 678 | Ga0495630_0032799 | 3300046517 | Bacteria | 3871 |
| 679 | Ga0495630_0244650 | 3300046517 | Bacteria | 1370 |
| 680 | Ga0495630_0474682 | 3300046517 | Bacteria | 959 |
| 681 | Ga0495630_0561814 | 3300046517 | Bacteria | 875 |
| 682 | Ga0495666_0011982 | 3300046526 | Bacteria | 4328 |
| 683 | Ga0495652_0000091 | 3300046529 | Bacteria | 96848 |
| 684 | Ga0495665_0058695 | 3300046531 | Bacteria | 2031 |
| 685 | Ga0495640_0024191 | 3300046533 | Bacteria | 4419 |
| 686 | Ga0495587_0000013 | 3300046536 | Bacteria | 195619 |
| 687 | Ga0495645_0026680 | 3300046543 | Bacteria | 4193 |
| 688 | Ga0495645_0216039 | 3300046543 | Bacteria | 1292 |
| 689 | Ga0495667_0000016 | 3300046559 | Bacteria | 195635 |
| 690 | Ga0495667_0003863 | 3300046559 | Bacteria | 10052 |
| 691 | Ga0495667_0033817 | 3300046559 | Bacteria | 3420 |
| 692 | Ga0495634_0012517 | 3300046642 | Bacteria | 6138 |
| 693 | Ga0495634_0701142 | 3300046642 | Bacteria | 582 |
| 694 | Ga0495635_0018288 | 3300046663 | Bacteria | 4891 |
| 695 | Ga0495635_0022276 | 3300046663 | Bacteria | 4411 |
| 696 | Ga0495635_0067167 | 3300046663 | Bacteria | 2459 |
| 697 | Ga0495635_0490978 | 3300046663 | Bacteria | 809 |
| 698 | Ga0495657_0000014 | 3300046675 | Bacteria | 195574 |
| 699 | Ga0495657_0027640 | 3300046675 | Bacteria | 4000 |
| 700 | Ga0495599_0000006 | 3300046678 | Bacteria | 283487 |
| 701 | Ga0495599_0003147 | 3300046678 | Bacteria | 9615 |
| 702 | Ga0495599_0185988 | 3300046678 | Bacteria | 1279 |
| 703 | Ga0495623_0000537 | 3300046679 | Bacteria | 25204 |
| 704 | Ga0495623_0014183 | 3300046679 | Bacteria | 5161 |
| 705 | Ga0495623_0027659 | 3300046679 | Bacteria | 3651 |
| 706 | Ga0495623_0060312 | 3300046679 | Bacteria | 2380 |
| 707 | Ga0495646_0004781 | 3300046680 | Bacteria | 8551 |
| 708 | Ga0495646_0005699 | 3300046680 | Bacteria | 7890 |
| 709 | Ga0495647_0004220 | 3300046681 | Bacteria | 4653 |
| 710 | Ga0495647_0341257 | 3300046681 | Bacteria | 681 |
| 711 | Ga0495658_0186447 | 3300046683 | Bacteria | 1288 |
| 712 | Ga0495669_0005292 | 3300046684 | Bacteria | 5376 |
| 713 | Ga0495613_0013377 | 3300046689 | Bacteria | 6095 |
| 714 | Ga0495624_0259066 | 3300046690 | Bacteria | 1051 |
| 715 | Ga0495624_0323613 | 3300046690 | Bacteria | 928 |
| 716 | Ga0495649_0444596 | 3300046694 | Bacteria | 648 |
| 717 | Ga0495600_0003129 | 3300046809 | Bacteria | 9692 |
| 718 | Ga0495600_0025754 | 3300046809 | Bacteria | 3791 |
| 719 | Ga0495600_0104960 | 3300046809 | Bacteria | 1841 |
| 720 | Ga0495581_0016627 | 3300047315 | Bacteria | 4276 |
| 721 | Ga0495581_0020125 | 3300047315 | Bacteria | 3874 |
| 722 | Ga0495581_0073409 | 3300047315 | Bacteria | 1979 |
| 723 | Ga0495604_0000015 | 3300047317 | Bacteria | 195635 |
| 724 | Ga0495604_0003750 | 3300047317 | Bacteria | 12100 |
| 725 | Ga0495604_0004336 | 3300047317 | Bacteria | 11232 |
| 726 | Ga0495604_0006697 | 3300047317 | Bacteria | 9134 |
| 727 | Ga0495674_0062948 | 3300047319 | Bacteria | 3228 |
| 728 | Ga0495674_0088995 | 3300047319 | Bacteria | 2639 |
| 729 | Ga0495674_0244692 | 3300047319 | Bacteria | 1477 |
| 730 | Ga0495676_0100184 | 3300047321 | Bacteria | 2145 |
| 731 | Ga0495676_0243739 | 3300047321 | Bacteria | 1229 |
| 732 | Ga0495680_0000380 | 3300047322 | Bacteria | 49632 |
| 733 | Ga0495683_0000189 | 3300047323 | Bacteria | 59252 |
| 734 | Ga0495675_0000648 | 3300047444 | Bacteria | 22080 |
| 735 | Ga0495675_0037089 | 3300047444 | Bacteria | 3106 |
| 736 | Ga0495675_0052697 | 3300047444 | Bacteria | 2583 |
| 737 | Ga0495675_0078551 | 3300047444 | Bacteria | 2078 |
| 738 | Ga0495684_0008195 | 3300047471 | Bacteria | 8088 |
| 739 | Ga0495684_0020878 | 3300047471 | Bacteria | 5046 |
| 740 | Ga0495684_0340939 | 3300047471 | Bacteria | 1066 |
| 741 | Ga0495593_0004255 | 3300047673 | Bacteria | 8518 |
| 742 | Ga0495593_0031232 | 3300047673 | Bacteria | 2911 |
| 743 | Ga0495602_0000013 | 3300048088 | Bacteria | 195591 |
| 744 | Ga0495602_0148521 | 3300048088 | Bacteria | 1845 |
| 745 | Ga0495614_0163091 | 3300048089 | Bacteria | 998 |
| 746 | Ga0496100_0000011 | 3300048903 | Bacteria | 190969 |
| 747 | Ga0496100_0040429 | 3300048903 | Bacteria | 2967 |
| 748 | Ga0496101_0000279 | 3300048904 | Bacteria | 36022 |
| 749 | Ga0496101_0098276 | 3300048904 | Bacteria | 2187 |
| 750 | Ga0496102_0010258 | 3300048905 | Bacteria | 8055 |
| 751 | Ga0496102_0028415 | 3300048905 | Bacteria | 4995 |
| 752 | Ga0496102_0125213 | 3300048905 | Bacteria | 2402 |
| 753 | Ga0496102_0791367 | 3300048905 | Bacteria | 871 |
| 754 | Ga0496103_0101727 | 3300048906 | Bacteria | 1819 |
| 755 | Ga0496104_0016929 | 3300048907 | Bacteria | 6631 |
| 756 | Ga0496104_0223850 | 3300048907 | Bacteria | 1794 |
| 757 | Ga0496104_0860193 | 3300048907 | Bacteria | 812 |
| 758 | Ga0496104_1010177 | 3300048907 | Bacteria | 736 |
| 759 | Ga0496105_0016569 | 3300048908 | Bacteria | 5885 |
| 760 | Ga0496105_0018189 | 3300048908 | Bacteria | 5642 |
| 761 | Ga0496105_0235412 | 3300048908 | Bacteria | 1487 |
| 762 | Ga0496106_0013771 | 3300048909 | Bacteria | 5975 |
| 763 | Ga0496106_0145691 | 3300048909 | Bacteria | 1865 |
| 764 | Ga0496107_0001343 | 3300048910 | Bacteria | 15104 |
| 765 | Ga0496107_0021477 | 3300048910 | Bacteria | 4562 |
| 766 | Ga0496107_0279325 | 3300048910 | Bacteria | 1243 |
| 767 | Ga0496108_0012162 | 3300048911 | Bacteria | 6998 |
| 768 | Ga0496108_0029511 | 3300048911 | Bacteria | 4542 |
| 769 | Ga0496109_0000179 | 3300048912 | Bacteria | 62857 |
| 770 | Ga0496109_0358060 | 3300048912 | Bacteria | 1379 |
| 771 | Ga0496109_0414059 | 3300048912 | Bacteria | 1273 |
| 772 | Ga0496109_1285082 | 3300048912 | Bacteria | 668 |
| 773 | Ga0496109_1449996 | 3300048912 | Bacteria | 622 |
| 774 | Ga0496110_0021491 | 3300048913 | Bacteria | 5465 |
| 775 | Ga0496110_0027924 | 3300048913 | Bacteria | 4841 |
| 776 | Ga0496110_0085957 | 3300048913 | Bacteria | 2807 |
| 777 | Ga0496110_0237645 | 3300048913 | Bacteria | 1658 |
| 778 | Ga0496110_0806870 | 3300048913 | Bacteria | 843 |
| 779 | Ga0496111_0003662 | 3300048914 | Bacteria | 9540 |
| 780 | Ga0496111_0023696 | 3300048914 | Bacteria | 4311 |
| 781 | Ga0496112_0209971 | 3300048915 | Bacteria | 1904 |
| 782 | Ga0496112_0707271 | 3300048915 | Bacteria | 935 |
| 783 | Ga0496113_0208740 | 3300048916 | Bacteria | 1554 |
| 784 | Ga0496113_0389447 | 3300048916 | Bacteria | 1119 |
| 785 | Ga0496114_0003812 | 3300048917 | Bacteria | 11626 |
| 786 | Ga0496114_0053410 | 3300048917 | Bacteria | 3368 |
| 787 | Ga0496114_0057190 | 3300048917 | Bacteria | 3256 |
| 788 | Ga0496114_0294101 | 3300048917 | Bacteria | 1433 |
| 789 | Ga0496114_0324560 | 3300048917 | Bacteria | 1360 |
| 790 | Ga0496114_0630216 | 3300048917 | Bacteria | 944 |
| 791 | Ga0496115_0064507 | 3300048918 | Bacteria | 2957 |
| 792 | Ga0496115_0345152 | 3300048918 | Bacteria | 1215 |
| 793 | Ga0496115_0484963 | 3300048918 | Bacteria | 995 |
| 794 | Ga0496116_0148454 | 3300048919 | Bacteria | 1306 |
| 795 | Ga0496117_0038461 | 3300048920 | Bacteria | 3546 |
| 796 | Ga0496118_0092036 | 3300048921 | Bacteria | 2083 |
| 797 | Ga0496119_0028285 | 3300048922 | Bacteria | 3829 |
| 798 | Ga0496120_0005714 | 3300048923 | Bacteria | 9810 |
| 799 | Ga0496121_0000014 | 3300048924 | Bacteria | 609379 |
| 800 | Ga0496122_0000084 | 3300048925 | Bacteria | 208740 |
| 801 | Ga0496123_0008199 | 3300048926 | Bacteria | 9634 |
| 802 | Ga0496124_0000019 | 3300048927 | Bacteria | 436995 |
| 803 | Ga0496125_0000014 | 3300048928 | Bacteria | 610124 |
| 804 | Ga0496126_0000017 | 3300048929 | Bacteria | 610676 |
| 805 | Ga0501306_015256 | 3300049127 | Bacteria | 1021 |
| 806 | Ga0501308_006849 | 3300049128 | Bacteria | 1180 |
| 807 | Ga0501309_013640 | 3300049129 | Bacteria | 1083 |
| 808 | Ga0501310_020126 | 3300049130 | Bacteria | 826 |
| 809 | Ga0501307_006654 | 3300049162 | Bacteria | 1255 |
| 810 | Ga0501311_004955 | 3300049527 | Bacteria | 1439 |
| 811 | Ga0501317_008593 | 3300049533 | Bacteria | 1180 |
| 812 | Ga0501317_026512 | 3300049533 | Bacteria | 818 |
| 813 | Ga0501318_001413 | 3300049534 | Bacteria | 1881 |
| 814 | Ga0501319_001136 | 3300049535 | Bacteria | 1477 |
| 815 | Ga0501321_000627 | 3300049537 | Bacteria | 2386 |
| 816 | Ga0501322_006931 | 3300049538 | Bacteria | 816 |
| 817 | Ga0501323_001085 | 3300049539 | Bacteria | 2295 |
| 818 | Ga0501324_002030 | 3300049540 | Bacteria | 1427 |
| 819 | Ga0501325_000688 | 3300049541 | Bacteria | 1758 |
| 820 | Ga0501031_0003650 | 3300049568 | Bacteria | 9906 |
| 821 | Ga0501031_0304136 | 3300049568 | Bacteria | 1033 |
| 822 | Ga0501032_0074653 | 3300049569 | Bacteria | 2259 |
| 823 | Ga0501032_0099477 | 3300049569 | Bacteria | 1927 |
| 824 | Ga0501032_0134306 | 3300049569 | Bacteria | 1631 |
| 825 | Ga0501032_0233761 | 3300049569 | Bacteria | 1195 |
| 826 | Ga0501032_0328178 | 3300049569 | Bacteria | 987 |
| 827 | Ga0501033_0002669 | 3300049570 | Bacteria | 14983 |
| 828 | Ga0501033_0048077 | 3300049570 | Bacteria | 3170 |
| 829 | Ga0501033_0167383 | 3300049570 | Bacteria | 1580 |
| 830 | Ga0501034_0002988 | 3300049571 | Bacteria | 19576 |
| 831 | Ga0501034_0035968 | 3300049571 | Bacteria | 5021 |
| 832 | Ga0501034_0228795 | 3300049571 | Bacteria | 1809 |
| 833 | Ga0501034_0873124 | 3300049571 | Bacteria | 789 |
| 834 | Ga0501036_0000969 | 3300049572 | Bacteria | 21651 |
| 835 | Ga0501036_0015857 | 3300049572 | Bacteria | 6292 |
| 836 | Ga0501036_0055657 | 3300049572 | Bacteria | 3351 |
| 837 | Ga0501036_0208687 | 3300049572 | Bacteria | 1642 |
| 838 | Ga0501036_0324593 | 3300049572 | Bacteria | 1286 |
| 839 | Ga0501036_0493729 | 3300049572 | Bacteria | 1019 |
| 840 | Ga0501036_0864117 | 3300049572 | Bacteria | 743 |
| 841 | Ga0501037_0001113 | 3300049573 | Bacteria | 19944 |
| 842 | Ga0501037_0031006 | 3300049573 | Bacteria | 3948 |
| 843 | Ga0501037_0054327 | 3300049573 | Bacteria | 2929 |
| 844 | Ga0501037_0063516 | 3300049573 | Bacteria | 2691 |
| 845 | Ga0501037_0255794 | 3300049573 | Bacteria | 1225 |
| 846 | Ga0501038_0013668 | 3300049574 | Bacteria | 7399 |
| 847 | Ga0501038_0035313 | 3300049574 | Bacteria | 4389 |
| 848 | Ga0501038_0109372 | 3300049574 | Bacteria | 2290 |
| 849 | Ga0501038_0122067 | 3300049574 | Bacteria | 2147 |
| 850 | Ga0501038_0137388 | 3300049574 | Bacteria | 2002 |
| 851 | Ga0501038_0830146 | 3300049574 | Bacteria | 685 |
| 852 | Ga0501039_0002962 | 3300049575 | Bacteria | 12708 |
| 853 | Ga0501039_0066265 | 3300049575 | Bacteria | 2803 |
| 854 | Ga0501039_0093748 | 3300049575 | Bacteria | 2340 |
| 855 | Ga0501039_0397219 | 3300049575 | Bacteria | 1083 |
| 856 | Ga0501039_0737570 | 3300049575 | Bacteria | 769 |
| 857 | Ga0501039_0855910 | 3300049575 | Bacteria | 708 |
| 858 | Ga0501039_1184792 | 3300049575 | Bacteria | 591 |
| 859 | Ga0501041_0028069 | 3300049577 | Bacteria | 3394 |
| 860 | Ga0501041_0154286 | 3300049577 | Bacteria | 1435 |
| 861 | Ga0501042_0022647 | 3300049578 | Bacteria | 4389 |
| 862 | Ga0501042_0027714 | 3300049578 | Bacteria | 3985 |
| 863 | Ga0501042_0037806 | 3300049578 | Bacteria | 3426 |
| 864 | Ga0501042_0087874 | 3300049578 | Bacteria | 2230 |
| 865 | Ga0501042_0117964 | 3300049578 | Bacteria | 1910 |
| 866 | Ga0501042_0189207 | 3300049578 | Bacteria | 1485 |
| 867 | Ga0501042_0603936 | 3300049578 | Bacteria | 798 |
| 868 | Ga0501043_0005373 | 3300049579 | Bacteria | 10344 |
| 869 | Ga0501043_0040876 | 3300049579 | Bacteria | 3644 |
| 870 | Ga0501043_0296988 | 3300049579 | Bacteria | 1235 |
| 871 | Ga0501043_0469952 | 3300049579 | Bacteria | 943 |
| 872 | Ga0501043_1215758 | 3300049579 | Bacteria | 529 |
| 873 | Ga0501046_0012603 | 3300049580 | Bacteria | 7189 |
| 874 | Ga0501046_0059062 | 3300049580 | Bacteria | 3005 |
| 875 | Ga0501046_0415216 | 3300049580 | Bacteria | 971 |
| 876 | Ga0501047_0000015 | 3300049581 | Bacteria | 307932 |
| 877 | Ga0501047_0073384 | 3300049581 | Bacteria | 3294 |
| 878 | Ga0501047_0214989 | 3300049581 | Bacteria | 1779 |
| 879 | Ga0501047_0232510 | 3300049581 | Bacteria | 1696 |
| 880 | Ga0501047_0321687 | 3300049581 | Bacteria | 1386 |
| 881 | Ga0501047_0670292 | 3300049581 | Bacteria | 856 |
| 882 | Ga0501048_0003907 | 3300049582 | Bacteria | 11320 |
| 883 | Ga0501048_0028534 | 3300049582 | Bacteria | 4051 |
| 884 | Ga0501048_0034976 | 3300049582 | Bacteria | 3620 |
| 885 | Ga0501048_0055269 | 3300049582 | Bacteria | 2818 |
| 886 | Ga0501048_0290415 | 3300049582 | Bacteria | 1163 |
| 887 | Ga0501067_0797933 | 3300049583 | Bacteria | 532 |
| 888 | Ga0501068_0081150 | 3300049584 | Bacteria | 1991 |
| 889 | Ga0501068_0288397 | 3300049584 | Bacteria | 1050 |
| 890 | Ga0501068_0523673 | 3300049584 | Bacteria | 770 |
| 891 | Ga0501069_0070056 | 3300049585 | Bacteria | 1964 |
| 892 | Ga0501069_0103529 | 3300049585 | Bacteria | 1617 |
| 893 | Ga0501069_0447619 | 3300049585 | Bacteria | 767 |
| 894 | Ga0501069_0800164 | 3300049585 | Bacteria | 571 |
| 895 | Ga0501070_0018361 | 3300049586 | Bacteria | 5868 |
| 896 | Ga0501070_0049598 | 3300049586 | Bacteria | 3486 |
| 897 | Ga0501070_0425441 | 3300049586 | Bacteria | 1072 |
| 898 | Ga0501070_1205284 | 3300049586 | Bacteria | 581 |
| 899 | Ga0501071_0225399 | 3300049587 | Bacteria | 1411 |
| 900 | Ga0501071_0433146 | 3300049587 | Bacteria | 1006 |
| 901 | Ga0501071_1003811 | 3300049587 | Bacteria | 645 |
| 902 | Ga0501072_0044766 | 3300049588 | Bacteria | 3480 |
| 903 | Ga0501072_0072403 | 3300049588 | Bacteria | 2724 |
| 904 | Ga0501072_0120059 | 3300049588 | Bacteria | 2094 |
| 905 | Ga0501072_1197328 | 3300049588 | Bacteria | 590 |
| 906 | Ga0501073_0010455 | 3300049589 | Bacteria | 6805 |
| 907 | Ga0501073_0075878 | 3300049589 | Bacteria | 2340 |
| 908 | Ga0501073_0255259 | 3300049589 | Bacteria | 1210 |
| 909 | Ga0501073_1240604 | 3300049589 | Bacteria | 511 |
| 910 | Ga0501074_0005245 | 3300049590 | Bacteria | 9323 |
| 911 | Ga0501074_0328171 | 3300049590 | Bacteria | 1086 |
| 912 | Ga0501074_0388248 | 3300049590 | Bacteria | 990 |
| 913 | Ga0501074_0586729 | 3300049590 | Bacteria | 788 |
| 914 | Ga0501074_0743271 | 3300049590 | Bacteria | 692 |
| 915 | Ga0501075_0083788 | 3300049591 | Bacteria | 2415 |
| 916 | Ga0501076_0289695 | 3300049592 | Bacteria | 1341 |
| 917 | Ga0501079_0044004 | 3300049741 | Bacteria | 3446 |
| 918 | Ga0501079_0355034 | 3300049741 | Bacteria | 1149 |
| 919 | Ga0501079_0360662 | 3300049741 | Bacteria | 1139 |
| 920 | Ga0501080_0028663 | 3300049742 | Bacteria | 5183 |
| 921 | Ga0501080_0070715 | 3300049742 | Bacteria | 3246 |
| 922 | Ga0501081_0063064 | 3300049743 | Bacteria | 2572 |
| 923 | Ga0501081_0365825 | 3300049743 | Bacteria | 1064 |
| 924 | Ga0501035_0002047 | 3300049822 | Bacteria | 20101 |
| 925 | Ga0501035_0075383 | 3300049822 | Bacteria | 2983 |
| 926 | Ga0501035_0867527 | 3300049822 | Bacteria | 717 |
| 927 | Ga0501044_0006225 | 3300049823 | Bacteria | 13190 |
| 928 | Ga0501044_0017172 | 3300049823 | Bacteria | 7765 |
| 929 | Ga0501044_0090982 | 3300049823 | Bacteria | 3077 |
| 930 | Ga0501044_0197724 | 3300049823 | Bacteria | 1970 |
| 931 | Ga0501044_0615234 | 3300049823 | Bacteria | 978 |
| 932 | Ga0501045_0123449 | 3300049824 | Bacteria | 1923 |
| 933 | Ga0501045_0148940 | 3300049824 | Bacteria | 1741 |
| 934 | Ga0501045_0186017 | 3300049824 | Bacteria | 1548 |
| 935 | Ga0501045_0201090 | 3300049824 | Bacteria | 1484 |
| 936 | nmdc:mga03683_185670_c1 | 3300050489 | Bacteria | 950 |
| 937 | nmdc:mga03683_208411_c1 | 3300050489 | Bacteria | 899 |
| 938 | nmdc:mga03683_37713_c1 | 3300050489 | Bacteria | 1971 |
| 939 | nmdc:mga03n38_15185_c1 | 3300050490 | Bacteria | 2969 |
| 940 | nmdc:mga03n38_342779_c1 | 3300050490 | Bacteria | 811 |
| 941 | nmdc:mga03n38_348272_c1 | 3300050490 | Bacteria | 806 |
| 942 | nmdc:mga03n38_351088_c1 | 3300050490 | Bacteria | 803 |
| 943 | nmdc:mga03n38_395767_c1 | 3300050490 | Bacteria | 760 |
| 944 | nmdc:mga03n38_488798_c1 | 3300050490 | Bacteria | 689 |
| 945 | nmdc:mga03n38_51524_c1 | 3300050490 | Bacteria | 1839 |
| 946 | nmdc:mga00v17_147997_c1 | 3300050491 | Bacteria | 1508 |
| 947 | nmdc:mga00v17_186502_c1 | 3300050491 | Bacteria | 1339 |
| 948 | nmdc:mga00v17_21827_c1 | 3300050491 | Bacteria | 3686 |
| 949 | nmdc:mga00v17_278073_c1 | 3300050491 | Bacteria | 1087 |
| 950 | nmdc:mga00v17_301922_c1 | 3300050491 | Bacteria | 1040 |
| 951 | nmdc:mga00v17_31654_c1 | 3300050491 | Bacteria | 3121 |
| 952 | nmdc:mga00v17_401253_c1 | 3300050491 | Bacteria | 891 |
| 953 | nmdc:mga00v17_403240_c1 | 3300050491 | Bacteria | 889 |
| 954 | nmdc:mga00v17_72542_c1 | 3300050491 | Bacteria | 2136 |
| 955 | nmdc:mga0yw44_108427_c1 | 3300050492 | Bacteria | 1777 |
| 956 | nmdc:mga0yw44_14822_c1 | 3300050492 | Bacteria | 4153 |
| 957 | nmdc:mga0yw44_160589_c1 | 3300050492 | Bacteria | 1471 |
| 958 | nmdc:mga0yw44_161341_c1 | 3300050492 | Bacteria | 1468 |
| 959 | nmdc:mga0yw44_182003_c2 | 3300050492 | Bacteria | 963 |
| 960 | nmdc:mga0yw44_18790_c1 | 3300050492 | Bacteria | 3795 |
| 961 | nmdc:mga0yw44_3102_c1 | 3300050492 | Bacteria | 7286 |
| 962 | nmdc:mga0yw44_320526_c1 | 3300050492 | Bacteria | 1041 |
| 963 | nmdc:mga0yw44_45853_c1 | 3300050492 | Bacteria | 2623 |
| 964 | nmdc:mga0yw44_68740_c1 | 3300050492 | Bacteria | 2192 |
| 965 | nmdc:mga0yw44_9272_c1 | 3300050492 | Bacteria | 4961 |
| 966 | nmdc:mga06z11_233607_c1 | 3300050494 | Bacteria | 1078 |
| 967 | nmdc:mga06z11_503929_c1 | 3300050494 | Bacteria | 734 |
| 968 | nmdc:mga06z11_88401_c1 | 3300050494 | Bacteria | 1678 |
| 969 | nmdc:mga04h51_16342_c1 | 3300050495 | Bacteria | 2154 |
| 970 | nmdc:mga07m45_195199_c1 | 3300050496 | Bacteria | 1177 |
| 971 | nmdc:mga07m45_285954_c1 | 3300050496 | Bacteria | 959 |
| 972 | nmdc:mga07m45_35624_c1 | 3300050496 | Bacteria | 2769 |
| 973 | nmdc:mga07m45_46119_c1 | 3300050496 | Bacteria | 2448 |
| 974 | nmdc:mga07m45_504539_c1 | 3300050496 | Bacteria | 700 |
| 975 | nmdc:mga07m45_575485_c1 | 3300050496 | Bacteria | 651 |
| 976 | nmdc:mga07m45_66009_c1 | 3300050496 | Bacteria | 2055 |
| 977 | nmdc:mga07m45_76768_c1 | 3300050496 | Bacteria | 1905 |
| 978 | nmdc:mga05p37_18110_c1 | 3300050507 | Bacteria | 8509 |
| 979 | nmdc:mga05p37_80286_c1 | 3300050507 | Bacteria | 4018 |
| 980 | nmdc:mga09592_109785_c1 | 3300050508 | Bacteria | 2366 |
| 981 | nmdc:mga09592_1569591_c1 | 3300050508 | Bacteria | 534 |
| 982 | nmdc:mga0qj67_301391_c1 | 3300050509 | Bacteria | 1298 |
| 983 | nmdc:mga06r32_407330_c1 | 3300050510 | Bacteria | 1342 |
| 984 | nmdc:mga06r32_5495_c1 | 3300050510 | Bacteria | 11415 |
| 985 | nmdc:mga08y16_64549_c1 | 3300050511 | Bacteria | 3823 |
| 986 | nmdc:mga0n895_16639_c1 | 3300050512 | Bacteria | 6754 |
| 987 | nmdc:mga0rr50_479314_c1 | 3300050513 | Bacteria | 1056 |
| 988 | nmdc:mga0rr50_57179_c1 | 3300050513 | Bacteria | 2917 |
| 989 | nmdc:mga08x19_41574_c1 | 3300050514 | Bacteria | 2928 |
| 990 | nmdc:mga08x19_61574_c1 | 3300050514 | Bacteria | 2433 |
| 991 | nmdc:mga0a205_10407_c1 | 3300050515 | Bacteria | 8548 |
| 992 | nmdc:mga0a205_37369_c1 | 3300050515 | Bacteria | 4670 |
| 993 | nmdc:mga0sz30_34731_c1 | 3300050516 | Bacteria | 2101 |
| 994 | Ga0495601_0056077 | 3300053077 | Bacteria | 2495 |
| 995 | Ga0495601_0061101 | 3300053077 | Bacteria | 2392 |
| 996 | Ga0495601_0586989 | 3300053077 | Bacteria | 715 |
| 997 | Ga0495612_0096725 | 3300053078 | Bacteria | 1254 |
| 998 | Ga0495595_0002322 | 3300053084 | Bacteria | 7419 |
| 999 | Ga0495595_0016048 | 3300053084 | Bacteria | 3199 |
| 1000 | Ga0495619_0008690 | 3300053085 | Bacteria | 6424 |
| 1001 | Ga0495619_0050165 | 3300053085 | Bacteria | 2754 |
| 1002 | Ga0495619_0158163 | 3300053085 | Bacteria | 1564 |
| 1003 | Ga0500643_000213 | 3300053087 | Bacteria | 54707 |
| 1004 | Ga0500644_0000047 | 3300053088 | Bacteria | 73844 |
| 1005 | Ga0500564_189310 | 3300053138 | Bacteria | 853 |
| 1006 | Ga0500568_0227762 | 3300053139 | Bacteria | 680 |
| 1007 | Ga0500573_0008093 | 3300053140 | Bacteria | 5780 |
| 1008 | Ga0501084_0032537 | 3300054114 | Bacteria | 4362 |
| 1009 | Ga0587073_0042208 | 3300059492 | Bacteria | 999 |
| 1010 | Ga0587085_055491 | 3300059506 | Bacteria | 734 |
| 1011 | Ga0587106_077786 | 3300059605 | Bacteria | 641 |
| 1012 | Ga0587122_047678 | 3300059628 | Bacteria | 549 |
| 1013 | Ga0587128_081436 | 3300059630 | Bacteria | 649 |
| 1014 | Ga0587068_097649 | 3300059641 | Bacteria | 613 |
| 1015 | Ga0587072_041075 | 3300059643 | Bacteria | 899 |
| 1016 | Ga0587072_100754 | 3300059643 | Bacteria | 648 |
| 1017 | Ga0587079_040168 | 3300059647 | Bacteria | 941 |
| 1018 | Ga0587079_118660 | 3300059647 | Bacteria | 652 |
| 1019 | Ga0587107_093191 | 3300059652 | Bacteria | 585 |
| 1020 | Ga0501082_0099545 | 3300060353 | Bacteria | 2514 |
| 1021 | Ga0501082_0216096 | 3300060353 | Bacteria | 1668 |
| 1022 | Ga0466962_0010540 | 3300061719 | Bacteria | 4447 |
| 1023 | Ga0466962_0028704 | 3300061719 | Bacteria | 2664 |
| 1024 | Ga0466962_0139648 | 3300061719 | Bacteria | 1173 |
| 1025 | Ga0530510_0114639 | 3300061734 | Bacteria | 1975 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0131381 | Ga0466967_0131381_790_1302 | 136 |
| 2 | 3300013296 | Ga0157374_10206169 | Ga0157374_102061692 | 139 |
| 3 | 3300031251 | Ga0265327_10000081 | Ga0265327_10000081149 | 139 |
| 4 | iso_pu_bacteria | 2731639228 | 2731905508 | 139 |
| 5 | iso_pu_bacteria | 2751185725 | 2753034953 | 139 |
| 6 | iso_pu_bacteria | 2887478801 | 2887481316 | 139 |
| 7 | iso_pu_bacteria | 8001781756 | 8001789778 | 139 |
| 8 | 3300005337 | Ga0070682_100452214 | Ga0070682_1004522142 | 140 |
| 9 | 3300005341 | Ga0070691_10584877 | Ga0070691_105848771 | 140 |
| 10 | 3300005535 | Ga0070684_100723193 | Ga0070684_1007231932 | 140 |
| 11 | 3300005616 | Ga0068852_100988807 | Ga0068852_1009888072 | 140 |
| 12 | 3300005840 | Ga0068870_10403656 | Ga0068870_104036562 | 140 |
| 13 | 3300005937 | Ga0081455_10008050 | Ga0081455_100080509 | 140 |
| 14 | 3300006038 | Ga0075365_10814805 | Ga0075365_108148052 | 140 |
| 15 | 3300013104 | Ga0157370_10429914 | Ga0157370_104299142 | 140 |
| 16 | 3300013105 | Ga0157369_10295849 | Ga0157369_102958492 | 140 |
| 17 | 3300013308 | Ga0157375_10034623 | Ga0157375_100346236 | 140 |
| 18 | 3300014325 | Ga0163163_11032346 | Ga0163163_110323462 | 140 |
| 19 | 3300014326 | Ga0157380_10165169 | Ga0157380_101651694 | 140 |
| 20 | 3300017792 | Ga0163161_10142069 | Ga0163161_101420692 | 140 |
| 21 | 3300025901 | Ga0207688_10561084 | Ga0207688_105610842 | 140 |
| 22 | 3300025908 | Ga0207643_10532004 | Ga0207643_105320042 | 140 |
| 23 | 3300025926 | Ga0207659_10145250 | Ga0207659_101452502 | 140 |
| 24 | 3300025944 | Ga0207661_11604636 | Ga0207661_116046362 | 140 |
| 25 | 3300026095 | Ga0207676_11119889 | Ga0207676_111198891 | 140 |
| 26 | 3300026142 | Ga0207698_10990795 | Ga0207698_109907952 | 140 |
| 27 | 3300031251 | Ga0265327_10027896 | Ga0265327_100278963 | 140 |
| 28 | 3300031727 | Ga0316576_10046001 | Ga0316576_100460014 | 140 |
| 29 | 3300031728 | Ga0316578_10017290 | Ga0316578_100172901 | 140 |
| 30 | 3300032137 | Ga0316585_10003099 | Ga0316585_100030992 | 140 |
| 31 | 3300033541 | Ga0316596_1001886 | Ga0316596_10018863 | 140 |
| 32 | 3300035398 | Ga0316574_0006776 | Ga0316574_0006776_4707_5153 | 140 |
| 33 | 3300036647 | Ga0316582_0007605 | Ga0316582_0007605_1057_1503 | 140 |
| 34 | 3300036712 | Ga0316584_0001043 | Ga0316584_0001043_14689_15135 | 140 |
| 35 | 3300041509 | Ga0451843_1590515 | Ga0451843_1590515_149_595 | 140 |
| 36 | 3300041512 | Ga0451853_0584877 | Ga0451853_0584877_389_835 | 140 |
| 37 | 3300042185 | Ga0450909_028179 | Ga0450909_028179_182_628 | 140 |
| 38 | 3300042531 | Ga0450918_044740 | Ga0450918_044740_132_578 | 140 |
| 39 | 3300046517 | Ga0495630_0474682 | Ga0495630_0474682_13_450 | 140 |
| 40 | 3300048907 | Ga0496104_0223850 | Ga0496104_0223850_866_1306 | 140 |
| 41 | 3300048908 | Ga0496105_0016569 | Ga0496105_0016569_4096_4536 | 140 |
| 42 | 3300048912 | Ga0496109_0414059 | Ga0496109_0414059_302_742 | 140 |
| 43 | 3300048913 | Ga0496110_0085957 | Ga0496110_0085957_1657_2097 | 140 |
| 44 | 3300048914 | Ga0496111_0023696 | Ga0496111_0023696_3604_4044 | 140 |
| 45 | 3300048916 | Ga0496113_0389447 | Ga0496113_0389447_297_737 | 140 |
| 46 | 3300048917 | Ga0496114_0057190 | Ga0496114_0057190_616_1056 | 140 |
| 47 | 3300048917 | Ga0496114_0324560 | Ga0496114_0324560_474_914 | 140 |
| 48 | 3300050509 | nmdc:mga0qj67_301391_c1 | nmdc:mga0qj67_301391_c1_93_533 | 140 |
| 49 | 3300050510 | nmdc:mga06r32_5495_c1 | nmdc:mga06r32_5495_c1_958_1398 | 140 |
| 50 | iso_pu_bacteria | 2773857762 | 2774392139 | 140 |
| 51 | iso_pu_bacteria | 2808606439 | 2809195925 | 140 |
| 52 | iso_pu_bacteria | 2891968417 | 2891970428 | 140 |
| 53 | 3300005440 | Ga0070705_100013596 | Ga0070705_1000135964 | 141 |
| 54 | 3300005457 | Ga0070662_100530031 | Ga0070662_1005300312 | 141 |
| 55 | 3300005578 | Ga0068854_100324875 | Ga0068854_1003248752 | 141 |
| 56 | 3300005615 | Ga0070702_100000821 | Ga0070702_1000008215 | 141 |
| 57 | 3300005615 | Ga0070702_100444918 | Ga0070702_1004449182 | 141 |
| 58 | 3300006881 | Ga0068865_100147964 | Ga0068865_1001479642 | 141 |
| 59 | 3300009148 | Ga0105243_10111333 | Ga0105243_101113334 | 141 |
| 60 | 3300009148 | Ga0105243_11886853 | Ga0105243_118868532 | 141 |
| 61 | 3300009176 | Ga0105242_10006011 | Ga0105242_100060112 | 141 |
| 62 | 3300009553 | Ga0105249_10023032 | Ga0105249_100230326 | 141 |
| 63 | 3300013297 | Ga0157378_10227778 | Ga0157378_102277782 | 141 |
| 64 | 3300013306 | Ga0163162_10019250 | Ga0163162_100192505 | 141 |
| 65 | 3300017792 | Ga0163161_10029059 | Ga0163161_100290593 | 141 |
| 66 | 3300025924 | Ga0207694_10438450 | Ga0207694_104384502 | 141 |
| 67 | 3300025931 | Ga0207644_10842072 | Ga0207644_108420722 | 141 |
| 68 | 3300025935 | Ga0207709_10235125 | Ga0207709_102351252 | 141 |
| 69 | 3300025961 | Ga0207712_10130884 | Ga0207712_101308842 | 141 |
| 70 | 3300026121 | Ga0207683_10348221 | Ga0207683_103482213 | 141 |
| 71 | 3300037466 | Ga0395898_0596916 | Ga0395898_0596916_153_614 | 141 |
| 72 | 3300048907 | Ga0496104_1010177 | Ga0496104_1010177_264_710 | 141 |
| 73 | 3300005347 | Ga0070668_100051232 | Ga0070668_1000512323 | 142 |
| 74 | 3300005367 | Ga0070667_100071409 | Ga0070667_1000714095 | 142 |
| 75 | 3300005455 | Ga0070663_100010788 | Ga0070663_1000107884 | 142 |
| 76 | 3300005615 | Ga0070702_100950227 | Ga0070702_1009502272 | 142 |
| 77 | 3300005616 | Ga0068852_101979930 | Ga0068852_1019799301 | 142 |
| 78 | 3300005840 | Ga0068870_10778447 | Ga0068870_107784472 | 142 |
| 79 | 3300005841 | Ga0068863_100838580 | Ga0068863_1008385802 | 142 |
| 80 | 3300005843 | Ga0068860_100000311 | Ga0068860_10000031173 | 142 |
| 81 | 3300006038 | Ga0075365_10009055 | Ga0075365_100090553 | 142 |
| 82 | 3300006038 | Ga0075365_10027959 | Ga0075365_100279595 | 142 |
| 83 | 3300006038 | Ga0075365_10037167 | Ga0075365_100371675 | 142 |
| 84 | 3300006038 | Ga0075365_10043679 | Ga0075365_100436794 | 142 |
| 85 | 3300006038 | Ga0075365_10281346 | Ga0075365_102813462 | 142 |
| 86 | 3300006042 | Ga0075368_10000188 | Ga0075368_1000018812 | 142 |
| 87 | 3300006042 | Ga0075368_10013720 | Ga0075368_100137203 | 142 |
| 88 | 3300006042 | Ga0075368_10119014 | Ga0075368_101190142 | 142 |
| 89 | 3300006048 | Ga0075363_100006379 | Ga0075363_1000063792 | 142 |
| 90 | 3300006048 | Ga0075363_100016364 | Ga0075363_1000163645 | 142 |
| 91 | 3300006048 | Ga0075363_100085108 | Ga0075363_1000851081 | 142 |
| 92 | 3300006048 | Ga0075363_100167151 | Ga0075363_1001671513 | 142 |
| 93 | 3300006051 | Ga0075364_10013400 | Ga0075364_100134002 | 142 |
| 94 | 3300006051 | Ga0075364_10015654 | Ga0075364_100156545 | 142 |
| 95 | 3300006051 | Ga0075364_10123355 | Ga0075364_101233552 | 142 |
| 96 | 3300006051 | Ga0075364_10311184 | Ga0075364_103111842 | 142 |
| 97 | 3300006177 | Ga0075362_10010752 | Ga0075362_100107525 | 142 |
| 98 | 3300006177 | Ga0075362_10183797 | Ga0075362_101837972 | 142 |
| 99 | 3300006178 | Ga0075367_10004589 | Ga0075367_100045894 | 142 |
| 100 | 3300006178 | Ga0075367_10027120 | Ga0075367_100271205 | 142 |
| 101 | 3300006178 | Ga0075367_10358481 | Ga0075367_103584812 | 142 |
| 102 | 3300006353 | Ga0075370_10009317 | Ga0075370_100093176 | 142 |
| 103 | 3300006353 | Ga0075370_10041500 | Ga0075370_100415002 | 142 |
| 104 | 3300006353 | Ga0075370_10065848 | Ga0075370_100658482 | 142 |
| 105 | 3300006353 | Ga0075370_10175446 | Ga0075370_101754463 | 142 |
| 106 | 3300006353 | Ga0075370_10205429 | Ga0075370_102054293 | 142 |
| 107 | 3300006353 | Ga0075370_10388409 | Ga0075370_103884092 | 142 |
| 108 | 3300009094 | Ga0111539_12281488 | Ga0111539_122814882 | 142 |
| 109 | 3300009148 | Ga0105243_10601421 | Ga0105243_106014212 | 142 |
| 110 | 3300009148 | Ga0105243_10851185 | Ga0105243_108511852 | 142 |
| 111 | 3300013308 | Ga0157375_10879156 | Ga0157375_108791562 | 142 |
| 112 | 3300013308 | Ga0157375_11316920 | Ga0157375_113169202 | 142 |
| 113 | 3300014745 | Ga0157377_11026102 | Ga0157377_110261021 | 142 |
| 114 | 3300014968 | Ga0157379_11268113 | Ga0157379_112681132 | 142 |
| 115 | 3300025908 | Ga0207643_10638079 | Ga0207643_106380792 | 142 |
| 116 | 3300025986 | Ga0207658_10013386 | Ga0207658_100133867 | 142 |
| 117 | 3300025986 | Ga0207658_10022887 | Ga0207658_100228874 | 142 |
| 118 | 3300027866 | Ga0209813_10026252 | Ga0209813_100262522 | 142 |
| 119 | 3300027866 | Ga0209813_10054887 | Ga0209813_100548872 | 142 |
| 120 | 3300028381 | Ga0268264_10000717 | Ga0268264_1000071738 | 142 |
| 121 | 3300030733 | Ga0314311_1113072 | Ga0314311_11130722 | 142 |
| 122 | 3300030745 | Ga0316182_1129288 | Ga0316182_11292882 | 142 |
| 123 | 3300031251 | Ga0265327_10002020 | Ga0265327_100020207 | 142 |
| 124 | 3300031730 | Ga0307516_10665113 | Ga0307516_106651131 | 142 |
| 125 | 3300031903 | Ga0307407_10471088 | Ga0307407_104710881 | 142 |
| 126 | 3300031911 | Ga0307412_10243357 | Ga0307412_102433572 | 142 |
| 127 | 3300031995 | Ga0307409_100476434 | Ga0307409_1004764342 | 142 |
| 128 | 3300037418 | Ga0395900_0355808 | Ga0395900_0355808_977_1423 | 142 |
| 129 | 3300037466 | Ga0395898_0669904 | Ga0395898_0669904_415_861 | 142 |
| 130 | 3300039437 | Ga0436365_1397305 | Ga0436365_1397305_44_490 | 142 |
| 131 | 3300041452 | Ga0451793_0052377 | Ga0451793_0052377_92_547 | 142 |
| 132 | 3300041456 | Ga0451795_1629950 | Ga0451795_1629950_161_607 | 142 |
| 133 | 3300048905 | Ga0496102_0791367 | Ga0496102_0791367_376_819 | 142 |
| 134 | 3300048913 | Ga0496110_0237645 | Ga0496110_0237645_991_1437 | 142 |
| 135 | 3300048917 | Ga0496114_0053410 | Ga0496114_0053410_1264_1710 | 142 |
| 136 | 3300049533 | Ga0501317_026512 | Ga0501317_026512_278_724 | 142 |
| 137 | 3300049569 | Ga0501032_0134306 | Ga0501032_0134306_703_1146 | 142 |
| 138 | 3300049572 | Ga0501036_0208687 | Ga0501036_0208687_94_540 | 142 |
| 139 | 3300049573 | Ga0501037_0255794 | Ga0501037_0255794_559_1005 | 142 |
| 140 | 3300049578 | Ga0501042_0603936 | Ga0501042_0603936_87_551 | 142 |
| 141 | 3300049579 | Ga0501043_0469952 | Ga0501043_0469952_28_471 | 142 |
| 142 | 3300049581 | Ga0501047_0000015 | Ga0501047_0000015_245870_246313 | 142 |
| 143 | 3300049586 | Ga0501070_1205284 | Ga0501070_1205284_108_563 | 142 |
| 144 | 3300049588 | Ga0501072_0120059 | Ga0501072_0120059_1545_1991 | 142 |
| 145 | 3300049588 | Ga0501072_1197328 | Ga0501072_1197328_34_480 | 142 |
| 146 | 3300049824 | Ga0501045_0186017 | Ga0501045_0186017_119_565 | 142 |
| 147 | 3300050489 | nmdc:mga03683_185670_c1 | nmdc:mga03683_185670_c1_186_632 | 142 |
| 148 | 3300050489 | nmdc:mga03683_37713_c1 | nmdc:mga03683_37713_c1_1514_1960 | 142 |
| 149 | 3300050490 | nmdc:mga03n38_15185_c1 | nmdc:mga03n38_15185_c1_1629_2075 | 142 |
| 150 | 3300050490 | nmdc:mga03n38_348272_c1 | nmdc:mga03n38_348272_c1_318_764 | 142 |
| 151 | 3300050490 | nmdc:mga03n38_395767_c1 | nmdc:mga03n38_395767_c1_178_624 | 142 |
| 152 | 3300050490 | nmdc:mga03n38_488798_c1 | nmdc:mga03n38_488798_c1_25_468 | 142 |
| 153 | 3300050490 | nmdc:mga03n38_51524_c1 | nmdc:mga03n38_51524_c1_576_1022 | 142 |
| 154 | 3300050491 | nmdc:mga00v17_147997_c1 | nmdc:mga00v17_147997_c1_765_1208 | 142 |
| 155 | 3300050491 | nmdc:mga00v17_21827_c1 | nmdc:mga00v17_21827_c1_2313_2759 | 142 |
| 156 | 3300050491 | nmdc:mga00v17_278073_c1 | nmdc:mga00v17_278073_c1_627_1073 | 142 |
| 157 | 3300050491 | nmdc:mga00v17_31654_c1 | nmdc:mga00v17_31654_c1_292_738 | 142 |
| 158 | 3300050491 | nmdc:mga00v17_401253_c1 | nmdc:mga00v17_401253_c1_94_540 | 142 |
| 159 | 3300050491 | nmdc:mga00v17_403240_c1 | nmdc:mga00v17_403240_c1_264_710 | 142 |
| 160 | 3300050492 | nmdc:mga0yw44_108427_c1 | nmdc:mga0yw44_108427_c1_633_1079 | 142 |
| 161 | 3300050492 | nmdc:mga0yw44_14822_c1 | nmdc:mga0yw44_14822_c1_1106_1549 | 142 |
| 162 | 3300050492 | nmdc:mga0yw44_160589_c1 | nmdc:mga0yw44_160589_c1_241_687 | 142 |
| 163 | 3300050492 | nmdc:mga0yw44_161341_c1 | nmdc:mga0yw44_161341_c1_926_1372 | 142 |
| 164 | 3300050492 | nmdc:mga0yw44_182003_c2 | nmdc:mga0yw44_182003_c2_373_819 | 142 |
| 165 | 3300050492 | nmdc:mga0yw44_18790_c1 | nmdc:mga0yw44_18790_c1_1649_2092 | 142 |
| 166 | 3300050492 | nmdc:mga0yw44_3102_c1 | nmdc:mga0yw44_3102_c1_2516_2962 | 142 |
| 167 | 3300050492 | nmdc:mga0yw44_45853_c1 | nmdc:mga0yw44_45853_c1_375_821 | 142 |
| 168 | 3300050492 | nmdc:mga0yw44_68740_c1 | nmdc:mga0yw44_68740_c1_758_1204 | 142 |
| 169 | 3300050492 | nmdc:mga0yw44_9272_c1 | nmdc:mga0yw44_9272_c1_4139_4585 | 142 |
| 170 | 3300050494 | nmdc:mga06z11_233607_c1 | nmdc:mga06z11_233607_c1_203_646 | 142 |
| 171 | 3300050494 | nmdc:mga06z11_503929_c1 | nmdc:mga06z11_503929_c1_51_497 | 142 |
| 172 | 3300050494 | nmdc:mga06z11_88401_c1 | nmdc:mga06z11_88401_c1_447_893 | 142 |
| 173 | 3300050495 | nmdc:mga04h51_16342_c1 | nmdc:mga04h51_16342_c1_1085_1531 | 142 |
| 174 | 3300050496 | nmdc:mga07m45_195199_c1 | nmdc:mga07m45_195199_c1_396_842 | 142 |
| 175 | 3300050496 | nmdc:mga07m45_285954_c1 | nmdc:mga07m45_285954_c1_73_519 | 142 |
| 176 | 3300050496 | nmdc:mga07m45_35624_c1 | nmdc:mga07m45_35624_c1_1699_2145 | 142 |
| 177 | 3300050496 | nmdc:mga07m45_46119_c1 | nmdc:mga07m45_46119_c1_1547_1993 | 142 |
| 178 | 3300050496 | nmdc:mga07m45_504539_c1 | nmdc:mga07m45_504539_c1_188_634 | 142 |
| 179 | 3300050496 | nmdc:mga07m45_575485_c1 | nmdc:mga07m45_575485_c1_65_508 | 142 |
| 180 | 3300050496 | nmdc:mga07m45_66009_c1 | nmdc:mga07m45_66009_c1_921_1367 | 142 |
| 181 | 3300050496 | nmdc:mga07m45_76768_c1 | nmdc:mga07m45_76768_c1_1169_1612 | 142 |
| 182 | 3300053088 | Ga0500644_0000047 | Ga0500644_0000047_39343_39789 | 142 |
| 183 | 3300053139 | Ga0500568_0227762 | Ga0500568_0227762_69_515 | 142 |
| 184 | iso_pu_bacteria | 2643221576 | 2643891812 | 142 |
| 185 | iso_pu_bacteria | 2643221590 | 2643960861 | 142 |
| 186 | iso_pu_bacteria | 2643221604 | 2644035621 | 142 |
| 187 | iso_pu_bacteria | 2811994878 | 2812351925 | 142 |
| 188 | iso_pu_bacteria | 2995463766 | 2995464902 | 142 |
| 189 | 3300005353 | Ga0070669_100596216 | Ga0070669_1005962162 | 143 |
| 190 | 3300005366 | Ga0070659_100740895 | Ga0070659_1007408952 | 143 |
| 191 | 3300005535 | Ga0070684_100255879 | Ga0070684_1002558792 | 143 |
| 192 | 3300005535 | Ga0070684_101177679 | Ga0070684_1011776792 | 143 |
| 193 | 3300005564 | Ga0070664_100454083 | Ga0070664_1004540832 | 143 |
| 194 | 3300005719 | Ga0068861_100217178 | Ga0068861_1002171782 | 143 |
| 195 | 3300006038 | Ga0075365_10525721 | Ga0075365_105257211 | 143 |
| 196 | 3300006178 | Ga0075367_10429354 | Ga0075367_104293541 | 143 |
| 197 | 3300009093 | Ga0105240_12490951 | Ga0105240_124909511 | 143 |
| 198 | 3300009553 | Ga0105249_11295545 | Ga0105249_112955452 | 143 |
| 199 | 3300009553 | Ga0105249_13501888 | Ga0105249_135018881 | 143 |
| 200 | 3300011119 | Ga0105246_10466911 | Ga0105246_104669112 | 143 |
| 201 | 3300014497 | Ga0182008_10321853 | Ga0182008_103218531 | 143 |
| 202 | 3300014745 | Ga0157377_10206301 | Ga0157377_102063012 | 143 |
| 203 | 3300020069 | Ga0197907_11113641 | Ga0197907_111136413 | 143 |
| 204 | 3300020070 | Ga0206356_10068051 | Ga0206356_100680513 | 143 |
| 205 | 3300020075 | Ga0206349_1536441 | Ga0206349_15364413 | 143 |
| 206 | 3300020076 | Ga0206355_1124023 | Ga0206355_11240231 | 143 |
| 207 | 3300020076 | Ga0206355_1642650 | Ga0206355_16426502 | 143 |
| 208 | 3300020077 | Ga0206351_10432790 | Ga0206351_104327903 | 143 |
| 209 | 3300020077 | Ga0206351_10445423 | Ga0206351_104454232 | 143 |
| 210 | 3300020078 | Ga0206352_10517260 | Ga0206352_105172604 | 143 |
| 211 | 3300020080 | Ga0206350_10713574 | Ga0206350_107135747 | 143 |
| 212 | 3300020081 | Ga0206354_10730064 | Ga0206354_107300642 | 143 |
| 213 | 3300020081 | Ga0206354_10790317 | Ga0206354_107903173 | 143 |
| 214 | 3300020082 | Ga0206353_11125031 | Ga0206353_111250314 | 143 |
| 215 | 3300020610 | Ga0154015_1594405 | Ga0154015_15944052 | 143 |
| 216 | 3300022467 | Ga0224712_10001468 | Ga0224712_100014684 | 143 |
| 217 | 3300025934 | Ga0207686_10497504 | Ga0207686_104975041 | 143 |
| 218 | 3300025935 | Ga0207709_10441053 | Ga0207709_104410532 | 143 |
| 219 | 3300025939 | Ga0207665_10314386 | Ga0207665_103143862 | 143 |
| 220 | 3300025940 | Ga0207691_10166739 | Ga0207691_101667393 | 143 |
| 221 | 3300025944 | Ga0207661_10051520 | Ga0207661_100515202 | 143 |
| 222 | 3300025945 | Ga0207679_10483402 | Ga0207679_104834022 | 143 |
| 223 | 3300025945 | Ga0207679_10495206 | Ga0207679_104952062 | 143 |
| 224 | 3300025972 | Ga0207668_11488911 | Ga0207668_114889112 | 143 |
| 225 | 3300026118 | Ga0207675_101072279 | Ga0207675_1010722792 | 143 |
| 226 | 3300031903 | Ga0307407_10516401 | Ga0307407_105164012 | 143 |
| 227 | 3300031911 | Ga0307412_10665408 | Ga0307412_106654082 | 143 |
| 228 | 3300031995 | Ga0307409_100216210 | Ga0307409_1002162102 | 143 |
| 229 | 3300031995 | Ga0307409_101910262 | Ga0307409_1019102622 | 143 |
| 230 | 3300032002 | Ga0307416_100380666 | Ga0307416_1003806662 | 143 |
| 231 | 3300032005 | Ga0307411_10251063 | Ga0307411_102510632 | 143 |
| 232 | 3300032126 | Ga0307415_100134833 | Ga0307415_1001348333 | 143 |
| 233 | 3300037068 | Ga0373925_0528843 | Ga0373925_0528843_474_944 | 143 |
| 234 | 3300041451 | Ga0451791_1849534 | Ga0451791_1849534_56_511 | 143 |
| 235 | 3300041512 | Ga0451853_1897627 | Ga0451853_1897627_112_567 | 143 |
| 236 | 3300044842 | Ga0466957_0172726 | Ga0466957_0172726_426_872 | 143 |
| 237 | 3300044901 | Ga0466960_0291335 | Ga0466960_0291335_441_887 | 143 |
| 238 | 3300045836 | Ga0466958_0150434 | Ga0466958_0150434_576_1022 | 143 |
| 239 | 3300045976 | Ga0466967_0012785 | Ga0466967_0012785_3466_3945 | 143 |
| 240 | 3300046455 | Ga0495603_0016498 | Ga0495603_0016498_591_1061 | 143 |
| 241 | 3300047319 | Ga0495674_0244692 | Ga0495674_0244692_930_1400 | 143 |
| 242 | 3300048089 | Ga0495614_0163091 | Ga0495614_0163091_149_619 | 143 |
| 243 | 3300048913 | Ga0496110_0806870 | Ga0496110_0806870_362_811 | 143 |
| 244 | 3300049127 | Ga0501306_015256 | Ga0501306_015256_329_775 | 143 |
| 245 | 3300049129 | Ga0501309_013640 | Ga0501309_013640_349_795 | 143 |
| 246 | 3300049535 | Ga0501319_001136 | Ga0501319_001136_384_830 | 143 |
| 247 | 3300049539 | Ga0501323_001085 | Ga0501323_001085_1348_1794 | 143 |
| 248 | 3300049540 | Ga0501324_002030 | Ga0501324_002030_616_1062 | 143 |
| 249 | 3300049541 | Ga0501325_000688 | Ga0501325_000688_632_1078 | 143 |
| 250 | 3300049574 | Ga0501038_0830146 | Ga0501038_0830146_62_514 | 143 |
| 251 | 3300049575 | Ga0501039_0397219 | Ga0501039_0397219_129_581 | 143 |
| 252 | 3300049575 | Ga0501039_1184792 | Ga0501039_1184792_90_545 | 143 |
| 253 | 3300049578 | Ga0501042_0189207 | Ga0501042_0189207_882_1334 | 143 |
| 254 | 3300049581 | Ga0501047_0073384 | Ga0501047_0073384_986_1441 | 143 |
| 255 | 3300049582 | Ga0501048_0290415 | Ga0501048_0290415_439_894 | 143 |
| 256 | 3300049585 | Ga0501069_0800164 | Ga0501069_0800164_17_469 | 143 |
| 257 | 3300049588 | Ga0501072_0044766 | Ga0501072_0044766_1817_2269 | 143 |
| 258 | 3300049589 | Ga0501073_1240604 | Ga0501073_1240604_43_498 | 143 |
| 259 | 3300049590 | Ga0501074_0388248 | Ga0501074_0388248_173_625 | 143 |
| 260 | 3300049590 | Ga0501074_0586729 | Ga0501074_0586729_228_680 | 143 |
| 261 | 3300049592 | Ga0501076_0289695 | Ga0501076_0289695_624_1076 | 143 |
| 262 | 3300049741 | Ga0501079_0360662 | Ga0501079_0360662_609_1061 | 143 |
| 263 | 3300049743 | Ga0501081_0365825 | Ga0501081_0365825_177_629 | 143 |
| 264 | 3300049823 | Ga0501044_0197724 | Ga0501044_0197724_22_477 | 143 |
| 265 | 3300050490 | nmdc:mga03n38_342779_c1 | nmdc:mga03n38_342779_c1_65_514 | 143 |
| 266 | 3300059647 | Ga0587079_040168 | Ga0587079_040168_72_524 | 143 |
| 267 | 3300060353 | Ga0501082_0099545 | Ga0501082_0099545_1654_2106 | 143 |
| 268 | 3300061719 | Ga0466962_0139648 | Ga0466962_0139648_699_1145 | 143 |
| 269 | iso_pu_bacteria | 2547132424 | 2548696690 | 143 |
| 270 | iso_pu_bacteria | 2551306166 | 2552108781 | 143 |
| 271 | iso_pu_bacteria | 2585427649 | 2586062253 | 143 |
| 272 | iso_pu_bacteria | 2643221692 | 2644512394 | 143 |
| 273 | iso_pu_bacteria | 2738541264 | 2738668157 | 143 |
| 274 | iso_pu_bacteria | 2738541305 | 2738868272 | 143 |
| 275 | iso_pu_bacteria | 2738541356 | 2739147227 | 143 |
| 276 | iso_pu_bacteria | 2808606522 | 2809588573 | 143 |
| 277 | iso_pu_bacteria | 2899359706 | 2899365257 | 143 |
| 278 | iso_pu_bacteria | 2915768154 | 2915770285 | 143 |
| 279 | iso_pu_bacteria | 2917736166 | 2917739459 | 143 |
| 280 | iso_pu_bacteria | 2919713450 | 2919717689 | 143 |
| 281 | iso_pu_bacteria | 8003314358 | 8003323847 | 143 |
| 282 | 3300001977 | JGI24746J21847_1041170 | JGI24746J21847_10411701 | 144 |
| 283 | 3300001979 | JGI24740J21852_10017776 | JGI24740J21852_100177764 | 144 |
| 284 | 3300002067 | JGI24735J21928_10016670 | JGI24735J21928_100166704 | 144 |
| 285 | 3300005327 | Ga0070658_10077548 | Ga0070658_100775483 | 144 |
| 286 | 3300005336 | Ga0070680_100533021 | Ga0070680_1005330212 | 144 |
| 287 | 3300005337 | Ga0070682_100477806 | Ga0070682_1004778062 | 144 |
| 288 | 3300005340 | Ga0070689_101107990 | Ga0070689_1011079902 | 144 |
| 289 | 3300005437 | Ga0070710_10000801 | Ga0070710_100008016 | 144 |
| 290 | 3300005438 | Ga0070701_10456633 | Ga0070701_104566332 | 144 |
| 291 | 3300005441 | Ga0070700_100979137 | Ga0070700_1009791371 | 144 |
| 292 | 3300005455 | Ga0070663_101357361 | Ga0070663_1013573611 | 144 |
| 293 | 3300005456 | Ga0070678_100219979 | Ga0070678_1002199792 | 144 |
| 294 | 3300005459 | Ga0068867_100526755 | Ga0068867_1005267551 | 144 |
| 295 | 3300005466 | Ga0070685_10272009 | Ga0070685_102720092 | 144 |
| 296 | 3300005530 | Ga0070679_100012491 | Ga0070679_1000124916 | 144 |
| 297 | 3300005544 | Ga0070686_100548446 | Ga0070686_1005484461 | 144 |
| 298 | 3300005548 | Ga0070665_100029684 | Ga0070665_1000296846 | 144 |
| 299 | 3300005577 | Ga0068857_100280058 | Ga0068857_1002800582 | 144 |
| 300 | 3300005719 | Ga0068861_101590455 | Ga0068861_1015904551 | 144 |
| 301 | 3300005985 | Ga0081539_10024421 | Ga0081539_100244213 | 144 |
| 302 | 3300009098 | Ga0105245_11194175 | Ga0105245_111941752 | 144 |
| 303 | 3300009177 | Ga0105248_11343235 | Ga0105248_113432352 | 144 |
| 304 | 3300009553 | Ga0105249_10831962 | Ga0105249_108319622 | 144 |
| 305 | 3300011119 | Ga0105246_10117793 | Ga0105246_101177932 | 144 |
| 306 | 3300011119 | Ga0105246_10184398 | Ga0105246_101843982 | 144 |
| 307 | 3300013306 | Ga0163162_10689326 | Ga0163162_106893262 | 144 |
| 308 | 3300013307 | Ga0157372_11700200 | Ga0157372_117002002 | 144 |
| 309 | 3300013308 | Ga0157375_10160740 | Ga0157375_101607402 | 144 |
| 310 | 3300013308 | Ga0157375_10643094 | Ga0157375_106430942 | 144 |
| 311 | 3300014326 | Ga0157380_12189714 | Ga0157380_121897142 | 144 |
| 312 | 3300014497 | Ga0182008_10040061 | Ga0182008_100400613 | 144 |
| 313 | 3300014497 | Ga0182008_10558235 | Ga0182008_105582352 | 144 |
| 314 | 3300015261 | Ga0182006_1249420 | Ga0182006_12494202 | 144 |
| 315 | 3300017792 | Ga0163161_10269852 | Ga0163161_102698522 | 144 |
| 316 | 3300020069 | Ga0197907_10630705 | Ga0197907_106307052 | 144 |
| 317 | 3300020082 | Ga0206353_10672241 | Ga0206353_106722412 | 144 |
| 318 | 3300021384 | Ga0213876_10253305 | Ga0213876_102533052 | 144 |
| 319 | 3300025898 | Ga0207692_10000388 | Ga0207692_1000038814 | 144 |
| 320 | 3300025904 | Ga0207647_10002418 | Ga0207647_100024183 | 144 |
| 321 | 3300025909 | Ga0207705_10000473 | Ga0207705_100004732 | 144 |
| 322 | 3300025909 | Ga0207705_10311099 | Ga0207705_103110993 | 144 |
| 323 | 3300025917 | Ga0207660_10368250 | Ga0207660_103682502 | 144 |
| 324 | 3300025919 | Ga0207657_10051387 | Ga0207657_100513872 | 144 |
| 325 | 3300025919 | Ga0207657_10408257 | Ga0207657_104082572 | 144 |
| 326 | 3300025921 | Ga0207652_10010913 | Ga0207652_100109136 | 144 |
| 327 | 3300025921 | Ga0207652_10320133 | Ga0207652_103201332 | 144 |
| 328 | 3300025927 | Ga0207687_10165793 | Ga0207687_101657933 | 144 |
| 329 | 3300025927 | Ga0207687_10949705 | Ga0207687_109497052 | 144 |
| 330 | 3300025937 | Ga0207669_10731406 | Ga0207669_107314062 | 144 |
| 331 | 3300025938 | Ga0207704_10711723 | Ga0207704_107117232 | 144 |
| 332 | 3300025944 | Ga0207661_10661371 | Ga0207661_106613712 | 144 |
| 333 | 3300025972 | Ga0207668_10345149 | Ga0207668_103451492 | 144 |
| 334 | 3300026075 | Ga0207708_10493775 | Ga0207708_104937752 | 144 |
| 335 | 3300026116 | Ga0207674_10282074 | Ga0207674_102820742 | 144 |
| 336 | 3300026121 | Ga0207683_10748938 | Ga0207683_107489382 | 144 |
| 337 | 3300027876 | Ga0209974_10088590 | Ga0209974_100885903 | 144 |
| 338 | 3300028379 | Ga0268266_10000855 | Ga0268266_1000085510 | 144 |
| 339 | 3300028380 | Ga0268265_11928816 | Ga0268265_119288161 | 144 |
| 340 | 3300028786 | Ga0307517_10283573 | Ga0307517_102835732 | 144 |
| 341 | 3300030731 | Ga0316177_1209821 | Ga0316177_12098212 | 144 |
| 342 | 3300030732 | Ga0316176_1061306 | Ga0316176_106130614 | 144 |
| 343 | 3300030733 | Ga0314311_1084681 | Ga0314311_10846816 | 144 |
| 344 | 3300030735 | Ga0316178_1152700 | Ga0316178_11527002 | 144 |
| 345 | 3300030736 | Ga0316180_1121628 | Ga0316180_11216282 | 144 |
| 346 | 3300038443 | Ga0395901_0095690 | Ga0395901_0095690_672_1148 | 144 |
| 347 | 3300041405 | Ga0439438_046980 | Ga0439438_046980_496_960 | 144 |
| 348 | 3300041407 | Ga0439447_021920 | Ga0439447_021920_1121_1576 | 144 |
| 349 | 3300041411 | Ga0439466_0137760 | Ga0439466_0137760_152_607 | 144 |
| 350 | 3300041452 | Ga0451793_1932876 | Ga0451793_1932876_32_520 | 144 |
| 351 | 3300041997 | Ga0439431_0005548 | Ga0439431_0005548_2031_2495 | 144 |
| 352 | 3300042156 | Ga0439446_0009340 | Ga0439446_0009340_381_845 | 144 |
| 353 | 3300042435 | Ga0439434_0006140 | Ga0439434_0006140_195_659 | 144 |
| 354 | 3300044658 | Ga0466972_0014657 | Ga0466972_0014657_574_1014 | 144 |
| 355 | 3300044683 | Ga0466965_0006241 | Ga0466965_0006241_2667_3107 | 144 |
| 356 | 3300044684 | Ga0466966_0154379 | Ga0466966_0154379_788_1246 | 144 |
| 357 | 3300044684 | Ga0466966_0642177 | Ga0466966_0642177_143_589 | 144 |
| 358 | 3300044694 | Ga0466963_0310667 | Ga0466963_0310667_381_833 | 144 |
| 359 | 3300044694 | Ga0466963_0750558 | Ga0466963_0750558_69_521 | 144 |
| 360 | 3300044706 | Ga0466964_0039878 | Ga0466964_0039878_1099_1551 | 144 |
| 361 | 3300044706 | Ga0466964_0248163 | Ga0466964_0248163_246_698 | 144 |
| 362 | 3300044901 | Ga0466960_0001500 | Ga0466960_0001500_3547_3987 | 144 |
| 363 | 3300045049 | Ga0466959_0191154 | Ga0466959_0191154_313_768 | 144 |
| 364 | 3300045976 | Ga0466967_0001887 | Ga0466967_0001887_9820_10272 | 144 |
| 365 | 3300045976 | Ga0466967_0029228 | Ga0466967_0029228_2678_3130 | 144 |
| 366 | 3300045976 | Ga0466967_0177604 | Ga0466967_0177604_766_1218 | 144 |
| 367 | 3300045976 | Ga0466967_0317676 | Ga0466967_0317676_832_1284 | 144 |
| 368 | 3300046461 | Ga0495641_0355341 | Ga0495641_0355341_168_629 | 144 |
| 369 | 3300046684 | Ga0495669_0005292 | Ga0495669_0005292_4173_4622 | 144 |
| 370 | 3300046694 | Ga0495649_0444596 | Ga0495649_0444596_97_579 | 144 |
| 371 | 3300048910 | Ga0496107_0279325 | Ga0496107_0279325_10_462 | 144 |
| 372 | 3300048912 | Ga0496109_1449996 | Ga0496109_1449996_76_537 | 144 |
| 373 | 3300049568 | Ga0501031_0003650 | Ga0501031_0003650_1956_2411 | 144 |
| 374 | 3300049568 | Ga0501031_0304136 | Ga0501031_0304136_117_566 | 144 |
| 375 | 3300049569 | Ga0501032_0074653 | Ga0501032_0074653_1420_1875 | 144 |
| 376 | 3300049569 | Ga0501032_0233761 | Ga0501032_0233761_146_595 | 144 |
| 377 | 3300049570 | Ga0501033_0002669 | Ga0501033_0002669_12572_13027 | 144 |
| 378 | 3300049571 | Ga0501034_0228795 | Ga0501034_0228795_341_796 | 144 |
| 379 | 3300049572 | Ga0501036_0055657 | Ga0501036_0055657_2449_2898 | 144 |
| 380 | 3300049572 | Ga0501036_0324593 | Ga0501036_0324593_668_1123 | 144 |
| 381 | 3300049572 | Ga0501036_0864117 | Ga0501036_0864117_250_705 | 144 |
| 382 | 3300049573 | Ga0501037_0001113 | Ga0501037_0001113_15171_15626 | 144 |
| 383 | 3300049573 | Ga0501037_0054327 | Ga0501037_0054327_34_483 | 144 |
| 384 | 3300049574 | Ga0501038_0109372 | Ga0501038_0109372_1251_1706 | 144 |
| 385 | 3300049574 | Ga0501038_0122067 | Ga0501038_0122067_747_1196 | 144 |
| 386 | 3300049575 | Ga0501039_0002962 | Ga0501039_0002962_10925_11380 | 144 |
| 387 | 3300049575 | Ga0501039_0737570 | Ga0501039_0737570_194_643 | 144 |
| 388 | 3300049575 | Ga0501039_0855910 | Ga0501039_0855910_62_517 | 144 |
| 389 | 3300049577 | Ga0501041_0028069 | Ga0501041_0028069_522_971 | 144 |
| 390 | 3300049578 | Ga0501042_0022647 | Ga0501042_0022647_3867_4316 | 144 |
| 391 | 3300049578 | Ga0501042_0027714 | Ga0501042_0027714_912_1388 | 144 |
| 392 | 3300049578 | Ga0501042_0087874 | Ga0501042_0087874_769_1224 | 144 |
| 393 | 3300049579 | Ga0501043_0040876 | Ga0501043_0040876_283_738 | 144 |
| 394 | 3300049579 | Ga0501043_1215758 | Ga0501043_1215758_61_516 | 144 |
| 395 | 3300049580 | Ga0501046_0012603 | Ga0501046_0012603_4729_5184 | 144 |
| 396 | 3300049580 | Ga0501046_0059062 | Ga0501046_0059062_1330_1785 | 144 |
| 397 | 3300049582 | Ga0501048_0003907 | Ga0501048_0003907_7410_7859 | 144 |
| 398 | 3300049582 | Ga0501048_0055269 | Ga0501048_0055269_1162_1617 | 144 |
| 399 | 3300049583 | Ga0501067_0797933 | Ga0501067_0797933_24_464 | 144 |
| 400 | 3300049584 | Ga0501068_0081150 | Ga0501068_0081150_117_566 | 144 |
| 401 | 3300049584 | Ga0501068_0288397 | Ga0501068_0288397_346_786 | 144 |
| 402 | 3300049585 | Ga0501069_0070056 | Ga0501069_0070056_59_508 | 144 |
| 403 | 3300049586 | Ga0501070_0018361 | Ga0501070_0018361_4301_4756 | 144 |
| 404 | 3300049587 | Ga0501071_0225399 | Ga0501071_0225399_637_1086 | 144 |
| 405 | 3300049587 | Ga0501071_0433146 | Ga0501071_0433146_230_706 | 144 |
| 406 | 3300049587 | Ga0501071_1003811 | Ga0501071_1003811_24_476 | 144 |
| 407 | 3300049588 | Ga0501072_0072403 | Ga0501072_0072403_1547_1996 | 144 |
| 408 | 3300049589 | Ga0501073_0255259 | Ga0501073_0255259_427_876 | 144 |
| 409 | 3300049590 | Ga0501074_0328171 | Ga0501074_0328171_448_897 | 144 |
| 410 | 3300049590 | Ga0501074_0743271 | Ga0501074_0743271_21_476 | 144 |
| 411 | 3300049591 | Ga0501075_0083788 | Ga0501075_0083788_1256_1705 | 144 |
| 412 | 3300049741 | Ga0501079_0044004 | Ga0501079_0044004_1748_2197 | 144 |
| 413 | 3300049742 | Ga0501080_0028663 | Ga0501080_0028663_2856_3311 | 144 |
| 414 | 3300049742 | Ga0501080_0070715 | Ga0501080_0070715_1032_1481 | 144 |
| 415 | 3300049743 | Ga0501081_0063064 | Ga0501081_0063064_1347_1796 | 144 |
| 416 | 3300049822 | Ga0501035_0075383 | Ga0501035_0075383_2219_2674 | 144 |
| 417 | 3300049822 | Ga0501035_0867527 | Ga0501035_0867527_180_629 | 144 |
| 418 | 3300049823 | Ga0501044_0090982 | Ga0501044_0090982_959_1414 | 144 |
| 419 | 3300049824 | Ga0501045_0148940 | Ga0501045_0148940_529_984 | 144 |
| 420 | 3300049824 | Ga0501045_0201090 | Ga0501045_0201090_899_1348 | 144 |
| 421 | 3300050491 | nmdc:mga00v17_301922_c1 | nmdc:mga00v17_301922_c1_357_809 | 144 |
| 422 | 3300053138 | Ga0500564_189310 | Ga0500564_189310_141_590 | 144 |
| 423 | 3300054114 | Ga0501084_0032537 | Ga0501084_0032537_342_791 | 144 |
| 424 | 3300059492 | Ga0587073_0042208 | Ga0587073_0042208_282_743 | 144 |
| 425 | 3300060353 | Ga0501082_0216096 | Ga0501082_0216096_306_755 | 144 |
| 426 | 3300061734 | Ga0530510_0114639 | Ga0530510_0114639_1451_1900 | 144 |
| 427 | iso_pu_bacteria | 2795385470 | 2795786671 | 144 |
| 428 | iso_pu_bacteria | 2866612099 | 2866614583 | 144 |
| 429 | iso_pu_bacteria | 2870782633 | 2870785313 | 144 |
| 430 | 3300005336 | Ga0070680_101286282 | Ga0070680_1012862821 | 145 |
| 431 | 3300005339 | Ga0070660_100282263 | Ga0070660_1002822632 | 145 |
| 432 | 3300005458 | Ga0070681_10088899 | Ga0070681_100888995 | 145 |
| 433 | 3300005530 | Ga0070679_100190367 | Ga0070679_1001903673 | 145 |
| 434 | 3300006038 | Ga0075365_10427097 | Ga0075365_104270972 | 145 |
| 435 | 3300006051 | Ga0075364_10323784 | Ga0075364_103237841 | 145 |
| 436 | 3300006173 | Ga0070716_100327919 | Ga0070716_1003279192 | 145 |
| 437 | 3300009011 | Ga0105251_10046840 | Ga0105251_100468402 | 145 |
| 438 | 3300009545 | Ga0105237_10111283 | Ga0105237_101112832 | 145 |
| 439 | 3300010375 | Ga0105239_10027014 | Ga0105239_100270147 | 145 |
| 440 | 3300013307 | Ga0157372_10563282 | Ga0157372_105632822 | 145 |
| 441 | 3300013308 | Ga0157375_10379131 | Ga0157375_103791313 | 145 |
| 442 | 3300014326 | Ga0157380_13062449 | Ga0157380_130624491 | 145 |
| 443 | 3300022467 | Ga0224712_10094320 | Ga0224712_100943202 | 145 |
| 444 | 3300025917 | Ga0207660_10953543 | Ga0207660_109535432 | 145 |
| 445 | 3300025921 | Ga0207652_10053044 | Ga0207652_100530442 | 145 |
| 446 | 3300025986 | Ga0207658_10234070 | Ga0207658_102340702 | 145 |
| 447 | 3300031727 | Ga0316576_10107854 | Ga0316576_101078542 | 145 |
| 448 | 3300032126 | Ga0307415_100976632 | Ga0307415_1009766322 | 145 |
| 449 | 3300035398 | Ga0316574_0019054 | Ga0316574_0019054_2349_2795 | 145 |
| 450 | 3300044901 | Ga0466960_0001488 | Ga0466960_0001488_4888_5343 | 145 |
| 451 | 3300045976 | Ga0466967_0087235 | Ga0466967_0087235_1013_1507 | 145 |
| 452 | 3300045976 | Ga0466967_1107971 | Ga0466967_1107971_178_633 | 145 |
| 453 | 3300046476 | Ga0495662_0159438 | Ga0495662_0159438_564_1016 | 145 |
| 454 | 3300046499 | Ga0495594_0029589 | Ga0495594_0029589_126_578 | 145 |
| 455 | 3300046501 | Ga0495607_0029787 | Ga0495607_0029787_2435_2926 | 145 |
| 456 | 3300046679 | Ga0495623_0027659 | Ga0495623_0027659_1228_1680 | 145 |
| 457 | 3300047317 | Ga0495604_0004336 | Ga0495604_0004336_6557_7009 | 145 |
| 458 | 3300047323 | Ga0495683_0000189 | Ga0495683_0000189_4489_4980 | 145 |
| 459 | 3300047444 | Ga0495675_0052697 | Ga0495675_0052697_249_701 | 145 |
| 460 | 3300048903 | Ga0496100_0000011 | Ga0496100_0000011_150589_151071 | 145 |
| 461 | 3300048904 | Ga0496101_0000279 | Ga0496101_0000279_4226_4708 | 145 |
| 462 | 3300048905 | Ga0496102_0010258 | Ga0496102_0010258_266_748 | 145 |
| 463 | 3300048906 | Ga0496103_0101727 | Ga0496103_0101727_1072_1554 | 145 |
| 464 | 3300048909 | Ga0496106_0013771 | Ga0496106_0013771_4748_5230 | 145 |
| 465 | 3300048910 | Ga0496107_0001343 | Ga0496107_0001343_1408_1890 | 145 |
| 466 | 3300048911 | Ga0496108_0029511 | Ga0496108_0029511_3604_4086 | 145 |
| 467 | 3300048912 | Ga0496109_0000179 | Ga0496109_0000179_31068_31550 | 145 |
| 468 | 3300048913 | Ga0496110_0027924 | Ga0496110_0027924_1624_2106 | 145 |
| 469 | 3300048916 | Ga0496113_0208740 | Ga0496113_0208740_101_583 | 145 |
| 470 | 3300048917 | Ga0496114_0003812 | Ga0496114_0003812_7831_8313 | 145 |
| 471 | 3300048918 | Ga0496115_0064507 | Ga0496115_0064507_600_1082 | 145 |
| 472 | 3300048919 | Ga0496116_0148454 | Ga0496116_0148454_266_748 | 145 |
| 473 | 3300048920 | Ga0496117_0038461 | Ga0496117_0038461_2288_2770 | 145 |
| 474 | 3300048921 | Ga0496118_0092036 | Ga0496118_0092036_777_1259 | 145 |
| 475 | 3300048922 | Ga0496119_0028285 | Ga0496119_0028285_686_1168 | 145 |
| 476 | 3300048923 | Ga0496120_0005714 | Ga0496120_0005714_8125_8607 | 145 |
| 477 | 3300048924 | Ga0496121_0000014 | Ga0496121_0000014_405199_405681 | 145 |
| 478 | 3300048925 | Ga0496122_0000084 | Ga0496122_0000084_205950_206432 | 145 |
| 479 | 3300048926 | Ga0496123_0008199 | Ga0496123_0008199_1264_1746 | 145 |
| 480 | 3300048927 | Ga0496124_0000019 | Ga0496124_0000019_405199_405681 | 145 |
| 481 | 3300048928 | Ga0496125_0000014 | Ga0496125_0000014_405199_405681 | 145 |
| 482 | 3300048929 | Ga0496126_0000017 | Ga0496126_0000017_204996_205478 | 145 |
| 483 | 3300049128 | Ga0501308_006849 | Ga0501308_006849_685_1143 | 145 |
| 484 | 3300049538 | Ga0501322_006931 | Ga0501322_006931_75_539 | 145 |
| 485 | 3300049569 | Ga0501032_0328178 | Ga0501032_0328178_329_787 | 145 |
| 486 | 3300049570 | Ga0501033_0167383 | Ga0501033_0167383_1039_1497 | 145 |
| 487 | 3300049571 | Ga0501034_0002988 | Ga0501034_0002988_7188_7646 | 145 |
| 488 | 3300049571 | Ga0501034_0873124 | Ga0501034_0873124_184_675 | 145 |
| 489 | 3300049572 | Ga0501036_0015857 | Ga0501036_0015857_4011_4469 | 145 |
| 490 | 3300049573 | Ga0501037_0031006 | Ga0501037_0031006_1812_2270 | 145 |
| 491 | 3300049574 | Ga0501038_0013668 | Ga0501038_0013668_142_600 | 145 |
| 492 | 3300049575 | Ga0501039_0066265 | Ga0501039_0066265_142_597 | 145 |
| 493 | 3300049577 | Ga0501041_0154286 | Ga0501041_0154286_299_757 | 145 |
| 494 | 3300049578 | Ga0501042_0117964 | Ga0501042_0117964_1268_1726 | 145 |
| 495 | 3300049579 | Ga0501043_0296988 | Ga0501043_0296988_506_964 | 145 |
| 496 | 3300049581 | Ga0501047_0321687 | Ga0501047_0321687_222_680 | 145 |
| 497 | 3300049581 | Ga0501047_0670292 | Ga0501047_0670292_93_584 | 145 |
| 498 | 3300049582 | Ga0501048_0034976 | Ga0501048_0034976_1120_1578 | 145 |
| 499 | 3300049585 | Ga0501069_0447619 | Ga0501069_0447619_169_660 | 145 |
| 500 | 3300049589 | Ga0501073_0075878 | Ga0501073_0075878_1001_1459 | 145 |
| 501 | 3300049741 | Ga0501079_0355034 | Ga0501079_0355034_250_717 | 145 |
| 502 | 3300049822 | Ga0501035_0002047 | Ga0501035_0002047_16453_16911 | 145 |
| 503 | 3300049823 | Ga0501044_0006225 | Ga0501044_0006225_12620_13078 | 145 |
| 504 | 3300050491 | nmdc:mga00v17_186502_c1 | nmdc:mga00v17_186502_c1_421_876 | 145 |
| 505 | 3300050492 | nmdc:mga0yw44_320526_c1 | nmdc:mga0yw44_320526_c1_441_896 | 145 |
| 506 | 3300053140 | Ga0500573_0008093 | Ga0500573_0008093_579_1031 | 145 |
| 507 | 3300059628 | Ga0587122_047678 | Ga0587122_047678_68_529 | 145 |
| 508 | 3300059630 | Ga0587128_081436 | Ga0587128_081436_105_563 | 145 |
| 509 | iso_pu_bacteria | 2643221561 | 2643826031 | 145 |
| 510 | iso_pu_bacteria | 2643221696 | 2644532019 | 145 |
| 511 | 3300005329 | Ga0070683_101289123 | Ga0070683_1012891232 | 146 |
| 512 | 3300005458 | Ga0070681_10926973 | Ga0070681_109269732 | 146 |
| 513 | 3300005466 | Ga0070685_10024015 | Ga0070685_100240152 | 146 |
| 514 | 3300005543 | Ga0070672_101151148 | Ga0070672_1011511482 | 146 |
| 515 | 3300005546 | Ga0070696_100497480 | Ga0070696_1004974801 | 146 |
| 516 | 3300005985 | Ga0081539_10078617 | Ga0081539_100786172 | 146 |
| 517 | 3300006048 | Ga0075363_100159700 | Ga0075363_1001597002 | 146 |
| 518 | 3300006051 | Ga0075364_10149999 | Ga0075364_101499993 | 146 |
| 519 | 3300006177 | Ga0075362_10063831 | Ga0075362_100638312 | 146 |
| 520 | 3300009098 | Ga0105245_11874486 | Ga0105245_118744861 | 146 |
| 521 | 3300013105 | Ga0157369_10001259 | Ga0157369_100012592 | 146 |
| 522 | 3300013296 | Ga0157374_10325781 | Ga0157374_103257812 | 146 |
| 523 | 3300013306 | Ga0163162_10677252 | Ga0163162_106772522 | 146 |
| 524 | 3300013308 | Ga0157375_11001806 | Ga0157375_110018062 | 146 |
| 525 | 3300019192 | Ga0184603_133284 | Ga0184603_1332842 | 146 |
| 526 | 3300020069 | Ga0197907_11048701 | Ga0197907_110487011 | 146 |
| 527 | 3300020078 | Ga0206352_10839668 | Ga0206352_108396682 | 146 |
| 528 | 3300020081 | Ga0206354_10138557 | Ga0206354_101385572 | 146 |
| 529 | 3300020082 | Ga0206353_10564495 | Ga0206353_105644952 | 146 |
| 530 | 3300020082 | Ga0206353_11470156 | Ga0206353_114701562 | 146 |
| 531 | 3300021377 | Ga0213874_10016680 | Ga0213874_100166802 | 146 |
| 532 | 3300022467 | Ga0224712_10377046 | Ga0224712_103770461 | 146 |
| 533 | 3300025294 | Ga0209025_1034041 | Ga0209025_10340412 | 146 |
| 534 | 3300025735 | Ga0207713_1056599 | Ga0207713_10565993 | 146 |
| 535 | 3300025912 | Ga0207707_10505747 | Ga0207707_105057472 | 146 |
| 536 | 3300025986 | Ga0207658_11082737 | Ga0207658_110827372 | 146 |
| 537 | 3300026088 | Ga0207641_11075322 | Ga0207641_110753222 | 146 |
| 538 | 3300026089 | Ga0207648_10128853 | Ga0207648_101288533 | 146 |
| 539 | 3300026116 | Ga0207674_10369428 | Ga0207674_103694282 | 146 |
| 540 | 3300028379 | Ga0268266_10102032 | Ga0268266_101020322 | 146 |
| 541 | 3300028379 | Ga0268266_11658644 | Ga0268266_116586442 | 146 |
| 542 | 3300030836 | Ga0265767_102761 | Ga0265767_1027612 | 146 |
| 543 | 3300035170 | Ga0373943_0036774 | Ga0373943_0036774_1692_2150 | 146 |
| 544 | 3300037418 | Ga0395900_0837218 | Ga0395900_0837218_156_620 | 146 |
| 545 | 3300038443 | Ga0395901_0014105 | Ga0395901_0014105_3884_4351 | 146 |
| 546 | 3300038443 | Ga0395901_0022089 | Ga0395901_0022089_834_1298 | 146 |
| 547 | 3300044658 | Ga0466972_0120626 | Ga0466972_0120626_294_761 | 146 |
| 548 | 3300044683 | Ga0466965_0474111 | Ga0466965_0474111_127_600 | 146 |
| 549 | 3300044694 | Ga0466963_0157850 | Ga0466963_0157850_1031_1561 | 146 |
| 550 | 3300044694 | Ga0466963_0251642 | Ga0466963_0251642_557_1033 | 146 |
| 551 | 3300044694 | Ga0466963_0310832 | Ga0466963_0310832_612_1067 | 146 |
| 552 | 3300044765 | Ga0466970_0436853 | Ga0466970_0436853_21_494 | 146 |
| 553 | 3300044901 | Ga0466960_0288613 | Ga0466960_0288613_50_523 | 146 |
| 554 | 3300045976 | Ga0466967_0267858 | Ga0466967_0267858_877_1344 | 146 |
| 555 | 3300046459 | Ga0495629_0009112 | Ga0495629_0009112_3953_4411 | 146 |
| 556 | 3300046459 | Ga0495629_0082051 | Ga0495629_0082051_933_1412 | 146 |
| 557 | 3300046472 | Ga0495580_0105024 | Ga0495580_0105024_589_1068 | 146 |
| 558 | 3300046642 | Ga0495634_0701142 | Ga0495634_0701142_21_500 | 146 |
| 559 | 3300046663 | Ga0495635_0490978 | Ga0495635_0490978_87_554 | 146 |
| 560 | 3300046681 | Ga0495647_0341257 | Ga0495647_0341257_20_463 | 146 |
| 561 | 3300046690 | Ga0495624_0259066 | Ga0495624_0259066_458_937 | 146 |
| 562 | 3300047315 | Ga0495581_0020125 | Ga0495581_0020125_3333_3812 | 146 |
| 563 | 3300047317 | Ga0495604_0006697 | Ga0495604_0006697_3665_4123 | 146 |
| 564 | 3300047673 | Ga0495593_0004255 | Ga0495593_0004255_4424_4903 | 146 |
| 565 | 3300048907 | Ga0496104_0860193 | Ga0496104_0860193_103_564 | 146 |
| 566 | 3300048912 | Ga0496109_0358060 | Ga0496109_0358060_534_1001 | 146 |
| 567 | 3300048917 | Ga0496114_0630216 | Ga0496114_0630216_203_670 | 146 |
| 568 | 3300048918 | Ga0496115_0345152 | Ga0496115_0345152_492_953 | 146 |
| 569 | 3300049569 | Ga0501032_0099477 | Ga0501032_0099477_1073_1549 | 146 |
| 570 | 3300049586 | Ga0501070_0049598 | Ga0501070_0049598_2436_2921 | 146 |
| 571 | 3300049823 | Ga0501044_0615234 | Ga0501044_0615234_172_648 | 146 |
| 572 | 3300050489 | nmdc:mga03683_208411_c1 | nmdc:mga03683_208411_c1_380_862 | 146 |
| 573 | 3300050490 | nmdc:mga03n38_351088_c1 | nmdc:mga03n38_351088_c1_18_500 | 146 |
| 574 | 3300050491 | nmdc:mga00v17_72542_c1 | nmdc:mga00v17_72542_c1_1474_1944 | 146 |
| 575 | 3300053085 | Ga0495619_0050165 | Ga0495619_0050165_1572_2039 | 146 |
| 576 | 3300053087 | Ga0500643_000213 | Ga0500643_000213_12655_13098 | 146 |
| 577 | 3300059643 | Ga0587072_041075 | Ga0587072_041075_234_734 | 146 |
| 578 | 3300059647 | Ga0587079_118660 | Ga0587079_118660_64_537 | 146 |
| 579 | 3300003659 | JGI25404J52841_10056937 | JGI25404J52841_100569372 | 147 |
| 580 | 3300003792 | Ga0055540_1000036 | Ga0055540_1000036111 | 147 |
| 581 | 3300005327 | Ga0070658_10100554 | Ga0070658_101005543 | 147 |
| 582 | 3300005335 | Ga0070666_10191540 | Ga0070666_101915403 | 147 |
| 583 | 3300005338 | Ga0068868_100384083 | Ga0068868_1003840832 | 147 |
| 584 | 3300005340 | Ga0070689_100580593 | Ga0070689_1005805932 | 147 |
| 585 | 3300005435 | Ga0070714_100130112 | Ga0070714_1001301122 | 147 |
| 586 | 3300005455 | Ga0070663_100419915 | Ga0070663_1004199151 | 147 |
| 587 | 3300005459 | Ga0068867_100189074 | Ga0068867_1001890741 | 147 |
| 588 | 3300005535 | Ga0070684_100573619 | Ga0070684_1005736192 | 147 |
| 589 | 3300005577 | Ga0068857_100325556 | Ga0068857_1003255562 | 147 |
| 590 | 3300005617 | Ga0068859_100126212 | Ga0068859_1001262124 | 147 |
| 591 | 3300005844 | Ga0068862_100990174 | Ga0068862_1009901742 | 147 |
| 592 | 3300005983 | Ga0081540_1000117 | Ga0081540_10001177 | 147 |
| 593 | 3300005983 | Ga0081540_1051895 | Ga0081540_10518952 | 147 |
| 594 | 3300006175 | Ga0070712_100113997 | Ga0070712_1001139972 | 147 |
| 595 | 3300006844 | Ga0075428_100421995 | Ga0075428_1004219952 | 147 |
| 596 | 3300006914 | Ga0075436_100013538 | Ga0075436_1000135386 | 147 |
| 597 | 3300006931 | Ga0097620_100126211 | Ga0097620_1001262114 | 147 |
| 598 | 3300009094 | Ga0111539_10050843 | Ga0111539_100508434 | 147 |
| 599 | 3300009098 | Ga0105245_11047374 | Ga0105245_110473742 | 147 |
| 600 | 3300009147 | Ga0114129_10004172 | Ga0114129_100041726 | 147 |
| 601 | 3300009174 | Ga0105241_10209893 | Ga0105241_102098932 | 147 |
| 602 | 3300010159 | Ga0099796_10188361 | Ga0099796_101883612 | 147 |
| 603 | 3300010375 | Ga0105239_12452413 | Ga0105239_124524132 | 147 |
| 604 | 3300011119 | Ga0105246_11000288 | Ga0105246_110002882 | 147 |
| 605 | 3300013105 | Ga0157369_10020619 | Ga0157369_100206191 | 147 |
| 606 | 3300013296 | Ga0157374_11395321 | Ga0157374_113953211 | 147 |
| 607 | 3300013306 | Ga0163162_11366363 | Ga0163162_113663632 | 147 |
| 608 | 3300013307 | Ga0157372_10863301 | Ga0157372_108633012 | 147 |
| 609 | 3300014969 | Ga0157376_10274463 | Ga0157376_102744633 | 147 |
| 610 | 3300021388 | Ga0213875_10000102 | Ga0213875_1000010230 | 147 |
| 611 | 3300022467 | Ga0224712_10219723 | Ga0224712_102197232 | 147 |
| 612 | 3300025303 | Ga0209051_1000021 | Ga0209051_1000021460 | 147 |
| 613 | 3300025903 | Ga0207680_10270423 | Ga0207680_102704232 | 147 |
| 614 | 3300025927 | Ga0207687_11921989 | Ga0207687_119219891 | 147 |
| 615 | 3300025929 | Ga0207664_10150420 | Ga0207664_101504202 | 147 |
| 616 | 3300025933 | Ga0207706_10382012 | Ga0207706_103820122 | 147 |
| 617 | 3300025972 | Ga0207668_10197731 | Ga0207668_101977313 | 147 |
| 618 | 3300026023 | Ga0207677_10165088 | Ga0207677_101650882 | 147 |
| 619 | 3300026116 | Ga0207674_10343894 | Ga0207674_103438942 | 147 |
| 620 | 3300031251 | Ga0265327_10113483 | Ga0265327_101134832 | 147 |
| 621 | 3300031548 | Ga0307408_100839563 | Ga0307408_1008395632 | 147 |
| 622 | 3300031691 | Ga0316579_10185689 | Ga0316579_101856892 | 147 |
| 623 | 3300031731 | Ga0307405_10211453 | Ga0307405_102114532 | 147 |
| 624 | 3300031838 | Ga0307518_10001710 | Ga0307518_100017107 | 147 |
| 625 | 3300031852 | Ga0307410_10092703 | Ga0307410_100927032 | 147 |
| 626 | 3300031911 | Ga0307412_10095212 | Ga0307412_100952122 | 147 |
| 627 | 3300031995 | Ga0307409_100143537 | Ga0307409_1001435372 | 147 |
| 628 | 3300031995 | Ga0307409_100257831 | Ga0307409_1002578312 | 147 |
| 629 | 3300032002 | Ga0307416_100345455 | Ga0307416_1003454552 | 147 |
| 630 | 3300032002 | Ga0307416_100919547 | Ga0307416_1009195471 | 147 |
| 631 | 3300032126 | Ga0307415_100080821 | Ga0307415_1000808212 | 147 |
| 632 | 3300032126 | Ga0307415_100171992 | Ga0307415_1001719923 | 147 |
| 633 | 3300032133 | Ga0316583_10143138 | Ga0316583_101431382 | 147 |
| 634 | 3300033179 | Ga0307507_10009186 | Ga0307507_100091868 | 147 |
| 635 | 3300035083 | Ga0373926_0134434 | Ga0373926_0134434_78_539 | 147 |
| 636 | 3300035086 | Ga0373934_0021200 | Ga0373934_0021200_1171_1626 | 147 |
| 637 | 3300035086 | Ga0373934_0098840 | Ga0373934_0098840_676_1137 | 147 |
| 638 | 3300035117 | Ga0373953_0091134 | Ga0373953_0091134_45_506 | 147 |
| 639 | 3300035118 | Ga0373954_0080673 | Ga0373954_0080673_45_506 | 147 |
| 640 | 3300035119 | Ga0373956_0017925 | Ga0373956_0017925_1062_1523 | 147 |
| 641 | 3300035170 | Ga0373943_0013820 | Ga0373943_0013820_39_500 | 147 |
| 642 | 3300035172 | Ga0373955_0119373 | Ga0373955_0119373_290_751 | 147 |
| 643 | 3300035398 | Ga0316574_0000101 | Ga0316574_0000101_14303_14749 | 147 |
| 644 | 3300035410 | Ga0373924_0004268 | Ga0373924_0004268_1586_2047 | 147 |
| 645 | 3300035692 | Ga0373935_0048565 | Ga0373935_0048565_1622_2083 | 147 |
| 646 | 3300035692 | Ga0373935_0067374 | Ga0373935_0067374_1536_1997 | 147 |
| 647 | 3300035695 | Ga0373927_0183574 | Ga0373927_0183574_21_482 | 147 |
| 648 | 3300035724 | Ga0373933_0002913 | Ga0373933_0002913_3676_4137 | 147 |
| 649 | 3300035724 | Ga0373933_0042008 | Ga0373933_0042008_357_812 | 147 |
| 650 | 3300035725 | Ga0373947_0275547 | Ga0373947_0275547_209_670 | 147 |
| 651 | 3300036401 | Ga0373937_0001426 | Ga0373937_0001426_46_507 | 147 |
| 652 | 3300036712 | Ga0316584_0185399 | Ga0316584_0185399_59_505 | 147 |
| 653 | 3300037418 | Ga0395900_0194724 | Ga0395900_0194724_1157_1669 | 147 |
| 654 | 3300037466 | Ga0395898_0106879 | Ga0395898_0106879_266_778 | 147 |
| 655 | 3300037471 | Ga0395905_0269311 | Ga0395905_0269311_75_587 | 147 |
| 656 | 3300037853 | Ga0436364_0940223 | Ga0436364_0940223_106741_107208 | 147 |
| 657 | 3300038443 | Ga0395901_0029427 | Ga0395901_0029427_4465_4977 | 147 |
| 658 | 3300044658 | Ga0466972_0020311 | Ga0466972_0020311_2304_2771 | 147 |
| 659 | 3300044683 | Ga0466965_0001357 | Ga0466965_0001357_3618_4085 | 147 |
| 660 | 3300044693 | Ga0466961_0165609 | Ga0466961_0165609_723_1190 | 147 |
| 661 | 3300044693 | Ga0466961_0290484 | Ga0466961_0290484_159_620 | 147 |
| 662 | 3300044694 | Ga0466963_0077264 | Ga0466963_0077264_593_1060 | 147 |
| 663 | 3300044706 | Ga0466964_0043935 | Ga0466964_0043935_820_1287 | 147 |
| 664 | 3300044719 | Ga0466971_0010225 | Ga0466971_0010225_1935_2402 | 147 |
| 665 | 3300044735 | Ga0466968_0079260 | Ga0466968_0079260_486_929 | 147 |
| 666 | 3300044765 | Ga0466970_0019209 | Ga0466970_0019209_666_1133 | 147 |
| 667 | 3300044765 | Ga0466970_0382919 | Ga0466970_0382919_276_737 | 147 |
| 668 | 3300044842 | Ga0466957_0357030 | Ga0466957_0357030_461_928 | 147 |
| 669 | 3300044901 | Ga0466960_0350482 | Ga0466960_0350482_37_504 | 147 |
| 670 | 3300045049 | Ga0466959_0365902 | Ga0466959_0365902_384_845 | 147 |
| 671 | 3300045836 | Ga0466958_0020682 | Ga0466958_0020682_1217_1684 | 147 |
| 672 | 3300045976 | Ga0466967_0043439 | Ga0466967_0043439_2421_2888 | 147 |
| 673 | 3300045976 | Ga0466967_0201091 | Ga0466967_0201091_1273_1761 | 147 |
| 674 | 3300045976 | Ga0466967_1140789 | Ga0466967_1140789_115_576 | 147 |
| 675 | 3300046454 | Ga0495592_0005811 | Ga0495592_0005811_6227_6688 | 147 |
| 676 | 3300046454 | Ga0495592_0081388 | Ga0495592_0081388_645_1100 | 147 |
| 677 | 3300046455 | Ga0495603_0033526 | Ga0495603_0033526_66_527 | 147 |
| 678 | 3300046459 | Ga0495629_0022210 | Ga0495629_0022210_2031_2492 | 147 |
| 679 | 3300046461 | Ga0495641_0004743 | Ga0495641_0004743_5948_6409 | 147 |
| 680 | 3300046461 | Ga0495641_0064410 | Ga0495641_0064410_187_648 | 147 |
| 681 | 3300046462 | Ga0495651_0026865 | Ga0495651_0026865_1264_1725 | 147 |
| 682 | 3300046462 | Ga0495651_0060501 | Ga0495651_0060501_1899_2354 | 147 |
| 683 | 3300046463 | Ga0495653_0036309 | Ga0495653_0036309_3355_3816 | 147 |
| 684 | 3300046463 | Ga0495653_0069805 | Ga0495653_0069805_538_993 | 147 |
| 685 | 3300046463 | Ga0495653_0089779 | Ga0495653_0089779_305_766 | 147 |
| 686 | 3300046473 | Ga0495582_0007863 | Ga0495582_0007863_3653_4114 | 147 |
| 687 | 3300046475 | Ga0495639_0263348 | Ga0495639_0263348_371_832 | 147 |
| 688 | 3300046476 | Ga0495662_0006974 | Ga0495662_0006974_258_719 | 147 |
| 689 | 3300046477 | Ga0495664_0034672 | Ga0495664_0034672_2463_2924 | 147 |
| 690 | 3300046511 | Ga0495608_0059867 | Ga0495608_0059867_1742_2203 | 147 |
| 691 | 3300046514 | Ga0495618_0070337 | Ga0495618_0070337_1590_2051 | 147 |
| 692 | 3300046514 | Ga0495618_0180519 | Ga0495618_0180519_842_1297 | 147 |
| 693 | 3300046516 | Ga0495628_0178997 | Ga0495628_0178997_1098_1559 | 147 |
| 694 | 3300046517 | Ga0495630_0032799 | Ga0495630_0032799_3254_3715 | 147 |
| 695 | 3300046517 | Ga0495630_0244650 | Ga0495630_0244650_733_1194 | 147 |
| 696 | 3300046517 | Ga0495630_0561814 | Ga0495630_0561814_214_669 | 147 |
| 697 | 3300046526 | Ga0495666_0011982 | Ga0495666_0011982_3641_4102 | 147 |
| 698 | 3300046531 | Ga0495665_0058695 | Ga0495665_0058695_1424_1885 | 147 |
| 699 | 3300046533 | Ga0495640_0024191 | Ga0495640_0024191_2004_2465 | 147 |
| 700 | 3300046543 | Ga0495645_0026680 | Ga0495645_0026680_209_670 | 147 |
| 701 | 3300046543 | Ga0495645_0216039 | Ga0495645_0216039_570_1031 | 147 |
| 702 | 3300046559 | Ga0495667_0003863 | Ga0495667_0003863_1049_1504 | 147 |
| 703 | 3300046559 | Ga0495667_0033817 | Ga0495667_0033817_96_557 | 147 |
| 704 | 3300046642 | Ga0495634_0012517 | Ga0495634_0012517_3651_4112 | 147 |
| 705 | 3300046663 | Ga0495635_0018288 | Ga0495635_0018288_917_1378 | 147 |
| 706 | 3300046663 | Ga0495635_0022276 | Ga0495635_0022276_2119_2574 | 147 |
| 707 | 3300046663 | Ga0495635_0067167 | Ga0495635_0067167_734_1195 | 147 |
| 708 | 3300046675 | Ga0495657_0027640 | Ga0495657_0027640_1537_1998 | 147 |
| 709 | 3300046678 | Ga0495599_0003147 | Ga0495599_0003147_4341_4802 | 147 |
| 710 | 3300046678 | Ga0495599_0185988 | Ga0495599_0185988_384_845 | 147 |
| 711 | 3300046679 | Ga0495623_0014183 | Ga0495623_0014183_2578_3039 | 147 |
| 712 | 3300046679 | Ga0495623_0060312 | Ga0495623_0060312_1393_1848 | 147 |
| 713 | 3300046680 | Ga0495646_0004781 | Ga0495646_0004781_3372_3833 | 147 |
| 714 | 3300046681 | Ga0495647_0004220 | Ga0495647_0004220_512_973 | 147 |
| 715 | 3300046683 | Ga0495658_0186447 | Ga0495658_0186447_385_846 | 147 |
| 716 | 3300046689 | Ga0495613_0013377 | Ga0495613_0013377_3709_4170 | 147 |
| 717 | 3300046690 | Ga0495624_0323613 | Ga0495624_0323613_389_850 | 147 |
| 718 | 3300046809 | Ga0495600_0025754 | Ga0495600_0025754_2518_2979 | 147 |
| 719 | 3300046809 | Ga0495600_0104960 | Ga0495600_0104960_684_1139 | 147 |
| 720 | 3300047315 | Ga0495581_0016627 | Ga0495581_0016627_2757_3218 | 147 |
| 721 | 3300047315 | Ga0495581_0073409 | Ga0495581_0073409_551_1012 | 147 |
| 722 | 3300047317 | Ga0495604_0003750 | Ga0495604_0003750_6579_7034 | 147 |
| 723 | 3300047319 | Ga0495674_0062948 | Ga0495674_0062948_2463_2924 | 147 |
| 724 | 3300047319 | Ga0495674_0088995 | Ga0495674_0088995_1808_2269 | 147 |
| 725 | 3300047321 | Ga0495676_0100184 | Ga0495676_0100184_1499_1960 | 147 |
| 726 | 3300047321 | Ga0495676_0243739 | Ga0495676_0243739_675_1136 | 147 |
| 727 | 3300047444 | Ga0495675_0037089 | Ga0495675_0037089_1467_1922 | 147 |
| 728 | 3300047444 | Ga0495675_0078551 | Ga0495675_0078551_1573_2034 | 147 |
| 729 | 3300047471 | Ga0495684_0008195 | Ga0495684_0008195_3149_3604 | 147 |
| 730 | 3300047471 | Ga0495684_0020878 | Ga0495684_0020878_949_1410 | 147 |
| 731 | 3300047471 | Ga0495684_0340939 | Ga0495684_0340939_147_608 | 147 |
| 732 | 3300047673 | Ga0495593_0031232 | Ga0495593_0031232_733_1194 | 147 |
| 733 | 3300048088 | Ga0495602_0148521 | Ga0495602_0148521_1339_1800 | 147 |
| 734 | 3300049130 | Ga0501310_020126 | Ga0501310_020126_58_537 | 147 |
| 735 | 3300049162 | Ga0501307_006654 | Ga0501307_006654_43_525 | 147 |
| 736 | 3300049527 | Ga0501311_004955 | Ga0501311_004955_85_567 | 147 |
| 737 | 3300049533 | Ga0501317_008593 | Ga0501317_008593_333_812 | 147 |
| 738 | 3300049534 | Ga0501318_001413 | Ga0501318_001413_878_1360 | 147 |
| 739 | 3300049537 | Ga0501321_000627 | Ga0501321_000627_666_1148 | 147 |
| 740 | 3300049571 | Ga0501034_0035968 | Ga0501034_0035968_1941_2384 | 147 |
| 741 | 3300049572 | Ga0501036_0000969 | Ga0501036_0000969_10294_10737 | 147 |
| 742 | 3300049572 | Ga0501036_0493729 | Ga0501036_0493729_334_810 | 147 |
| 743 | 3300049573 | Ga0501037_0063516 | Ga0501037_0063516_1230_1673 | 147 |
| 744 | 3300049574 | Ga0501038_0035313 | Ga0501038_0035313_392_835 | 147 |
| 745 | 3300049574 | Ga0501038_0137388 | Ga0501038_0137388_549_1058 | 147 |
| 746 | 3300049575 | Ga0501039_0093748 | Ga0501039_0093748_858_1301 | 147 |
| 747 | 3300049578 | Ga0501042_0037806 | Ga0501042_0037806_1136_1579 | 147 |
| 748 | 3300049579 | Ga0501043_0005373 | Ga0501043_0005373_6260_6703 | 147 |
| 749 | 3300049580 | Ga0501046_0415216 | Ga0501046_0415216_129_572 | 147 |
| 750 | 3300049581 | Ga0501047_0214989 | Ga0501047_0214989_1009_1452 | 147 |
| 751 | 3300049582 | Ga0501048_0028534 | Ga0501048_0028534_1172_1615 | 147 |
| 752 | 3300049584 | Ga0501068_0523673 | Ga0501068_0523673_110_586 | 147 |
| 753 | 3300049586 | Ga0501070_0425441 | Ga0501070_0425441_207_668 | 147 |
| 754 | 3300049589 | Ga0501073_0010455 | Ga0501073_0010455_1108_1551 | 147 |
| 755 | 3300049590 | Ga0501074_0005245 | Ga0501074_0005245_4804_5247 | 147 |
| 756 | 3300049823 | Ga0501044_0017172 | Ga0501044_0017172_2740_3183 | 147 |
| 757 | 3300049824 | Ga0501045_0123449 | Ga0501045_0123449_855_1331 | 147 |
| 758 | 3300050507 | nmdc:mga05p37_18110_c1 | nmdc:mga05p37_18110_c1_4396_4857 | 147 |
| 759 | 3300050508 | nmdc:mga09592_1569591_c1 | nmdc:mga09592_1569591_c1_50_511 | 147 |
| 760 | 3300050511 | nmdc:mga08y16_64549_c1 | nmdc:mga08y16_64549_c1_1272_1733 | 147 |
| 761 | 3300050514 | nmdc:mga08x19_61574_c1 | nmdc:mga08x19_61574_c1_1922_2383 | 147 |
| 762 | 3300050515 | nmdc:mga0a205_37369_c1 | nmdc:mga0a205_37369_c1_3724_4185 | 147 |
| 763 | 3300053077 | Ga0495601_0056077 | Ga0495601_0056077_1214_1675 | 147 |
| 764 | 3300053077 | Ga0495601_0586989 | Ga0495601_0586989_46_507 | 147 |
| 765 | 3300053078 | Ga0495612_0096725 | Ga0495612_0096725_250_711 | 147 |
| 766 | 3300053084 | Ga0495595_0016048 | Ga0495595_0016048_1731_2192 | 147 |
| 767 | 3300053085 | Ga0495619_0008690 | Ga0495619_0008690_4289_4738 | 147 |
| 768 | 3300053085 | Ga0495619_0158163 | Ga0495619_0158163_896_1351 | 147 |
| 769 | 3300059506 | Ga0587085_055491 | Ga0587085_055491_237_698 | 147 |
| 770 | 3300059605 | Ga0587106_077786 | Ga0587106_077786_44_505 | 147 |
| 771 | 3300059643 | Ga0587072_100754 | Ga0587072_100754_66_515 | 147 |
| 772 | 3300059652 | Ga0587107_093191 | Ga0587107_093191_48_497 | 147 |
| 773 | 3300061719 | Ga0466962_0010540 | Ga0466962_0010540_1262_1729 | 147 |
| 774 | iso_pu_bacteria | 2684623035 | 2686538513 | 147 |
| 775 | iso_pu_bacteria | 2895880812 | 2895885674 | 147 |
| 776 | 3300004799 | Ga0058863_11868134 | Ga0058863_118681343 | 148 |
| 777 | 3300005327 | Ga0070658_10000603 | Ga0070658_1000060317 | 148 |
| 778 | 3300005329 | Ga0070683_100328580 | Ga0070683_1003285802 | 148 |
| 779 | 3300005336 | Ga0070680_100000622 | Ga0070680_1000006226 | 148 |
| 780 | 3300005434 | Ga0070709_10121217 | Ga0070709_101212172 | 148 |
| 781 | 3300005435 | Ga0070714_100003855 | Ga0070714_1000038557 | 148 |
| 782 | 3300005436 | Ga0070713_100007332 | Ga0070713_1000073327 | 148 |
| 783 | 3300005437 | Ga0070710_10034672 | Ga0070710_100346723 | 148 |
| 784 | 3300005439 | Ga0070711_100392882 | Ga0070711_1003928821 | 148 |
| 785 | 3300005458 | Ga0070681_10000561 | Ga0070681_1000056113 | 148 |
| 786 | 3300005468 | Ga0070707_100181398 | Ga0070707_1001813983 | 148 |
| 787 | 3300005530 | Ga0070679_100000912 | Ga0070679_10000091210 | 148 |
| 788 | 3300005536 | Ga0070697_100015765 | Ga0070697_1000157653 | 148 |
| 789 | 3300005549 | Ga0070704_100281570 | Ga0070704_1002815703 | 148 |
| 790 | 3300006028 | Ga0070717_10069655 | Ga0070717_100696551 | 148 |
| 791 | 3300006175 | Ga0070712_100119096 | Ga0070712_1001190962 | 148 |
| 792 | 3300009101 | Ga0105247_10313276 | Ga0105247_103132762 | 148 |
| 793 | 3300013104 | Ga0157370_10620900 | Ga0157370_106209001 | 148 |
| 794 | 3300013105 | Ga0157369_10158228 | Ga0157369_101582282 | 148 |
| 795 | 3300013307 | Ga0157372_10344977 | Ga0157372_103449772 | 148 |
| 796 | 3300013307 | Ga0157372_10544157 | Ga0157372_105441572 | 148 |
| 797 | 3300013307 | Ga0157372_11011355 | Ga0157372_110113551 | 148 |
| 798 | 3300013308 | Ga0157375_10732980 | Ga0157375_107329803 | 148 |
| 799 | 3300014326 | Ga0157380_10957883 | Ga0157380_109578832 | 148 |
| 800 | 3300014326 | Ga0157380_12678787 | Ga0157380_126787871 | 148 |
| 801 | 3300020069 | Ga0197907_10307493 | Ga0197907_103074933 | 148 |
| 802 | 3300020069 | Ga0197907_10608651 | Ga0197907_106086515 | 148 |
| 803 | 3300020070 | Ga0206356_10176009 | Ga0206356_101760092 | 148 |
| 804 | 3300020075 | Ga0206349_1224696 | Ga0206349_12246962 | 148 |
| 805 | 3300020077 | Ga0206351_10105420 | Ga0206351_101054201 | 148 |
| 806 | 3300020077 | Ga0206351_10828683 | Ga0206351_108286833 | 148 |
| 807 | 3300020078 | Ga0206352_10633471 | Ga0206352_106334712 | 148 |
| 808 | 3300020080 | Ga0206350_10401678 | Ga0206350_104016782 | 148 |
| 809 | 3300020080 | Ga0206350_10669213 | Ga0206350_106692132 | 148 |
| 810 | 3300020081 | Ga0206354_10566456 | Ga0206354_105664569 | 148 |
| 811 | 3300020082 | Ga0206353_10548237 | Ga0206353_105482374 | 148 |
| 812 | 3300020610 | Ga0154015_1029170 | Ga0154015_10291702 | 148 |
| 813 | 3300020610 | Ga0154015_1252405 | Ga0154015_12524051 | 148 |
| 814 | 3300022467 | Ga0224712_10029020 | Ga0224712_100290203 | 148 |
| 815 | 3300025898 | Ga0207692_10018677 | Ga0207692_100186775 | 148 |
| 816 | 3300025900 | Ga0207710_10104924 | Ga0207710_101049241 | 148 |
| 817 | 3300025906 | Ga0207699_10078718 | Ga0207699_100787183 | 148 |
| 818 | 3300025909 | Ga0207705_10000656 | Ga0207705_1000065610 | 148 |
| 819 | 3300025912 | Ga0207707_10000151 | Ga0207707_1000015144 | 148 |
| 820 | 3300025915 | Ga0207693_10123935 | Ga0207693_101239352 | 148 |
| 821 | 3300025916 | Ga0207663_10093553 | Ga0207663_100935532 | 148 |
| 822 | 3300025917 | Ga0207660_10000490 | Ga0207660_1000049024 | 148 |
| 823 | 3300025921 | Ga0207652_10000244 | Ga0207652_1000024457 | 148 |
| 824 | 3300025922 | Ga0207646_10009734 | Ga0207646_1000973410 | 148 |
| 825 | 3300025928 | Ga0207700_10005313 | Ga0207700_100053132 | 148 |
| 826 | 3300025929 | Ga0207664_10013288 | Ga0207664_100132884 | 148 |
| 827 | 3300025932 | Ga0207690_10182574 | Ga0207690_101825743 | 148 |
| 828 | 3300025944 | Ga0207661_10259967 | Ga0207661_102599672 | 148 |
| 829 | 3300026067 | Ga0207678_10702470 | Ga0207678_107024702 | 148 |
| 830 | 3300041512 | Ga0451853_1644521 | Ga0451853_1644521_193_657 | 148 |
| 831 | 3300044693 | Ga0466961_0046581 | Ga0466961_0046581_1661_2110 | 148 |
| 832 | 3300048905 | Ga0496102_0125213 | Ga0496102_0125213_1401_1886 | 148 |
| 833 | 3300048908 | Ga0496105_0235412 | Ga0496105_0235412_647_1132 | 148 |
| 834 | 3300048912 | Ga0496109_1285082 | Ga0496109_1285082_174_623 | 148 |
| 835 | 3300048917 | Ga0496114_0294101 | Ga0496114_0294101_207_656 | 148 |
| 836 | 3300049570 | Ga0501033_0048077 | Ga0501033_0048077_1764_2252 | 148 |
| 837 | 3300049581 | Ga0501047_0232510 | Ga0501047_0232510_591_1088 | 148 |
| 838 | 3300049585 | Ga0501069_0103529 | Ga0501069_0103529_488_985 | 148 |
| 839 | 3300050513 | nmdc:mga0rr50_479314_c1 | nmdc:mga0rr50_479314_c1_297_812 | 148 |
| 840 | 3300050516 | nmdc:mga0sz30_34731_c1 | nmdc:mga0sz30_34731_c1_1185_1667 | 148 |
| 841 | 3300005937 | Ga0081455_10194202 | Ga0081455_101942022 | 149 |
| 842 | 3300020069 | Ga0197907_10728872 | Ga0197907_107288722 | 149 |
| 843 | 3300020077 | Ga0206351_10173414 | Ga0206351_101734143 | 149 |
| 844 | 3300020080 | Ga0206350_11614803 | Ga0206350_116148032 | 149 |
| 845 | 3300020081 | Ga0206354_10424931 | Ga0206354_104249312 | 149 |
| 846 | 3300020082 | Ga0206353_10555370 | Ga0206353_105553703 | 149 |
| 847 | 3300022467 | Ga0224712_10020064 | Ga0224712_100200643 | 149 |
| 848 | 3300025917 | Ga0207660_10320012 | Ga0207660_103200122 | 149 |
| 849 | 3300026075 | Ga0207708_10258951 | Ga0207708_102589512 | 149 |
| 850 | 3300028379 | Ga0268266_10627677 | Ga0268266_106276772 | 149 |
| 851 | 3300044683 | Ga0466965_0258667 | Ga0466965_0258667_133_630 | 149 |
| 852 | 3300044694 | Ga0466963_0900181 | Ga0466963_0900181_83_580 | 149 |
| 853 | 3300044842 | Ga0466957_0018276 | Ga0466957_0018276_78_575 | 149 |
| 854 | 3300044842 | Ga0466957_0094201 | Ga0466957_0094201_10_507 | 149 |
| 855 | 3300045836 | Ga0466958_0002768 | Ga0466958_0002768_8272_8769 | 149 |
| 856 | 3300045976 | Ga0466967_0065799 | Ga0466967_0065799_1364_1861 | 149 |
| 857 | 3300061719 | Ga0466962_0028704 | Ga0466962_0028704_1860_2357 | 149 |
| 858 | 3300004799 | Ga0058863_11885469 | Ga0058863_118854692 | 150 |
| 859 | 3300004800 | Ga0058861_11963846 | Ga0058861_119638462 | 150 |
| 860 | 3300004803 | Ga0058862_12752443 | Ga0058862_127524433 | 150 |
| 861 | 3300005834 | Ga0068851_10021990 | Ga0068851_100219902 | 150 |
| 862 | 3300009147 | Ga0114129_10241311 | Ga0114129_102413114 | 150 |
| 863 | 3300010375 | Ga0105239_11304588 | Ga0105239_113045882 | 150 |
| 864 | 3300014497 | Ga0182008_10046941 | Ga0182008_100469412 | 150 |
| 865 | 3300017792 | Ga0163161_11233663 | Ga0163161_112336631 | 150 |
| 866 | 3300020076 | Ga0206355_1327778 | Ga0206355_13277782 | 150 |
| 867 | 3300025923 | Ga0207681_10704273 | Ga0207681_107042732 | 150 |
| 868 | 3300035086 | Ga0373934_0000025 | Ga0373934_0000025_45646_46125 | 150 |
| 869 | 3300035111 | Ga0373923_0004992 | Ga0373923_0004992_1444_1923 | 150 |
| 870 | 3300035113 | Ga0373936_0237260 | Ga0373936_0237260_121_600 | 150 |
| 871 | 3300035117 | Ga0373953_0002033 | Ga0373953_0002033_1192_1671 | 150 |
| 872 | 3300035118 | Ga0373954_0004039 | Ga0373954_0004039_2211_2690 | 150 |
| 873 | 3300035119 | Ga0373956_0000185 | Ga0373956_0000185_5545_6024 | 150 |
| 874 | 3300035120 | Ga0373957_0000293 | Ga0373957_0000293_2391_2870 | 150 |
| 875 | 3300035172 | Ga0373955_0000237 | Ga0373955_0000237_4550_5029 | 150 |
| 876 | 3300035410 | Ga0373924_0006427 | Ga0373924_0006427_2972_3451 | 150 |
| 877 | 3300035692 | Ga0373935_0199714 | Ga0373935_0199714_700_1179 | 150 |
| 878 | 3300035724 | Ga0373933_0000001 | Ga0373933_0000001_163350_163829 | 150 |
| 879 | 3300036401 | Ga0373937_0000087 | Ga0373937_0000087_43404_43883 | 150 |
| 880 | 3300037418 | Ga0395900_1304358 | Ga0395900_1304358_104_556 | 150 |
| 881 | 3300037466 | Ga0395898_1271121 | Ga0395898_1271121_48_500 | 150 |
| 882 | 3300042005 | Ga0439448_0005283 | Ga0439448_0005283_491_943 | 150 |
| 883 | 3300042008 | Ga0439450_169893 | Ga0439450_169893_114_566 | 150 |
| 884 | 3300042016 | Ga0439463_014614 | Ga0439463_014614_1095_1547 | 150 |
| 885 | 3300042157 | Ga0439458_0004896 | Ga0439458_0004896_427_879 | 150 |
| 886 | 3300042438 | Ga0439459_0032052 | Ga0439459_0032052_440_892 | 150 |
| 887 | 3300046454 | Ga0495592_0000002 | Ga0495592_0000002_163380_163859 | 150 |
| 888 | 3300046462 | Ga0495651_0000002 | Ga0495651_0000002_45635_46114 | 150 |
| 889 | 3300046463 | Ga0495653_0001815 | Ga0495653_0001815_5352_5831 | 150 |
| 890 | 3300046511 | Ga0495608_0000118 | Ga0495608_0000118_45650_46129 | 150 |
| 891 | 3300046516 | Ga0495628_0000103 | Ga0495628_0000103_40093_40572 | 150 |
| 892 | 3300046529 | Ga0495652_0000091 | Ga0495652_0000091_19327_19806 | 150 |
| 893 | 3300046536 | Ga0495587_0000013 | Ga0495587_0000013_149511_149990 | 150 |
| 894 | 3300046559 | Ga0495667_0000016 | Ga0495667_0000016_149516_149995 | 150 |
| 895 | 3300046675 | Ga0495657_0000014 | Ga0495657_0000014_45581_46060 | 150 |
| 896 | 3300046678 | Ga0495599_0000006 | Ga0495599_0000006_163798_164277 | 150 |
| 897 | 3300046679 | Ga0495623_0000537 | Ga0495623_0000537_4097_4576 | 150 |
| 898 | 3300046680 | Ga0495646_0005699 | Ga0495646_0005699_4605_5084 | 150 |
| 899 | 3300046809 | Ga0495600_0003129 | Ga0495600_0003129_4908_5387 | 150 |
| 900 | 3300047317 | Ga0495604_0000015 | Ga0495604_0000015_149497_149976 | 150 |
| 901 | 3300047322 | Ga0495680_0000380 | Ga0495680_0000380_45625_46104 | 150 |
| 902 | 3300047444 | Ga0495675_0000648 | Ga0495675_0000648_4260_4739 | 150 |
| 903 | 3300048088 | Ga0495602_0000013 | Ga0495602_0000013_149494_149973 | 150 |
| 904 | 3300048915 | Ga0496112_0209971 | Ga0496112_0209971_125_577 | 150 |
| 905 | 3300048915 | Ga0496112_0707271 | Ga0496112_0707271_15_467 | 150 |
| 906 | 3300050507 | nmdc:mga05p37_80286_c1 | nmdc:mga05p37_80286_c1_3111_3563 | 150 |
| 907 | 3300050514 | nmdc:mga08x19_41574_c1 | nmdc:mga08x19_41574_c1_2404_2856 | 150 |
| 908 | 3300053077 | Ga0495601_0061101 | Ga0495601_0061101_1046_1525 | 150 |
| 909 | 3300053084 | Ga0495595_0002322 | Ga0495595_0002322_3515_3994 | 150 |
| 910 | 3300005434 | Ga0070709_10095206 | Ga0070709_100952063 | 151 |
| 911 | 3300005436 | Ga0070713_100450429 | Ga0070713_1004504292 | 151 |
| 912 | 3300005439 | Ga0070711_100151929 | Ga0070711_1001519293 | 151 |
| 913 | 3300006173 | Ga0070716_100546892 | Ga0070716_1005468922 | 151 |
| 914 | 3300025906 | Ga0207699_10394798 | Ga0207699_103947982 | 151 |
| 915 | 3300025915 | Ga0207693_10219262 | Ga0207693_102192622 | 151 |
| 916 | 3300025916 | Ga0207663_10069925 | Ga0207663_100699252 | 151 |
| 917 | 3300025928 | Ga0207700_10255552 | Ga0207700_102555522 | 151 |
| 918 | 3300025929 | Ga0207664_10540273 | Ga0207664_105402732 | 151 |
| 919 | 3300025939 | Ga0207665_10208117 | Ga0207665_102081172 | 151 |
| 920 | 3300026078 | Ga0207702_10051266 | Ga0207702_100512664 | 151 |
| 921 | 3300035695 | Ga0373927_0615835 | Ga0373927_0615835_244_699 | 151 |
| 922 | 3300059641 | Ga0587068_097649 | Ga0587068_097649_13_474 | 151 |
| 923 | 3300005467 | Ga0070706_100518750 | Ga0070706_1005187501 | 152 |
| 924 | 3300005468 | Ga0070707_100212173 | Ga0070707_1002121732 | 152 |
| 925 | 3300025922 | Ga0207646_10271653 | Ga0207646_102716532 | 152 |
| 926 | 3300028666 | Ga0265336_10013779 | Ga0265336_100137792 | 152 |
| 927 | 3300028800 | Ga0265338_10001554 | Ga0265338_1000155410 | 152 |
| 928 | 3300037853 | Ga0436364_0024361 | Ga0436364_0024361_657_1136 | 152 |
| 929 | iso_pu_bacteria | 2687453743 | 2689990105 | 152 |
| 930 | 3300031903 | Ga0307407_10899419 | Ga0307407_108994192 | 154 |
| 931 | 3300001915 | JGI24741J21665_1013336 | JGI24741J21665_10133362 | 168 |
| 932 | 3300005327 | Ga0070658_10043896 | Ga0070658_100438962 | 168 |
| 933 | 3300005330 | Ga0070690_100062889 | Ga0070690_1000628892 | 168 |
| 934 | 3300005331 | Ga0070670_100003677 | Ga0070670_10000367710 | 168 |
| 935 | 3300005334 | Ga0068869_100001245 | Ga0068869_10000124511 | 168 |
| 936 | 3300005335 | Ga0070666_10060956 | Ga0070666_100609562 | 168 |
| 937 | 3300005336 | Ga0070680_100092433 | Ga0070680_1000924332 | 168 |
| 938 | 3300005337 | Ga0070682_100107994 | Ga0070682_1001079942 | 168 |
| 939 | 3300005338 | Ga0068868_100007359 | Ga0068868_1000073596 | 168 |
| 940 | 3300005339 | Ga0070660_100113719 | Ga0070660_1001137194 | 168 |
| 941 | 3300005341 | Ga0070691_10028714 | Ga0070691_100287142 | 168 |
| 942 | 3300005344 | Ga0070661_100534814 | Ga0070661_1005348142 | 168 |
| 943 | 3300005345 | Ga0070692_10002493 | Ga0070692_100024935 | 168 |
| 944 | 3300005354 | Ga0070675_100013556 | Ga0070675_1000135565 | 168 |
| 945 | 3300005355 | Ga0070671_100002954 | Ga0070671_10000295411 | 168 |
| 946 | 3300005364 | Ga0070673_100008126 | Ga0070673_1000081266 | 168 |
| 947 | 3300005440 | Ga0070705_100186024 | Ga0070705_1001860242 | 168 |
| 948 | 3300005441 | Ga0070700_100036519 | Ga0070700_1000365192 | 168 |
| 949 | 3300005455 | Ga0070663_100003424 | Ga0070663_1000034246 | 168 |
| 950 | 3300005456 | Ga0070678_100010655 | Ga0070678_1000106552 | 168 |
| 951 | 3300005457 | Ga0070662_100086108 | Ga0070662_1000861082 | 168 |
| 952 | 3300005458 | Ga0070681_10076299 | Ga0070681_100762993 | 168 |
| 953 | 3300005530 | Ga0070679_100679147 | Ga0070679_1006791472 | 168 |
| 954 | 3300005539 | Ga0068853_100408167 | Ga0068853_1004081672 | 168 |
| 955 | 3300005543 | Ga0070672_100416782 | Ga0070672_1004167822 | 168 |
| 956 | 3300005544 | Ga0070686_100276370 | Ga0070686_1002763701 | 168 |
| 957 | 3300005546 | Ga0070696_100718182 | Ga0070696_1007181821 | 168 |
| 958 | 3300005547 | Ga0070693_100179727 | Ga0070693_1001797272 | 168 |
| 959 | 3300005578 | Ga0068854_100047428 | Ga0068854_1000474282 | 168 |
| 960 | 3300005615 | Ga0070702_100002847 | Ga0070702_1000028476 | 168 |
| 961 | 3300005616 | Ga0068852_100064041 | Ga0068852_1000640412 | 168 |
| 962 | 3300005617 | Ga0068859_100071646 | Ga0068859_1000716462 | 168 |
| 963 | 3300005618 | Ga0068864_100178627 | Ga0068864_1001786273 | 168 |
| 964 | 3300005719 | Ga0068861_100727552 | Ga0068861_1007275521 | 168 |
| 965 | 3300005840 | Ga0068870_10001037 | Ga0068870_1000103710 | 168 |
| 966 | 3300005841 | Ga0068863_100006203 | Ga0068863_10000620311 | 168 |
| 967 | 3300005842 | Ga0068858_100048458 | Ga0068858_1000484583 | 168 |
| 968 | 3300005843 | Ga0068860_100614801 | Ga0068860_1006148012 | 168 |
| 969 | 3300006237 | Ga0097621_100006415 | Ga0097621_1000064157 | 168 |
| 970 | 3300006844 | Ga0075428_100111063 | Ga0075428_1001110632 | 168 |
| 971 | 3300006847 | Ga0075431_100049848 | Ga0075431_1000498484 | 168 |
| 972 | 3300006852 | Ga0075433_10005579 | Ga0075433_100055796 | 168 |
| 973 | 3300006871 | Ga0075434_100002856 | Ga0075434_10000285613 | 168 |
| 974 | 3300006880 | Ga0075429_100453458 | Ga0075429_1004534582 | 168 |
| 975 | 3300006881 | Ga0068865_100363383 | Ga0068865_1003633832 | 168 |
| 976 | 3300006914 | Ga0075436_100002169 | Ga0075436_1000021692 | 168 |
| 977 | 3300006931 | Ga0097620_100071648 | Ga0097620_1000716485 | 168 |
| 978 | 3300007076 | Ga0075435_100006462 | Ga0075435_1000064627 | 168 |
| 979 | 3300009011 | Ga0105251_10008366 | Ga0105251_100083663 | 168 |
| 980 | 3300009093 | Ga0105240_11127137 | Ga0105240_111271372 | 168 |
| 981 | 3300009094 | Ga0111539_10017516 | Ga0111539_100175168 | 168 |
| 982 | 3300009098 | Ga0105245_10075606 | Ga0105245_100756062 | 168 |
| 983 | 3300009148 | Ga0105243_10144836 | Ga0105243_101448362 | 168 |
| 984 | 3300009174 | Ga0105241_10092283 | Ga0105241_100922834 | 168 |
| 985 | 3300009177 | Ga0105248_10054024 | Ga0105248_100540242 | 168 |
| 986 | 3300009551 | Ga0105238_10199060 | Ga0105238_101990602 | 168 |
| 987 | 3300011119 | Ga0105246_10022876 | Ga0105246_100228766 | 168 |
| 988 | 3300013100 | Ga0157373_10070352 | Ga0157373_100703525 | 168 |
| 989 | 3300013102 | Ga0157371_10097728 | Ga0157371_100977282 | 168 |
| 990 | 3300013104 | Ga0157370_10025448 | Ga0157370_100254486 | 168 |
| 991 | 3300013105 | Ga0157369_10650809 | Ga0157369_106508092 | 168 |
| 992 | 3300013306 | Ga0163162_10396978 | Ga0163162_103969783 | 168 |
| 993 | 3300013307 | Ga0157372_10028842 | Ga0157372_100288426 | 168 |
| 994 | 3300013308 | Ga0157375_10219689 | Ga0157375_102196893 | 168 |
| 995 | 3300014968 | Ga0157379_10134130 | Ga0157379_101341302 | 168 |
| 996 | 3300014969 | Ga0157376_10066159 | Ga0157376_100661594 | 168 |
| 997 | 3300020069 | Ga0197907_10866496 | Ga0197907_108664963 | 168 |
| 998 | 3300020070 | Ga0206356_10355133 | Ga0206356_103551334 | 168 |
| 999 | 3300020075 | Ga0206349_1425530 | Ga0206349_14255302 | 168 |
| 1000 | 3300020077 | Ga0206351_10323992 | Ga0206351_103239925 | 168 |
| 1001 | 3300020078 | Ga0206352_10126105 | Ga0206352_101261055 | 168 |
| 1002 | 3300020080 | Ga0206350_10125668 | Ga0206350_101256682 | 168 |
| 1003 | 3300020082 | Ga0206353_11189061 | Ga0206353_111890612 | 168 |
| 1004 | 3300025901 | Ga0207688_10018768 | Ga0207688_100187684 | 168 |
| 1005 | 3300025903 | Ga0207680_10192755 | Ga0207680_101927552 | 168 |
| 1006 | 3300025907 | Ga0207645_10091949 | Ga0207645_100919492 | 168 |
| 1007 | 3300025908 | Ga0207643_10002076 | Ga0207643_1000207610 | 168 |
| 1008 | 3300025909 | Ga0207705_10111512 | Ga0207705_101115122 | 168 |
| 1009 | 3300025911 | Ga0207654_10011248 | Ga0207654_100112485 | 168 |
| 1010 | 3300025912 | Ga0207707_10040361 | Ga0207707_100403613 | 168 |
| 1011 | 3300025913 | Ga0207695_10673985 | Ga0207695_106739852 | 168 |
| 1012 | 3300025914 | Ga0207671_10103889 | Ga0207671_101038893 | 168 |
| 1013 | 3300025917 | Ga0207660_10051770 | Ga0207660_100517704 | 168 |
| 1014 | 3300025918 | Ga0207662_10151718 | Ga0207662_101517182 | 168 |
| 1015 | 3300025920 | Ga0207649_10002292 | Ga0207649_1000229210 | 168 |
| 1016 | 3300025921 | Ga0207652_10005388 | Ga0207652_1000538810 | 168 |
| 1017 | 3300025925 | Ga0207650_10002863 | Ga0207650_1000286310 | 168 |
| 1018 | 3300025926 | Ga0207659_10028015 | Ga0207659_100280153 | 168 |
| 1019 | 3300025931 | Ga0207644_10005580 | Ga0207644_100055804 | 168 |
| 1020 | 3300025932 | Ga0207690_10061333 | Ga0207690_100613332 | 168 |
| 1021 | 3300025933 | Ga0207706_10023491 | Ga0207706_100234916 | 168 |
| 1022 | 3300025934 | Ga0207686_10385770 | Ga0207686_103857701 | 168 |
| 1023 | 3300025936 | Ga0207670_10036590 | Ga0207670_100365902 | 168 |
| 1024 | 3300025940 | Ga0207691_10155897 | Ga0207691_101558972 | 168 |
| 1025 | 3300025942 | Ga0207689_10000187 | Ga0207689_1000018727 | 168 |
| 1026 | 3300025944 | Ga0207661_10007069 | Ga0207661_100070697 | 168 |
| 1027 | 3300025945 | Ga0207679_10003356 | Ga0207679_100033566 | 168 |
| 1028 | 3300025949 | Ga0207667_10464664 | Ga0207667_104646642 | 168 |
| 1029 | 3300025981 | Ga0207640_10691655 | Ga0207640_106916552 | 168 |
| 1030 | 3300026023 | Ga0207677_10029455 | Ga0207677_100294553 | 168 |
| 1031 | 3300026035 | Ga0207703_10151595 | Ga0207703_101515953 | 168 |
| 1032 | 3300026041 | Ga0207639_10086732 | Ga0207639_100867322 | 168 |
| 1033 | 3300026067 | Ga0207678_10001304 | Ga0207678_100013048 | 168 |
| 1034 | 3300026078 | Ga0207702_10035607 | Ga0207702_100356072 | 168 |
| 1035 | 3300026088 | Ga0207641_10012905 | Ga0207641_100129058 | 168 |
| 1036 | 3300026095 | Ga0207676_10004752 | Ga0207676_100047524 | 168 |
| 1037 | 3300026121 | Ga0207683_10003495 | Ga0207683_100034956 | 168 |
| 1038 | 3300026142 | Ga0207698_10011335 | Ga0207698_100113353 | 168 |
| 1039 | 3300027907 | Ga0207428_10030086 | Ga0207428_100300866 | 168 |
| 1040 | 3300028379 | Ga0268266_10091196 | Ga0268266_100911963 | 168 |
| 1041 | 3300028381 | Ga0268264_10415167 | Ga0268264_104151672 | 168 |
| 1042 | 3300038443 | Ga0395901_1310911 | Ga0395901_1310911_33_575 | 168 |
| 1043 | 3300048903 | Ga0496100_0040429 | Ga0496100_0040429_2415_2957 | 168 |
| 1044 | 3300048904 | Ga0496101_0098276 | Ga0496101_0098276_315_857 | 168 |
| 1045 | 3300048905 | Ga0496102_0028415 | Ga0496102_0028415_2701_3243 | 168 |
| 1046 | 3300048907 | Ga0496104_0016929 | Ga0496104_0016929_1016_1558 | 168 |
| 1047 | 3300048908 | Ga0496105_0018189 | Ga0496105_0018189_2523_3065 | 168 |
| 1048 | 3300048909 | Ga0496106_0145691 | Ga0496106_0145691_308_850 | 168 |
| 1049 | 3300048910 | Ga0496107_0021477 | Ga0496107_0021477_222_764 | 168 |
| 1050 | 3300048911 | Ga0496108_0012162 | Ga0496108_0012162_2477_3019 | 168 |
| 1051 | 3300048913 | Ga0496110_0021491 | Ga0496110_0021491_4306_4848 | 168 |
| 1052 | 3300048914 | Ga0496111_0003662 | Ga0496111_0003662_1673_2215 | 168 |
| 1053 | 3300048918 | Ga0496115_0484963 | Ga0496115_0484963_364_906 | 168 |
| 1054 | 3300050508 | nmdc:mga09592_109785_c1 | nmdc:mga09592_109785_c1_1672_2214 | 168 |
| 1055 | 3300050510 | nmdc:mga06r32_407330_c1 | nmdc:mga06r32_407330_c1_243_785 | 168 |
| 1056 | 3300050512 | nmdc:mga0n895_16639_c1 | nmdc:mga0n895_16639_c1_3429_3971 | 168 |
| 1057 | 3300050513 | nmdc:mga0rr50_57179_c1 | nmdc:mga0rr50_57179_c1_774_1316 | 168 |
| 1058 | 3300050515 | nmdc:mga0a205_10407_c1 | nmdc:mga0a205_10407_c1_2238_2780 | 168 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6jzw-assembly4.cif.gz_D | crystal structure of sufu from bacillus subtilis with cys persulfurated | 0.9592 | 3 | 138 |
| 8odq-assembly1.cif.gz_C | sufs-sufu complex from mycobacterium tuberculosis | 0.9499 | 2 | 144 |
| 2qq4-assembly2.cif.gz_D | crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8 | 0.9466 | 1 | 138 |
| 6jzw-assembly3.cif.gz_C | crystal structure of sufu from bacillus subtilis with cys persulfurated | 0.9428 | 3 | 141 |
| 6jzw-assembly2.cif.gz_B | crystal structure of sufu from bacillus subtilis with cys persulfurated | 0.9354 | 3 | 138 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53156_2_157_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.993 | 2 | 152 | 3.90.1010.10 |
| 2qq4B00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9611 | 1 | 139 | 3.90.1010.10 |
| af_O53156_2_157_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9552 | 2 | 152 | 3.90.1010.10 |
| 2qq4B00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9475 | 1 | 139 | 3.90.1010.10 |
| 5xt5C00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9034 | 2 | 138 | 3.90.1010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y9RW40-F1-model_v4 | Nitrogen fixation NifU-like protein | 0.9946 | 3 | 149 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A7Y9AVG4-F1-model_v4 | Nitrogen fixation NifU-like protein | 0.9933 | 6 | 142 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A1Q7AXU5-F1-model_v4 | SUF system NifU family Fe-S cluster assembly protein | 0.9931 | 1 | 149 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A5B1M9N4-F1-model_v4 | SUF system NifU family Fe-S cluster assembly protein | 0.993 | 3 | 143 |
GO:0005506
GO:0016226 GO:0051536 |
| AF-A0A1X0DFB0-F1-model_v4 | SUF system NifU family Fe-S cluster assembly protein | 0.9928 | 1 | 152 |
GO:0005506
GO:0016226 GO:0051536 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar