F489157
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1055 | 446 | 2110 | 98 |
Family's Representative Sequence
| Representative Sequence | 3300031507|Ga0307509_10512516|Ga0307509_105125162 |
| Length | 120 |
| Sequence | LEHGAFSPSFSLSERLTEVISQVYVGALTLDLLLGDVRSLKQKRSVIRPIVAEVQKRFPAVAVAETGENDLHRRAEIGVAVVSATADNCTHVLDACERLVAGRPEIELLSARQRLYNDED |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 100 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 118 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 119 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 120 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 121 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 122 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 123 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 124 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 125 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 126 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 139 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 148 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 154 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 155 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 222 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 223 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 224 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 226 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 228 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300030886 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 238 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 239 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 240 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 241 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 242 | 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 243 | 3300031678 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 244 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 245 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 246 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 247 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 248 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 249 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 250 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 251 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 252 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 253 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 254 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 255 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 257 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 260 | 3300033548 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 | Metagenome | Unclassified |
| 261 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 262 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 263 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 264 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 265 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 266 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 269 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 273 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 274 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 276 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 277 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 279 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 286 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 287 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 288 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 289 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 290 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 291 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 292 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 293 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 296 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 297 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 298 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 299 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 301 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 302 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 303 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 304 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 305 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 306 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 307 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 308 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 309 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 310 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 311 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 312 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 313 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 314 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 315 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 316 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 317 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 318 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 319 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 320 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 321 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 322 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 323 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 324 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 325 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 326 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 327 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 328 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 329 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 330 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 331 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 332 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 333 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 380 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 382 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 383 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 384 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 385 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 386 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 387 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 390 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 391 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 392 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 393 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 394 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 395 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 396 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 397 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 428 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 438 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 439 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 440 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 441 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 442 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 443 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 444 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 445 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 446 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.89 |
| Metatranscriptomes | 6.35 |
| Isolates | 0.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.19 |
| Nodule | 0.09 |
| Rhizoplane | 4.27 |
| Rhizosphere | 91.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307509_10512516 | 3300031507 | Bacteria | 882 |
| 2 | JGI24735J21928_10171235 | 3300002067 | Bacteria | 628 |
| 3 | JGI24738J21930_10061658 | 3300002075 | Bacteria | 771 |
| 4 | JGI25406J46586_10019691 | 3300003203 | Bacteria | 2743 |
| 5 | JGI25404J52841_10003154 | 3300003659 | Bacteria | 3225 |
| 6 | Ga0058861_10050548 | 3300004800 | Bacteria | 976 |
| 7 | Ga0070658_10077399 | 3300005327 | Bacteria | 2728 |
| 8 | Ga0070658_10114670 | 3300005327 | Bacteria | 2235 |
| 9 | Ga0070658_10186243 | 3300005327 | Bacteria | 1748 |
| 10 | Ga0070676_10058660 | 3300005328 | Bacteria | 2281 |
| 11 | Ga0070676_10065461 | 3300005328 | Bacteria | 2170 |
| 12 | Ga0070683_100161126 | 3300005329 | Bacteria | 2128 |
| 13 | Ga0070683_101712378 | 3300005329 | Bacteria | 604 |
| 14 | Ga0070683_101842019 | 3300005329 | Bacteria | 582 |
| 15 | Ga0070690_100141844 | 3300005330 | Bacteria | 1631 |
| 16 | Ga0070670_101109341 | 3300005331 | Bacteria | 722 |
| 17 | Ga0068869_100047053 | 3300005334 | Bacteria | 3113 |
| 18 | Ga0068869_100261280 | 3300005334 | Bacteria | 1386 |
| 19 | Ga0068869_101862294 | 3300005334 | Bacteria | 539 |
| 20 | Ga0070666_10233102 | 3300005335 | Bacteria | 1300 |
| 21 | Ga0070680_100099306 | 3300005336 | Bacteria | 2415 |
| 22 | Ga0070680_100165816 | 3300005336 | Bacteria | 1857 |
| 23 | Ga0070680_100166878 | 3300005336 | Bacteria | 1851 |
| 24 | Ga0070680_100313519 | 3300005336 | Bacteria | 1331 |
| 25 | Ga0070680_101215661 | 3300005336 | Bacteria | 652 |
| 26 | Ga0070682_100295980 | 3300005337 | Bacteria | 1185 |
| 27 | Ga0068868_100129961 | 3300005338 | Bacteria | 2060 |
| 28 | Ga0070660_100335015 | 3300005339 | Bacteria | 1244 |
| 29 | Ga0070660_100420630 | 3300005339 | Bacteria | 1106 |
| 30 | Ga0070660_101601751 | 3300005339 | Bacteria | 554 |
| 31 | Ga0070691_10018094 | 3300005341 | Bacteria | 3245 |
| 32 | Ga0070691_10495152 | 3300005341 | Bacteria | 705 |
| 33 | Ga0070691_10645624 | 3300005341 | Bacteria | 629 |
| 34 | Ga0070691_10679883 | 3300005341 | Bacteria | 616 |
| 35 | Ga0070687_100086341 | 3300005343 | Bacteria | 1724 |
| 36 | Ga0070661_100301453 | 3300005344 | Bacteria | 1247 |
| 37 | Ga0070661_100979072 | 3300005344 | Bacteria | 701 |
| 38 | Ga0070692_10081597 | 3300005345 | Bacteria | 1743 |
| 39 | Ga0070668_100809478 | 3300005347 | Bacteria | 833 |
| 40 | Ga0070668_101200930 | 3300005347 | Bacteria | 687 |
| 41 | Ga0070669_100668835 | 3300005353 | Bacteria | 875 |
| 42 | Ga0070675_100138246 | 3300005354 | Bacteria | 2080 |
| 43 | Ga0070675_100289066 | 3300005354 | Bacteria | 1442 |
| 44 | Ga0070671_100097211 | 3300005355 | Bacteria | 2469 |
| 45 | Ga0070674_100045756 | 3300005356 | Bacteria | 2990 |
| 46 | Ga0070673_100026214 | 3300005364 | Bacteria | 4302 |
| 47 | Ga0070673_100064467 | 3300005364 | Bacteria | 2919 |
| 48 | Ga0070688_100570252 | 3300005365 | Bacteria | 863 |
| 49 | Ga0070659_100258234 | 3300005366 | Bacteria | 1445 |
| 50 | Ga0070659_101824341 | 3300005366 | Bacteria | 545 |
| 51 | Ga0070667_100019139 | 3300005367 | Bacteria | 5678 |
| 52 | Ga0070667_100239569 | 3300005367 | Bacteria | 1619 |
| 53 | Ga0070667_100350887 | 3300005367 | Bacteria | 1336 |
| 54 | Ga0070667_101312960 | 3300005367 | Unclassified | 678 |
| 55 | Ga0070709_10019091 | 3300005434 | Bacteria | 3956 |
| 56 | Ga0070709_10053195 | 3300005434 | Bacteria | 2548 |
| 57 | Ga0070709_10090988 | 3300005434 | Bacteria | 2013 |
| 58 | Ga0070709_10132410 | 3300005434 | Bacteria | 1704 |
| 59 | Ga0070709_10250614 | 3300005434 | Bacteria | 1275 |
| 60 | Ga0070714_100011051 | 3300005435 | Bacteria | 7153 |
| 61 | Ga0070714_100059588 | 3300005435 | Bacteria | 3274 |
| 62 | Ga0070714_100370473 | 3300005435 | Bacteria | 1348 |
| 63 | Ga0070714_100496692 | 3300005435 | Bacteria | 1163 |
| 64 | Ga0070714_100715931 | 3300005435 | Bacteria | 966 |
| 65 | Ga0070713_100219475 | 3300005436 | Bacteria | 1724 |
| 66 | Ga0070713_100246184 | 3300005436 | Bacteria | 1629 |
| 67 | Ga0070713_100263298 | 3300005436 | Bacteria | 1576 |
| 68 | Ga0070713_100460589 | 3300005436 | Bacteria | 1195 |
| 69 | Ga0070713_100610859 | 3300005436 | Bacteria | 1036 |
| 70 | Ga0070713_101567903 | 3300005436 | Bacteria | 639 |
| 71 | Ga0070710_10050534 | 3300005437 | Bacteria | 2331 |
| 72 | Ga0070710_10798997 | 3300005437 | Bacteria | 674 |
| 73 | Ga0070710_10823778 | 3300005437 | Bacteria | 664 |
| 74 | Ga0070710_10935656 | 3300005437 | Bacteria | 628 |
| 75 | Ga0070701_10101501 | 3300005438 | Bacteria | 1594 |
| 76 | Ga0070711_100017485 | 3300005439 | Bacteria | 4566 |
| 77 | Ga0070711_100275335 | 3300005439 | Bacteria | 1329 |
| 78 | Ga0070711_101151724 | 3300005439 | Bacteria | 669 |
| 79 | Ga0070705_100063130 | 3300005440 | Bacteria | 2208 |
| 80 | Ga0070705_100251841 | 3300005440 | Bacteria | 1240 |
| 81 | Ga0070700_100471614 | 3300005441 | Bacteria | 960 |
| 82 | Ga0070708_100134599 | 3300005445 | Bacteria | 2288 |
| 83 | Ga0070708_100392108 | 3300005445 | Bacteria | 1309 |
| 84 | Ga0070708_100585813 | 3300005445 | Bacteria | 1052 |
| 85 | Ga0070708_101328181 | 3300005445 | Bacteria | 671 |
| 86 | Ga0070663_100114507 | 3300005455 | Bacteria | 2030 |
| 87 | Ga0070663_100217590 | 3300005455 | Bacteria | 1498 |
| 88 | Ga0070663_100363354 | 3300005455 | Bacteria | 1175 |
| 89 | Ga0070663_100831765 | 3300005455 | Bacteria | 793 |
| 90 | Ga0070678_100208896 | 3300005456 | Bacteria | 1616 |
| 91 | Ga0070678_100982960 | 3300005456 | Bacteria | 775 |
| 92 | Ga0070662_100429005 | 3300005457 | Bacteria | 1095 |
| 93 | Ga0070681_10024013 | 3300005458 | Bacteria | 6138 |
| 94 | Ga0070681_10154212 | 3300005458 | Bacteria | 2222 |
| 95 | Ga0070681_10535082 | 3300005458 | Bacteria | 1085 |
| 96 | Ga0070681_11176724 | 3300005458 | Bacteria | 688 |
| 97 | Ga0070681_11379844 | 3300005458 | Bacteria | 628 |
| 98 | Ga0068867_100118995 | 3300005459 | Bacteria | 2039 |
| 99 | Ga0070685_10015250 | 3300005466 | Bacteria | 4080 |
| 100 | Ga0070685_10098587 | 3300005466 | Bacteria | 1781 |
| 101 | Ga0070706_100022829 | 3300005467 | Bacteria | 5762 |
| 102 | Ga0070706_100070425 | 3300005467 | Bacteria | 3234 |
| 103 | Ga0070706_100120420 | 3300005467 | Bacteria | 2446 |
| 104 | Ga0070706_100366837 | 3300005467 | Bacteria | 1342 |
| 105 | Ga0070706_100798841 | 3300005467 | Bacteria | 873 |
| 106 | Ga0070706_100938481 | 3300005467 | Bacteria | 799 |
| 107 | Ga0070706_101173309 | 3300005467 | Bacteria | 706 |
| 108 | Ga0070706_101246952 | 3300005467 | Bacteria | 682 |
| 109 | Ga0070707_100036268 | 3300005468 | Bacteria | 4704 |
| 110 | Ga0070707_100043862 | 3300005468 | Bacteria | 4281 |
| 111 | Ga0070707_100158400 | 3300005468 | Bacteria | 2205 |
| 112 | Ga0070707_100185126 | 3300005468 | Bacteria | 2030 |
| 113 | Ga0070707_100746985 | 3300005468 | Bacteria | 942 |
| 114 | Ga0070707_101944430 | 3300005468 | Bacteria | 556 |
| 115 | Ga0070698_100003439 | 3300005471 | Bacteria | 17407 |
| 116 | Ga0070698_100034744 | 3300005471 | Bacteria | 5216 |
| 117 | Ga0070698_100087214 | 3300005471 | Bacteria | 3107 |
| 118 | Ga0070698_100385190 | 3300005471 | Bacteria | 1335 |
| 119 | Ga0070698_101726626 | 3300005471 | Bacteria | 578 |
| 120 | Ga0070699_100010810 | 3300005518 | Bacteria | 7899 |
| 121 | Ga0070699_100245834 | 3300005518 | Bacteria | 1598 |
| 122 | Ga0070699_100600042 | 3300005518 | Bacteria | 1004 |
| 123 | Ga0070679_100081061 | 3300005530 | Bacteria | 3234 |
| 124 | Ga0070679_100164457 | 3300005530 | Bacteria | 2193 |
| 125 | Ga0070684_100058031 | 3300005535 | Bacteria | 3381 |
| 126 | Ga0070684_100058098 | 3300005535 | Bacteria | 3379 |
| 127 | Ga0070684_101405717 | 3300005535 | Bacteria | 657 |
| 128 | Ga0070684_101637431 | 3300005535 | Bacteria | 607 |
| 129 | Ga0070684_101784621 | 3300005535 | Bacteria | 580 |
| 130 | Ga0070684_101784657 | 3300005535 | Bacteria | 580 |
| 131 | Ga0070697_100006581 | 3300005536 | Bacteria | 9005 |
| 132 | Ga0070697_100355688 | 3300005536 | Bacteria | 1265 |
| 133 | Ga0070697_101614871 | 3300005536 | Bacteria | 580 |
| 134 | Ga0068853_100071201 | 3300005539 | Bacteria | 3027 |
| 135 | Ga0068853_100294422 | 3300005539 | Bacteria | 1499 |
| 136 | Ga0068853_100304730 | 3300005539 | Bacteria | 1473 |
| 137 | Ga0068853_102125664 | 3300005539 | Bacteria | 544 |
| 138 | Ga0070672_100188568 | 3300005543 | Bacteria | 1721 |
| 139 | Ga0070686_100077111 | 3300005544 | Bacteria | 2196 |
| 140 | Ga0070686_100655243 | 3300005544 | Bacteria | 833 |
| 141 | Ga0070695_100166365 | 3300005545 | Bacteria | 1552 |
| 142 | Ga0070695_100731917 | 3300005545 | Bacteria | 787 |
| 143 | Ga0070696_100649300 | 3300005546 | Bacteria | 855 |
| 144 | Ga0070693_100440758 | 3300005547 | Bacteria | 912 |
| 145 | Ga0070693_100541611 | 3300005547 | Bacteria | 832 |
| 146 | Ga0070693_101163821 | 3300005547 | Bacteria | 591 |
| 147 | Ga0070693_101504710 | 3300005547 | Bacteria | 526 |
| 148 | Ga0070665_100012829 | 3300005548 | Bacteria | 8437 |
| 149 | Ga0070665_100212346 | 3300005548 | Bacteria | 1936 |
| 150 | Ga0070665_100224452 | 3300005548 | Bacteria | 1879 |
| 151 | Ga0070665_100266041 | 3300005548 | Bacteria | 1716 |
| 152 | Ga0070665_100649471 | 3300005548 | Bacteria | 1068 |
| 153 | Ga0070665_101885337 | 3300005548 | Bacteria | 604 |
| 154 | Ga0070704_100195860 | 3300005549 | Bacteria | 1627 |
| 155 | Ga0070704_100745863 | 3300005549 | Bacteria | 871 |
| 156 | Ga0070704_102204589 | 3300005549 | Bacteria | 512 |
| 157 | Ga0068855_100021107 | 3300005563 | Bacteria | 7809 |
| 158 | Ga0068855_100565603 | 3300005563 | Bacteria | 1229 |
| 159 | Ga0070664_100029287 | 3300005564 | Bacteria | 4590 |
| 160 | Ga0068857_100036487 | 3300005577 | Bacteria | 4355 |
| 161 | Ga0068857_101223864 | 3300005577 | Bacteria | 727 |
| 162 | Ga0068857_101223865 | 3300005577 | Bacteria | 727 |
| 163 | Ga0068857_102019311 | 3300005577 | Bacteria | 565 |
| 164 | Ga0068854_100004751 | 3300005578 | Bacteria | 8566 |
| 165 | Ga0068854_100054440 | 3300005578 | Bacteria | 2877 |
| 166 | Ga0068854_100443282 | 3300005578 | Bacteria | 1083 |
| 167 | Ga0068856_100182790 | 3300005614 | Bacteria | 2110 |
| 168 | Ga0068856_100366862 | 3300005614 | Bacteria | 1459 |
| 169 | Ga0068856_101485615 | 3300005614 | Bacteria | 692 |
| 170 | Ga0068856_101498163 | 3300005614 | Bacteria | 688 |
| 171 | Ga0070702_100173298 | 3300005615 | Bacteria | 1405 |
| 172 | Ga0068852_100198342 | 3300005616 | Bacteria | 1898 |
| 173 | Ga0068852_100261919 | 3300005616 | Bacteria | 1660 |
| 174 | Ga0068852_101881100 | 3300005616 | Bacteria | 621 |
| 175 | Ga0068859_100247012 | 3300005617 | Bacteria | 1874 |
| 176 | Ga0068864_100481548 | 3300005618 | Bacteria | 1191 |
| 177 | Ga0068864_100763173 | 3300005618 | Bacteria | 948 |
| 178 | Ga0068864_100836027 | 3300005618 | Bacteria | 906 |
| 179 | Ga0068866_10012061 | 3300005718 | Bacteria | 3759 |
| 180 | Ga0068861_100009787 | 3300005719 | Bacteria | 6629 |
| 181 | Ga0068861_100086090 | 3300005719 | Bacteria | 2470 |
| 182 | Ga0068851_10388673 | 3300005834 | Bacteria | 819 |
| 183 | Ga0068870_10155348 | 3300005840 | Bacteria | 1351 |
| 184 | Ga0068863_100015044 | 3300005841 | Bacteria | 7434 |
| 185 | Ga0068863_101390278 | 3300005841 | Bacteria | 710 |
| 186 | Ga0068858_100979082 | 3300005842 | Bacteria | 828 |
| 187 | Ga0068858_101406035 | 3300005842 | Unclassified | 687 |
| 188 | Ga0068860_100293470 | 3300005843 | Bacteria | 1591 |
| 189 | Ga0068862_100149526 | 3300005844 | Bacteria | 2078 |
| 190 | Ga0081455_10012907 | 3300005937 | Bacteria | 8289 |
| 191 | Ga0081455_10941865 | 3300005937 | Bacteria | 536 |
| 192 | Ga0081540_1000009 | 3300005983 | Bacteria | 193562 |
| 193 | Ga0081540_1006532 | 3300005983 | Bacteria | 8470 |
| 194 | Ga0081539_10000846 | 3300005985 | Bacteria | 58555 |
| 195 | Ga0070717_10133729 | 3300006028 | Bacteria | 2134 |
| 196 | Ga0070717_10206461 | 3300006028 | Bacteria | 1723 |
| 197 | Ga0070717_10446015 | 3300006028 | Bacteria | 1166 |
| 198 | Ga0070717_11219293 | 3300006028 | Bacteria | 685 |
| 199 | Ga0070717_11565673 | 3300006028 | Bacteria | 597 |
| 200 | Ga0075365_11043605 | 3300006038 | Bacteria | 576 |
| 201 | Ga0075432_10117156 | 3300006058 | Bacteria | 997 |
| 202 | Ga0070715_10029477 | 3300006163 | Bacteria | 2210 |
| 203 | Ga0070715_10058976 | 3300006163 | Bacteria | 1677 |
| 204 | Ga0070715_10084267 | 3300006163 | Bacteria | 1449 |
| 205 | Ga0070715_10165799 | 3300006163 | Bacteria | 1096 |
| 206 | Ga0070716_100289285 | 3300006173 | Bacteria | 1134 |
| 207 | Ga0070716_100455620 | 3300006173 | Bacteria | 933 |
| 208 | Ga0070716_100463002 | 3300006173 | Bacteria | 927 |
| 209 | Ga0070716_100478888 | 3300006173 | Bacteria | 914 |
| 210 | Ga0070716_100581283 | 3300006173 | Bacteria | 840 |
| 211 | Ga0070716_100642510 | 3300006173 | Bacteria | 803 |
| 212 | Ga0070712_100013903 | 3300006175 | Bacteria | 5154 |
| 213 | Ga0070712_100169901 | 3300006175 | Bacteria | 1691 |
| 214 | Ga0070712_100273404 | 3300006175 | Bacteria | 1358 |
| 215 | Ga0070712_100540101 | 3300006175 | Bacteria | 981 |
| 216 | Ga0070712_100721144 | 3300006175 | Bacteria | 851 |
| 217 | Ga0070712_101585978 | 3300006175 | Bacteria | 572 |
| 218 | Ga0097621_100132185 | 3300006237 | Bacteria | 2125 |
| 219 | Ga0068871_100057615 | 3300006358 | Bacteria | 3161 |
| 220 | Ga0068871_100289812 | 3300006358 | Bacteria | 1434 |
| 221 | Ga0068871_100521945 | 3300006358 | Bacteria | 1073 |
| 222 | Ga0075428_100040546 | 3300006844 | Bacteria | 5122 |
| 223 | Ga0075428_100053163 | 3300006844 | Bacteria | 4438 |
| 224 | Ga0075430_100062344 | 3300006846 | Bacteria | 3133 |
| 225 | Ga0075430_101144205 | 3300006846 | Bacteria | 641 |
| 226 | Ga0075430_101404475 | 3300006846 | Bacteria | 574 |
| 227 | Ga0075431_100009154 | 3300006847 | Bacteria | 9930 |
| 228 | Ga0075431_100105695 | 3300006847 | Bacteria | 2904 |
| 229 | Ga0075431_102091081 | 3300006847 | Bacteria | 521 |
| 230 | Ga0075433_10286255 | 3300006852 | Bacteria | 1460 |
| 231 | Ga0075434_100363345 | 3300006871 | Bacteria | 1468 |
| 232 | Ga0075434_100474560 | 3300006871 | Bacteria | 1272 |
| 233 | Ga0075434_100850503 | 3300006871 | Bacteria | 928 |
| 234 | Ga0075434_101239176 | 3300006871 | Bacteria | 758 |
| 235 | Ga0075434_101655801 | 3300006871 | Bacteria | 648 |
| 236 | Ga0075429_100001463 | 3300006880 | Bacteria | 19406 |
| 237 | Ga0075429_100004985 | 3300006880 | Bacteria | 11437 |
| 238 | Ga0075429_100322444 | 3300006880 | Bacteria | 1352 |
| 239 | Ga0068865_100343106 | 3300006881 | Bacteria | 1208 |
| 240 | Ga0075436_100384904 | 3300006914 | Bacteria | 1015 |
| 241 | Ga0097620_100246999 | 3300006931 | Bacteria | 1874 |
| 242 | Ga0075435_100064873 | 3300007076 | Bacteria | 2968 |
| 243 | Ga0075435_101517807 | 3300007076 | Bacteria | 588 |
| 244 | Ga0099794_10157616 | 3300007265 | Bacteria | 1154 |
| 245 | Ga0099794_10281148 | 3300007265 | Bacteria | 860 |
| 246 | Ga0105251_10216133 | 3300009011 | Bacteria | 863 |
| 247 | Ga0105244_10446617 | 3300009036 | Bacteria | 595 |
| 248 | Ga0105244_10592447 | 3300009036 | Bacteria | 508 |
| 249 | Ga0105250_10193607 | 3300009092 | Bacteria | 856 |
| 250 | Ga0105240_10005049 | 3300009093 | Bacteria | 19797 |
| 251 | Ga0105240_10148595 | 3300009093 | Bacteria | 2793 |
| 252 | Ga0105240_10530028 | 3300009093 | Bacteria | 1306 |
| 253 | Ga0105240_11240616 | 3300009093 | Bacteria | 788 |
| 254 | Ga0111539_10095829 | 3300009094 | Bacteria | 3485 |
| 255 | Ga0111539_11937737 | 3300009094 | Bacteria | 683 |
| 256 | Ga0105245_10879852 | 3300009098 | Bacteria | 937 |
| 257 | Ga0105245_11491215 | 3300009098 | Bacteria | 727 |
| 258 | Ga0105245_11928268 | 3300009098 | Bacteria | 644 |
| 259 | Ga0105247_10030756 | 3300009101 | Bacteria | 3255 |
| 260 | Ga0105247_10093595 | 3300009101 | Bacteria | 1910 |
| 261 | Ga0105247_10241327 | 3300009101 | Bacteria | 1231 |
| 262 | Ga0105247_11565567 | 3300009101 | Unclassified | 540 |
| 263 | Ga0114129_10005490 | 3300009147 | Bacteria | 17924 |
| 264 | Ga0114129_10011782 | 3300009147 | Bacteria | 12442 |
| 265 | Ga0114129_10098006 | 3300009147 | Bacteria | 4058 |
| 266 | Ga0114129_10191923 | 3300009147 | Bacteria | 2773 |
| 267 | Ga0114129_10689696 | 3300009147 | Bacteria | 1314 |
| 268 | Ga0114129_11136350 | 3300009147 | Bacteria | 976 |
| 269 | Ga0114129_12307258 | 3300009147 | Bacteria | 646 |
| 270 | Ga0105243_10147129 | 3300009148 | Bacteria | 2017 |
| 271 | Ga0105243_10250905 | 3300009148 | Bacteria | 1580 |
| 272 | Ga0105243_10442798 | 3300009148 | Bacteria | 1217 |
| 273 | Ga0105241_10002864 | 3300009174 | Bacteria | 12889 |
| 274 | Ga0105241_10009338 | 3300009174 | Bacteria | 7209 |
| 275 | Ga0105241_10023035 | 3300009174 | Bacteria | 4617 |
| 276 | Ga0105241_11157959 | 3300009174 | Bacteria | 731 |
| 277 | Ga0105248_10099174 | 3300009177 | Bacteria | 3282 |
| 278 | Ga0105248_10133427 | 3300009177 | Bacteria | 2801 |
| 279 | Ga0105248_10535853 | 3300009177 | Bacteria | 1320 |
| 280 | Ga0105237_10006743 | 3300009545 | Bacteria | 12680 |
| 281 | Ga0105237_10883528 | 3300009545 | Bacteria | 901 |
| 282 | Ga0105237_11150672 | 3300009545 | Bacteria | 783 |
| 283 | Ga0105237_11975529 | 3300009545 | Bacteria | 592 |
| 284 | Ga0105238_10015348 | 3300009551 | Bacteria | 7757 |
| 285 | Ga0105238_10103318 | 3300009551 | Bacteria | 2831 |
| 286 | Ga0105238_10428255 | 3300009551 | Bacteria | 1319 |
| 287 | Ga0105238_10447601 | 3300009551 | Bacteria | 1288 |
| 288 | Ga0105238_11780418 | 3300009551 | Bacteria | 648 |
| 289 | Ga0105238_12356847 | 3300009551 | Bacteria | 568 |
| 290 | Ga0105249_10423985 | 3300009553 | Bacteria | 1365 |
| 291 | Ga0105249_10952638 | 3300009553 | Bacteria | 926 |
| 292 | Ga0099796_10208602 | 3300010159 | Bacteria | 796 |
| 293 | Ga0105239_10028184 | 3300010375 | Bacteria | 6178 |
| 294 | Ga0105239_10996700 | 3300010375 | Bacteria | 963 |
| 295 | Ga0105246_10003333 | 3300011119 | Bacteria | 9719 |
| 296 | Ga0105246_10067347 | 3300011119 | Bacteria | 2509 |
| 297 | Ga0105246_10261241 | 3300011119 | Bacteria | 1380 |
| 298 | Ga0157340_1005324 | 3300012473 | Bacteria | 774 |
| 299 | Ga0157346_1012257 | 3300012480 | Bacteria | 647 |
| 300 | Ga0157337_1002560 | 3300012483 | Bacteria | 1039 |
| 301 | Ga0157325_1012806 | 3300012485 | Bacteria | 652 |
| 302 | Ga0157343_1000771 | 3300012488 | Bacteria | 1390 |
| 303 | Ga0157322_1002597 | 3300012490 | Bacteria | 1032 |
| 304 | Ga0157323_1025849 | 3300012495 | Bacteria | 592 |
| 305 | Ga0157342_1010144 | 3300012507 | Bacteria | 959 |
| 306 | Ga0157315_1054815 | 3300012508 | Bacteria | 546 |
| 307 | Ga0157326_1023376 | 3300012513 | Bacteria | 777 |
| 308 | Ga0157373_10080944 | 3300013100 | Bacteria | 2290 |
| 309 | Ga0157371_10026186 | 3300013102 | Bacteria | 4241 |
| 310 | Ga0157371_10028526 | 3300013102 | Bacteria | 4041 |
| 311 | Ga0157371_11045684 | 3300013102 | Bacteria | 624 |
| 312 | Ga0157370_10096691 | 3300013104 | Bacteria | 2770 |
| 313 | Ga0157370_10166858 | 3300013104 | Bacteria | 2047 |
| 314 | Ga0157370_10415418 | 3300013104 | Bacteria | 1238 |
| 315 | Ga0157369_10087391 | 3300013105 | Bacteria | 3329 |
| 316 | Ga0157369_10192683 | 3300013105 | Bacteria | 2141 |
| 317 | Ga0157369_10193030 | 3300013105 | Bacteria | 2139 |
| 318 | Ga0157369_10207601 | 3300013105 | Bacteria | 2054 |
| 319 | Ga0157369_10371209 | 3300013105 | Bacteria | 1485 |
| 320 | Ga0157369_10421868 | 3300013105 | Bacteria | 1383 |
| 321 | Ga0157369_12107754 | 3300013105 | Bacteria | 572 |
| 322 | Ga0157374_10005049 | 3300013296 | Bacteria | 11068 |
| 323 | Ga0157374_10453645 | 3300013296 | Bacteria | 1284 |
| 324 | Ga0157374_10790396 | 3300013296 | Bacteria | 965 |
| 325 | Ga0157374_12339877 | 3300013296 | Bacteria | 562 |
| 326 | Ga0157378_10641435 | 3300013297 | Bacteria | 1077 |
| 327 | Ga0157378_11270692 | 3300013297 | Bacteria | 777 |
| 328 | Ga0163162_10460375 | 3300013306 | Bacteria | 1403 |
| 329 | Ga0163162_10496834 | 3300013306 | Bacteria | 1351 |
| 330 | Ga0157372_10333350 | 3300013307 | Bacteria | 1767 |
| 331 | Ga0157372_11307306 | 3300013307 | Bacteria | 837 |
| 332 | Ga0157375_10154278 | 3300013308 | Bacteria | 2434 |
| 333 | Ga0157375_10348756 | 3300013308 | Bacteria | 1646 |
| 334 | Ga0163163_10131321 | 3300014325 | Bacteria | 2545 |
| 335 | Ga0163163_10451334 | 3300014325 | Bacteria | 1346 |
| 336 | Ga0163163_10993766 | 3300014325 | Bacteria | 902 |
| 337 | Ga0163163_11099001 | 3300014325 | Bacteria | 858 |
| 338 | Ga0163163_11550685 | 3300014325 | Bacteria | 724 |
| 339 | Ga0163163_13301814 | 3300014325 | Bacteria | 503 |
| 340 | Ga0157380_10476799 | 3300014326 | Bacteria | 1206 |
| 341 | Ga0157380_10703348 | 3300014326 | Bacteria | 1016 |
| 342 | Ga0182008_10066425 | 3300014497 | Bacteria | 1775 |
| 343 | Ga0182008_10083900 | 3300014497 | Bacteria | 1569 |
| 344 | Ga0157377_10046061 | 3300014745 | Bacteria | 2438 |
| 345 | Ga0157377_11461876 | 3300014745 | Bacteria | 542 |
| 346 | Ga0157377_11670158 | 3300014745 | Bacteria | 513 |
| 347 | Ga0157379_10219414 | 3300014968 | Bacteria | 1723 |
| 348 | Ga0157379_10370864 | 3300014968 | Bacteria | 1312 |
| 349 | Ga0157379_10441890 | 3300014968 | Bacteria | 1199 |
| 350 | Ga0157376_10268229 | 3300014969 | Bacteria | 1602 |
| 351 | Ga0157376_10616184 | 3300014969 | Bacteria | 1082 |
| 352 | Ga0157376_10661613 | 3300014969 | Bacteria | 1046 |
| 353 | Ga0182005_1024683 | 3300015265 | Bacteria | 1641 |
| 354 | Ga0163161_10165684 | 3300017792 | Bacteria | 1687 |
| 355 | Ga0197907_10040213 | 3300020069 | Bacteria | 946 |
| 356 | Ga0197907_10134442 | 3300020069 | Bacteria | 3086 |
| 357 | Ga0197907_10239040 | 3300020069 | Bacteria | 1366 |
| 358 | Ga0197907_11079237 | 3300020069 | Bacteria | 1576 |
| 359 | Ga0197907_11202783 | 3300020069 | Bacteria | 1821 |
| 360 | Ga0197907_11233655 | 3300020069 | Bacteria | 1122 |
| 361 | Ga0206356_10024402 | 3300020070 | Bacteria | 2500 |
| 362 | Ga0206356_10473527 | 3300020070 | Bacteria | 1096 |
| 363 | Ga0206356_10750368 | 3300020070 | Bacteria | 677 |
| 364 | Ga0206356_10822231 | 3300020070 | Bacteria | 2273 |
| 365 | Ga0206356_10869480 | 3300020070 | Bacteria | 1182 |
| 366 | Ga0206356_11238138 | 3300020070 | Bacteria | 774 |
| 367 | Ga0206349_1452056 | 3300020075 | Bacteria | 2372 |
| 368 | Ga0206349_1676835 | 3300020075 | Bacteria | 1893 |
| 369 | Ga0206349_1737499 | 3300020075 | Bacteria | 1334 |
| 370 | Ga0206349_1774434 | 3300020075 | Bacteria | 550 |
| 371 | Ga0206355_1028181 | 3300020076 | Bacteria | 1011 |
| 372 | Ga0206355_1662650 | 3300020076 | Bacteria | 1148 |
| 373 | Ga0206351_10115453 | 3300020077 | Bacteria | 1480 |
| 374 | Ga0206351_10982567 | 3300020077 | Bacteria | 1504 |
| 375 | Ga0206352_10504371 | 3300020078 | Bacteria | 1621 |
| 376 | Ga0206352_10694081 | 3300020078 | Bacteria | 547 |
| 377 | Ga0206350_10034037 | 3300020080 | Bacteria | 1130 |
| 378 | Ga0206350_10358249 | 3300020080 | Bacteria | 1324 |
| 379 | Ga0206350_10870138 | 3300020080 | Bacteria | 1283 |
| 380 | Ga0206354_10379054 | 3300020081 | Bacteria | 2174 |
| 381 | Ga0206354_10728610 | 3300020081 | Bacteria | 1042 |
| 382 | Ga0206354_10896237 | 3300020081 | Bacteria | 2249 |
| 383 | Ga0206354_10900266 | 3300020081 | Bacteria | 1055 |
| 384 | Ga0206354_11642901 | 3300020081 | Bacteria | 805 |
| 385 | Ga0206353_10064748 | 3300020082 | Bacteria | 1023 |
| 386 | Ga0206353_10104151 | 3300020082 | Bacteria | 2368 |
| 387 | Ga0206353_10739044 | 3300020082 | Bacteria | 1044 |
| 388 | Ga0206353_11147038 | 3300020082 | Bacteria | 1535 |
| 389 | Ga0206353_11347620 | 3300020082 | Bacteria | 634 |
| 390 | Ga0206353_11694473 | 3300020082 | Bacteria | 1918 |
| 391 | Ga0206353_11788060 | 3300020082 | Bacteria | 717 |
| 392 | Ga0213873_10205543 | 3300021358 | Bacteria | 612 |
| 393 | Ga0213875_10002550 | 3300021388 | Bacteria | 10865 |
| 394 | Ga0213875_10016499 | 3300021388 | Bacteria | 3579 |
| 395 | Ga0213875_10016913 | 3300021388 | Bacteria | 3532 |
| 396 | Ga0213875_10025578 | 3300021388 | Bacteria | 2812 |
| 397 | Ga0213875_10088465 | 3300021388 | Bacteria | 1445 |
| 398 | Ga0213875_10202452 | 3300021388 | Bacteria | 934 |
| 399 | Ga0213875_10248617 | 3300021388 | Bacteria | 838 |
| 400 | Ga0224712_10014026 | 3300022467 | Bacteria | 2568 |
| 401 | Ga0224712_10017963 | 3300022467 | Bacteria | 2355 |
| 402 | Ga0224712_10031419 | 3300022467 | Bacteria | 1926 |
| 403 | Ga0224712_10150122 | 3300022467 | Bacteria | 1032 |
| 404 | Ga0224712_10584038 | 3300022467 | Bacteria | 545 |
| 405 | Ga0207656_10041050 | 3300025321 | Bacteria | 1964 |
| 406 | Ga0207656_10355025 | 3300025321 | Bacteria | 732 |
| 407 | Ga0207655_1143876 | 3300025728 | Bacteria | 762 |
| 408 | Ga0207653_10030471 | 3300025885 | Bacteria | 1741 |
| 409 | Ga0207692_10013124 | 3300025898 | Bacteria | 3585 |
| 410 | Ga0207692_10021079 | 3300025898 | Bacteria | 2976 |
| 411 | Ga0207692_10050051 | 3300025898 | Bacteria | 2111 |
| 412 | Ga0207692_10085068 | 3300025898 | Bacteria | 1701 |
| 413 | Ga0207692_10424140 | 3300025898 | Bacteria | 833 |
| 414 | Ga0207642_10077427 | 3300025899 | Bacteria | 1604 |
| 415 | Ga0207710_10057377 | 3300025900 | Bacteria | 1759 |
| 416 | Ga0207688_10017931 | 3300025901 | Bacteria | 3852 |
| 417 | Ga0207680_10498412 | 3300025903 | Bacteria | 867 |
| 418 | Ga0207647_10006461 | 3300025904 | Bacteria | 8520 |
| 419 | Ga0207647_10098044 | 3300025904 | Bacteria | 1742 |
| 420 | Ga0207647_10569375 | 3300025904 | Bacteria | 627 |
| 421 | Ga0207685_10055403 | 3300025905 | Bacteria | 1548 |
| 422 | Ga0207685_10121230 | 3300025905 | Bacteria | 1148 |
| 423 | Ga0207685_10621905 | 3300025905 | Bacteria | 581 |
| 424 | Ga0207685_10681936 | 3300025905 | Bacteria | 558 |
| 425 | Ga0207699_10008764 | 3300025906 | Bacteria | 5007 |
| 426 | Ga0207699_10073791 | 3300025906 | Bacteria | 2094 |
| 427 | Ga0207699_10094495 | 3300025906 | Bacteria | 1883 |
| 428 | Ga0207699_10103328 | 3300025906 | Bacteria | 1812 |
| 429 | Ga0207699_10208817 | 3300025906 | Bacteria | 1327 |
| 430 | Ga0207699_10247885 | 3300025906 | Bacteria | 1226 |
| 431 | Ga0207699_10344694 | 3300025906 | Bacteria | 1050 |
| 432 | Ga0207645_10041227 | 3300025907 | Bacteria | 2956 |
| 433 | Ga0207705_10390344 | 3300025909 | Bacteria | 1076 |
| 434 | Ga0207684_10040946 | 3300025910 | Bacteria | 3929 |
| 435 | Ga0207684_10059276 | 3300025910 | Bacteria | 3250 |
| 436 | Ga0207684_10172837 | 3300025910 | Bacteria | 1862 |
| 437 | Ga0207684_10186279 | 3300025910 | Bacteria | 1790 |
| 438 | Ga0207684_10408978 | 3300025910 | Bacteria | 1166 |
| 439 | Ga0207684_10638192 | 3300025910 | Bacteria | 908 |
| 440 | Ga0207684_10852026 | 3300025910 | Bacteria | 768 |
| 441 | Ga0207654_10021325 | 3300025911 | Bacteria | 3444 |
| 442 | Ga0207654_10073585 | 3300025911 | Bacteria | 2037 |
| 443 | Ga0207707_10172743 | 3300025912 | Bacteria | 1888 |
| 444 | Ga0207707_10198943 | 3300025912 | Bacteria | 1747 |
| 445 | Ga0207707_11372113 | 3300025912 | Bacteria | 565 |
| 446 | Ga0207707_11609758 | 3300025912 | Bacteria | 511 |
| 447 | Ga0207695_10000449 | 3300025913 | Bacteria | 89856 |
| 448 | Ga0207695_10352063 | 3300025913 | Bacteria | 1360 |
| 449 | Ga0207671_10000052 | 3300025914 | Bacteria | 188462 |
| 450 | Ga0207671_10112610 | 3300025914 | Bacteria | 2072 |
| 451 | Ga0207693_10030647 | 3300025915 | Bacteria | 4249 |
| 452 | Ga0207693_10040828 | 3300025915 | Bacteria | 3654 |
| 453 | Ga0207693_10761776 | 3300025915 | Bacteria | 747 |
| 454 | Ga0207663_10016875 | 3300025916 | Bacteria | 4060 |
| 455 | Ga0207663_10112538 | 3300025916 | Bacteria | 1849 |
| 456 | Ga0207663_10193911 | 3300025916 | Bacteria | 1461 |
| 457 | Ga0207663_10391856 | 3300025916 | Bacteria | 1060 |
| 458 | Ga0207663_10931971 | 3300025916 | Bacteria | 695 |
| 459 | Ga0207660_10132698 | 3300025917 | Bacteria | 1897 |
| 460 | Ga0207660_10324930 | 3300025917 | Bacteria | 1229 |
| 461 | Ga0207660_11244807 | 3300025917 | Bacteria | 605 |
| 462 | Ga0207662_10004683 | 3300025918 | Bacteria | 7220 |
| 463 | Ga0207657_10051513 | 3300025919 | Bacteria | 3578 |
| 464 | Ga0207657_10101618 | 3300025919 | Bacteria | 2386 |
| 465 | Ga0207657_10774810 | 3300025919 | Bacteria | 742 |
| 466 | Ga0207649_10061098 | 3300025920 | Bacteria | 2370 |
| 467 | Ga0207652_10005773 | 3300025921 | Bacteria | 10041 |
| 468 | Ga0207652_10106977 | 3300025921 | Bacteria | 2477 |
| 469 | Ga0207652_10748069 | 3300025921 | Bacteria | 870 |
| 470 | Ga0207652_10758159 | 3300025921 | Bacteria | 863 |
| 471 | Ga0207646_10003188 | 3300025922 | Bacteria | 18739 |
| 472 | Ga0207646_10131385 | 3300025922 | Bacteria | 2254 |
| 473 | Ga0207646_10199598 | 3300025922 | Bacteria | 1807 |
| 474 | Ga0207646_10510442 | 3300025922 | Bacteria | 1083 |
| 475 | Ga0207646_10528097 | 3300025922 | Bacteria | 1062 |
| 476 | Ga0207646_10726577 | 3300025922 | Bacteria | 887 |
| 477 | Ga0207646_11259079 | 3300025922 | Bacteria | 647 |
| 478 | Ga0207694_10000079 | 3300025924 | Bacteria | 111767 |
| 479 | Ga0207694_10154280 | 3300025924 | Bacteria | 1851 |
| 480 | Ga0207659_10183332 | 3300025926 | Bacteria | 1660 |
| 481 | Ga0207687_10629327 | 3300025927 | Bacteria | 906 |
| 482 | Ga0207687_10750300 | 3300025927 | Bacteria | 831 |
| 483 | Ga0207687_11272542 | 3300025927 | Bacteria | 632 |
| 484 | Ga0207700_10013850 | 3300025928 | Bacteria | 5266 |
| 485 | Ga0207700_10044737 | 3300025928 | Bacteria | 3261 |
| 486 | Ga0207700_10062352 | 3300025928 | Bacteria | 2831 |
| 487 | Ga0207700_10306198 | 3300025928 | Bacteria | 1373 |
| 488 | Ga0207700_10420267 | 3300025928 | Bacteria | 1174 |
| 489 | Ga0207700_10555896 | 3300025928 | Bacteria | 1019 |
| 490 | Ga0207700_10656503 | 3300025928 | Bacteria | 935 |
| 491 | Ga0207700_11075068 | 3300025928 | Bacteria | 719 |
| 492 | Ga0207664_10021682 | 3300025929 | Bacteria | 4783 |
| 493 | Ga0207664_10029279 | 3300025929 | Bacteria | 4193 |
| 494 | Ga0207664_10035671 | 3300025929 | Bacteria | 3839 |
| 495 | Ga0207664_10064082 | 3300025929 | Bacteria | 2938 |
| 496 | Ga0207664_10145790 | 3300025929 | Bacteria | 2007 |
| 497 | Ga0207664_10220288 | 3300025929 | Bacteria | 1645 |
| 498 | Ga0207664_10384490 | 3300025929 | Bacteria | 1246 |
| 499 | Ga0207664_10839049 | 3300025929 | Bacteria | 826 |
| 500 | Ga0207644_10297553 | 3300025931 | Bacteria | 1300 |
| 501 | Ga0207644_10637241 | 3300025931 | Bacteria | 886 |
| 502 | Ga0207690_10081243 | 3300025932 | Bacteria | 2264 |
| 503 | Ga0207706_10410754 | 3300025933 | Bacteria | 1173 |
| 504 | Ga0207686_10120631 | 3300025934 | Bacteria | 1784 |
| 505 | Ga0207709_10305066 | 3300025935 | Bacteria | 1186 |
| 506 | Ga0207670_10097441 | 3300025936 | Bacteria | 2093 |
| 507 | Ga0207704_10176148 | 3300025938 | Bacteria | 1540 |
| 508 | Ga0207665_10008152 | 3300025939 | Bacteria | 6915 |
| 509 | Ga0207665_10030690 | 3300025939 | Bacteria | 3553 |
| 510 | Ga0207665_10056775 | 3300025939 | Bacteria | 2643 |
| 511 | Ga0207665_10077407 | 3300025939 | Bacteria | 2283 |
| 512 | Ga0207665_10896130 | 3300025939 | Bacteria | 703 |
| 513 | Ga0207691_10230112 | 3300025940 | Bacteria | 1605 |
| 514 | Ga0207711_10195471 | 3300025941 | Bacteria | 1845 |
| 515 | Ga0207689_10072095 | 3300025942 | Bacteria | 2837 |
| 516 | Ga0207661_10024560 | 3300025944 | Bacteria | 4569 |
| 517 | Ga0207661_10089973 | 3300025944 | Bacteria | 2555 |
| 518 | Ga0207661_10153939 | 3300025944 | Bacteria | 1989 |
| 519 | Ga0207661_10930771 | 3300025944 | Bacteria | 800 |
| 520 | Ga0207667_10017127 | 3300025949 | Bacteria | 8169 |
| 521 | Ga0207667_10138355 | 3300025949 | Bacteria | 2507 |
| 522 | Ga0207651_10318437 | 3300025960 | Bacteria | 1299 |
| 523 | Ga0207712_10222920 | 3300025961 | Bacteria | 1509 |
| 524 | Ga0207712_10301408 | 3300025961 | Bacteria | 1315 |
| 525 | Ga0207668_10114515 | 3300025972 | Bacteria | 2030 |
| 526 | Ga0207668_10578798 | 3300025972 | Bacteria | 976 |
| 527 | Ga0207640_10006042 | 3300025981 | Bacteria | 6618 |
| 528 | Ga0207640_11816465 | 3300025981 | Bacteria | 551 |
| 529 | Ga0207658_10023037 | 3300025986 | Bacteria | 4342 |
| 530 | Ga0207658_10187864 | 3300025986 | Bacteria | 1715 |
| 531 | Ga0207658_11814357 | 3300025986 | Unclassified | 556 |
| 532 | Ga0207677_10328160 | 3300026023 | Bacteria | 1274 |
| 533 | Ga0207703_11288228 | 3300026035 | Bacteria | 703 |
| 534 | Ga0207639_11679320 | 3300026041 | Bacteria | 595 |
| 535 | Ga0207678_10061626 | 3300026067 | Bacteria | 3226 |
| 536 | Ga0207678_10228781 | 3300026067 | Bacteria | 1592 |
| 537 | Ga0207678_10626017 | 3300026067 | Bacteria | 944 |
| 538 | Ga0207708_10067415 | 3300026075 | Bacteria | 2737 |
| 539 | Ga0207702_10070332 | 3300026078 | Bacteria | 3010 |
| 540 | Ga0207702_10079881 | 3300026078 | Bacteria | 2836 |
| 541 | Ga0207702_10299375 | 3300026078 | Bacteria | 1526 |
| 542 | Ga0207702_10389451 | 3300026078 | Bacteria | 1342 |
| 543 | Ga0207702_11464960 | 3300026078 | Bacteria | 676 |
| 544 | Ga0207641_10043174 | 3300026088 | Bacteria | 3785 |
| 545 | Ga0207641_10199139 | 3300026088 | Bacteria | 1845 |
| 546 | Ga0207648_10048063 | 3300026089 | Bacteria | 3737 |
| 547 | Ga0207676_10131492 | 3300026095 | Bacteria | 2128 |
| 548 | Ga0207676_10955708 | 3300026095 | Unclassified | 843 |
| 549 | Ga0207676_12419906 | 3300026095 | Bacteria | 522 |
| 550 | Ga0207674_10020491 | 3300026116 | Bacteria | 7142 |
| 551 | Ga0207674_10141959 | 3300026116 | Bacteria | 2361 |
| 552 | Ga0207675_100016033 | 3300026118 | Bacteria | 6995 |
| 553 | Ga0207675_100777514 | 3300026118 | Bacteria | 970 |
| 554 | Ga0207675_100854762 | 3300026118 | Bacteria | 925 |
| 555 | Ga0207683_10001450 | 3300026121 | Bacteria | 21423 |
| 556 | Ga0207698_10052683 | 3300026142 | Bacteria | 3119 |
| 557 | Ga0207698_10223496 | 3300026142 | Bacteria | 1703 |
| 558 | Ga0207698_10434028 | 3300026142 | Bacteria | 1264 |
| 559 | Ga0207698_11853092 | 3300026142 | Bacteria | 618 |
| 560 | Ga0209588_1200788 | 3300027671 | Bacteria | 621 |
| 561 | Ga0268266_10041880 | 3300028379 | Bacteria | 3910 |
| 562 | Ga0268266_10080057 | 3300028379 | Bacteria | 2846 |
| 563 | Ga0268266_10109148 | 3300028379 | Bacteria | 2450 |
| 564 | Ga0268266_10121394 | 3300028379 | Bacteria | 2326 |
| 565 | Ga0268266_10268326 | 3300028379 | Bacteria | 1583 |
| 566 | Ga0268264_10253422 | 3300028381 | Bacteria | 1636 |
| 567 | Ga0265337_1029278 | 3300028556 | Bacteria | 1647 |
| 568 | Ga0265326_10007790 | 3300028558 | Bacteria | 3263 |
| 569 | Ga0265319_1028537 | 3300028563 | Bacteria | 1966 |
| 570 | Ga0265334_10009187 | 3300028573 | Bacteria | 4188 |
| 571 | Ga0265334_10009842 | 3300028573 | Bacteria | 4040 |
| 572 | Ga0265318_10070223 | 3300028577 | Bacteria | 1298 |
| 573 | Ga0265322_10007800 | 3300028654 | Bacteria | 3120 |
| 574 | Ga0265336_10012599 | 3300028666 | Bacteria | 2841 |
| 575 | Ga0265338_10003311 | 3300028800 | Bacteria | 22817 |
| 576 | Ga0265338_10101236 | 3300028800 | Bacteria | 2346 |
| 577 | Ga0265324_10004355 | 3300029957 | Bacteria | 6437 |
| 578 | Ga0265762_1022334 | 3300030760 | Bacteria | 1170 |
| 579 | Ga0265762_1123363 | 3300030760 | Bacteria | 594 |
| 580 | Ga0265766_1001019 | 3300030863 | Bacteria | 1338 |
| 581 | Ga0265764_101113 | 3300030882 | Bacteria | 1147 |
| 582 | Ga0265772_102455 | 3300030886 | Bacteria | 731 |
| 583 | Ga0265769_101054 | 3300030888 | Bacteria | 1248 |
| 584 | Ga0265330_10218379 | 3300031235 | Bacteria | 805 |
| 585 | Ga0265332_10018388 | 3300031238 | Bacteria | 3083 |
| 586 | Ga0265320_10046163 | 3300031240 | Bacteria | 2136 |
| 587 | Ga0265325_10032851 | 3300031241 | Bacteria | 2768 |
| 588 | Ga0265340_10027939 | 3300031247 | Bacteria | 2840 |
| 589 | Ga0265316_10006980 | 3300031344 | Bacteria | 10705 |
| 590 | Ga0310103_132896 | 3300031614 | Bacteria | 617 |
| 591 | Ga0310111_101896 | 3300031667 | Bacteria | 2357 |
| 592 | Ga0310114_120261 | 3300031678 | Unclassified | 592 |
| 593 | Ga0316579_10053204 | 3300031691 | Bacteria | 1896 |
| 594 | Ga0265342_10002252 | 3300031712 | Bacteria | 16856 |
| 595 | Ga0316576_10317935 | 3300031727 | Bacteria | 1161 |
| 596 | Ga0316578_10004365 | 3300031728 | Bacteria | 6666 |
| 597 | Ga0307413_10537971 | 3300031824 | Bacteria | 945 |
| 598 | Ga0307410_10127879 | 3300031852 | Bacteria | 1862 |
| 599 | Ga0307410_11321012 | 3300031852 | Unclassified | 631 |
| 600 | Ga0307406_10165726 | 3300031901 | Bacteria | 1594 |
| 601 | Ga0307406_10836277 | 3300031901 | Bacteria | 779 |
| 602 | Ga0307415_100360260 | 3300032126 | Bacteria | 1228 |
| 603 | Ga0316583_10015746 | 3300032133 | Bacteria | 2723 |
| 604 | Ga0316585_10001193 | 3300032137 | Bacteria | 6785 |
| 605 | Ga0316580_10002452 | 3300032139 | Bacteria | 5102 |
| 606 | Ga0316593_10001329 | 3300032168 | Bacteria | 5401 |
| 607 | Ga0307507_10202340 | 3300033179 | Bacteria | 1371 |
| 608 | Ga0307507_10447720 | 3300033179 | Bacteria | 714 |
| 609 | Ga0307507_10517086 | 3300033179 | Bacteria | 638 |
| 610 | Ga0316592_1005348 | 3300033524 | Bacteria | 2433 |
| 611 | Ga0316596_1002330 | 3300033541 | Bacteria | 4037 |
| 612 | Ga0316212_1003332 | 3300033547 | Bacteria | 2316 |
| 613 | Ga0316216_1007074 | 3300033548 | Bacteria | 839 |
| 614 | Ga0373930_0012934 | 3300034816 | Bacteria | 1530 |
| 615 | Ga0373948_0005644 | 3300034817 | Bacteria | 2038 |
| 616 | Ga0373959_0003163 | 3300034820 | Bacteria | 2622 |
| 617 | Ga0373938_0018325 | 3300034957 | Bacteria | 1388 |
| 618 | Ga0373926_0002035 | 3300035083 | Bacteria | 6359 |
| 619 | Ga0373926_0006212 | 3300035083 | Bacteria | 3963 |
| 620 | Ga0373926_0160848 | 3300035083 | Bacteria | 857 |
| 621 | Ga0373934_0007699 | 3300035086 | Bacteria | 4003 |
| 622 | Ga0373934_0027044 | 3300035086 | Bacteria | 2227 |
| 623 | Ga0373934_0093738 | 3300035086 | Bacteria | 1212 |
| 624 | Ga0373934_0414476 | 3300035086 | Bacteria | 563 |
| 625 | Ga0373944_0009356 | 3300035089 | Bacteria | 2655 |
| 626 | Ga0373944_0114910 | 3300035089 | Bacteria | 922 |
| 627 | Ga0373949_0008788 | 3300035090 | Bacteria | 2210 |
| 628 | Ga0373951_0016297 | 3300035091 | Bacteria | 1676 |
| 629 | Ga0373923_0000406 | 3300035111 | Bacteria | 10002 |
| 630 | Ga0373923_0006683 | 3300035111 | Bacteria | 4005 |
| 631 | Ga0373932_0054516 | 3300035112 | Bacteria | 1197 |
| 632 | Ga0373936_0008014 | 3300035113 | Bacteria | 3969 |
| 633 | Ga0373936_0015213 | 3300035113 | Bacteria | 2947 |
| 634 | Ga0373936_0025086 | 3300035113 | Bacteria | 2329 |
| 635 | Ga0373941_0011747 | 3300035115 | Bacteria | 2270 |
| 636 | Ga0373945_0002694 | 3300035116 | Bacteria | 5573 |
| 637 | Ga0373945_0093513 | 3300035116 | Bacteria | 1167 |
| 638 | Ga0373945_0173980 | 3300035116 | Bacteria | 883 |
| 639 | Ga0373953_0010369 | 3300035117 | Bacteria | 3240 |
| 640 | Ga0373953_0043540 | 3300035117 | Bacteria | 1792 |
| 641 | Ga0373954_0003330 | 3300035118 | Bacteria | 6795 |
| 642 | Ga0373954_0016223 | 3300035118 | Bacteria | 3332 |
| 643 | Ga0373954_0041295 | 3300035118 | Bacteria | 2150 |
| 644 | Ga0373956_0005088 | 3300035119 | Bacteria | 5261 |
| 645 | Ga0373956_0056135 | 3300035119 | Bacteria | 1777 |
| 646 | Ga0373957_0008357 | 3300035120 | Bacteria | 3348 |
| 647 | Ga0373957_0028205 | 3300035120 | Bacteria | 2044 |
| 648 | Ga0373960_0039269 | 3300035121 | Bacteria | 1360 |
| 649 | Ga0373960_0078459 | 3300035121 | Bacteria | 1035 |
| 650 | Ga0373943_0000399 | 3300035170 | Bacteria | 18249 |
| 651 | Ga0373943_0000928 | 3300035170 | Bacteria | 12910 |
| 652 | Ga0373943_0240704 | 3300035170 | Bacteria | 1014 |
| 653 | Ga0373946_0000096 | 3300035171 | Bacteria | 24568 |
| 654 | Ga0373946_0007742 | 3300035171 | Bacteria | 3938 |
| 655 | Ga0373946_0590038 | 3300035171 | Bacteria | 575 |
| 656 | Ga0373955_0009583 | 3300035172 | Bacteria | 4544 |
| 657 | Ga0373955_0026141 | 3300035172 | Bacteria | 3003 |
| 658 | Ga0373955_0078893 | 3300035172 | Bacteria | 1856 |
| 659 | Ga0373955_0216370 | 3300035172 | Bacteria | 1143 |
| 660 | Ga0373942_0017840 | 3300035207 | Bacteria | 1755 |
| 661 | Ga0373961_0110429 | 3300035241 | Bacteria | 900 |
| 662 | Ga0373962_0187310 | 3300035242 | Bacteria | 695 |
| 663 | Ga0316574_0078457 | 3300035398 | Bacteria | 2093 |
| 664 | Ga0373924_0001557 | 3300035410 | Bacteria | 7487 |
| 665 | Ga0373924_0006457 | 3300035410 | Bacteria | 4202 |
| 666 | Ga0373924_0017498 | 3300035410 | Bacteria | 2751 |
| 667 | Ga0373931_0117461 | 3300035691 | Bacteria | 1516 |
| 668 | Ga0373935_0001778 | 3300035692 | Bacteria | 12124 |
| 669 | Ga0373935_0002824 | 3300035692 | Bacteria | 9997 |
| 670 | Ga0373935_0003633 | 3300035692 | Bacteria | 8994 |
| 671 | Ga0373935_0087419 | 3300035692 | Bacteria | 2035 |
| 672 | Ga0373935_0820762 | 3300035692 | Bacteria | 687 |
| 673 | Ga0373935_0870977 | 3300035692 | Bacteria | 666 |
| 674 | Ga0373935_1140777 | 3300035692 | Bacteria | 580 |
| 675 | Ga0373927_0002491 | 3300035695 | Bacteria | 13440 |
| 676 | Ga0373927_0006534 | 3300035695 | Bacteria | 7942 |
| 677 | Ga0373927_0158724 | 3300035695 | Bacteria | 1481 |
| 678 | Ga0373933_0006735 | 3300035724 | Bacteria | 6263 |
| 679 | Ga0373933_0010409 | 3300035724 | Bacteria | 5098 |
| 680 | Ga0373933_0619400 | 3300035724 | Bacteria | 711 |
| 681 | Ga0373933_0833777 | 3300035724 | Bacteria | 607 |
| 682 | Ga0373947_0000041 | 3300035725 | Bacteria | 62914 |
| 683 | Ga0373947_0012716 | 3300035725 | Bacteria | 4825 |
| 684 | Ga0373947_0231771 | 3300035725 | Bacteria | 1216 |
| 685 | Ga0373937_0025411 | 3300036401 | Bacteria | 5345 |
| 686 | Ga0373937_0074945 | 3300036401 | Bacteria | 3123 |
| 687 | Ga0373937_0212914 | 3300036401 | Bacteria | 1818 |
| 688 | Ga0373937_1067520 | 3300036401 | Bacteria | 756 |
| 689 | Ga0265778_003501 | 3300036457 | Bacteria | 1582 |
| 690 | Ga0372808_008932 | 3300036459 | Bacteria | 1395 |
| 691 | Ga0310109_004114 | 3300036534 | Bacteria | 1783 |
| 692 | Ga0310109_017818 | 3300036534 | Bacteria | 960 |
| 693 | Ga0316582_0022422 | 3300036647 | Bacteria | 3748 |
| 694 | Ga0316584_0039982 | 3300036712 | Bacteria | 3493 |
| 695 | Ga0373925_0000539 | 3300037068 | Bacteria | 37333 |
| 696 | Ga0373925_0002876 | 3300037068 | Bacteria | 13595 |
| 697 | Ga0373925_0004812 | 3300037068 | Bacteria | 10171 |
| 698 | Ga0373925_0059415 | 3300037068 | Bacteria | 2868 |
| 699 | Ga0373925_0103638 | 3300037068 | Bacteria | 2190 |
| 700 | Ga0373925_1030362 | 3300037068 | Bacteria | 677 |
| 701 | Ga0395899_0022158 | 3300037312 | Bacteria | 4817 |
| 702 | Ga0395899_0022741 | 3300037312 | Bacteria | 4750 |
| 703 | Ga0395899_0469714 | 3300037312 | Bacteria | 821 |
| 704 | Ga0395900_0025148 | 3300037418 | Bacteria | 6095 |
| 705 | Ga0395900_0231418 | 3300037418 | Bacteria | 1858 |
| 706 | Ga0395900_0262157 | 3300037418 | Bacteria | 1725 |
| 707 | Ga0395900_0443310 | 3300037418 | Bacteria | 1256 |
| 708 | Ga0395900_0680176 | 3300037418 | Bacteria | 964 |
| 709 | Ga0395898_0003894 | 3300037466 | Bacteria | 16487 |
| 710 | Ga0395898_0075612 | 3300037466 | Bacteria | 3253 |
| 711 | Ga0395898_0120565 | 3300037466 | Bacteria | 2513 |
| 712 | Ga0395898_0291355 | 3300037466 | Bacteria | 1557 |
| 713 | Ga0395898_0655301 | 3300037466 | Bacteria | 992 |
| 714 | Ga0395905_0009180 | 3300037471 | Bacteria | 9682 |
| 715 | Ga0395905_0749315 | 3300037471 | Bacteria | 879 |
| 716 | Ga0395905_1220297 | 3300037471 | Bacteria | 656 |
| 717 | Ga0316581_0010762 | 3300037588 | Bacteria | 2543 |
| 718 | Ga0436364_0108657 | 3300037853 | Bacteria | 2790 |
| 719 | Ga0436364_0263457 | 3300037853 | Bacteria | 4794 |
| 720 | Ga0436364_0313993 | 3300037853 | Bacteria | 1430 |
| 721 | Ga0436364_0620905 | 3300037853 | Bacteria | 3546 |
| 722 | Ga0436364_0667270 | 3300037853 | Bacteria | 158868 |
| 723 | Ga0436364_0746948 | 3300037853 | Bacteria | 844 |
| 724 | Ga0436364_0851474 | 3300037853 | Bacteria | 640 |
| 725 | Ga0436364_1234022 | 3300037853 | Bacteria | 1031 |
| 726 | Ga0436364_1235254 | 3300037853 | Bacteria | 853 |
| 727 | Ga0436364_1382612 | 3300037853 | Bacteria | 1110 |
| 728 | Ga0436364_1499708 | 3300037853 | Bacteria | 1199 |
| 729 | Ga0436364_1512252 | 3300037853 | Bacteria | 784 |
| 730 | Ga0395901_0011518 | 3300038443 | Bacteria | 8961 |
| 731 | Ga0395901_0012344 | 3300038443 | Bacteria | 8666 |
| 732 | Ga0395901_0163193 | 3300038443 | Bacteria | 2340 |
| 733 | Ga0395901_0755620 | 3300038443 | Bacteria | 965 |
| 734 | Ga0242420_036091 | 3300038996 | Bacteria | 932 |
| 735 | Ga0436365_0728596 | 3300039437 | Bacteria | 657 |
| 736 | Ga0436365_0838927 | 3300039437 | Bacteria | 653 |
| 737 | Ga0436365_0879082 | 3300039437 | Bacteria | 2037 |
| 738 | Ga0436365_1835412 | 3300039437 | Bacteria | 2080 |
| 739 | Ga0436360_1302274 | 3300039438 | Bacteria | 614 |
| 740 | Ga0436363_0423171 | 3300039450 | Bacteria | 2573 |
| 741 | Ga0436363_0537553 | 3300039450 | Bacteria | 650 |
| 742 | Ga0436363_0729247 | 3300039450 | Bacteria | 511 |
| 743 | Ga0436363_0857353 | 3300039450 | Bacteria | 2897 |
| 744 | Ga0436363_1709813 | 3300039450 | Bacteria | 1988 |
| 745 | Ga0436362_0515179 | 3300039453 | Bacteria | 1433 |
| 746 | Ga0436362_0535795 | 3300039453 | Bacteria | 1033 |
| 747 | Ga0436362_0762648 | 3300039453 | Bacteria | 722 |
| 748 | Ga0451853_2653668 | 3300041512 | Bacteria | 1096 |
| 749 | Ga0439448_0010736 | 3300042005 | Bacteria | 2720 |
| 750 | Ga0439448_0056290 | 3300042005 | Bacteria | 1294 |
| 751 | Ga0439448_0133650 | 3300042005 | Bacteria | 856 |
| 752 | Ga0439455_0015930 | 3300042012 | Bacteria | 1733 |
| 753 | Ga0439463_006507 | 3300042016 | Bacteria | 2895 |
| 754 | Ga0439458_0197856 | 3300042157 | Bacteria | 549 |
| 755 | Ga0439459_0035437 | 3300042438 | Bacteria | 1037 |
| 756 | Ga0439440_0031573 | 3300042993 | Bacteria | 1253 |
| 757 | Ga0466969_0016647 | 3300044656 | Bacteria | 3845 |
| 758 | Ga0466969_0155369 | 3300044656 | Bacteria | 1053 |
| 759 | Ga0466972_0599534 | 3300044658 | Bacteria | 521 |
| 760 | Ga0466965_0480738 | 3300044683 | Bacteria | 695 |
| 761 | Ga0466966_0352970 | 3300044684 | Bacteria | 884 |
| 762 | Ga0466961_0010897 | 3300044693 | Bacteria | 5807 |
| 763 | Ga0466961_0014702 | 3300044693 | Bacteria | 5030 |
| 764 | Ga0466961_0184651 | 3300044693 | Bacteria | 1294 |
| 765 | Ga0466961_0821103 | 3300044693 | Bacteria | 555 |
| 766 | Ga0466963_0191050 | 3300044694 | Bacteria | 1431 |
| 767 | Ga0466963_0201586 | 3300044694 | Bacteria | 1392 |
| 768 | Ga0466963_0205742 | 3300044694 | Bacteria | 1377 |
| 769 | Ga0466964_0078348 | 3300044706 | Bacteria | 1413 |
| 770 | Ga0466964_0581700 | 3300044706 | Bacteria | 612 |
| 771 | Ga0466971_0089516 | 3300044719 | Bacteria | 1409 |
| 772 | Ga0466971_0139463 | 3300044719 | Bacteria | 1129 |
| 773 | Ga0466970_0005151 | 3300044765 | Bacteria | 6464 |
| 774 | Ga0466970_0728175 | 3300044765 | Bacteria | 579 |
| 775 | Ga0466957_0016026 | 3300044842 | Bacteria | 4380 |
| 776 | Ga0466957_0068488 | 3300044842 | Bacteria | 2191 |
| 777 | Ga0466957_0944117 | 3300044842 | Bacteria | 618 |
| 778 | Ga0466960_0055075 | 3300044901 | Bacteria | 1933 |
| 779 | Ga0466959_0087156 | 3300045049 | Bacteria | 2246 |
| 780 | Ga0466958_0010977 | 3300045836 | Bacteria | 5091 |
| 781 | Ga0466958_0152151 | 3300045836 | Bacteria | 1460 |
| 782 | Ga0466958_0388857 | 3300045836 | Bacteria | 900 |
| 783 | Ga0466958_1059889 | 3300045836 | Bacteria | 529 |
| 784 | Ga0466967_0018473 | 3300045976 | Bacteria | 5574 |
| 785 | Ga0466967_0183436 | 3300045976 | Bacteria | 1975 |
| 786 | Ga0466967_0336139 | 3300045976 | Bacteria | 1459 |
| 787 | Ga0466967_0563070 | 3300045976 | Bacteria | 1122 |
| 788 | Ga0466967_0947411 | 3300045976 | Bacteria | 857 |
| 789 | Ga0495592_0006913 | 3300046454 | Bacteria | 8475 |
| 790 | Ga0495592_0128159 | 3300046454 | Bacteria | 1777 |
| 791 | Ga0495592_0177963 | 3300046454 | Bacteria | 1451 |
| 792 | Ga0495592_0722516 | 3300046454 | Bacteria | 597 |
| 793 | Ga0495603_0001574 | 3300046455 | Bacteria | 13347 |
| 794 | Ga0495629_0003373 | 3300046459 | Bacteria | 12070 |
| 795 | Ga0495629_0243794 | 3300046459 | Bacteria | 1237 |
| 796 | Ga0495629_0572619 | 3300046459 | Bacteria | 757 |
| 797 | Ga0495641_0004090 | 3300046461 | Bacteria | 10521 |
| 798 | Ga0495641_0025003 | 3300046461 | Bacteria | 2936 |
| 799 | Ga0495641_0086897 | 3300046461 | Bacteria | 1399 |
| 800 | Ga0495651_0004709 | 3300046462 | Bacteria | 10438 |
| 801 | Ga0495651_0031971 | 3300046462 | Bacteria | 4104 |
| 802 | Ga0495651_0036142 | 3300046462 | Bacteria | 3845 |
| 803 | Ga0495651_0090324 | 3300046462 | Bacteria | 2298 |
| 804 | Ga0495651_0095680 | 3300046462 | Bacteria | 2220 |
| 805 | Ga0495651_0100109 | 3300046462 | Bacteria | 2159 |
| 806 | Ga0495651_0252673 | 3300046462 | Bacteria | 1203 |
| 807 | Ga0495651_0287652 | 3300046462 | Bacteria | 1107 |
| 808 | Ga0495653_0007298 | 3300046463 | Bacteria | 9053 |
| 809 | Ga0495653_0039446 | 3300046463 | Bacteria | 3699 |
| 810 | Ga0495653_0071807 | 3300046463 | Bacteria | 2586 |
| 811 | Ga0495653_0382468 | 3300046463 | Bacteria | 898 |
| 812 | Ga0495580_0018888 | 3300046472 | Bacteria | 5128 |
| 813 | Ga0495582_0038471 | 3300046473 | Bacteria | 2632 |
| 814 | Ga0495582_0364232 | 3300046473 | Bacteria | 833 |
| 815 | Ga0495662_0000662 | 3300046476 | Bacteria | 16218 |
| 816 | Ga0495662_0240320 | 3300046476 | Bacteria | 892 |
| 817 | Ga0495662_0381684 | 3300046476 | Bacteria | 692 |
| 818 | Ga0495664_0002834 | 3300046477 | Bacteria | 9329 |
| 819 | Ga0495664_0066453 | 3300046477 | Bacteria | 2150 |
| 820 | Ga0495664_0071409 | 3300046477 | Bacteria | 2073 |
| 821 | Ga0495664_0825693 | 3300046477 | Bacteria | 544 |
| 822 | Ga0495594_0006963 | 3300046499 | Bacteria | 5812 |
| 823 | Ga0495594_0015411 | 3300046499 | Bacteria | 4015 |
| 824 | Ga0495608_0006489 | 3300046511 | Bacteria | 8303 |
| 825 | Ga0495608_0021963 | 3300046511 | Bacteria | 4377 |
| 826 | Ga0495608_0026229 | 3300046511 | Bacteria | 3974 |
| 827 | Ga0495608_0031539 | 3300046511 | Bacteria | 3583 |
| 828 | Ga0495618_0009092 | 3300046514 | Bacteria | 5996 |
| 829 | Ga0495618_0075409 | 3300046514 | Bacteria | 2148 |
| 830 | Ga0495618_0114518 | 3300046514 | Bacteria | 1726 |
| 831 | Ga0495618_0616610 | 3300046514 | Bacteria | 644 |
| 832 | Ga0495628_0012848 | 3300046516 | Bacteria | 7050 |
| 833 | Ga0495628_0015919 | 3300046516 | Bacteria | 6275 |
| 834 | Ga0495628_0018102 | 3300046516 | Bacteria | 5843 |
| 835 | Ga0495628_0065111 | 3300046516 | Bacteria | 2852 |
| 836 | Ga0495628_0380620 | 3300046516 | Bacteria | 1033 |
| 837 | Ga0495630_0002430 | 3300046517 | Bacteria | 12900 |
| 838 | Ga0495630_0018482 | 3300046517 | Bacteria | 5121 |
| 839 | Ga0495630_0067994 | 3300046517 | Bacteria | 2678 |
| 840 | Ga0495666_0004269 | 3300046526 | Bacteria | 7206 |
| 841 | Ga0495652_0006509 | 3300046529 | Bacteria | 10862 |
| 842 | Ga0495652_0037433 | 3300046529 | Bacteria | 4209 |
| 843 | Ga0495652_0058302 | 3300046529 | Bacteria | 3269 |
| 844 | Ga0495665_0001359 | 3300046531 | Bacteria | 13086 |
| 845 | Ga0495665_0030650 | 3300046531 | Bacteria | 2879 |
| 846 | Ga0495640_0025392 | 3300046533 | Bacteria | 4298 |
| 847 | Ga0495640_0028807 | 3300046533 | Bacteria | 3994 |
| 848 | Ga0495586_0041499 | 3300046535 | Bacteria | 2478 |
| 849 | Ga0495587_0029006 | 3300046536 | Bacteria | 3361 |
| 850 | Ga0495587_0043586 | 3300046536 | Bacteria | 2672 |
| 851 | Ga0495587_0116853 | 3300046536 | Bacteria | 1529 |
| 852 | Ga0495645_0029596 | 3300046543 | Bacteria | 3983 |
| 853 | Ga0495645_0035408 | 3300046543 | Bacteria | 3639 |
| 854 | Ga0495645_0041269 | 3300046543 | Bacteria | 3364 |
| 855 | Ga0495645_0111193 | 3300046543 | Bacteria | 1938 |
| 856 | Ga0495645_0551421 | 3300046543 | Bacteria | 714 |
| 857 | Ga0495622_0066461 | 3300046557 | Bacteria | 1667 |
| 858 | Ga0495622_0079104 | 3300046557 | Bacteria | 1513 |
| 859 | Ga0495622_0136256 | 3300046557 | Bacteria | 1116 |
| 860 | Ga0495667_0005787 | 3300046559 | Bacteria | 8372 |
| 861 | Ga0495667_0009483 | 3300046559 | Bacteria | 6595 |
| 862 | Ga0495667_0059785 | 3300046559 | Bacteria | 2500 |
| 863 | Ga0495667_0130439 | 3300046559 | Bacteria | 1621 |
| 864 | Ga0495634_0010845 | 3300046642 | Bacteria | 6662 |
| 865 | Ga0495634_0038784 | 3300046642 | Bacteria | 3246 |
| 866 | Ga0495635_0006817 | 3300046663 | Bacteria | 7983 |
| 867 | Ga0495635_0013814 | 3300046663 | Bacteria | 5648 |
| 868 | Ga0495635_0040834 | 3300046663 | Bacteria | 3205 |
| 869 | Ga0495635_0042864 | 3300046663 | Bacteria | 3123 |
| 870 | Ga0495588_0014179 | 3300046674 | Bacteria | 3811 |
| 871 | Ga0495657_0063311 | 3300046675 | Bacteria | 2440 |
| 872 | Ga0495657_0077729 | 3300046675 | Bacteria | 2152 |
| 873 | Ga0495657_0085180 | 3300046675 | Bacteria | 2037 |
| 874 | Ga0495657_0123913 | 3300046675 | Bacteria | 1625 |
| 875 | Ga0495599_0055822 | 3300046678 | Bacteria | 2472 |
| 876 | Ga0495599_0069872 | 3300046678 | Bacteria | 2191 |
| 877 | Ga0495599_0176472 | 3300046678 | Bacteria | 1317 |
| 878 | Ga0495599_0301242 | 3300046678 | Bacteria | 967 |
| 879 | Ga0495599_0732099 | 3300046678 | Bacteria | 568 |
| 880 | Ga0495623_0042974 | 3300046679 | Bacteria | 2877 |
| 881 | Ga0495623_0047754 | 3300046679 | Bacteria | 2717 |
| 882 | Ga0495623_0139272 | 3300046679 | Bacteria | 1445 |
| 883 | Ga0495623_0485900 | 3300046679 | Bacteria | 653 |
| 884 | Ga0495646_0017948 | 3300046680 | Bacteria | 4482 |
| 885 | Ga0495646_0032518 | 3300046680 | Bacteria | 3246 |
| 886 | Ga0495647_0080310 | 3300046681 | Bacteria | 1321 |
| 887 | Ga0495658_0035403 | 3300046683 | Bacteria | 2746 |
| 888 | Ga0495658_0421985 | 3300046683 | Bacteria | 851 |
| 889 | Ga0495613_0003560 | 3300046689 | Bacteria | 11677 |
| 890 | Ga0495613_0535575 | 3300046689 | Bacteria | 785 |
| 891 | Ga0495624_0004753 | 3300046690 | Bacteria | 9880 |
| 892 | Ga0495624_0008258 | 3300046690 | Bacteria | 7280 |
| 893 | Ga0495624_0086437 | 3300046690 | Bacteria | 1937 |
| 894 | Ga0495624_0968152 | 3300046690 | Bacteria | 500 |
| 895 | Ga0495600_0024850 | 3300046809 | Bacteria | 3856 |
| 896 | Ga0495600_0025919 | 3300046809 | Bacteria | 3781 |
| 897 | Ga0495600_0042058 | 3300046809 | Bacteria | 2978 |
| 898 | Ga0495600_0059108 | 3300046809 | Bacteria | 2504 |
| 899 | Ga0495600_0094573 | 3300046809 | Bacteria | 1948 |
| 900 | Ga0495581_0000263 | 3300047315 | Bacteria | 25263 |
| 901 | Ga0495581_0156855 | 3300047315 | Bacteria | 1330 |
| 902 | Ga0495581_0625899 | 3300047315 | Bacteria | 623 |
| 903 | Ga0495604_0005534 | 3300047317 | Bacteria | 10016 |
| 904 | Ga0495604_0008117 | 3300047317 | Bacteria | 8313 |
| 905 | Ga0495604_0063001 | 3300047317 | Bacteria | 2830 |
| 906 | Ga0495604_0359536 | 3300047317 | Bacteria | 966 |
| 907 | Ga0495604_0368698 | 3300047317 | Bacteria | 951 |
| 908 | Ga0495674_0025319 | 3300047319 | Bacteria | 5441 |
| 909 | Ga0495674_0300381 | 3300047319 | Bacteria | 1311 |
| 910 | Ga0495676_0004207 | 3300047321 | Bacteria | 13140 |
| 911 | Ga0495680_0008279 | 3300047322 | Bacteria | 9467 |
| 912 | Ga0495680_0041045 | 3300047322 | Bacteria | 3680 |
| 913 | Ga0495680_0107344 | 3300047322 | Bacteria | 2073 |
| 914 | Ga0495680_0446027 | 3300047322 | Bacteria | 886 |
| 915 | Ga0495675_0008842 | 3300047444 | Bacteria | 6252 |
| 916 | Ga0495684_0004343 | 3300047471 | Bacteria | 11077 |
| 917 | Ga0495684_0015547 | 3300047471 | Bacteria | 5859 |
| 918 | Ga0495684_0150006 | 3300047471 | Bacteria | 1743 |
| 919 | Ga0495593_0000560 | 3300047673 | Bacteria | 21093 |
| 920 | Ga0495593_0071315 | 3300047673 | Bacteria | 1804 |
| 921 | Ga0495602_0040768 | 3300048088 | Bacteria | 4251 |
| 922 | Ga0495602_0075578 | 3300048088 | Bacteria | 2858 |
| 923 | Ga0495602_0441954 | 3300048088 | Bacteria | 919 |
| 924 | Ga0495614_0002333 | 3300048089 | Bacteria | 8443 |
| 925 | Ga0496100_0066175 | 3300048903 | Bacteria | 2396 |
| 926 | Ga0496100_0115887 | 3300048903 | Bacteria | 1869 |
| 927 | Ga0496101_0021815 | 3300048904 | Bacteria | 4401 |
| 928 | Ga0496102_0016882 | 3300048905 | Bacteria | 6387 |
| 929 | Ga0496102_0122562 | 3300048905 | Bacteria | 2429 |
| 930 | Ga0496102_0304286 | 3300048905 | Bacteria | 1502 |
| 931 | Ga0496102_0666074 | 3300048905 | Bacteria | 964 |
| 932 | Ga0496103_0541535 | 3300048906 | Bacteria | 743 |
| 933 | Ga0496103_0813778 | 3300048906 | Bacteria | 589 |
| 934 | Ga0496104_0168334 | 3300048907 | Bacteria | 2101 |
| 935 | Ga0496104_0444131 | 3300048907 | Bacteria | 1209 |
| 936 | Ga0496104_0485653 | 3300048907 | Bacteria | 1146 |
| 937 | Ga0496105_0039221 | 3300048908 | Bacteria | 3903 |
| 938 | Ga0496105_0329646 | 3300048908 | Bacteria | 1222 |
| 939 | Ga0496105_0441292 | 3300048908 | Bacteria | 1028 |
| 940 | Ga0496105_0736103 | 3300048908 | Bacteria | 754 |
| 941 | Ga0496105_0818704 | 3300048908 | Bacteria | 707 |
| 942 | Ga0496106_0002401 | 3300048909 | Bacteria | 13955 |
| 943 | Ga0496106_0775083 | 3300048909 | Bacteria | 761 |
| 944 | Ga0496107_0088882 | 3300048910 | Bacteria | 2255 |
| 945 | Ga0496108_0015462 | 3300048911 | Bacteria | 6224 |
| 946 | Ga0496108_0058790 | 3300048911 | Bacteria | 3232 |
| 947 | Ga0496108_0362851 | 3300048911 | Bacteria | 1264 |
| 948 | Ga0496108_0749754 | 3300048911 | Bacteria | 845 |
| 949 | Ga0496108_0994249 | 3300048911 | Bacteria | 717 |
| 950 | Ga0496108_1648908 | 3300048911 | Unclassified | 529 |
| 951 | Ga0496109_0095005 | 3300048912 | Bacteria | 2759 |
| 952 | Ga0496109_1392085 | 3300048912 | Bacteria | 637 |
| 953 | Ga0496109_1615203 | 3300048912 | Bacteria | 582 |
| 954 | Ga0496110_0016790 | 3300048913 | Bacteria | 6116 |
| 955 | Ga0496110_0069142 | 3300048913 | Bacteria | 3126 |
| 956 | Ga0496110_1051948 | 3300048913 | Unclassified | 722 |
| 957 | Ga0496111_0017340 | 3300048914 | Bacteria | 4978 |
| 958 | Ga0496111_0047729 | 3300048914 | Bacteria | 3083 |
| 959 | Ga0496112_0009408 | 3300048915 | Bacteria | 8801 |
| 960 | Ga0496112_0050630 | 3300048915 | Bacteria | 4074 |
| 961 | Ga0496112_0157657 | 3300048915 | Bacteria | 2236 |
| 962 | Ga0496112_0173067 | 3300048915 | Bacteria | 2124 |
| 963 | Ga0496113_0067453 | 3300048916 | Bacteria | 2712 |
| 964 | Ga0496113_0133356 | 3300048916 | Bacteria | 1950 |
| 965 | Ga0496113_0399718 | 3300048916 | Bacteria | 1103 |
| 966 | Ga0496114_0490744 | 3300048917 | Bacteria | 1086 |
| 967 | Ga0496114_1221544 | 3300048917 | Bacteria | 638 |
| 968 | Ga0496115_0059342 | 3300048918 | Bacteria | 3081 |
| 969 | Ga0496115_0136634 | 3300048918 | Bacteria | 2021 |
| 970 | Ga0496119_0028875 | 3300048922 | Bacteria | 3775 |
| 971 | Ga0496126_0036755 | 3300048929 | Bacteria | 4576 |
| 972 | Ga0496126_0652055 | 3300048929 | Bacteria | 823 |
| 973 | Ga0501032_0108967 | 3300049569 | Bacteria | 1834 |
| 974 | Ga0501034_0001833 | 3300049571 | Bacteria | 26980 |
| 975 | Ga0501036_0023432 | 3300049572 | Bacteria | 5201 |
| 976 | Ga0501037_0449294 | 3300049573 | Bacteria | 879 |
| 977 | Ga0501038_0089621 | 3300049574 | Bacteria | 2579 |
| 978 | Ga0501042_0067780 | 3300049578 | Bacteria | 2551 |
| 979 | Ga0501042_0069992 | 3300049578 | Bacteria | 2510 |
| 980 | Ga0501042_1134065 | 3300049578 | Bacteria | 570 |
| 981 | Ga0501043_0001757 | 3300049579 | Bacteria | 18675 |
| 982 | Ga0501047_0012436 | 3300049581 | Bacteria | 8057 |
| 983 | Ga0501047_0051340 | 3300049581 | Bacteria | 3984 |
| 984 | Ga0501047_0479993 | 3300049581 | Bacteria | 1071 |
| 985 | Ga0501047_0849753 | 3300049581 | Bacteria | 727 |
| 986 | Ga0501048_0069116 | 3300049582 | Bacteria | 2494 |
| 987 | Ga0501068_0430221 | 3300049584 | Bacteria | 853 |
| 988 | Ga0501069_0984531 | 3300049585 | Bacteria | 515 |
| 989 | Ga0501074_0001800 | 3300049590 | Bacteria | 14677 |
| 990 | Ga0501077_0090862 | 3300049593 | Bacteria | 1935 |
| 991 | Ga0501081_1409110 | 3300049743 | Bacteria | 529 |
| 992 | Ga0501083_0078619 | 3300049744 | Bacteria | 2188 |
| 993 | Ga0501044_0082616 | 3300049823 | Bacteria | 3250 |
| 994 | Ga0501044_1642909 | 3300049823 | Unclassified | 507 |
| 995 | Ga0501045_1188239 | 3300049824 | Bacteria | 557 |
| 996 | nmdc:mga05p37_11220_c1 | 3300050507 | Bacteria | 10652 |
| 997 | nmdc:mga05p37_122880_c1 | 3300050507 | Bacteria | 3189 |
| 998 | nmdc:mga05p37_194513_c1 | 3300050507 | Bacteria | 2460 |
| 999 | nmdc:mga05p37_668592_c1 | 3300050507 | Bacteria | 1160 |
| 1000 | nmdc:mga05p37_70709_c1 | 3300050507 | Bacteria | 4293 |
| 1001 | nmdc:mga05p37_860663_c1 | 3300050507 | Bacteria | 983 |
| 1002 | nmdc:mga09592_259491_c1 | 3300050508 | Bacteria | 1507 |
| 1003 | nmdc:mga09592_383231_c1 | 3300050508 | Bacteria | 1216 |
| 1004 | nmdc:mga09592_4491_c1 | 3300050508 | Bacteria | 11287 |
| 1005 | nmdc:mga09592_618634_c1 | 3300050508 | Bacteria | 927 |
| 1006 | nmdc:mga0qj67_36507_c1 | 3300050509 | Bacteria | 3845 |
| 1007 | nmdc:mga06r32_11664_c1 | 3300050510 | Bacteria | 7911 |
| 1008 | nmdc:mga06r32_942963_c1 | 3300050510 | Bacteria | 818 |
| 1009 | nmdc:mga08y16_1962216_c1 | 3300050511 | Bacteria | 535 |
| 1010 | nmdc:mga08y16_60734_c1 | 3300050511 | Bacteria | 3948 |
| 1011 | nmdc:mga0n895_1761759_c1 | 3300050512 | Bacteria | 581 |
| 1012 | nmdc:mga0n895_1903317_c1 | 3300050512 | Bacteria | 554 |
| 1013 | nmdc:mga0n895_587277_c1 | 3300050512 | Bacteria | 1117 |
| 1014 | nmdc:mga0n895_67166_c1 | 3300050512 | Bacteria | 3551 |
| 1015 | nmdc:mga0rr50_36513_c1 | 3300050513 | Bacteria | 3540 |
| 1016 | nmdc:mga08x19_17616_c1 | 3300050514 | Bacteria | 4374 |
| 1017 | nmdc:mga08x19_96539_c1 | 3300050514 | Bacteria | 1956 |
| 1018 | nmdc:mga0a205_457852_c1 | 3300050515 | Bacteria | 1135 |
| 1019 | nmdc:mga0a205_63893_c1 | 3300050515 | Bacteria | 3556 |
| 1020 | Ga0495601_0063407 | 3300053077 | Bacteria | 2349 |
| 1021 | Ga0495601_0153359 | 3300053077 | Bacteria | 1504 |
| 1022 | Ga0495601_0390063 | 3300053077 | Bacteria | 903 |
| 1023 | Ga0495612_0000642 | 3300053078 | Bacteria | 14034 |
| 1024 | Ga0495612_0007581 | 3300053078 | Bacteria | 4434 |
| 1025 | Ga0495612_0033877 | 3300053078 | Bacteria | 2067 |
| 1026 | Ga0495612_0177799 | 3300053078 | Bacteria | 934 |
| 1027 | Ga0495595_0046484 | 3300053084 | Bacteria | 2000 |
| 1028 | Ga0495595_0109112 | 3300053084 | Bacteria | 1340 |
| 1029 | Ga0495619_0001852 | 3300053085 | Bacteria | 14079 |
| 1030 | Ga0495619_0080577 | 3300053085 | Bacteria | 2191 |
| 1031 | Ga0495619_0107503 | 3300053085 | Bacteria | 1903 |
| 1032 | Ga0495619_0626807 | 3300053085 | Bacteria | 735 |
| 1033 | Ga0495619_0711752 | 3300053085 | Bacteria | 682 |
| 1034 | Ga0495619_0794526 | 3300053085 | Bacteria | 640 |
| 1035 | Ga0500630_261660 | 3300053159 | Bacteria | 601 |
| 1036 | Ga0501084_1444110 | 3300054114 | Bacteria | 576 |
| 1037 | Ga0587073_0178187 | 3300059492 | Bacteria | 622 |
| 1038 | Ga0587077_243622 | 3300059493 | Bacteria | 517 |
| 1039 | Ga0587083_0115572 | 3300059505 | Bacteria | 687 |
| 1040 | Ga0587098_058950 | 3300059604 | Bacteria | 599 |
| 1041 | Ga0587106_045502 | 3300059605 | Bacteria | 760 |
| 1042 | Ga0587101_030434 | 3300059623 | Bacteria | 838 |
| 1043 | Ga0587100_026826 | 3300059648 | Bacteria | 593 |
| 1044 | Ga0587111_0100849 | 3300060346 | Bacteria | 719 |
| 1045 | Ga0466962_0072621 | 3300061719 | Bacteria | 1644 |
| 1046 | Ga0466962_0430172 | 3300061719 | Bacteria | 663 |
| 1047 | Ga0530510_0043987 | 3300061734 | Bacteria | 3227 |
| 1048 | 2554255960 | 2554235005 | Bacteria | 6457341 |
| 1049 | 2619855820 | 2619618881 | Bacteria | 7521104 |
| 1050 | 2620348262 | 2619619003 | Bacteria | 7619552 |
| 1051 | 2676486012 | 2675903059 | Bacteria | 8644972 |
| 1052 | 2862290411 | 2862290372 | Bacteria | 7471434 |
| 1053 | 2895447694 | 2895442618 | Bacteria | 11027144 |
| 1054 | 2935396044 | 2935390628 | Bacteria | 7043367 |
| 1055 | 8053946865 | 8053945823 | Bacteria | 8962862 |
| 1056 | Ga0307509_10512516 | |||
| 1057 | JGI24735J21928_10171235 | |||
| 1058 | JGI24738J21930_10061658 | |||
| 1059 | JGI25406J46586_10019691 | |||
| 1060 | JGI25404J52841_10003154 | |||
| 1061 | Ga0058861_10050548 | |||
| 1062 | Ga0070658_10077399 | |||
| 1063 | Ga0070658_10114670 | |||
| 1064 | Ga0070658_10186243 | |||
| 1065 | Ga0070676_10058660 | |||
| 1066 | Ga0070676_10065461 | |||
| 1067 | Ga0070683_100161126 | |||
| 1068 | Ga0070683_101712378 | |||
| 1069 | Ga0070683_101842019 | |||
| 1070 | Ga0070690_100141844 | |||
| 1071 | Ga0070670_101109341 | |||
| 1072 | Ga0068869_100047053 | |||
| 1073 | Ga0068869_100261280 | |||
| 1074 | Ga0068869_101862294 | |||
| 1075 | Ga0070666_10233102 | |||
| 1076 | Ga0070680_100099306 | |||
| 1077 | Ga0070680_100165816 | |||
| 1078 | Ga0070680_100166878 | |||
| 1079 | Ga0070680_100313519 | |||
| 1080 | Ga0070680_101215661 | |||
| 1081 | Ga0070682_100295980 | |||
| 1082 | Ga0068868_100129961 | |||
| 1083 | Ga0070660_100335015 | |||
| 1084 | Ga0070660_100420630 | |||
| 1085 | Ga0070660_101601751 | |||
| 1086 | Ga0070691_10018094 | |||
| 1087 | Ga0070691_10495152 | |||
| 1088 | Ga0070691_10645624 | |||
| 1089 | Ga0070691_10679883 | |||
| 1090 | Ga0070687_100086341 | |||
| 1091 | Ga0070661_100301453 | |||
| 1092 | Ga0070661_100979072 | |||
| 1093 | Ga0070692_10081597 | |||
| 1094 | Ga0070668_100809478 | |||
| 1095 | Ga0070668_101200930 | |||
| 1096 | Ga0070669_100668835 | |||
| 1097 | Ga0070675_100138246 | |||
| 1098 | Ga0070675_100289066 | |||
| 1099 | Ga0070671_100097211 | |||
| 1100 | Ga0070674_100045756 | |||
| 1101 | Ga0070673_100026214 | |||
| 1102 | Ga0070673_100064467 | |||
| 1103 | Ga0070688_100570252 | |||
| 1104 | Ga0070659_100258234 | |||
| 1105 | Ga0070659_101824341 | |||
| 1106 | Ga0070667_100019139 | |||
| 1107 | Ga0070667_100239569 | |||
| 1108 | Ga0070667_100350887 | |||
| 1109 | Ga0070667_101312960 | |||
| 1110 | Ga0070709_10019091 | |||
| 1111 | Ga0070709_10053195 | |||
| 1112 | Ga0070709_10090988 | |||
| 1113 | Ga0070709_10132410 | |||
| 1114 | Ga0070709_10250614 | |||
| 1115 | Ga0070714_100011051 | |||
| 1116 | Ga0070714_100059588 | |||
| 1117 | Ga0070714_100370473 | |||
| 1118 | Ga0070714_100496692 | |||
| 1119 | Ga0070714_100715931 | |||
| 1120 | Ga0070713_100219475 | |||
| 1121 | Ga0070713_100246184 | |||
| 1122 | Ga0070713_100263298 | |||
| 1123 | Ga0070713_100460589 | |||
| 1124 | Ga0070713_100610859 | |||
| 1125 | Ga0070713_101567903 | |||
| 1126 | Ga0070710_10050534 | |||
| 1127 | Ga0070710_10798997 | |||
| 1128 | Ga0070710_10823778 | |||
| 1129 | Ga0070710_10935656 | |||
| 1130 | Ga0070701_10101501 | |||
| 1131 | Ga0070711_100017485 | |||
| 1132 | Ga0070711_100275335 | |||
| 1133 | Ga0070711_101151724 | |||
| 1134 | Ga0070705_100063130 | |||
| 1135 | Ga0070705_100251841 | |||
| 1136 | Ga0070700_100471614 | |||
| 1137 | Ga0070708_100134599 | |||
| 1138 | Ga0070708_100392108 | |||
| 1139 | Ga0070708_100585813 | |||
| 1140 | Ga0070708_101328181 | |||
| 1141 | Ga0070663_100114507 | |||
| 1142 | Ga0070663_100217590 | |||
| 1143 | Ga0070663_100363354 | |||
| 1144 | Ga0070663_100831765 | |||
| 1145 | Ga0070678_100208896 | |||
| 1146 | Ga0070678_100982960 | |||
| 1147 | Ga0070662_100429005 | |||
| 1148 | Ga0070681_10024013 | |||
| 1149 | Ga0070681_10154212 | |||
| 1150 | Ga0070681_10535082 | |||
| 1151 | Ga0070681_11176724 | |||
| 1152 | Ga0070681_11379844 | |||
| 1153 | Ga0068867_100118995 | |||
| 1154 | Ga0070685_10015250 | |||
| 1155 | Ga0070685_10098587 | |||
| 1156 | Ga0070706_100022829 | |||
| 1157 | Ga0070706_100070425 | |||
| 1158 | Ga0070706_100120420 | |||
| 1159 | Ga0070706_100366837 | |||
| 1160 | Ga0070706_100798841 | |||
| 1161 | Ga0070706_100938481 | |||
| 1162 | Ga0070706_101173309 | |||
| 1163 | Ga0070706_101246952 | |||
| 1164 | Ga0070707_100036268 | |||
| 1165 | Ga0070707_100043862 | |||
| 1166 | Ga0070707_100158400 | |||
| 1167 | Ga0070707_100185126 | |||
| 1168 | Ga0070707_100746985 | |||
| 1169 | Ga0070707_101944430 | |||
| 1170 | Ga0070698_100003439 | |||
| 1171 | Ga0070698_100034744 | |||
| 1172 | Ga0070698_100087214 | |||
| 1173 | Ga0070698_100385190 | |||
| 1174 | Ga0070698_101726626 | |||
| 1175 | Ga0070699_100010810 | |||
| 1176 | Ga0070699_100245834 | |||
| 1177 | Ga0070699_100600042 | |||
| 1178 | Ga0070679_100081061 | |||
| 1179 | Ga0070679_100164457 | |||
| 1180 | Ga0070684_100058031 | |||
| 1181 | Ga0070684_100058098 | |||
| 1182 | Ga0070684_101405717 | |||
| 1183 | Ga0070684_101637431 | |||
| 1184 | Ga0070684_101784621 | |||
| 1185 | Ga0070684_101784657 | |||
| 1186 | Ga0070697_100006581 | |||
| 1187 | Ga0070697_100355688 | |||
| 1188 | Ga0070697_101614871 | |||
| 1189 | Ga0068853_100071201 | |||
| 1190 | Ga0068853_100294422 | |||
| 1191 | Ga0068853_100304730 | |||
| 1192 | Ga0068853_102125664 | |||
| 1193 | Ga0070672_100188568 | |||
| 1194 | Ga0070686_100077111 | |||
| 1195 | Ga0070686_100655243 | |||
| 1196 | Ga0070695_100166365 | |||
| 1197 | Ga0070695_100731917 | |||
| 1198 | Ga0070696_100649300 | |||
| 1199 | Ga0070693_100440758 | |||
| 1200 | Ga0070693_100541611 | |||
| 1201 | Ga0070693_101163821 | |||
| 1202 | Ga0070693_101504710 | |||
| 1203 | Ga0070665_100012829 | |||
| 1204 | Ga0070665_100212346 | |||
| 1205 | Ga0070665_100224452 | |||
| 1206 | Ga0070665_100266041 | |||
| 1207 | Ga0070665_100649471 | |||
| 1208 | Ga0070665_101885337 | |||
| 1209 | Ga0070704_100195860 | |||
| 1210 | Ga0070704_100745863 | |||
| 1211 | Ga0070704_102204589 | |||
| 1212 | Ga0068855_100021107 | |||
| 1213 | Ga0068855_100565603 | |||
| 1214 | Ga0070664_100029287 | |||
| 1215 | Ga0068857_100036487 | |||
| 1216 | Ga0068857_101223864 | |||
| 1217 | Ga0068857_101223865 | |||
| 1218 | Ga0068857_102019311 | |||
| 1219 | Ga0068854_100004751 | |||
| 1220 | Ga0068854_100054440 | |||
| 1221 | Ga0068854_100443282 | |||
| 1222 | Ga0068856_100182790 | |||
| 1223 | Ga0068856_100366862 | |||
| 1224 | Ga0068856_101485615 | |||
| 1225 | Ga0068856_101498163 | |||
| 1226 | Ga0070702_100173298 | |||
| 1227 | Ga0068852_100198342 | |||
| 1228 | Ga0068852_100261919 | |||
| 1229 | Ga0068852_101881100 | |||
| 1230 | Ga0068859_100247012 | |||
| 1231 | Ga0068864_100481548 | |||
| 1232 | Ga0068864_100763173 | |||
| 1233 | Ga0068864_100836027 | |||
| 1234 | Ga0068866_10012061 | |||
| 1235 | Ga0068861_100009787 | |||
| 1236 | Ga0068861_100086090 | |||
| 1237 | Ga0068851_10388673 | |||
| 1238 | Ga0068870_10155348 | |||
| 1239 | Ga0068863_100015044 | |||
| 1240 | Ga0068863_101390278 | |||
| 1241 | Ga0068858_100979082 | |||
| 1242 | Ga0068858_101406035 | |||
| 1243 | Ga0068860_100293470 | |||
| 1244 | Ga0068862_100149526 | |||
| 1245 | Ga0081455_10012907 | |||
| 1246 | Ga0081455_10941865 | |||
| 1247 | Ga0081540_1000009 | |||
| 1248 | Ga0081540_1006532 | |||
| 1249 | Ga0081539_10000846 | |||
| 1250 | Ga0070717_10133729 | |||
| 1251 | Ga0070717_10206461 | |||
| 1252 | Ga0070717_10446015 | |||
| 1253 | Ga0070717_11219293 | |||
| 1254 | Ga0070717_11565673 | |||
| 1255 | Ga0075365_11043605 | |||
| 1256 | Ga0075432_10117156 | |||
| 1257 | Ga0070715_10029477 | |||
| 1258 | Ga0070715_10058976 | |||
| 1259 | Ga0070715_10084267 | |||
| 1260 | Ga0070715_10165799 | |||
| 1261 | Ga0070716_100289285 | |||
| 1262 | Ga0070716_100455620 | |||
| 1263 | Ga0070716_100463002 | |||
| 1264 | Ga0070716_100478888 | |||
| 1265 | Ga0070716_100581283 | |||
| 1266 | Ga0070716_100642510 | |||
| 1267 | Ga0070712_100013903 | |||
| 1268 | Ga0070712_100169901 | |||
| 1269 | Ga0070712_100273404 | |||
| 1270 | Ga0070712_100540101 | |||
| 1271 | Ga0070712_100721144 | |||
| 1272 | Ga0070712_101585978 | |||
| 1273 | Ga0097621_100132185 | |||
| 1274 | Ga0068871_100057615 | |||
| 1275 | Ga0068871_100289812 | |||
| 1276 | Ga0068871_100521945 | |||
| 1277 | Ga0075428_100040546 | |||
| 1278 | Ga0075428_100053163 | |||
| 1279 | Ga0075430_100062344 | |||
| 1280 | Ga0075430_101144205 | |||
| 1281 | Ga0075430_101404475 | |||
| 1282 | Ga0075431_100009154 | |||
| 1283 | Ga0075431_100105695 | |||
| 1284 | Ga0075431_102091081 | |||
| 1285 | Ga0075433_10286255 | |||
| 1286 | Ga0075434_100363345 | |||
| 1287 | Ga0075434_100474560 | |||
| 1288 | Ga0075434_100850503 | |||
| 1289 | Ga0075434_101239176 | |||
| 1290 | Ga0075434_101655801 | |||
| 1291 | Ga0075429_100001463 | |||
| 1292 | Ga0075429_100004985 | |||
| 1293 | Ga0075429_100322444 | |||
| 1294 | Ga0068865_100343106 | |||
| 1295 | Ga0075436_100384904 | |||
| 1296 | Ga0097620_100246999 | |||
| 1297 | Ga0075435_100064873 | |||
| 1298 | Ga0075435_101517807 | |||
| 1299 | Ga0099794_10157616 | |||
| 1300 | Ga0099794_10281148 | |||
| 1301 | Ga0105251_10216133 | |||
| 1302 | Ga0105244_10446617 | |||
| 1303 | Ga0105244_10592447 | |||
| 1304 | Ga0105250_10193607 | |||
| 1305 | Ga0105240_10005049 | |||
| 1306 | Ga0105240_10148595 | |||
| 1307 | Ga0105240_10530028 | |||
| 1308 | Ga0105240_11240616 | |||
| 1309 | Ga0111539_10095829 | |||
| 1310 | Ga0111539_11937737 | |||
| 1311 | Ga0105245_10879852 | |||
| 1312 | Ga0105245_11491215 | |||
| 1313 | Ga0105245_11928268 | |||
| 1314 | Ga0105247_10030756 | |||
| 1315 | Ga0105247_10093595 | |||
| 1316 | Ga0105247_10241327 | |||
| 1317 | Ga0105247_11565567 | |||
| 1318 | Ga0114129_10005490 | |||
| 1319 | Ga0114129_10011782 | |||
| 1320 | Ga0114129_10098006 | |||
| 1321 | Ga0114129_10191923 | |||
| 1322 | Ga0114129_10689696 | |||
| 1323 | Ga0114129_11136350 | |||
| 1324 | Ga0114129_12307258 | |||
| 1325 | Ga0105243_10147129 | |||
| 1326 | Ga0105243_10250905 | |||
| 1327 | Ga0105243_10442798 | |||
| 1328 | Ga0105241_10002864 | |||
| 1329 | Ga0105241_10009338 | |||
| 1330 | Ga0105241_10023035 | |||
| 1331 | Ga0105241_11157959 | |||
| 1332 | Ga0105248_10099174 | |||
| 1333 | Ga0105248_10133427 | |||
| 1334 | Ga0105248_10535853 | |||
| 1335 | Ga0105237_10006743 | |||
| 1336 | Ga0105237_10883528 | |||
| 1337 | Ga0105237_11150672 | |||
| 1338 | Ga0105237_11975529 | |||
| 1339 | Ga0105238_10015348 | |||
| 1340 | Ga0105238_10103318 | |||
| 1341 | Ga0105238_10428255 | |||
| 1342 | Ga0105238_10447601 | |||
| 1343 | Ga0105238_11780418 | |||
| 1344 | Ga0105238_12356847 | |||
| 1345 | Ga0105249_10423985 | |||
| 1346 | Ga0105249_10952638 | |||
| 1347 | Ga0099796_10208602 | |||
| 1348 | Ga0105239_10028184 | |||
| 1349 | Ga0105239_10996700 | |||
| 1350 | Ga0105246_10003333 | |||
| 1351 | Ga0105246_10067347 | |||
| 1352 | Ga0105246_10261241 | |||
| 1353 | Ga0157340_1005324 | |||
| 1354 | Ga0157346_1012257 | |||
| 1355 | Ga0157337_1002560 | |||
| 1356 | Ga0157325_1012806 | |||
| 1357 | Ga0157343_1000771 | |||
| 1358 | Ga0157322_1002597 | |||
| 1359 | Ga0157323_1025849 | |||
| 1360 | Ga0157342_1010144 | |||
| 1361 | Ga0157315_1054815 | |||
| 1362 | Ga0157326_1023376 | |||
| 1363 | Ga0157373_10080944 | |||
| 1364 | Ga0157371_10026186 | |||
| 1365 | Ga0157371_10028526 | |||
| 1366 | Ga0157371_11045684 | |||
| 1367 | Ga0157370_10096691 | |||
| 1368 | Ga0157370_10166858 | |||
| 1369 | Ga0157370_10415418 | |||
| 1370 | Ga0157369_10087391 | |||
| 1371 | Ga0157369_10192683 | |||
| 1372 | Ga0157369_10193030 | |||
| 1373 | Ga0157369_10207601 | |||
| 1374 | Ga0157369_10371209 | |||
| 1375 | Ga0157369_10421868 | |||
| 1376 | Ga0157369_12107754 | |||
| 1377 | Ga0157374_10005049 | |||
| 1378 | Ga0157374_10453645 | |||
| 1379 | Ga0157374_10790396 | |||
| 1380 | Ga0157374_12339877 | |||
| 1381 | Ga0157378_10641435 | |||
| 1382 | Ga0157378_11270692 | |||
| 1383 | Ga0163162_10460375 | |||
| 1384 | Ga0163162_10496834 | |||
| 1385 | Ga0157372_10333350 | |||
| 1386 | Ga0157372_11307306 | |||
| 1387 | Ga0157375_10154278 | |||
| 1388 | Ga0157375_10348756 | |||
| 1389 | Ga0163163_10131321 | |||
| 1390 | Ga0163163_10451334 | |||
| 1391 | Ga0163163_10993766 | |||
| 1392 | Ga0163163_11099001 | |||
| 1393 | Ga0163163_11550685 | |||
| 1394 | Ga0163163_13301814 | |||
| 1395 | Ga0157380_10476799 | |||
| 1396 | Ga0157380_10703348 | |||
| 1397 | Ga0182008_10066425 | |||
| 1398 | Ga0182008_10083900 | |||
| 1399 | Ga0157377_10046061 | |||
| 1400 | Ga0157377_11461876 | |||
| 1401 | Ga0157377_11670158 | |||
| 1402 | Ga0157379_10219414 | |||
| 1403 | Ga0157379_10370864 | |||
| 1404 | Ga0157379_10441890 | |||
| 1405 | Ga0157376_10268229 | |||
| 1406 | Ga0157376_10616184 | |||
| 1407 | Ga0157376_10661613 | |||
| 1408 | Ga0182005_1024683 | |||
| 1409 | Ga0163161_10165684 | |||
| 1410 | Ga0197907_10040213 | |||
| 1411 | Ga0197907_10134442 | |||
| 1412 | Ga0197907_10239040 | |||
| 1413 | Ga0197907_11079237 | |||
| 1414 | Ga0197907_11202783 | |||
| 1415 | Ga0197907_11233655 | |||
| 1416 | Ga0206356_10024402 | |||
| 1417 | Ga0206356_10473527 | |||
| 1418 | Ga0206356_10750368 | |||
| 1419 | Ga0206356_10822231 | |||
| 1420 | Ga0206356_10869480 | |||
| 1421 | Ga0206356_11238138 | |||
| 1422 | Ga0206349_1452056 | |||
| 1423 | Ga0206349_1676835 | |||
| 1424 | Ga0206349_1737499 | |||
| 1425 | Ga0206349_1774434 | |||
| 1426 | Ga0206355_1028181 | |||
| 1427 | Ga0206355_1662650 | |||
| 1428 | Ga0206351_10115453 | |||
| 1429 | Ga0206351_10982567 | |||
| 1430 | Ga0206352_10504371 | |||
| 1431 | Ga0206352_10694081 | |||
| 1432 | Ga0206350_10034037 | |||
| 1433 | Ga0206350_10358249 | |||
| 1434 | Ga0206350_10870138 | |||
| 1435 | Ga0206354_10379054 | |||
| 1436 | Ga0206354_10728610 | |||
| 1437 | Ga0206354_10896237 | |||
| 1438 | Ga0206354_10900266 | |||
| 1439 | Ga0206354_11642901 | |||
| 1440 | Ga0206353_10064748 | |||
| 1441 | Ga0206353_10104151 | |||
| 1442 | Ga0206353_10739044 | |||
| 1443 | Ga0206353_11147038 | |||
| 1444 | Ga0206353_11347620 | |||
| 1445 | Ga0206353_11694473 | |||
| 1446 | Ga0206353_11788060 | |||
| 1447 | Ga0213873_10205543 | |||
| 1448 | Ga0213875_10002550 | |||
| 1449 | Ga0213875_10016499 | |||
| 1450 | Ga0213875_10016913 | |||
| 1451 | Ga0213875_10025578 | |||
| 1452 | Ga0213875_10088465 | |||
| 1453 | Ga0213875_10202452 | |||
| 1454 | Ga0213875_10248617 | |||
| 1455 | Ga0224712_10014026 | |||
| 1456 | Ga0224712_10017963 | |||
| 1457 | Ga0224712_10031419 | |||
| 1458 | Ga0224712_10150122 | |||
| 1459 | Ga0224712_10584038 | |||
| 1460 | Ga0207656_10041050 | |||
| 1461 | Ga0207656_10355025 | |||
| 1462 | Ga0207655_1143876 | |||
| 1463 | Ga0207653_10030471 | |||
| 1464 | Ga0207692_10013124 | |||
| 1465 | Ga0207692_10021079 | |||
| 1466 | Ga0207692_10050051 | |||
| 1467 | Ga0207692_10085068 | |||
| 1468 | Ga0207692_10424140 | |||
| 1469 | Ga0207642_10077427 | |||
| 1470 | Ga0207710_10057377 | |||
| 1471 | Ga0207688_10017931 | |||
| 1472 | Ga0207680_10498412 | |||
| 1473 | Ga0207647_10006461 | |||
| 1474 | Ga0207647_10098044 | |||
| 1475 | Ga0207647_10569375 | |||
| 1476 | Ga0207685_10055403 | |||
| 1477 | Ga0207685_10121230 | |||
| 1478 | Ga0207685_10621905 | |||
| 1479 | Ga0207685_10681936 | |||
| 1480 | Ga0207699_10008764 | |||
| 1481 | Ga0207699_10073791 | |||
| 1482 | Ga0207699_10094495 | |||
| 1483 | Ga0207699_10103328 | |||
| 1484 | Ga0207699_10208817 | |||
| 1485 | Ga0207699_10247885 | |||
| 1486 | Ga0207699_10344694 | |||
| 1487 | Ga0207645_10041227 | |||
| 1488 | Ga0207705_10390344 | |||
| 1489 | Ga0207684_10040946 | |||
| 1490 | Ga0207684_10059276 | |||
| 1491 | Ga0207684_10172837 | |||
| 1492 | Ga0207684_10186279 | |||
| 1493 | Ga0207684_10408978 | |||
| 1494 | Ga0207684_10638192 | |||
| 1495 | Ga0207684_10852026 | |||
| 1496 | Ga0207654_10021325 | |||
| 1497 | Ga0207654_10073585 | |||
| 1498 | Ga0207707_10172743 | |||
| 1499 | Ga0207707_10198943 | |||
| 1500 | Ga0207707_11372113 | |||
| 1501 | Ga0207707_11609758 | |||
| 1502 | Ga0207695_10000449 | |||
| 1503 | Ga0207695_10352063 | |||
| 1504 | Ga0207671_10000052 | |||
| 1505 | Ga0207671_10112610 | |||
| 1506 | Ga0207693_10030647 | |||
| 1507 | Ga0207693_10040828 | |||
| 1508 | Ga0207693_10761776 | |||
| 1509 | Ga0207663_10016875 | |||
| 1510 | Ga0207663_10112538 | |||
| 1511 | Ga0207663_10193911 | |||
| 1512 | Ga0207663_10391856 | |||
| 1513 | Ga0207663_10931971 | |||
| 1514 | Ga0207660_10132698 | |||
| 1515 | Ga0207660_10324930 | |||
| 1516 | Ga0207660_11244807 | |||
| 1517 | Ga0207662_10004683 | |||
| 1518 | Ga0207657_10051513 | |||
| 1519 | Ga0207657_10101618 | |||
| 1520 | Ga0207657_10774810 | |||
| 1521 | Ga0207649_10061098 | |||
| 1522 | Ga0207652_10005773 | |||
| 1523 | Ga0207652_10106977 | |||
| 1524 | Ga0207652_10748069 | |||
| 1525 | Ga0207652_10758159 | |||
| 1526 | Ga0207646_10003188 | |||
| 1527 | Ga0207646_10131385 | |||
| 1528 | Ga0207646_10199598 | |||
| 1529 | Ga0207646_10510442 | |||
| 1530 | Ga0207646_10528097 | |||
| 1531 | Ga0207646_10726577 | |||
| 1532 | Ga0207646_11259079 | |||
| 1533 | Ga0207694_10000079 | |||
| 1534 | Ga0207694_10154280 | |||
| 1535 | Ga0207659_10183332 | |||
| 1536 | Ga0207687_10629327 | |||
| 1537 | Ga0207687_10750300 | |||
| 1538 | Ga0207687_11272542 | |||
| 1539 | Ga0207700_10013850 | |||
| 1540 | Ga0207700_10044737 | |||
| 1541 | Ga0207700_10062352 | |||
| 1542 | Ga0207700_10306198 | |||
| 1543 | Ga0207700_10420267 | |||
| 1544 | Ga0207700_10555896 | |||
| 1545 | Ga0207700_10656503 | |||
| 1546 | Ga0207700_11075068 | |||
| 1547 | Ga0207664_10021682 | |||
| 1548 | Ga0207664_10029279 | |||
| 1549 | Ga0207664_10035671 | |||
| 1550 | Ga0207664_10064082 | |||
| 1551 | Ga0207664_10145790 | |||
| 1552 | Ga0207664_10220288 | |||
| 1553 | Ga0207664_10384490 | |||
| 1554 | Ga0207664_10839049 | |||
| 1555 | Ga0207644_10297553 | |||
| 1556 | Ga0207644_10637241 | |||
| 1557 | Ga0207690_10081243 | |||
| 1558 | Ga0207706_10410754 | |||
| 1559 | Ga0207686_10120631 | |||
| 1560 | Ga0207709_10305066 | |||
| 1561 | Ga0207670_10097441 | |||
| 1562 | Ga0207704_10176148 | |||
| 1563 | Ga0207665_10008152 | |||
| 1564 | Ga0207665_10030690 | |||
| 1565 | Ga0207665_10056775 | |||
| 1566 | Ga0207665_10077407 | |||
| 1567 | Ga0207665_10896130 | |||
| 1568 | Ga0207691_10230112 | |||
| 1569 | Ga0207711_10195471 | |||
| 1570 | Ga0207689_10072095 | |||
| 1571 | Ga0207661_10024560 | |||
| 1572 | Ga0207661_10089973 | |||
| 1573 | Ga0207661_10153939 | |||
| 1574 | Ga0207661_10930771 | |||
| 1575 | Ga0207667_10017127 | |||
| 1576 | Ga0207667_10138355 | |||
| 1577 | Ga0207651_10318437 | |||
| 1578 | Ga0207712_10222920 | |||
| 1579 | Ga0207712_10301408 | |||
| 1580 | Ga0207668_10114515 | |||
| 1581 | Ga0207668_10578798 | |||
| 1582 | Ga0207640_10006042 | |||
| 1583 | Ga0207640_11816465 | |||
| 1584 | Ga0207658_10023037 | |||
| 1585 | Ga0207658_10187864 | |||
| 1586 | Ga0207658_11814357 | |||
| 1587 | Ga0207677_10328160 | |||
| 1588 | Ga0207703_11288228 | |||
| 1589 | Ga0207639_11679320 | |||
| 1590 | Ga0207678_10061626 | |||
| 1591 | Ga0207678_10228781 | |||
| 1592 | Ga0207678_10626017 | |||
| 1593 | Ga0207708_10067415 | |||
| 1594 | Ga0207702_10070332 | |||
| 1595 | Ga0207702_10079881 | |||
| 1596 | Ga0207702_10299375 | |||
| 1597 | Ga0207702_10389451 | |||
| 1598 | Ga0207702_11464960 | |||
| 1599 | Ga0207641_10043174 | |||
| 1600 | Ga0207641_10199139 | |||
| 1601 | Ga0207648_10048063 | |||
| 1602 | Ga0207676_10131492 | |||
| 1603 | Ga0207676_10955708 | |||
| 1604 | Ga0207676_12419906 | |||
| 1605 | Ga0207674_10020491 | |||
| 1606 | Ga0207674_10141959 | |||
| 1607 | Ga0207675_100016033 | |||
| 1608 | Ga0207675_100777514 | |||
| 1609 | Ga0207675_100854762 | |||
| 1610 | Ga0207683_10001450 | |||
| 1611 | Ga0207698_10052683 | |||
| 1612 | Ga0207698_10223496 | |||
| 1613 | Ga0207698_10434028 | |||
| 1614 | Ga0207698_11853092 | |||
| 1615 | Ga0209588_1200788 | |||
| 1616 | Ga0268266_10041880 | |||
| 1617 | Ga0268266_10080057 | |||
| 1618 | Ga0268266_10109148 | |||
| 1619 | Ga0268266_10121394 | |||
| 1620 | Ga0268266_10268326 | |||
| 1621 | Ga0268264_10253422 | |||
| 1622 | Ga0265337_1029278 | |||
| 1623 | Ga0265326_10007790 | |||
| 1624 | Ga0265319_1028537 | |||
| 1625 | Ga0265334_10009187 | |||
| 1626 | Ga0265334_10009842 | |||
| 1627 | Ga0265318_10070223 | |||
| 1628 | Ga0265322_10007800 | |||
| 1629 | Ga0265336_10012599 | |||
| 1630 | Ga0265338_10003311 | |||
| 1631 | Ga0265338_10101236 | |||
| 1632 | Ga0265324_10004355 | |||
| 1633 | Ga0265762_1022334 | |||
| 1634 | Ga0265762_1123363 | |||
| 1635 | Ga0265766_1001019 | |||
| 1636 | Ga0265764_101113 | |||
| 1637 | Ga0265772_102455 | |||
| 1638 | Ga0265769_101054 | |||
| 1639 | Ga0265330_10218379 | |||
| 1640 | Ga0265332_10018388 | |||
| 1641 | Ga0265320_10046163 | |||
| 1642 | Ga0265325_10032851 | |||
| 1643 | Ga0265340_10027939 | |||
| 1644 | Ga0265316_10006980 | |||
| 1645 | Ga0310103_132896 | |||
| 1646 | Ga0310111_101896 | |||
| 1647 | Ga0310114_120261 | |||
| 1648 | Ga0316579_10053204 | |||
| 1649 | Ga0265342_10002252 | |||
| 1650 | Ga0316576_10317935 | |||
| 1651 | Ga0316578_10004365 | |||
| 1652 | Ga0307413_10537971 | |||
| 1653 | Ga0307410_10127879 | |||
| 1654 | Ga0307410_11321012 | |||
| 1655 | Ga0307406_10165726 | |||
| 1656 | Ga0307406_10836277 | |||
| 1657 | Ga0307415_100360260 | |||
| 1658 | Ga0316583_10015746 | |||
| 1659 | Ga0316585_10001193 | |||
| 1660 | Ga0316580_10002452 | |||
| 1661 | Ga0316593_10001329 | |||
| 1662 | Ga0307507_10202340 | |||
| 1663 | Ga0307507_10447720 | |||
| 1664 | Ga0307507_10517086 | |||
| 1665 | Ga0316592_1005348 | |||
| 1666 | Ga0316596_1002330 | |||
| 1667 | Ga0316212_1003332 | |||
| 1668 | Ga0316216_1007074 | |||
| 1669 | Ga0373930_0012934 | |||
| 1670 | Ga0373948_0005644 | |||
| 1671 | Ga0373959_0003163 | |||
| 1672 | Ga0373938_0018325 | |||
| 1673 | Ga0373926_0002035 | |||
| 1674 | Ga0373926_0006212 | |||
| 1675 | Ga0373926_0160848 | |||
| 1676 | Ga0373934_0007699 | |||
| 1677 | Ga0373934_0027044 | |||
| 1678 | Ga0373934_0093738 | |||
| 1679 | Ga0373934_0414476 | |||
| 1680 | Ga0373944_0009356 | |||
| 1681 | Ga0373944_0114910 | |||
| 1682 | Ga0373949_0008788 | |||
| 1683 | Ga0373951_0016297 | |||
| 1684 | Ga0373923_0000406 | |||
| 1685 | Ga0373923_0006683 | |||
| 1686 | Ga0373932_0054516 | |||
| 1687 | Ga0373936_0008014 | |||
| 1688 | Ga0373936_0015213 | |||
| 1689 | Ga0373936_0025086 | |||
| 1690 | Ga0373941_0011747 | |||
| 1691 | Ga0373945_0002694 | |||
| 1692 | Ga0373945_0093513 | |||
| 1693 | Ga0373945_0173980 | |||
| 1694 | Ga0373953_0010369 | |||
| 1695 | Ga0373953_0043540 | |||
| 1696 | Ga0373954_0003330 | |||
| 1697 | Ga0373954_0016223 | |||
| 1698 | Ga0373954_0041295 | |||
| 1699 | Ga0373956_0005088 | |||
| 1700 | Ga0373956_0056135 | |||
| 1701 | Ga0373957_0008357 | |||
| 1702 | Ga0373957_0028205 | |||
| 1703 | Ga0373960_0039269 | |||
| 1704 | Ga0373960_0078459 | |||
| 1705 | Ga0373943_0000399 | |||
| 1706 | Ga0373943_0000928 | |||
| 1707 | Ga0373943_0240704 | |||
| 1708 | Ga0373946_0000096 | |||
| 1709 | Ga0373946_0007742 | |||
| 1710 | Ga0373946_0590038 | |||
| 1711 | Ga0373955_0009583 | |||
| 1712 | Ga0373955_0026141 | |||
| 1713 | Ga0373955_0078893 | |||
| 1714 | Ga0373955_0216370 | |||
| 1715 | Ga0373942_0017840 | |||
| 1716 | Ga0373961_0110429 | |||
| 1717 | Ga0373962_0187310 | |||
| 1718 | Ga0316574_0078457 | |||
| 1719 | Ga0373924_0001557 | |||
| 1720 | Ga0373924_0006457 | |||
| 1721 | Ga0373924_0017498 | |||
| 1722 | Ga0373931_0117461 | |||
| 1723 | Ga0373935_0001778 | |||
| 1724 | Ga0373935_0002824 | |||
| 1725 | Ga0373935_0003633 | |||
| 1726 | Ga0373935_0087419 | |||
| 1727 | Ga0373935_0820762 | |||
| 1728 | Ga0373935_0870977 | |||
| 1729 | Ga0373935_1140777 | |||
| 1730 | Ga0373927_0002491 | |||
| 1731 | Ga0373927_0006534 | |||
| 1732 | Ga0373927_0158724 | |||
| 1733 | Ga0373933_0006735 | |||
| 1734 | Ga0373933_0010409 | |||
| 1735 | Ga0373933_0619400 | |||
| 1736 | Ga0373933_0833777 | |||
| 1737 | Ga0373947_0000041 | |||
| 1738 | Ga0373947_0012716 | |||
| 1739 | Ga0373947_0231771 | |||
| 1740 | Ga0373937_0025411 | |||
| 1741 | Ga0373937_0074945 | |||
| 1742 | Ga0373937_0212914 | |||
| 1743 | Ga0373937_1067520 | |||
| 1744 | Ga0265778_003501 | |||
| 1745 | Ga0372808_008932 | |||
| 1746 | Ga0310109_004114 | |||
| 1747 | Ga0310109_017818 | |||
| 1748 | Ga0316582_0022422 | |||
| 1749 | Ga0316584_0039982 | |||
| 1750 | Ga0373925_0000539 | |||
| 1751 | Ga0373925_0002876 | |||
| 1752 | Ga0373925_0004812 | |||
| 1753 | Ga0373925_0059415 | |||
| 1754 | Ga0373925_0103638 | |||
| 1755 | Ga0373925_1030362 | |||
| 1756 | Ga0395899_0022158 | |||
| 1757 | Ga0395899_0022741 | |||
| 1758 | Ga0395899_0469714 | |||
| 1759 | Ga0395900_0025148 | |||
| 1760 | Ga0395900_0231418 | |||
| 1761 | Ga0395900_0262157 | |||
| 1762 | Ga0395900_0443310 | |||
| 1763 | Ga0395900_0680176 | |||
| 1764 | Ga0395898_0003894 | |||
| 1765 | Ga0395898_0075612 | |||
| 1766 | Ga0395898_0120565 | |||
| 1767 | Ga0395898_0291355 | |||
| 1768 | Ga0395898_0655301 | |||
| 1769 | Ga0395905_0009180 | |||
| 1770 | Ga0395905_0749315 | |||
| 1771 | Ga0395905_1220297 | |||
| 1772 | Ga0316581_0010762 | |||
| 1773 | Ga0436364_0108657 | |||
| 1774 | Ga0436364_0263457 | |||
| 1775 | Ga0436364_0313993 | |||
| 1776 | Ga0436364_0620905 | |||
| 1777 | Ga0436364_0667270 | |||
| 1778 | Ga0436364_0746948 | |||
| 1779 | Ga0436364_0851474 | |||
| 1780 | Ga0436364_1234022 | |||
| 1781 | Ga0436364_1235254 | |||
| 1782 | Ga0436364_1382612 | |||
| 1783 | Ga0436364_1499708 | |||
| 1784 | Ga0436364_1512252 | |||
| 1785 | Ga0395901_0011518 | |||
| 1786 | Ga0395901_0012344 | |||
| 1787 | Ga0395901_0163193 | |||
| 1788 | Ga0395901_0755620 | |||
| 1789 | Ga0242420_036091 | |||
| 1790 | Ga0436365_0728596 | |||
| 1791 | Ga0436365_0838927 | |||
| 1792 | Ga0436365_0879082 | |||
| 1793 | Ga0436365_1835412 | |||
| 1794 | Ga0436360_1302274 | |||
| 1795 | Ga0436363_0423171 | |||
| 1796 | Ga0436363_0537553 | |||
| 1797 | Ga0436363_0729247 | |||
| 1798 | Ga0436363_0857353 | |||
| 1799 | Ga0436363_1709813 | |||
| 1800 | Ga0436362_0515179 | |||
| 1801 | Ga0436362_0535795 | |||
| 1802 | Ga0436362_0762648 | |||
| 1803 | Ga0451853_2653668 | |||
| 1804 | Ga0439448_0010736 | |||
| 1805 | Ga0439448_0056290 | |||
| 1806 | Ga0439448_0133650 | |||
| 1807 | Ga0439455_0015930 | |||
| 1808 | Ga0439463_006507 | |||
| 1809 | Ga0439458_0197856 | |||
| 1810 | Ga0439459_0035437 | |||
| 1811 | Ga0439440_0031573 | |||
| 1812 | Ga0466969_0016647 | |||
| 1813 | Ga0466969_0155369 | |||
| 1814 | Ga0466972_0599534 | |||
| 1815 | Ga0466965_0480738 | |||
| 1816 | Ga0466966_0352970 | |||
| 1817 | Ga0466961_0010897 | |||
| 1818 | Ga0466961_0014702 | |||
| 1819 | Ga0466961_0184651 | |||
| 1820 | Ga0466961_0821103 | |||
| 1821 | Ga0466963_0191050 | |||
| 1822 | Ga0466963_0201586 | |||
| 1823 | Ga0466963_0205742 | |||
| 1824 | Ga0466964_0078348 | |||
| 1825 | Ga0466964_0581700 | |||
| 1826 | Ga0466971_0089516 | |||
| 1827 | Ga0466971_0139463 | |||
| 1828 | Ga0466970_0005151 | |||
| 1829 | Ga0466970_0728175 | |||
| 1830 | Ga0466957_0016026 | |||
| 1831 | Ga0466957_0068488 | |||
| 1832 | Ga0466957_0944117 | |||
| 1833 | Ga0466960_0055075 | |||
| 1834 | Ga0466959_0087156 | |||
| 1835 | Ga0466958_0010977 | |||
| 1836 | Ga0466958_0152151 | |||
| 1837 | Ga0466958_0388857 | |||
| 1838 | Ga0466958_1059889 | |||
| 1839 | Ga0466967_0018473 | |||
| 1840 | Ga0466967_0183436 | |||
| 1841 | Ga0466967_0336139 | |||
| 1842 | Ga0466967_0563070 | |||
| 1843 | Ga0466967_0947411 | |||
| 1844 | Ga0495592_0006913 | |||
| 1845 | Ga0495592_0128159 | |||
| 1846 | Ga0495592_0177963 | |||
| 1847 | Ga0495592_0722516 | |||
| 1848 | Ga0495603_0001574 | |||
| 1849 | Ga0495629_0003373 | |||
| 1850 | Ga0495629_0243794 | |||
| 1851 | Ga0495629_0572619 | |||
| 1852 | Ga0495641_0004090 | |||
| 1853 | Ga0495641_0025003 | |||
| 1854 | Ga0495641_0086897 | |||
| 1855 | Ga0495651_0004709 | |||
| 1856 | Ga0495651_0031971 | |||
| 1857 | Ga0495651_0036142 | |||
| 1858 | Ga0495651_0090324 | |||
| 1859 | Ga0495651_0095680 | |||
| 1860 | Ga0495651_0100109 | |||
| 1861 | Ga0495651_0252673 | |||
| 1862 | Ga0495651_0287652 | |||
| 1863 | Ga0495653_0007298 | |||
| 1864 | Ga0495653_0039446 | |||
| 1865 | Ga0495653_0071807 | |||
| 1866 | Ga0495653_0382468 | |||
| 1867 | Ga0495580_0018888 | |||
| 1868 | Ga0495582_0038471 | |||
| 1869 | Ga0495582_0364232 | |||
| 1870 | Ga0495662_0000662 | |||
| 1871 | Ga0495662_0240320 | |||
| 1872 | Ga0495662_0381684 | |||
| 1873 | Ga0495664_0002834 | |||
| 1874 | Ga0495664_0066453 | |||
| 1875 | Ga0495664_0071409 | |||
| 1876 | Ga0495664_0825693 | |||
| 1877 | Ga0495594_0006963 | |||
| 1878 | Ga0495594_0015411 | |||
| 1879 | Ga0495608_0006489 | |||
| 1880 | Ga0495608_0021963 | |||
| 1881 | Ga0495608_0026229 | |||
| 1882 | Ga0495608_0031539 | |||
| 1883 | Ga0495618_0009092 | |||
| 1884 | Ga0495618_0075409 | |||
| 1885 | Ga0495618_0114518 | |||
| 1886 | Ga0495618_0616610 | |||
| 1887 | Ga0495628_0012848 | |||
| 1888 | Ga0495628_0015919 | |||
| 1889 | Ga0495628_0018102 | |||
| 1890 | Ga0495628_0065111 | |||
| 1891 | Ga0495628_0380620 | |||
| 1892 | Ga0495630_0002430 | |||
| 1893 | Ga0495630_0018482 | |||
| 1894 | Ga0495630_0067994 | |||
| 1895 | Ga0495666_0004269 | |||
| 1896 | Ga0495652_0006509 | |||
| 1897 | Ga0495652_0037433 | |||
| 1898 | Ga0495652_0058302 | |||
| 1899 | Ga0495665_0001359 | |||
| 1900 | Ga0495665_0030650 | |||
| 1901 | Ga0495640_0025392 | |||
| 1902 | Ga0495640_0028807 | |||
| 1903 | Ga0495586_0041499 | |||
| 1904 | Ga0495587_0029006 | |||
| 1905 | Ga0495587_0043586 | |||
| 1906 | Ga0495587_0116853 | |||
| 1907 | Ga0495645_0029596 | |||
| 1908 | Ga0495645_0035408 | |||
| 1909 | Ga0495645_0041269 | |||
| 1910 | Ga0495645_0111193 | |||
| 1911 | Ga0495645_0551421 | |||
| 1912 | Ga0495622_0066461 | |||
| 1913 | Ga0495622_0079104 | |||
| 1914 | Ga0495622_0136256 | |||
| 1915 | Ga0495667_0005787 | |||
| 1916 | Ga0495667_0009483 | |||
| 1917 | Ga0495667_0059785 | |||
| 1918 | Ga0495667_0130439 | |||
| 1919 | Ga0495634_0010845 | |||
| 1920 | Ga0495634_0038784 | |||
| 1921 | Ga0495635_0006817 | |||
| 1922 | Ga0495635_0013814 | |||
| 1923 | Ga0495635_0040834 | |||
| 1924 | Ga0495635_0042864 | |||
| 1925 | Ga0495588_0014179 | |||
| 1926 | Ga0495657_0063311 | |||
| 1927 | Ga0495657_0077729 | |||
| 1928 | Ga0495657_0085180 | |||
| 1929 | Ga0495657_0123913 | |||
| 1930 | Ga0495599_0055822 | |||
| 1931 | Ga0495599_0069872 | |||
| 1932 | Ga0495599_0176472 | |||
| 1933 | Ga0495599_0301242 | |||
| 1934 | Ga0495599_0732099 | |||
| 1935 | Ga0495623_0042974 | |||
| 1936 | Ga0495623_0047754 | |||
| 1937 | Ga0495623_0139272 | |||
| 1938 | Ga0495623_0485900 | |||
| 1939 | Ga0495646_0017948 | |||
| 1940 | Ga0495646_0032518 | |||
| 1941 | Ga0495647_0080310 | |||
| 1942 | Ga0495658_0035403 | |||
| 1943 | Ga0495658_0421985 | |||
| 1944 | Ga0495613_0003560 | |||
| 1945 | Ga0495613_0535575 | |||
| 1946 | Ga0495624_0004753 | |||
| 1947 | Ga0495624_0008258 | |||
| 1948 | Ga0495624_0086437 | |||
| 1949 | Ga0495624_0968152 | |||
| 1950 | Ga0495600_0024850 | |||
| 1951 | Ga0495600_0025919 | |||
| 1952 | Ga0495600_0042058 | |||
| 1953 | Ga0495600_0059108 | |||
| 1954 | Ga0495600_0094573 | |||
| 1955 | Ga0495581_0000263 | |||
| 1956 | Ga0495581_0156855 | |||
| 1957 | Ga0495581_0625899 | |||
| 1958 | Ga0495604_0005534 | |||
| 1959 | Ga0495604_0008117 | |||
| 1960 | Ga0495604_0063001 | |||
| 1961 | Ga0495604_0359536 | |||
| 1962 | Ga0495604_0368698 | |||
| 1963 | Ga0495674_0025319 | |||
| 1964 | Ga0495674_0300381 | |||
| 1965 | Ga0495676_0004207 | |||
| 1966 | Ga0495680_0008279 | |||
| 1967 | Ga0495680_0041045 | |||
| 1968 | Ga0495680_0107344 | |||
| 1969 | Ga0495680_0446027 | |||
| 1970 | Ga0495675_0008842 | |||
| 1971 | Ga0495684_0004343 | |||
| 1972 | Ga0495684_0015547 | |||
| 1973 | Ga0495684_0150006 | |||
| 1974 | Ga0495593_0000560 | |||
| 1975 | Ga0495593_0071315 | |||
| 1976 | Ga0495602_0040768 | |||
| 1977 | Ga0495602_0075578 | |||
| 1978 | Ga0495602_0441954 | |||
| 1979 | Ga0495614_0002333 | |||
| 1980 | Ga0496100_0066175 | |||
| 1981 | Ga0496100_0115887 | |||
| 1982 | Ga0496101_0021815 | |||
| 1983 | Ga0496102_0016882 | |||
| 1984 | Ga0496102_0122562 | |||
| 1985 | Ga0496102_0304286 | |||
| 1986 | Ga0496102_0666074 | |||
| 1987 | Ga0496103_0541535 | |||
| 1988 | Ga0496103_0813778 | |||
| 1989 | Ga0496104_0168334 | |||
| 1990 | Ga0496104_0444131 | |||
| 1991 | Ga0496104_0485653 | |||
| 1992 | Ga0496105_0039221 | |||
| 1993 | Ga0496105_0329646 | |||
| 1994 | Ga0496105_0441292 | |||
| 1995 | Ga0496105_0736103 | |||
| 1996 | Ga0496105_0818704 | |||
| 1997 | Ga0496106_0002401 | |||
| 1998 | Ga0496106_0775083 | |||
| 1999 | Ga0496107_0088882 | |||
| 2000 | Ga0496108_0015462 | |||
| 2001 | Ga0496108_0058790 | |||
| 2002 | Ga0496108_0362851 | |||
| 2003 | Ga0496108_0749754 | |||
| 2004 | Ga0496108_0994249 | |||
| 2005 | Ga0496108_1648908 | |||
| 2006 | Ga0496109_0095005 | |||
| 2007 | Ga0496109_1392085 | |||
| 2008 | Ga0496109_1615203 | |||
| 2009 | Ga0496110_0016790 | |||
| 2010 | Ga0496110_0069142 | |||
| 2011 | Ga0496110_1051948 | |||
| 2012 | Ga0496111_0017340 | |||
| 2013 | Ga0496111_0047729 | |||
| 2014 | Ga0496112_0009408 | |||
| 2015 | Ga0496112_0050630 | |||
| 2016 | Ga0496112_0157657 | |||
| 2017 | Ga0496112_0173067 | |||
| 2018 | Ga0496113_0067453 | |||
| 2019 | Ga0496113_0133356 | |||
| 2020 | Ga0496113_0399718 | |||
| 2021 | Ga0496114_0490744 | |||
| 2022 | Ga0496114_1221544 | |||
| 2023 | Ga0496115_0059342 | |||
| 2024 | Ga0496115_0136634 | |||
| 2025 | Ga0496119_0028875 | |||
| 2026 | Ga0496126_0036755 | |||
| 2027 | Ga0496126_0652055 | |||
| 2028 | Ga0501032_0108967 | |||
| 2029 | Ga0501034_0001833 | |||
| 2030 | Ga0501036_0023432 | |||
| 2031 | Ga0501037_0449294 | |||
| 2032 | Ga0501038_0089621 | |||
| 2033 | Ga0501042_0067780 | |||
| 2034 | Ga0501042_0069992 | |||
| 2035 | Ga0501042_1134065 | |||
| 2036 | Ga0501043_0001757 | |||
| 2037 | Ga0501047_0012436 | |||
| 2038 | Ga0501047_0051340 | |||
| 2039 | Ga0501047_0479993 | |||
| 2040 | Ga0501047_0849753 | |||
| 2041 | Ga0501048_0069116 | |||
| 2042 | Ga0501068_0430221 | |||
| 2043 | Ga0501069_0984531 | |||
| 2044 | Ga0501074_0001800 | |||
| 2045 | Ga0501077_0090862 | |||
| 2046 | Ga0501081_1409110 | |||
| 2047 | Ga0501083_0078619 | |||
| 2048 | Ga0501044_0082616 | |||
| 2049 | Ga0501044_1642909 | |||
| 2050 | Ga0501045_1188239 | |||
| 2051 | nmdc:mga05p37_11220_c1 | |||
| 2052 | nmdc:mga05p37_122880_c1 | |||
| 2053 | nmdc:mga05p37_194513_c1 | |||
| 2054 | nmdc:mga05p37_668592_c1 | |||
| 2055 | nmdc:mga05p37_70709_c1 | |||
| 2056 | nmdc:mga05p37_860663_c1 | |||
| 2057 | nmdc:mga09592_259491_c1 | |||
| 2058 | nmdc:mga09592_383231_c1 | |||
| 2059 | nmdc:mga09592_4491_c1 | |||
| 2060 | nmdc:mga09592_618634_c1 | |||
| 2061 | nmdc:mga0qj67_36507_c1 | |||
| 2062 | nmdc:mga06r32_11664_c1 | |||
| 2063 | nmdc:mga06r32_942963_c1 | |||
| 2064 | nmdc:mga08y16_1962216_c1 | |||
| 2065 | nmdc:mga08y16_60734_c1 | |||
| 2066 | nmdc:mga0n895_1761759_c1 | |||
| 2067 | nmdc:mga0n895_1903317_c1 | |||
| 2068 | nmdc:mga0n895_587277_c1 | |||
| 2069 | nmdc:mga0n895_67166_c1 | |||
| 2070 | nmdc:mga0rr50_36513_c1 | |||
| 2071 | nmdc:mga08x19_17616_c1 | |||
| 2072 | nmdc:mga08x19_96539_c1 | |||
| 2073 | nmdc:mga0a205_457852_c1 | |||
| 2074 | nmdc:mga0a205_63893_c1 | |||
| 2075 | Ga0495601_0063407 | |||
| 2076 | Ga0495601_0153359 | |||
| 2077 | Ga0495601_0390063 | |||
| 2078 | Ga0495612_0000642 | |||
| 2079 | Ga0495612_0007581 | |||
| 2080 | Ga0495612_0033877 | |||
| 2081 | Ga0495612_0177799 | |||
| 2082 | Ga0495595_0046484 | |||
| 2083 | Ga0495595_0109112 | |||
| 2084 | Ga0495619_0001852 | |||
| 2085 | Ga0495619_0080577 | |||
| 2086 | Ga0495619_0107503 | |||
| 2087 | Ga0495619_0626807 | |||
| 2088 | Ga0495619_0711752 | |||
| 2089 | Ga0495619_0794526 | |||
| 2090 | Ga0500630_261660 | |||
| 2091 | Ga0501084_1444110 | |||
| 2092 | Ga0587073_0178187 | |||
| 2093 | Ga0587077_243622 | |||
| 2094 | Ga0587083_0115572 | |||
| 2095 | Ga0587098_058950 | |||
| 2096 | Ga0587106_045502 | |||
| 2097 | Ga0587101_030434 | |||
| 2098 | Ga0587100_026826 | |||
| 2099 | Ga0587111_0100849 | |||
| 2100 | Ga0466962_0072621 | |||
| 2101 | Ga0466962_0430172 | |||
| 2102 | Ga0530510_0043987 | |||
| 2103 | 2554255960 | |||
| 2104 | 2619855820 | |||
| 2105 | 2620348262 | |||
| 2106 | 2676486012 | |||
| 2107 | 2862290411 | |||
| 2108 | 2895447694 | |||
| 2109 | 2935396044 | |||
| 2110 | 8053946865 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1j27-assembly1.cif.gz_A | crystal structure of a hypothetical protein, tt1725, from thermus thermophilus hb8 at 1.7a resolution | 0.9504 | 2 | 94 |
| 7bfd-assembly1.cif.gz_K | circular permutant of ribosomal protein s6, p54-55 truncated, y4a mutant. | 0.7712 | 4 | 92 |
| 7b90-assembly1.cif.gz_E | circular permutant of ribosomal protein s6, p54-55 truncated, i8a mutant | 0.7581 | 4 | 95 |
| 7bfe-assembly1.cif.gz_E | circular permutant of ribosomal protein s6, p54-55 truncated, l21a mutant. | 0.7491 | 4 | 92 |
| 7bfd-assembly1.cif.gz_K | circular permutant of ribosomal protein s6, p54-55 truncated, y4a mutant. | 0.7322 | 4 | 92 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O33252_1_96_3.30.70.1120 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like | 0.9867 | 1 | 96 | 3.30.70.1120 |
| af_O33252_1_96_3.30.70.1120 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like | 0.9666 | 1 | 96 | 3.30.70.1120 |
| 1j27A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like | 0.9507 | 2 | 94 | 3.30.70.1120 |
| af_P9WHL9_202_394_3.30.470.20 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.7463 | 25 | 77 | 3.30.470.20 |
| af_A0A1D6HD72_49_115_3.30.1360.10 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;RNA polymerase, RBP11-like subunit | 0.7278 | 5 | 57 | 3.30.1360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A543CDC8-F1-model_v4 | DUF503 domain-containing protein | 1.001 | 2 | 98 |
|
| AF-A0A543IIJ2-F1-model_v4 | DUF503 domain-containing protein | 1.001 | 2 | 98 |
|
| AF-A0A7Y9G934-F1-model_v4 | DUF503 domain-containing protein | 0.9983 | 2 | 98 |
|
| AF-W9DAE5-F1-model_v4 | deleted | 0.997 | 1 | 97 |
|
| AF-A0A1V2KRF2-F1-model_v4 | DUF503 domain-containing protein | 0.9967 | 1 | 97 |
|