F489157

General Info

Members Datasets Scaffolds Average Seq Length
1055 446 2110 98

Family's Representative Sequence

Representative Sequence 3300031507|Ga0307509_10512516|Ga0307509_105125162
Length 120
Sequence LEHGAFSPSFSLSERLTEVISQVYVGALTLDLLLGDVRSLKQKRSVIRPIVAEVQKRFPAVAVAETGENDLHRRAEIGVAVVSATADNCTHVLDACERLVAGRPEIELLSARQRLYNDED

Samples

Sample ID Description Type Environment
1 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
102 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
118 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
119 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
120 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
121 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
122 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
123 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
124 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
125 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
126 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
148 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
154 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
155 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
222 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
223 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
224 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
225 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
226 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
227 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
228 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
229 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
230 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300030886 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
236 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
237 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
238 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
239 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
240 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
241 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
242 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
243 3300031678 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
244 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
245 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
246 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
247 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
248 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
249 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
250 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
251 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
252 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
253 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
254 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
255 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
257 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
260 3300033548 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 Metagenome Unclassified
261 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
262 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
263 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
264 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
265 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
266 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
267 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
268 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
269 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
270 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
272 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
273 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
274 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
275 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
276 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
277 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
278 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
279 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
280 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
281 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
282 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
283 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
284 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
285 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
286 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
287 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
288 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
289 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
290 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
291 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
292 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
293 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
294 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
296 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
297 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
298 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
299 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
300 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
301 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
302 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
303 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
304 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
305 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
306 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
307 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
308 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
309 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
310 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
311 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
312 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
313 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
314 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
315 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
316 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
317 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
318 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
319 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
320 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
321 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
322 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
323 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
324 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
325 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
326 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
327 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
328 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
329 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
330 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
331 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
332 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
333 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
334 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
335 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
336 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
337 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
338 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
339 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
340 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
341 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
342 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
343 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
344 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
345 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
346 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
347 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
348 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
349 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
350 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
351 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
352 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
353 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
354 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
355 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
356 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
357 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
358 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
359 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
360 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
361 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
362 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
363 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
364 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
365 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
366 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
367 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
368 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
369 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
370 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
371 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
372 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
373 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
374 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
375 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
376 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
377 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
378 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
379 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
380 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
381 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
382 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
383 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
384 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
385 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
386 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
387 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
388 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
389 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
390 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
391 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
392 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
393 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
394 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
395 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
396 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
397 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
407 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
408 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
409 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
410 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
411 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
412 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
414 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
415 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
416 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
417 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
418 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
419 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
420 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
421 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
422 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
423 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
424 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
425 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
426 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
427 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
428 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
429 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
438 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
439 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
440 2619618881 Frankia sp. ACN1ag Isolate Unclassified
441 2619619003 Frankia sp. CpI1-P Isolate Nodule
442 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
443 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
444 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
445 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
446 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.89
Metatranscriptomes 6.35
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0.09
Rhizoplane 4.27
Rhizosphere 91.09
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307509_10512516 3300031507 Bacteria 882
2 JGI24735J21928_10171235 3300002067 Bacteria 628
3 JGI24738J21930_10061658 3300002075 Bacteria 771
4 JGI25406J46586_10019691 3300003203 Bacteria 2743
5 JGI25404J52841_10003154 3300003659 Bacteria 3225
6 Ga0058861_10050548 3300004800 Bacteria 976
7 Ga0070658_10077399 3300005327 Bacteria 2728
8 Ga0070658_10114670 3300005327 Bacteria 2235
9 Ga0070658_10186243 3300005327 Bacteria 1748
10 Ga0070676_10058660 3300005328 Bacteria 2281
11 Ga0070676_10065461 3300005328 Bacteria 2170
12 Ga0070683_100161126 3300005329 Bacteria 2128
13 Ga0070683_101712378 3300005329 Bacteria 604
14 Ga0070683_101842019 3300005329 Bacteria 582
15 Ga0070690_100141844 3300005330 Bacteria 1631
16 Ga0070670_101109341 3300005331 Bacteria 722
17 Ga0068869_100047053 3300005334 Bacteria 3113
18 Ga0068869_100261280 3300005334 Bacteria 1386
19 Ga0068869_101862294 3300005334 Bacteria 539
20 Ga0070666_10233102 3300005335 Bacteria 1300
21 Ga0070680_100099306 3300005336 Bacteria 2415
22 Ga0070680_100165816 3300005336 Bacteria 1857
23 Ga0070680_100166878 3300005336 Bacteria 1851
24 Ga0070680_100313519 3300005336 Bacteria 1331
25 Ga0070680_101215661 3300005336 Bacteria 652
26 Ga0070682_100295980 3300005337 Bacteria 1185
27 Ga0068868_100129961 3300005338 Bacteria 2060
28 Ga0070660_100335015 3300005339 Bacteria 1244
29 Ga0070660_100420630 3300005339 Bacteria 1106
30 Ga0070660_101601751 3300005339 Bacteria 554
31 Ga0070691_10018094 3300005341 Bacteria 3245
32 Ga0070691_10495152 3300005341 Bacteria 705
33 Ga0070691_10645624 3300005341 Bacteria 629
34 Ga0070691_10679883 3300005341 Bacteria 616
35 Ga0070687_100086341 3300005343 Bacteria 1724
36 Ga0070661_100301453 3300005344 Bacteria 1247
37 Ga0070661_100979072 3300005344 Bacteria 701
38 Ga0070692_10081597 3300005345 Bacteria 1743
39 Ga0070668_100809478 3300005347 Bacteria 833
40 Ga0070668_101200930 3300005347 Bacteria 687
41 Ga0070669_100668835 3300005353 Bacteria 875
42 Ga0070675_100138246 3300005354 Bacteria 2080
43 Ga0070675_100289066 3300005354 Bacteria 1442
44 Ga0070671_100097211 3300005355 Bacteria 2469
45 Ga0070674_100045756 3300005356 Bacteria 2990
46 Ga0070673_100026214 3300005364 Bacteria 4302
47 Ga0070673_100064467 3300005364 Bacteria 2919
48 Ga0070688_100570252 3300005365 Bacteria 863
49 Ga0070659_100258234 3300005366 Bacteria 1445
50 Ga0070659_101824341 3300005366 Bacteria 545
51 Ga0070667_100019139 3300005367 Bacteria 5678
52 Ga0070667_100239569 3300005367 Bacteria 1619
53 Ga0070667_100350887 3300005367 Bacteria 1336
54 Ga0070667_101312960 3300005367 Unclassified 678
55 Ga0070709_10019091 3300005434 Bacteria 3956
56 Ga0070709_10053195 3300005434 Bacteria 2548
57 Ga0070709_10090988 3300005434 Bacteria 2013
58 Ga0070709_10132410 3300005434 Bacteria 1704
59 Ga0070709_10250614 3300005434 Bacteria 1275
60 Ga0070714_100011051 3300005435 Bacteria 7153
61 Ga0070714_100059588 3300005435 Bacteria 3274
62 Ga0070714_100370473 3300005435 Bacteria 1348
63 Ga0070714_100496692 3300005435 Bacteria 1163
64 Ga0070714_100715931 3300005435 Bacteria 966
65 Ga0070713_100219475 3300005436 Bacteria 1724
66 Ga0070713_100246184 3300005436 Bacteria 1629
67 Ga0070713_100263298 3300005436 Bacteria 1576
68 Ga0070713_100460589 3300005436 Bacteria 1195
69 Ga0070713_100610859 3300005436 Bacteria 1036
70 Ga0070713_101567903 3300005436 Bacteria 639
71 Ga0070710_10050534 3300005437 Bacteria 2331
72 Ga0070710_10798997 3300005437 Bacteria 674
73 Ga0070710_10823778 3300005437 Bacteria 664
74 Ga0070710_10935656 3300005437 Bacteria 628
75 Ga0070701_10101501 3300005438 Bacteria 1594
76 Ga0070711_100017485 3300005439 Bacteria 4566
77 Ga0070711_100275335 3300005439 Bacteria 1329
78 Ga0070711_101151724 3300005439 Bacteria 669
79 Ga0070705_100063130 3300005440 Bacteria 2208
80 Ga0070705_100251841 3300005440 Bacteria 1240
81 Ga0070700_100471614 3300005441 Bacteria 960
82 Ga0070708_100134599 3300005445 Bacteria 2288
83 Ga0070708_100392108 3300005445 Bacteria 1309
84 Ga0070708_100585813 3300005445 Bacteria 1052
85 Ga0070708_101328181 3300005445 Bacteria 671
86 Ga0070663_100114507 3300005455 Bacteria 2030
87 Ga0070663_100217590 3300005455 Bacteria 1498
88 Ga0070663_100363354 3300005455 Bacteria 1175
89 Ga0070663_100831765 3300005455 Bacteria 793
90 Ga0070678_100208896 3300005456 Bacteria 1616
91 Ga0070678_100982960 3300005456 Bacteria 775
92 Ga0070662_100429005 3300005457 Bacteria 1095
93 Ga0070681_10024013 3300005458 Bacteria 6138
94 Ga0070681_10154212 3300005458 Bacteria 2222
95 Ga0070681_10535082 3300005458 Bacteria 1085
96 Ga0070681_11176724 3300005458 Bacteria 688
97 Ga0070681_11379844 3300005458 Bacteria 628
98 Ga0068867_100118995 3300005459 Bacteria 2039
99 Ga0070685_10015250 3300005466 Bacteria 4080
100 Ga0070685_10098587 3300005466 Bacteria 1781
101 Ga0070706_100022829 3300005467 Bacteria 5762
102 Ga0070706_100070425 3300005467 Bacteria 3234
103 Ga0070706_100120420 3300005467 Bacteria 2446
104 Ga0070706_100366837 3300005467 Bacteria 1342
105 Ga0070706_100798841 3300005467 Bacteria 873
106 Ga0070706_100938481 3300005467 Bacteria 799
107 Ga0070706_101173309 3300005467 Bacteria 706
108 Ga0070706_101246952 3300005467 Bacteria 682
109 Ga0070707_100036268 3300005468 Bacteria 4704
110 Ga0070707_100043862 3300005468 Bacteria 4281
111 Ga0070707_100158400 3300005468 Bacteria 2205
112 Ga0070707_100185126 3300005468 Bacteria 2030
113 Ga0070707_100746985 3300005468 Bacteria 942
114 Ga0070707_101944430 3300005468 Bacteria 556
115 Ga0070698_100003439 3300005471 Bacteria 17407
116 Ga0070698_100034744 3300005471 Bacteria 5216
117 Ga0070698_100087214 3300005471 Bacteria 3107
118 Ga0070698_100385190 3300005471 Bacteria 1335
119 Ga0070698_101726626 3300005471 Bacteria 578
120 Ga0070699_100010810 3300005518 Bacteria 7899
121 Ga0070699_100245834 3300005518 Bacteria 1598
122 Ga0070699_100600042 3300005518 Bacteria 1004
123 Ga0070679_100081061 3300005530 Bacteria 3234
124 Ga0070679_100164457 3300005530 Bacteria 2193
125 Ga0070684_100058031 3300005535 Bacteria 3381
126 Ga0070684_100058098 3300005535 Bacteria 3379
127 Ga0070684_101405717 3300005535 Bacteria 657
128 Ga0070684_101637431 3300005535 Bacteria 607
129 Ga0070684_101784621 3300005535 Bacteria 580
130 Ga0070684_101784657 3300005535 Bacteria 580
131 Ga0070697_100006581 3300005536 Bacteria 9005
132 Ga0070697_100355688 3300005536 Bacteria 1265
133 Ga0070697_101614871 3300005536 Bacteria 580
134 Ga0068853_100071201 3300005539 Bacteria 3027
135 Ga0068853_100294422 3300005539 Bacteria 1499
136 Ga0068853_100304730 3300005539 Bacteria 1473
137 Ga0068853_102125664 3300005539 Bacteria 544
138 Ga0070672_100188568 3300005543 Bacteria 1721
139 Ga0070686_100077111 3300005544 Bacteria 2196
140 Ga0070686_100655243 3300005544 Bacteria 833
141 Ga0070695_100166365 3300005545 Bacteria 1552
142 Ga0070695_100731917 3300005545 Bacteria 787
143 Ga0070696_100649300 3300005546 Bacteria 855
144 Ga0070693_100440758 3300005547 Bacteria 912
145 Ga0070693_100541611 3300005547 Bacteria 832
146 Ga0070693_101163821 3300005547 Bacteria 591
147 Ga0070693_101504710 3300005547 Bacteria 526
148 Ga0070665_100012829 3300005548 Bacteria 8437
149 Ga0070665_100212346 3300005548 Bacteria 1936
150 Ga0070665_100224452 3300005548 Bacteria 1879
151 Ga0070665_100266041 3300005548 Bacteria 1716
152 Ga0070665_100649471 3300005548 Bacteria 1068
153 Ga0070665_101885337 3300005548 Bacteria 604
154 Ga0070704_100195860 3300005549 Bacteria 1627
155 Ga0070704_100745863 3300005549 Bacteria 871
156 Ga0070704_102204589 3300005549 Bacteria 512
157 Ga0068855_100021107 3300005563 Bacteria 7809
158 Ga0068855_100565603 3300005563 Bacteria 1229
159 Ga0070664_100029287 3300005564 Bacteria 4590
160 Ga0068857_100036487 3300005577 Bacteria 4355
161 Ga0068857_101223864 3300005577 Bacteria 727
162 Ga0068857_101223865 3300005577 Bacteria 727
163 Ga0068857_102019311 3300005577 Bacteria 565
164 Ga0068854_100004751 3300005578 Bacteria 8566
165 Ga0068854_100054440 3300005578 Bacteria 2877
166 Ga0068854_100443282 3300005578 Bacteria 1083
167 Ga0068856_100182790 3300005614 Bacteria 2110
168 Ga0068856_100366862 3300005614 Bacteria 1459
169 Ga0068856_101485615 3300005614 Bacteria 692
170 Ga0068856_101498163 3300005614 Bacteria 688
171 Ga0070702_100173298 3300005615 Bacteria 1405
172 Ga0068852_100198342 3300005616 Bacteria 1898
173 Ga0068852_100261919 3300005616 Bacteria 1660
174 Ga0068852_101881100 3300005616 Bacteria 621
175 Ga0068859_100247012 3300005617 Bacteria 1874
176 Ga0068864_100481548 3300005618 Bacteria 1191
177 Ga0068864_100763173 3300005618 Bacteria 948
178 Ga0068864_100836027 3300005618 Bacteria 906
179 Ga0068866_10012061 3300005718 Bacteria 3759
180 Ga0068861_100009787 3300005719 Bacteria 6629
181 Ga0068861_100086090 3300005719 Bacteria 2470
182 Ga0068851_10388673 3300005834 Bacteria 819
183 Ga0068870_10155348 3300005840 Bacteria 1351
184 Ga0068863_100015044 3300005841 Bacteria 7434
185 Ga0068863_101390278 3300005841 Bacteria 710
186 Ga0068858_100979082 3300005842 Bacteria 828
187 Ga0068858_101406035 3300005842 Unclassified 687
188 Ga0068860_100293470 3300005843 Bacteria 1591
189 Ga0068862_100149526 3300005844 Bacteria 2078
190 Ga0081455_10012907 3300005937 Bacteria 8289
191 Ga0081455_10941865 3300005937 Bacteria 536
192 Ga0081540_1000009 3300005983 Bacteria 193562
193 Ga0081540_1006532 3300005983 Bacteria 8470
194 Ga0081539_10000846 3300005985 Bacteria 58555
195 Ga0070717_10133729 3300006028 Bacteria 2134
196 Ga0070717_10206461 3300006028 Bacteria 1723
197 Ga0070717_10446015 3300006028 Bacteria 1166
198 Ga0070717_11219293 3300006028 Bacteria 685
199 Ga0070717_11565673 3300006028 Bacteria 597
200 Ga0075365_11043605 3300006038 Bacteria 576
201 Ga0075432_10117156 3300006058 Bacteria 997
202 Ga0070715_10029477 3300006163 Bacteria 2210
203 Ga0070715_10058976 3300006163 Bacteria 1677
204 Ga0070715_10084267 3300006163 Bacteria 1449
205 Ga0070715_10165799 3300006163 Bacteria 1096
206 Ga0070716_100289285 3300006173 Bacteria 1134
207 Ga0070716_100455620 3300006173 Bacteria 933
208 Ga0070716_100463002 3300006173 Bacteria 927
209 Ga0070716_100478888 3300006173 Bacteria 914
210 Ga0070716_100581283 3300006173 Bacteria 840
211 Ga0070716_100642510 3300006173 Bacteria 803
212 Ga0070712_100013903 3300006175 Bacteria 5154
213 Ga0070712_100169901 3300006175 Bacteria 1691
214 Ga0070712_100273404 3300006175 Bacteria 1358
215 Ga0070712_100540101 3300006175 Bacteria 981
216 Ga0070712_100721144 3300006175 Bacteria 851
217 Ga0070712_101585978 3300006175 Bacteria 572
218 Ga0097621_100132185 3300006237 Bacteria 2125
219 Ga0068871_100057615 3300006358 Bacteria 3161
220 Ga0068871_100289812 3300006358 Bacteria 1434
221 Ga0068871_100521945 3300006358 Bacteria 1073
222 Ga0075428_100040546 3300006844 Bacteria 5122
223 Ga0075428_100053163 3300006844 Bacteria 4438
224 Ga0075430_100062344 3300006846 Bacteria 3133
225 Ga0075430_101144205 3300006846 Bacteria 641
226 Ga0075430_101404475 3300006846 Bacteria 574
227 Ga0075431_100009154 3300006847 Bacteria 9930
228 Ga0075431_100105695 3300006847 Bacteria 2904
229 Ga0075431_102091081 3300006847 Bacteria 521
230 Ga0075433_10286255 3300006852 Bacteria 1460
231 Ga0075434_100363345 3300006871 Bacteria 1468
232 Ga0075434_100474560 3300006871 Bacteria 1272
233 Ga0075434_100850503 3300006871 Bacteria 928
234 Ga0075434_101239176 3300006871 Bacteria 758
235 Ga0075434_101655801 3300006871 Bacteria 648
236 Ga0075429_100001463 3300006880 Bacteria 19406
237 Ga0075429_100004985 3300006880 Bacteria 11437
238 Ga0075429_100322444 3300006880 Bacteria 1352
239 Ga0068865_100343106 3300006881 Bacteria 1208
240 Ga0075436_100384904 3300006914 Bacteria 1015
241 Ga0097620_100246999 3300006931 Bacteria 1874
242 Ga0075435_100064873 3300007076 Bacteria 2968
243 Ga0075435_101517807 3300007076 Bacteria 588
244 Ga0099794_10157616 3300007265 Bacteria 1154
245 Ga0099794_10281148 3300007265 Bacteria 860
246 Ga0105251_10216133 3300009011 Bacteria 863
247 Ga0105244_10446617 3300009036 Bacteria 595
248 Ga0105244_10592447 3300009036 Bacteria 508
249 Ga0105250_10193607 3300009092 Bacteria 856
250 Ga0105240_10005049 3300009093 Bacteria 19797
251 Ga0105240_10148595 3300009093 Bacteria 2793
252 Ga0105240_10530028 3300009093 Bacteria 1306
253 Ga0105240_11240616 3300009093 Bacteria 788
254 Ga0111539_10095829 3300009094 Bacteria 3485
255 Ga0111539_11937737 3300009094 Bacteria 683
256 Ga0105245_10879852 3300009098 Bacteria 937
257 Ga0105245_11491215 3300009098 Bacteria 727
258 Ga0105245_11928268 3300009098 Bacteria 644
259 Ga0105247_10030756 3300009101 Bacteria 3255
260 Ga0105247_10093595 3300009101 Bacteria 1910
261 Ga0105247_10241327 3300009101 Bacteria 1231
262 Ga0105247_11565567 3300009101 Unclassified 540
263 Ga0114129_10005490 3300009147 Bacteria 17924
264 Ga0114129_10011782 3300009147 Bacteria 12442
265 Ga0114129_10098006 3300009147 Bacteria 4058
266 Ga0114129_10191923 3300009147 Bacteria 2773
267 Ga0114129_10689696 3300009147 Bacteria 1314
268 Ga0114129_11136350 3300009147 Bacteria 976
269 Ga0114129_12307258 3300009147 Bacteria 646
270 Ga0105243_10147129 3300009148 Bacteria 2017
271 Ga0105243_10250905 3300009148 Bacteria 1580
272 Ga0105243_10442798 3300009148 Bacteria 1217
273 Ga0105241_10002864 3300009174 Bacteria 12889
274 Ga0105241_10009338 3300009174 Bacteria 7209
275 Ga0105241_10023035 3300009174 Bacteria 4617
276 Ga0105241_11157959 3300009174 Bacteria 731
277 Ga0105248_10099174 3300009177 Bacteria 3282
278 Ga0105248_10133427 3300009177 Bacteria 2801
279 Ga0105248_10535853 3300009177 Bacteria 1320
280 Ga0105237_10006743 3300009545 Bacteria 12680
281 Ga0105237_10883528 3300009545 Bacteria 901
282 Ga0105237_11150672 3300009545 Bacteria 783
283 Ga0105237_11975529 3300009545 Bacteria 592
284 Ga0105238_10015348 3300009551 Bacteria 7757
285 Ga0105238_10103318 3300009551 Bacteria 2831
286 Ga0105238_10428255 3300009551 Bacteria 1319
287 Ga0105238_10447601 3300009551 Bacteria 1288
288 Ga0105238_11780418 3300009551 Bacteria 648
289 Ga0105238_12356847 3300009551 Bacteria 568
290 Ga0105249_10423985 3300009553 Bacteria 1365
291 Ga0105249_10952638 3300009553 Bacteria 926
292 Ga0099796_10208602 3300010159 Bacteria 796
293 Ga0105239_10028184 3300010375 Bacteria 6178
294 Ga0105239_10996700 3300010375 Bacteria 963
295 Ga0105246_10003333 3300011119 Bacteria 9719
296 Ga0105246_10067347 3300011119 Bacteria 2509
297 Ga0105246_10261241 3300011119 Bacteria 1380
298 Ga0157340_1005324 3300012473 Bacteria 774
299 Ga0157346_1012257 3300012480 Bacteria 647
300 Ga0157337_1002560 3300012483 Bacteria 1039
301 Ga0157325_1012806 3300012485 Bacteria 652
302 Ga0157343_1000771 3300012488 Bacteria 1390
303 Ga0157322_1002597 3300012490 Bacteria 1032
304 Ga0157323_1025849 3300012495 Bacteria 592
305 Ga0157342_1010144 3300012507 Bacteria 959
306 Ga0157315_1054815 3300012508 Bacteria 546
307 Ga0157326_1023376 3300012513 Bacteria 777
308 Ga0157373_10080944 3300013100 Bacteria 2290
309 Ga0157371_10026186 3300013102 Bacteria 4241
310 Ga0157371_10028526 3300013102 Bacteria 4041
311 Ga0157371_11045684 3300013102 Bacteria 624
312 Ga0157370_10096691 3300013104 Bacteria 2770
313 Ga0157370_10166858 3300013104 Bacteria 2047
314 Ga0157370_10415418 3300013104 Bacteria 1238
315 Ga0157369_10087391 3300013105 Bacteria 3329
316 Ga0157369_10192683 3300013105 Bacteria 2141
317 Ga0157369_10193030 3300013105 Bacteria 2139
318 Ga0157369_10207601 3300013105 Bacteria 2054
319 Ga0157369_10371209 3300013105 Bacteria 1485
320 Ga0157369_10421868 3300013105 Bacteria 1383
321 Ga0157369_12107754 3300013105 Bacteria 572
322 Ga0157374_10005049 3300013296 Bacteria 11068
323 Ga0157374_10453645 3300013296 Bacteria 1284
324 Ga0157374_10790396 3300013296 Bacteria 965
325 Ga0157374_12339877 3300013296 Bacteria 562
326 Ga0157378_10641435 3300013297 Bacteria 1077
327 Ga0157378_11270692 3300013297 Bacteria 777
328 Ga0163162_10460375 3300013306 Bacteria 1403
329 Ga0163162_10496834 3300013306 Bacteria 1351
330 Ga0157372_10333350 3300013307 Bacteria 1767
331 Ga0157372_11307306 3300013307 Bacteria 837
332 Ga0157375_10154278 3300013308 Bacteria 2434
333 Ga0157375_10348756 3300013308 Bacteria 1646
334 Ga0163163_10131321 3300014325 Bacteria 2545
335 Ga0163163_10451334 3300014325 Bacteria 1346
336 Ga0163163_10993766 3300014325 Bacteria 902
337 Ga0163163_11099001 3300014325 Bacteria 858
338 Ga0163163_11550685 3300014325 Bacteria 724
339 Ga0163163_13301814 3300014325 Bacteria 503
340 Ga0157380_10476799 3300014326 Bacteria 1206
341 Ga0157380_10703348 3300014326 Bacteria 1016
342 Ga0182008_10066425 3300014497 Bacteria 1775
343 Ga0182008_10083900 3300014497 Bacteria 1569
344 Ga0157377_10046061 3300014745 Bacteria 2438
345 Ga0157377_11461876 3300014745 Bacteria 542
346 Ga0157377_11670158 3300014745 Bacteria 513
347 Ga0157379_10219414 3300014968 Bacteria 1723
348 Ga0157379_10370864 3300014968 Bacteria 1312
349 Ga0157379_10441890 3300014968 Bacteria 1199
350 Ga0157376_10268229 3300014969 Bacteria 1602
351 Ga0157376_10616184 3300014969 Bacteria 1082
352 Ga0157376_10661613 3300014969 Bacteria 1046
353 Ga0182005_1024683 3300015265 Bacteria 1641
354 Ga0163161_10165684 3300017792 Bacteria 1687
355 Ga0197907_10040213 3300020069 Bacteria 946
356 Ga0197907_10134442 3300020069 Bacteria 3086
357 Ga0197907_10239040 3300020069 Bacteria 1366
358 Ga0197907_11079237 3300020069 Bacteria 1576
359 Ga0197907_11202783 3300020069 Bacteria 1821
360 Ga0197907_11233655 3300020069 Bacteria 1122
361 Ga0206356_10024402 3300020070 Bacteria 2500
362 Ga0206356_10473527 3300020070 Bacteria 1096
363 Ga0206356_10750368 3300020070 Bacteria 677
364 Ga0206356_10822231 3300020070 Bacteria 2273
365 Ga0206356_10869480 3300020070 Bacteria 1182
366 Ga0206356_11238138 3300020070 Bacteria 774
367 Ga0206349_1452056 3300020075 Bacteria 2372
368 Ga0206349_1676835 3300020075 Bacteria 1893
369 Ga0206349_1737499 3300020075 Bacteria 1334
370 Ga0206349_1774434 3300020075 Bacteria 550
371 Ga0206355_1028181 3300020076 Bacteria 1011
372 Ga0206355_1662650 3300020076 Bacteria 1148
373 Ga0206351_10115453 3300020077 Bacteria 1480
374 Ga0206351_10982567 3300020077 Bacteria 1504
375 Ga0206352_10504371 3300020078 Bacteria 1621
376 Ga0206352_10694081 3300020078 Bacteria 547
377 Ga0206350_10034037 3300020080 Bacteria 1130
378 Ga0206350_10358249 3300020080 Bacteria 1324
379 Ga0206350_10870138 3300020080 Bacteria 1283
380 Ga0206354_10379054 3300020081 Bacteria 2174
381 Ga0206354_10728610 3300020081 Bacteria 1042
382 Ga0206354_10896237 3300020081 Bacteria 2249
383 Ga0206354_10900266 3300020081 Bacteria 1055
384 Ga0206354_11642901 3300020081 Bacteria 805
385 Ga0206353_10064748 3300020082 Bacteria 1023
386 Ga0206353_10104151 3300020082 Bacteria 2368
387 Ga0206353_10739044 3300020082 Bacteria 1044
388 Ga0206353_11147038 3300020082 Bacteria 1535
389 Ga0206353_11347620 3300020082 Bacteria 634
390 Ga0206353_11694473 3300020082 Bacteria 1918
391 Ga0206353_11788060 3300020082 Bacteria 717
392 Ga0213873_10205543 3300021358 Bacteria 612
393 Ga0213875_10002550 3300021388 Bacteria 10865
394 Ga0213875_10016499 3300021388 Bacteria 3579
395 Ga0213875_10016913 3300021388 Bacteria 3532
396 Ga0213875_10025578 3300021388 Bacteria 2812
397 Ga0213875_10088465 3300021388 Bacteria 1445
398 Ga0213875_10202452 3300021388 Bacteria 934
399 Ga0213875_10248617 3300021388 Bacteria 838
400 Ga0224712_10014026 3300022467 Bacteria 2568
401 Ga0224712_10017963 3300022467 Bacteria 2355
402 Ga0224712_10031419 3300022467 Bacteria 1926
403 Ga0224712_10150122 3300022467 Bacteria 1032
404 Ga0224712_10584038 3300022467 Bacteria 545
405 Ga0207656_10041050 3300025321 Bacteria 1964
406 Ga0207656_10355025 3300025321 Bacteria 732
407 Ga0207655_1143876 3300025728 Bacteria 762
408 Ga0207653_10030471 3300025885 Bacteria 1741
409 Ga0207692_10013124 3300025898 Bacteria 3585
410 Ga0207692_10021079 3300025898 Bacteria 2976
411 Ga0207692_10050051 3300025898 Bacteria 2111
412 Ga0207692_10085068 3300025898 Bacteria 1701
413 Ga0207692_10424140 3300025898 Bacteria 833
414 Ga0207642_10077427 3300025899 Bacteria 1604
415 Ga0207710_10057377 3300025900 Bacteria 1759
416 Ga0207688_10017931 3300025901 Bacteria 3852
417 Ga0207680_10498412 3300025903 Bacteria 867
418 Ga0207647_10006461 3300025904 Bacteria 8520
419 Ga0207647_10098044 3300025904 Bacteria 1742
420 Ga0207647_10569375 3300025904 Bacteria 627
421 Ga0207685_10055403 3300025905 Bacteria 1548
422 Ga0207685_10121230 3300025905 Bacteria 1148
423 Ga0207685_10621905 3300025905 Bacteria 581
424 Ga0207685_10681936 3300025905 Bacteria 558
425 Ga0207699_10008764 3300025906 Bacteria 5007
426 Ga0207699_10073791 3300025906 Bacteria 2094
427 Ga0207699_10094495 3300025906 Bacteria 1883
428 Ga0207699_10103328 3300025906 Bacteria 1812
429 Ga0207699_10208817 3300025906 Bacteria 1327
430 Ga0207699_10247885 3300025906 Bacteria 1226
431 Ga0207699_10344694 3300025906 Bacteria 1050
432 Ga0207645_10041227 3300025907 Bacteria 2956
433 Ga0207705_10390344 3300025909 Bacteria 1076
434 Ga0207684_10040946 3300025910 Bacteria 3929
435 Ga0207684_10059276 3300025910 Bacteria 3250
436 Ga0207684_10172837 3300025910 Bacteria 1862
437 Ga0207684_10186279 3300025910 Bacteria 1790
438 Ga0207684_10408978 3300025910 Bacteria 1166
439 Ga0207684_10638192 3300025910 Bacteria 908
440 Ga0207684_10852026 3300025910 Bacteria 768
441 Ga0207654_10021325 3300025911 Bacteria 3444
442 Ga0207654_10073585 3300025911 Bacteria 2037
443 Ga0207707_10172743 3300025912 Bacteria 1888
444 Ga0207707_10198943 3300025912 Bacteria 1747
445 Ga0207707_11372113 3300025912 Bacteria 565
446 Ga0207707_11609758 3300025912 Bacteria 511
447 Ga0207695_10000449 3300025913 Bacteria 89856
448 Ga0207695_10352063 3300025913 Bacteria 1360
449 Ga0207671_10000052 3300025914 Bacteria 188462
450 Ga0207671_10112610 3300025914 Bacteria 2072
451 Ga0207693_10030647 3300025915 Bacteria 4249
452 Ga0207693_10040828 3300025915 Bacteria 3654
453 Ga0207693_10761776 3300025915 Bacteria 747
454 Ga0207663_10016875 3300025916 Bacteria 4060
455 Ga0207663_10112538 3300025916 Bacteria 1849
456 Ga0207663_10193911 3300025916 Bacteria 1461
457 Ga0207663_10391856 3300025916 Bacteria 1060
458 Ga0207663_10931971 3300025916 Bacteria 695
459 Ga0207660_10132698 3300025917 Bacteria 1897
460 Ga0207660_10324930 3300025917 Bacteria 1229
461 Ga0207660_11244807 3300025917 Bacteria 605
462 Ga0207662_10004683 3300025918 Bacteria 7220
463 Ga0207657_10051513 3300025919 Bacteria 3578
464 Ga0207657_10101618 3300025919 Bacteria 2386
465 Ga0207657_10774810 3300025919 Bacteria 742
466 Ga0207649_10061098 3300025920 Bacteria 2370
467 Ga0207652_10005773 3300025921 Bacteria 10041
468 Ga0207652_10106977 3300025921 Bacteria 2477
469 Ga0207652_10748069 3300025921 Bacteria 870
470 Ga0207652_10758159 3300025921 Bacteria 863
471 Ga0207646_10003188 3300025922 Bacteria 18739
472 Ga0207646_10131385 3300025922 Bacteria 2254
473 Ga0207646_10199598 3300025922 Bacteria 1807
474 Ga0207646_10510442 3300025922 Bacteria 1083
475 Ga0207646_10528097 3300025922 Bacteria 1062
476 Ga0207646_10726577 3300025922 Bacteria 887
477 Ga0207646_11259079 3300025922 Bacteria 647
478 Ga0207694_10000079 3300025924 Bacteria 111767
479 Ga0207694_10154280 3300025924 Bacteria 1851
480 Ga0207659_10183332 3300025926 Bacteria 1660
481 Ga0207687_10629327 3300025927 Bacteria 906
482 Ga0207687_10750300 3300025927 Bacteria 831
483 Ga0207687_11272542 3300025927 Bacteria 632
484 Ga0207700_10013850 3300025928 Bacteria 5266
485 Ga0207700_10044737 3300025928 Bacteria 3261
486 Ga0207700_10062352 3300025928 Bacteria 2831
487 Ga0207700_10306198 3300025928 Bacteria 1373
488 Ga0207700_10420267 3300025928 Bacteria 1174
489 Ga0207700_10555896 3300025928 Bacteria 1019
490 Ga0207700_10656503 3300025928 Bacteria 935
491 Ga0207700_11075068 3300025928 Bacteria 719
492 Ga0207664_10021682 3300025929 Bacteria 4783
493 Ga0207664_10029279 3300025929 Bacteria 4193
494 Ga0207664_10035671 3300025929 Bacteria 3839
495 Ga0207664_10064082 3300025929 Bacteria 2938
496 Ga0207664_10145790 3300025929 Bacteria 2007
497 Ga0207664_10220288 3300025929 Bacteria 1645
498 Ga0207664_10384490 3300025929 Bacteria 1246
499 Ga0207664_10839049 3300025929 Bacteria 826
500 Ga0207644_10297553 3300025931 Bacteria 1300
501 Ga0207644_10637241 3300025931 Bacteria 886
502 Ga0207690_10081243 3300025932 Bacteria 2264
503 Ga0207706_10410754 3300025933 Bacteria 1173
504 Ga0207686_10120631 3300025934 Bacteria 1784
505 Ga0207709_10305066 3300025935 Bacteria 1186
506 Ga0207670_10097441 3300025936 Bacteria 2093
507 Ga0207704_10176148 3300025938 Bacteria 1540
508 Ga0207665_10008152 3300025939 Bacteria 6915
509 Ga0207665_10030690 3300025939 Bacteria 3553
510 Ga0207665_10056775 3300025939 Bacteria 2643
511 Ga0207665_10077407 3300025939 Bacteria 2283
512 Ga0207665_10896130 3300025939 Bacteria 703
513 Ga0207691_10230112 3300025940 Bacteria 1605
514 Ga0207711_10195471 3300025941 Bacteria 1845
515 Ga0207689_10072095 3300025942 Bacteria 2837
516 Ga0207661_10024560 3300025944 Bacteria 4569
517 Ga0207661_10089973 3300025944 Bacteria 2555
518 Ga0207661_10153939 3300025944 Bacteria 1989
519 Ga0207661_10930771 3300025944 Bacteria 800
520 Ga0207667_10017127 3300025949 Bacteria 8169
521 Ga0207667_10138355 3300025949 Bacteria 2507
522 Ga0207651_10318437 3300025960 Bacteria 1299
523 Ga0207712_10222920 3300025961 Bacteria 1509
524 Ga0207712_10301408 3300025961 Bacteria 1315
525 Ga0207668_10114515 3300025972 Bacteria 2030
526 Ga0207668_10578798 3300025972 Bacteria 976
527 Ga0207640_10006042 3300025981 Bacteria 6618
528 Ga0207640_11816465 3300025981 Bacteria 551
529 Ga0207658_10023037 3300025986 Bacteria 4342
530 Ga0207658_10187864 3300025986 Bacteria 1715
531 Ga0207658_11814357 3300025986 Unclassified 556
532 Ga0207677_10328160 3300026023 Bacteria 1274
533 Ga0207703_11288228 3300026035 Bacteria 703
534 Ga0207639_11679320 3300026041 Bacteria 595
535 Ga0207678_10061626 3300026067 Bacteria 3226
536 Ga0207678_10228781 3300026067 Bacteria 1592
537 Ga0207678_10626017 3300026067 Bacteria 944
538 Ga0207708_10067415 3300026075 Bacteria 2737
539 Ga0207702_10070332 3300026078 Bacteria 3010
540 Ga0207702_10079881 3300026078 Bacteria 2836
541 Ga0207702_10299375 3300026078 Bacteria 1526
542 Ga0207702_10389451 3300026078 Bacteria 1342
543 Ga0207702_11464960 3300026078 Bacteria 676
544 Ga0207641_10043174 3300026088 Bacteria 3785
545 Ga0207641_10199139 3300026088 Bacteria 1845
546 Ga0207648_10048063 3300026089 Bacteria 3737
547 Ga0207676_10131492 3300026095 Bacteria 2128
548 Ga0207676_10955708 3300026095 Unclassified 843
549 Ga0207676_12419906 3300026095 Bacteria 522
550 Ga0207674_10020491 3300026116 Bacteria 7142
551 Ga0207674_10141959 3300026116 Bacteria 2361
552 Ga0207675_100016033 3300026118 Bacteria 6995
553 Ga0207675_100777514 3300026118 Bacteria 970
554 Ga0207675_100854762 3300026118 Bacteria 925
555 Ga0207683_10001450 3300026121 Bacteria 21423
556 Ga0207698_10052683 3300026142 Bacteria 3119
557 Ga0207698_10223496 3300026142 Bacteria 1703
558 Ga0207698_10434028 3300026142 Bacteria 1264
559 Ga0207698_11853092 3300026142 Bacteria 618
560 Ga0209588_1200788 3300027671 Bacteria 621
561 Ga0268266_10041880 3300028379 Bacteria 3910
562 Ga0268266_10080057 3300028379 Bacteria 2846
563 Ga0268266_10109148 3300028379 Bacteria 2450
564 Ga0268266_10121394 3300028379 Bacteria 2326
565 Ga0268266_10268326 3300028379 Bacteria 1583
566 Ga0268264_10253422 3300028381 Bacteria 1636
567 Ga0265337_1029278 3300028556 Bacteria 1647
568 Ga0265326_10007790 3300028558 Bacteria 3263
569 Ga0265319_1028537 3300028563 Bacteria 1966
570 Ga0265334_10009187 3300028573 Bacteria 4188
571 Ga0265334_10009842 3300028573 Bacteria 4040
572 Ga0265318_10070223 3300028577 Bacteria 1298
573 Ga0265322_10007800 3300028654 Bacteria 3120
574 Ga0265336_10012599 3300028666 Bacteria 2841
575 Ga0265338_10003311 3300028800 Bacteria 22817
576 Ga0265338_10101236 3300028800 Bacteria 2346
577 Ga0265324_10004355 3300029957 Bacteria 6437
578 Ga0265762_1022334 3300030760 Bacteria 1170
579 Ga0265762_1123363 3300030760 Bacteria 594
580 Ga0265766_1001019 3300030863 Bacteria 1338
581 Ga0265764_101113 3300030882 Bacteria 1147
582 Ga0265772_102455 3300030886 Bacteria 731
583 Ga0265769_101054 3300030888 Bacteria 1248
584 Ga0265330_10218379 3300031235 Bacteria 805
585 Ga0265332_10018388 3300031238 Bacteria 3083
586 Ga0265320_10046163 3300031240 Bacteria 2136
587 Ga0265325_10032851 3300031241 Bacteria 2768
588 Ga0265340_10027939 3300031247 Bacteria 2840
589 Ga0265316_10006980 3300031344 Bacteria 10705
590 Ga0310103_132896 3300031614 Bacteria 617
591 Ga0310111_101896 3300031667 Bacteria 2357
592 Ga0310114_120261 3300031678 Unclassified 592
593 Ga0316579_10053204 3300031691 Bacteria 1896
594 Ga0265342_10002252 3300031712 Bacteria 16856
595 Ga0316576_10317935 3300031727 Bacteria 1161
596 Ga0316578_10004365 3300031728 Bacteria 6666
597 Ga0307413_10537971 3300031824 Bacteria 945
598 Ga0307410_10127879 3300031852 Bacteria 1862
599 Ga0307410_11321012 3300031852 Unclassified 631
600 Ga0307406_10165726 3300031901 Bacteria 1594
601 Ga0307406_10836277 3300031901 Bacteria 779
602 Ga0307415_100360260 3300032126 Bacteria 1228
603 Ga0316583_10015746 3300032133 Bacteria 2723
604 Ga0316585_10001193 3300032137 Bacteria 6785
605 Ga0316580_10002452 3300032139 Bacteria 5102
606 Ga0316593_10001329 3300032168 Bacteria 5401
607 Ga0307507_10202340 3300033179 Bacteria 1371
608 Ga0307507_10447720 3300033179 Bacteria 714
609 Ga0307507_10517086 3300033179 Bacteria 638
610 Ga0316592_1005348 3300033524 Bacteria 2433
611 Ga0316596_1002330 3300033541 Bacteria 4037
612 Ga0316212_1003332 3300033547 Bacteria 2316
613 Ga0316216_1007074 3300033548 Bacteria 839
614 Ga0373930_0012934 3300034816 Bacteria 1530
615 Ga0373948_0005644 3300034817 Bacteria 2038
616 Ga0373959_0003163 3300034820 Bacteria 2622
617 Ga0373938_0018325 3300034957 Bacteria 1388
618 Ga0373926_0002035 3300035083 Bacteria 6359
619 Ga0373926_0006212 3300035083 Bacteria 3963
620 Ga0373926_0160848 3300035083 Bacteria 857
621 Ga0373934_0007699 3300035086 Bacteria 4003
622 Ga0373934_0027044 3300035086 Bacteria 2227
623 Ga0373934_0093738 3300035086 Bacteria 1212
624 Ga0373934_0414476 3300035086 Bacteria 563
625 Ga0373944_0009356 3300035089 Bacteria 2655
626 Ga0373944_0114910 3300035089 Bacteria 922
627 Ga0373949_0008788 3300035090 Bacteria 2210
628 Ga0373951_0016297 3300035091 Bacteria 1676
629 Ga0373923_0000406 3300035111 Bacteria 10002
630 Ga0373923_0006683 3300035111 Bacteria 4005
631 Ga0373932_0054516 3300035112 Bacteria 1197
632 Ga0373936_0008014 3300035113 Bacteria 3969
633 Ga0373936_0015213 3300035113 Bacteria 2947
634 Ga0373936_0025086 3300035113 Bacteria 2329
635 Ga0373941_0011747 3300035115 Bacteria 2270
636 Ga0373945_0002694 3300035116 Bacteria 5573
637 Ga0373945_0093513 3300035116 Bacteria 1167
638 Ga0373945_0173980 3300035116 Bacteria 883
639 Ga0373953_0010369 3300035117 Bacteria 3240
640 Ga0373953_0043540 3300035117 Bacteria 1792
641 Ga0373954_0003330 3300035118 Bacteria 6795
642 Ga0373954_0016223 3300035118 Bacteria 3332
643 Ga0373954_0041295 3300035118 Bacteria 2150
644 Ga0373956_0005088 3300035119 Bacteria 5261
645 Ga0373956_0056135 3300035119 Bacteria 1777
646 Ga0373957_0008357 3300035120 Bacteria 3348
647 Ga0373957_0028205 3300035120 Bacteria 2044
648 Ga0373960_0039269 3300035121 Bacteria 1360
649 Ga0373960_0078459 3300035121 Bacteria 1035
650 Ga0373943_0000399 3300035170 Bacteria 18249
651 Ga0373943_0000928 3300035170 Bacteria 12910
652 Ga0373943_0240704 3300035170 Bacteria 1014
653 Ga0373946_0000096 3300035171 Bacteria 24568
654 Ga0373946_0007742 3300035171 Bacteria 3938
655 Ga0373946_0590038 3300035171 Bacteria 575
656 Ga0373955_0009583 3300035172 Bacteria 4544
657 Ga0373955_0026141 3300035172 Bacteria 3003
658 Ga0373955_0078893 3300035172 Bacteria 1856
659 Ga0373955_0216370 3300035172 Bacteria 1143
660 Ga0373942_0017840 3300035207 Bacteria 1755
661 Ga0373961_0110429 3300035241 Bacteria 900
662 Ga0373962_0187310 3300035242 Bacteria 695
663 Ga0316574_0078457 3300035398 Bacteria 2093
664 Ga0373924_0001557 3300035410 Bacteria 7487
665 Ga0373924_0006457 3300035410 Bacteria 4202
666 Ga0373924_0017498 3300035410 Bacteria 2751
667 Ga0373931_0117461 3300035691 Bacteria 1516
668 Ga0373935_0001778 3300035692 Bacteria 12124
669 Ga0373935_0002824 3300035692 Bacteria 9997
670 Ga0373935_0003633 3300035692 Bacteria 8994
671 Ga0373935_0087419 3300035692 Bacteria 2035
672 Ga0373935_0820762 3300035692 Bacteria 687
673 Ga0373935_0870977 3300035692 Bacteria 666
674 Ga0373935_1140777 3300035692 Bacteria 580
675 Ga0373927_0002491 3300035695 Bacteria 13440
676 Ga0373927_0006534 3300035695 Bacteria 7942
677 Ga0373927_0158724 3300035695 Bacteria 1481
678 Ga0373933_0006735 3300035724 Bacteria 6263
679 Ga0373933_0010409 3300035724 Bacteria 5098
680 Ga0373933_0619400 3300035724 Bacteria 711
681 Ga0373933_0833777 3300035724 Bacteria 607
682 Ga0373947_0000041 3300035725 Bacteria 62914
683 Ga0373947_0012716 3300035725 Bacteria 4825
684 Ga0373947_0231771 3300035725 Bacteria 1216
685 Ga0373937_0025411 3300036401 Bacteria 5345
686 Ga0373937_0074945 3300036401 Bacteria 3123
687 Ga0373937_0212914 3300036401 Bacteria 1818
688 Ga0373937_1067520 3300036401 Bacteria 756
689 Ga0265778_003501 3300036457 Bacteria 1582
690 Ga0372808_008932 3300036459 Bacteria 1395
691 Ga0310109_004114 3300036534 Bacteria 1783
692 Ga0310109_017818 3300036534 Bacteria 960
693 Ga0316582_0022422 3300036647 Bacteria 3748
694 Ga0316584_0039982 3300036712 Bacteria 3493
695 Ga0373925_0000539 3300037068 Bacteria 37333
696 Ga0373925_0002876 3300037068 Bacteria 13595
697 Ga0373925_0004812 3300037068 Bacteria 10171
698 Ga0373925_0059415 3300037068 Bacteria 2868
699 Ga0373925_0103638 3300037068 Bacteria 2190
700 Ga0373925_1030362 3300037068 Bacteria 677
701 Ga0395899_0022158 3300037312 Bacteria 4817
702 Ga0395899_0022741 3300037312 Bacteria 4750
703 Ga0395899_0469714 3300037312 Bacteria 821
704 Ga0395900_0025148 3300037418 Bacteria 6095
705 Ga0395900_0231418 3300037418 Bacteria 1858
706 Ga0395900_0262157 3300037418 Bacteria 1725
707 Ga0395900_0443310 3300037418 Bacteria 1256
708 Ga0395900_0680176 3300037418 Bacteria 964
709 Ga0395898_0003894 3300037466 Bacteria 16487
710 Ga0395898_0075612 3300037466 Bacteria 3253
711 Ga0395898_0120565 3300037466 Bacteria 2513
712 Ga0395898_0291355 3300037466 Bacteria 1557
713 Ga0395898_0655301 3300037466 Bacteria 992
714 Ga0395905_0009180 3300037471 Bacteria 9682
715 Ga0395905_0749315 3300037471 Bacteria 879
716 Ga0395905_1220297 3300037471 Bacteria 656
717 Ga0316581_0010762 3300037588 Bacteria 2543
718 Ga0436364_0108657 3300037853 Bacteria 2790
719 Ga0436364_0263457 3300037853 Bacteria 4794
720 Ga0436364_0313993 3300037853 Bacteria 1430
721 Ga0436364_0620905 3300037853 Bacteria 3546
722 Ga0436364_0667270 3300037853 Bacteria 158868
723 Ga0436364_0746948 3300037853 Bacteria 844
724 Ga0436364_0851474 3300037853 Bacteria 640
725 Ga0436364_1234022 3300037853 Bacteria 1031
726 Ga0436364_1235254 3300037853 Bacteria 853
727 Ga0436364_1382612 3300037853 Bacteria 1110
728 Ga0436364_1499708 3300037853 Bacteria 1199
729 Ga0436364_1512252 3300037853 Bacteria 784
730 Ga0395901_0011518 3300038443 Bacteria 8961
731 Ga0395901_0012344 3300038443 Bacteria 8666
732 Ga0395901_0163193 3300038443 Bacteria 2340
733 Ga0395901_0755620 3300038443 Bacteria 965
734 Ga0242420_036091 3300038996 Bacteria 932
735 Ga0436365_0728596 3300039437 Bacteria 657
736 Ga0436365_0838927 3300039437 Bacteria 653
737 Ga0436365_0879082 3300039437 Bacteria 2037
738 Ga0436365_1835412 3300039437 Bacteria 2080
739 Ga0436360_1302274 3300039438 Bacteria 614
740 Ga0436363_0423171 3300039450 Bacteria 2573
741 Ga0436363_0537553 3300039450 Bacteria 650
742 Ga0436363_0729247 3300039450 Bacteria 511
743 Ga0436363_0857353 3300039450 Bacteria 2897
744 Ga0436363_1709813 3300039450 Bacteria 1988
745 Ga0436362_0515179 3300039453 Bacteria 1433
746 Ga0436362_0535795 3300039453 Bacteria 1033
747 Ga0436362_0762648 3300039453 Bacteria 722
748 Ga0451853_2653668 3300041512 Bacteria 1096
749 Ga0439448_0010736 3300042005 Bacteria 2720
750 Ga0439448_0056290 3300042005 Bacteria 1294
751 Ga0439448_0133650 3300042005 Bacteria 856
752 Ga0439455_0015930 3300042012 Bacteria 1733
753 Ga0439463_006507 3300042016 Bacteria 2895
754 Ga0439458_0197856 3300042157 Bacteria 549
755 Ga0439459_0035437 3300042438 Bacteria 1037
756 Ga0439440_0031573 3300042993 Bacteria 1253
757 Ga0466969_0016647 3300044656 Bacteria 3845
758 Ga0466969_0155369 3300044656 Bacteria 1053
759 Ga0466972_0599534 3300044658 Bacteria 521
760 Ga0466965_0480738 3300044683 Bacteria 695
761 Ga0466966_0352970 3300044684 Bacteria 884
762 Ga0466961_0010897 3300044693 Bacteria 5807
763 Ga0466961_0014702 3300044693 Bacteria 5030
764 Ga0466961_0184651 3300044693 Bacteria 1294
765 Ga0466961_0821103 3300044693 Bacteria 555
766 Ga0466963_0191050 3300044694 Bacteria 1431
767 Ga0466963_0201586 3300044694 Bacteria 1392
768 Ga0466963_0205742 3300044694 Bacteria 1377
769 Ga0466964_0078348 3300044706 Bacteria 1413
770 Ga0466964_0581700 3300044706 Bacteria 612
771 Ga0466971_0089516 3300044719 Bacteria 1409
772 Ga0466971_0139463 3300044719 Bacteria 1129
773 Ga0466970_0005151 3300044765 Bacteria 6464
774 Ga0466970_0728175 3300044765 Bacteria 579
775 Ga0466957_0016026 3300044842 Bacteria 4380
776 Ga0466957_0068488 3300044842 Bacteria 2191
777 Ga0466957_0944117 3300044842 Bacteria 618
778 Ga0466960_0055075 3300044901 Bacteria 1933
779 Ga0466959_0087156 3300045049 Bacteria 2246
780 Ga0466958_0010977 3300045836 Bacteria 5091
781 Ga0466958_0152151 3300045836 Bacteria 1460
782 Ga0466958_0388857 3300045836 Bacteria 900
783 Ga0466958_1059889 3300045836 Bacteria 529
784 Ga0466967_0018473 3300045976 Bacteria 5574
785 Ga0466967_0183436 3300045976 Bacteria 1975
786 Ga0466967_0336139 3300045976 Bacteria 1459
787 Ga0466967_0563070 3300045976 Bacteria 1122
788 Ga0466967_0947411 3300045976 Bacteria 857
789 Ga0495592_0006913 3300046454 Bacteria 8475
790 Ga0495592_0128159 3300046454 Bacteria 1777
791 Ga0495592_0177963 3300046454 Bacteria 1451
792 Ga0495592_0722516 3300046454 Bacteria 597
793 Ga0495603_0001574 3300046455 Bacteria 13347
794 Ga0495629_0003373 3300046459 Bacteria 12070
795 Ga0495629_0243794 3300046459 Bacteria 1237
796 Ga0495629_0572619 3300046459 Bacteria 757
797 Ga0495641_0004090 3300046461 Bacteria 10521
798 Ga0495641_0025003 3300046461 Bacteria 2936
799 Ga0495641_0086897 3300046461 Bacteria 1399
800 Ga0495651_0004709 3300046462 Bacteria 10438
801 Ga0495651_0031971 3300046462 Bacteria 4104
802 Ga0495651_0036142 3300046462 Bacteria 3845
803 Ga0495651_0090324 3300046462 Bacteria 2298
804 Ga0495651_0095680 3300046462 Bacteria 2220
805 Ga0495651_0100109 3300046462 Bacteria 2159
806 Ga0495651_0252673 3300046462 Bacteria 1203
807 Ga0495651_0287652 3300046462 Bacteria 1107
808 Ga0495653_0007298 3300046463 Bacteria 9053
809 Ga0495653_0039446 3300046463 Bacteria 3699
810 Ga0495653_0071807 3300046463 Bacteria 2586
811 Ga0495653_0382468 3300046463 Bacteria 898
812 Ga0495580_0018888 3300046472 Bacteria 5128
813 Ga0495582_0038471 3300046473 Bacteria 2632
814 Ga0495582_0364232 3300046473 Bacteria 833
815 Ga0495662_0000662 3300046476 Bacteria 16218
816 Ga0495662_0240320 3300046476 Bacteria 892
817 Ga0495662_0381684 3300046476 Bacteria 692
818 Ga0495664_0002834 3300046477 Bacteria 9329
819 Ga0495664_0066453 3300046477 Bacteria 2150
820 Ga0495664_0071409 3300046477 Bacteria 2073
821 Ga0495664_0825693 3300046477 Bacteria 544
822 Ga0495594_0006963 3300046499 Bacteria 5812
823 Ga0495594_0015411 3300046499 Bacteria 4015
824 Ga0495608_0006489 3300046511 Bacteria 8303
825 Ga0495608_0021963 3300046511 Bacteria 4377
826 Ga0495608_0026229 3300046511 Bacteria 3974
827 Ga0495608_0031539 3300046511 Bacteria 3583
828 Ga0495618_0009092 3300046514 Bacteria 5996
829 Ga0495618_0075409 3300046514 Bacteria 2148
830 Ga0495618_0114518 3300046514 Bacteria 1726
831 Ga0495618_0616610 3300046514 Bacteria 644
832 Ga0495628_0012848 3300046516 Bacteria 7050
833 Ga0495628_0015919 3300046516 Bacteria 6275
834 Ga0495628_0018102 3300046516 Bacteria 5843
835 Ga0495628_0065111 3300046516 Bacteria 2852
836 Ga0495628_0380620 3300046516 Bacteria 1033
837 Ga0495630_0002430 3300046517 Bacteria 12900
838 Ga0495630_0018482 3300046517 Bacteria 5121
839 Ga0495630_0067994 3300046517 Bacteria 2678
840 Ga0495666_0004269 3300046526 Bacteria 7206
841 Ga0495652_0006509 3300046529 Bacteria 10862
842 Ga0495652_0037433 3300046529 Bacteria 4209
843 Ga0495652_0058302 3300046529 Bacteria 3269
844 Ga0495665_0001359 3300046531 Bacteria 13086
845 Ga0495665_0030650 3300046531 Bacteria 2879
846 Ga0495640_0025392 3300046533 Bacteria 4298
847 Ga0495640_0028807 3300046533 Bacteria 3994
848 Ga0495586_0041499 3300046535 Bacteria 2478
849 Ga0495587_0029006 3300046536 Bacteria 3361
850 Ga0495587_0043586 3300046536 Bacteria 2672
851 Ga0495587_0116853 3300046536 Bacteria 1529
852 Ga0495645_0029596 3300046543 Bacteria 3983
853 Ga0495645_0035408 3300046543 Bacteria 3639
854 Ga0495645_0041269 3300046543 Bacteria 3364
855 Ga0495645_0111193 3300046543 Bacteria 1938
856 Ga0495645_0551421 3300046543 Bacteria 714
857 Ga0495622_0066461 3300046557 Bacteria 1667
858 Ga0495622_0079104 3300046557 Bacteria 1513
859 Ga0495622_0136256 3300046557 Bacteria 1116
860 Ga0495667_0005787 3300046559 Bacteria 8372
861 Ga0495667_0009483 3300046559 Bacteria 6595
862 Ga0495667_0059785 3300046559 Bacteria 2500
863 Ga0495667_0130439 3300046559 Bacteria 1621
864 Ga0495634_0010845 3300046642 Bacteria 6662
865 Ga0495634_0038784 3300046642 Bacteria 3246
866 Ga0495635_0006817 3300046663 Bacteria 7983
867 Ga0495635_0013814 3300046663 Bacteria 5648
868 Ga0495635_0040834 3300046663 Bacteria 3205
869 Ga0495635_0042864 3300046663 Bacteria 3123
870 Ga0495588_0014179 3300046674 Bacteria 3811
871 Ga0495657_0063311 3300046675 Bacteria 2440
872 Ga0495657_0077729 3300046675 Bacteria 2152
873 Ga0495657_0085180 3300046675 Bacteria 2037
874 Ga0495657_0123913 3300046675 Bacteria 1625
875 Ga0495599_0055822 3300046678 Bacteria 2472
876 Ga0495599_0069872 3300046678 Bacteria 2191
877 Ga0495599_0176472 3300046678 Bacteria 1317
878 Ga0495599_0301242 3300046678 Bacteria 967
879 Ga0495599_0732099 3300046678 Bacteria 568
880 Ga0495623_0042974 3300046679 Bacteria 2877
881 Ga0495623_0047754 3300046679 Bacteria 2717
882 Ga0495623_0139272 3300046679 Bacteria 1445
883 Ga0495623_0485900 3300046679 Bacteria 653
884 Ga0495646_0017948 3300046680 Bacteria 4482
885 Ga0495646_0032518 3300046680 Bacteria 3246
886 Ga0495647_0080310 3300046681 Bacteria 1321
887 Ga0495658_0035403 3300046683 Bacteria 2746
888 Ga0495658_0421985 3300046683 Bacteria 851
889 Ga0495613_0003560 3300046689 Bacteria 11677
890 Ga0495613_0535575 3300046689 Bacteria 785
891 Ga0495624_0004753 3300046690 Bacteria 9880
892 Ga0495624_0008258 3300046690 Bacteria 7280
893 Ga0495624_0086437 3300046690 Bacteria 1937
894 Ga0495624_0968152 3300046690 Bacteria 500
895 Ga0495600_0024850 3300046809 Bacteria 3856
896 Ga0495600_0025919 3300046809 Bacteria 3781
897 Ga0495600_0042058 3300046809 Bacteria 2978
898 Ga0495600_0059108 3300046809 Bacteria 2504
899 Ga0495600_0094573 3300046809 Bacteria 1948
900 Ga0495581_0000263 3300047315 Bacteria 25263
901 Ga0495581_0156855 3300047315 Bacteria 1330
902 Ga0495581_0625899 3300047315 Bacteria 623
903 Ga0495604_0005534 3300047317 Bacteria 10016
904 Ga0495604_0008117 3300047317 Bacteria 8313
905 Ga0495604_0063001 3300047317 Bacteria 2830
906 Ga0495604_0359536 3300047317 Bacteria 966
907 Ga0495604_0368698 3300047317 Bacteria 951
908 Ga0495674_0025319 3300047319 Bacteria 5441
909 Ga0495674_0300381 3300047319 Bacteria 1311
910 Ga0495676_0004207 3300047321 Bacteria 13140
911 Ga0495680_0008279 3300047322 Bacteria 9467
912 Ga0495680_0041045 3300047322 Bacteria 3680
913 Ga0495680_0107344 3300047322 Bacteria 2073
914 Ga0495680_0446027 3300047322 Bacteria 886
915 Ga0495675_0008842 3300047444 Bacteria 6252
916 Ga0495684_0004343 3300047471 Bacteria 11077
917 Ga0495684_0015547 3300047471 Bacteria 5859
918 Ga0495684_0150006 3300047471 Bacteria 1743
919 Ga0495593_0000560 3300047673 Bacteria 21093
920 Ga0495593_0071315 3300047673 Bacteria 1804
921 Ga0495602_0040768 3300048088 Bacteria 4251
922 Ga0495602_0075578 3300048088 Bacteria 2858
923 Ga0495602_0441954 3300048088 Bacteria 919
924 Ga0495614_0002333 3300048089 Bacteria 8443
925 Ga0496100_0066175 3300048903 Bacteria 2396
926 Ga0496100_0115887 3300048903 Bacteria 1869
927 Ga0496101_0021815 3300048904 Bacteria 4401
928 Ga0496102_0016882 3300048905 Bacteria 6387
929 Ga0496102_0122562 3300048905 Bacteria 2429
930 Ga0496102_0304286 3300048905 Bacteria 1502
931 Ga0496102_0666074 3300048905 Bacteria 964
932 Ga0496103_0541535 3300048906 Bacteria 743
933 Ga0496103_0813778 3300048906 Bacteria 589
934 Ga0496104_0168334 3300048907 Bacteria 2101
935 Ga0496104_0444131 3300048907 Bacteria 1209
936 Ga0496104_0485653 3300048907 Bacteria 1146
937 Ga0496105_0039221 3300048908 Bacteria 3903
938 Ga0496105_0329646 3300048908 Bacteria 1222
939 Ga0496105_0441292 3300048908 Bacteria 1028
940 Ga0496105_0736103 3300048908 Bacteria 754
941 Ga0496105_0818704 3300048908 Bacteria 707
942 Ga0496106_0002401 3300048909 Bacteria 13955
943 Ga0496106_0775083 3300048909 Bacteria 761
944 Ga0496107_0088882 3300048910 Bacteria 2255
945 Ga0496108_0015462 3300048911 Bacteria 6224
946 Ga0496108_0058790 3300048911 Bacteria 3232
947 Ga0496108_0362851 3300048911 Bacteria 1264
948 Ga0496108_0749754 3300048911 Bacteria 845
949 Ga0496108_0994249 3300048911 Bacteria 717
950 Ga0496108_1648908 3300048911 Unclassified 529
951 Ga0496109_0095005 3300048912 Bacteria 2759
952 Ga0496109_1392085 3300048912 Bacteria 637
953 Ga0496109_1615203 3300048912 Bacteria 582
954 Ga0496110_0016790 3300048913 Bacteria 6116
955 Ga0496110_0069142 3300048913 Bacteria 3126
956 Ga0496110_1051948 3300048913 Unclassified 722
957 Ga0496111_0017340 3300048914 Bacteria 4978
958 Ga0496111_0047729 3300048914 Bacteria 3083
959 Ga0496112_0009408 3300048915 Bacteria 8801
960 Ga0496112_0050630 3300048915 Bacteria 4074
961 Ga0496112_0157657 3300048915 Bacteria 2236
962 Ga0496112_0173067 3300048915 Bacteria 2124
963 Ga0496113_0067453 3300048916 Bacteria 2712
964 Ga0496113_0133356 3300048916 Bacteria 1950
965 Ga0496113_0399718 3300048916 Bacteria 1103
966 Ga0496114_0490744 3300048917 Bacteria 1086
967 Ga0496114_1221544 3300048917 Bacteria 638
968 Ga0496115_0059342 3300048918 Bacteria 3081
969 Ga0496115_0136634 3300048918 Bacteria 2021
970 Ga0496119_0028875 3300048922 Bacteria 3775
971 Ga0496126_0036755 3300048929 Bacteria 4576
972 Ga0496126_0652055 3300048929 Bacteria 823
973 Ga0501032_0108967 3300049569 Bacteria 1834
974 Ga0501034_0001833 3300049571 Bacteria 26980
975 Ga0501036_0023432 3300049572 Bacteria 5201
976 Ga0501037_0449294 3300049573 Bacteria 879
977 Ga0501038_0089621 3300049574 Bacteria 2579
978 Ga0501042_0067780 3300049578 Bacteria 2551
979 Ga0501042_0069992 3300049578 Bacteria 2510
980 Ga0501042_1134065 3300049578 Bacteria 570
981 Ga0501043_0001757 3300049579 Bacteria 18675
982 Ga0501047_0012436 3300049581 Bacteria 8057
983 Ga0501047_0051340 3300049581 Bacteria 3984
984 Ga0501047_0479993 3300049581 Bacteria 1071
985 Ga0501047_0849753 3300049581 Bacteria 727
986 Ga0501048_0069116 3300049582 Bacteria 2494
987 Ga0501068_0430221 3300049584 Bacteria 853
988 Ga0501069_0984531 3300049585 Bacteria 515
989 Ga0501074_0001800 3300049590 Bacteria 14677
990 Ga0501077_0090862 3300049593 Bacteria 1935
991 Ga0501081_1409110 3300049743 Bacteria 529
992 Ga0501083_0078619 3300049744 Bacteria 2188
993 Ga0501044_0082616 3300049823 Bacteria 3250
994 Ga0501044_1642909 3300049823 Unclassified 507
995 Ga0501045_1188239 3300049824 Bacteria 557
996 nmdc:mga05p37_11220_c1 3300050507 Bacteria 10652
997 nmdc:mga05p37_122880_c1 3300050507 Bacteria 3189
998 nmdc:mga05p37_194513_c1 3300050507 Bacteria 2460
999 nmdc:mga05p37_668592_c1 3300050507 Bacteria 1160
1000 nmdc:mga05p37_70709_c1 3300050507 Bacteria 4293
1001 nmdc:mga05p37_860663_c1 3300050507 Bacteria 983
1002 nmdc:mga09592_259491_c1 3300050508 Bacteria 1507
1003 nmdc:mga09592_383231_c1 3300050508 Bacteria 1216
1004 nmdc:mga09592_4491_c1 3300050508 Bacteria 11287
1005 nmdc:mga09592_618634_c1 3300050508 Bacteria 927
1006 nmdc:mga0qj67_36507_c1 3300050509 Bacteria 3845
1007 nmdc:mga06r32_11664_c1 3300050510 Bacteria 7911
1008 nmdc:mga06r32_942963_c1 3300050510 Bacteria 818
1009 nmdc:mga08y16_1962216_c1 3300050511 Bacteria 535
1010 nmdc:mga08y16_60734_c1 3300050511 Bacteria 3948
1011 nmdc:mga0n895_1761759_c1 3300050512 Bacteria 581
1012 nmdc:mga0n895_1903317_c1 3300050512 Bacteria 554
1013 nmdc:mga0n895_587277_c1 3300050512 Bacteria 1117
1014 nmdc:mga0n895_67166_c1 3300050512 Bacteria 3551
1015 nmdc:mga0rr50_36513_c1 3300050513 Bacteria 3540
1016 nmdc:mga08x19_17616_c1 3300050514 Bacteria 4374
1017 nmdc:mga08x19_96539_c1 3300050514 Bacteria 1956
1018 nmdc:mga0a205_457852_c1 3300050515 Bacteria 1135
1019 nmdc:mga0a205_63893_c1 3300050515 Bacteria 3556
1020 Ga0495601_0063407 3300053077 Bacteria 2349
1021 Ga0495601_0153359 3300053077 Bacteria 1504
1022 Ga0495601_0390063 3300053077 Bacteria 903
1023 Ga0495612_0000642 3300053078 Bacteria 14034
1024 Ga0495612_0007581 3300053078 Bacteria 4434
1025 Ga0495612_0033877 3300053078 Bacteria 2067
1026 Ga0495612_0177799 3300053078 Bacteria 934
1027 Ga0495595_0046484 3300053084 Bacteria 2000
1028 Ga0495595_0109112 3300053084 Bacteria 1340
1029 Ga0495619_0001852 3300053085 Bacteria 14079
1030 Ga0495619_0080577 3300053085 Bacteria 2191
1031 Ga0495619_0107503 3300053085 Bacteria 1903
1032 Ga0495619_0626807 3300053085 Bacteria 735
1033 Ga0495619_0711752 3300053085 Bacteria 682
1034 Ga0495619_0794526 3300053085 Bacteria 640
1035 Ga0500630_261660 3300053159 Bacteria 601
1036 Ga0501084_1444110 3300054114 Bacteria 576
1037 Ga0587073_0178187 3300059492 Bacteria 622
1038 Ga0587077_243622 3300059493 Bacteria 517
1039 Ga0587083_0115572 3300059505 Bacteria 687
1040 Ga0587098_058950 3300059604 Bacteria 599
1041 Ga0587106_045502 3300059605 Bacteria 760
1042 Ga0587101_030434 3300059623 Bacteria 838
1043 Ga0587100_026826 3300059648 Bacteria 593
1044 Ga0587111_0100849 3300060346 Bacteria 719
1045 Ga0466962_0072621 3300061719 Bacteria 1644
1046 Ga0466962_0430172 3300061719 Bacteria 663
1047 Ga0530510_0043987 3300061734 Bacteria 3227
1048 2554255960 2554235005 Bacteria 6457341
1049 2619855820 2619618881 Bacteria 7521104
1050 2620348262 2619619003 Bacteria 7619552
1051 2676486012 2675903059 Bacteria 8644972
1052 2862290411 2862290372 Bacteria 7471434
1053 2895447694 2895442618 Bacteria 11027144
1054 2935396044 2935390628 Bacteria 7043367
1055 8053946865 8053945823 Bacteria 8962862
1056 Ga0307509_10512516
1057 JGI24735J21928_10171235
1058 JGI24738J21930_10061658
1059 JGI25406J46586_10019691
1060 JGI25404J52841_10003154
1061 Ga0058861_10050548
1062 Ga0070658_10077399
1063 Ga0070658_10114670
1064 Ga0070658_10186243
1065 Ga0070676_10058660
1066 Ga0070676_10065461
1067 Ga0070683_100161126
1068 Ga0070683_101712378
1069 Ga0070683_101842019
1070 Ga0070690_100141844
1071 Ga0070670_101109341
1072 Ga0068869_100047053
1073 Ga0068869_100261280
1074 Ga0068869_101862294
1075 Ga0070666_10233102
1076 Ga0070680_100099306
1077 Ga0070680_100165816
1078 Ga0070680_100166878
1079 Ga0070680_100313519
1080 Ga0070680_101215661
1081 Ga0070682_100295980
1082 Ga0068868_100129961
1083 Ga0070660_100335015
1084 Ga0070660_100420630
1085 Ga0070660_101601751
1086 Ga0070691_10018094
1087 Ga0070691_10495152
1088 Ga0070691_10645624
1089 Ga0070691_10679883
1090 Ga0070687_100086341
1091 Ga0070661_100301453
1092 Ga0070661_100979072
1093 Ga0070692_10081597
1094 Ga0070668_100809478
1095 Ga0070668_101200930
1096 Ga0070669_100668835
1097 Ga0070675_100138246
1098 Ga0070675_100289066
1099 Ga0070671_100097211
1100 Ga0070674_100045756
1101 Ga0070673_100026214
1102 Ga0070673_100064467
1103 Ga0070688_100570252
1104 Ga0070659_100258234
1105 Ga0070659_101824341
1106 Ga0070667_100019139
1107 Ga0070667_100239569
1108 Ga0070667_100350887
1109 Ga0070667_101312960
1110 Ga0070709_10019091
1111 Ga0070709_10053195
1112 Ga0070709_10090988
1113 Ga0070709_10132410
1114 Ga0070709_10250614
1115 Ga0070714_100011051
1116 Ga0070714_100059588
1117 Ga0070714_100370473
1118 Ga0070714_100496692
1119 Ga0070714_100715931
1120 Ga0070713_100219475
1121 Ga0070713_100246184
1122 Ga0070713_100263298
1123 Ga0070713_100460589
1124 Ga0070713_100610859
1125 Ga0070713_101567903
1126 Ga0070710_10050534
1127 Ga0070710_10798997
1128 Ga0070710_10823778
1129 Ga0070710_10935656
1130 Ga0070701_10101501
1131 Ga0070711_100017485
1132 Ga0070711_100275335
1133 Ga0070711_101151724
1134 Ga0070705_100063130
1135 Ga0070705_100251841
1136 Ga0070700_100471614
1137 Ga0070708_100134599
1138 Ga0070708_100392108
1139 Ga0070708_100585813
1140 Ga0070708_101328181
1141 Ga0070663_100114507
1142 Ga0070663_100217590
1143 Ga0070663_100363354
1144 Ga0070663_100831765
1145 Ga0070678_100208896
1146 Ga0070678_100982960
1147 Ga0070662_100429005
1148 Ga0070681_10024013
1149 Ga0070681_10154212
1150 Ga0070681_10535082
1151 Ga0070681_11176724
1152 Ga0070681_11379844
1153 Ga0068867_100118995
1154 Ga0070685_10015250
1155 Ga0070685_10098587
1156 Ga0070706_100022829
1157 Ga0070706_100070425
1158 Ga0070706_100120420
1159 Ga0070706_100366837
1160 Ga0070706_100798841
1161 Ga0070706_100938481
1162 Ga0070706_101173309
1163 Ga0070706_101246952
1164 Ga0070707_100036268
1165 Ga0070707_100043862
1166 Ga0070707_100158400
1167 Ga0070707_100185126
1168 Ga0070707_100746985
1169 Ga0070707_101944430
1170 Ga0070698_100003439
1171 Ga0070698_100034744
1172 Ga0070698_100087214
1173 Ga0070698_100385190
1174 Ga0070698_101726626
1175 Ga0070699_100010810
1176 Ga0070699_100245834
1177 Ga0070699_100600042
1178 Ga0070679_100081061
1179 Ga0070679_100164457
1180 Ga0070684_100058031
1181 Ga0070684_100058098
1182 Ga0070684_101405717
1183 Ga0070684_101637431
1184 Ga0070684_101784621
1185 Ga0070684_101784657
1186 Ga0070697_100006581
1187 Ga0070697_100355688
1188 Ga0070697_101614871
1189 Ga0068853_100071201
1190 Ga0068853_100294422
1191 Ga0068853_100304730
1192 Ga0068853_102125664
1193 Ga0070672_100188568
1194 Ga0070686_100077111
1195 Ga0070686_100655243
1196 Ga0070695_100166365
1197 Ga0070695_100731917
1198 Ga0070696_100649300
1199 Ga0070693_100440758
1200 Ga0070693_100541611
1201 Ga0070693_101163821
1202 Ga0070693_101504710
1203 Ga0070665_100012829
1204 Ga0070665_100212346
1205 Ga0070665_100224452
1206 Ga0070665_100266041
1207 Ga0070665_100649471
1208 Ga0070665_101885337
1209 Ga0070704_100195860
1210 Ga0070704_100745863
1211 Ga0070704_102204589
1212 Ga0068855_100021107
1213 Ga0068855_100565603
1214 Ga0070664_100029287
1215 Ga0068857_100036487
1216 Ga0068857_101223864
1217 Ga0068857_101223865
1218 Ga0068857_102019311
1219 Ga0068854_100004751
1220 Ga0068854_100054440
1221 Ga0068854_100443282
1222 Ga0068856_100182790
1223 Ga0068856_100366862
1224 Ga0068856_101485615
1225 Ga0068856_101498163
1226 Ga0070702_100173298
1227 Ga0068852_100198342
1228 Ga0068852_100261919
1229 Ga0068852_101881100
1230 Ga0068859_100247012
1231 Ga0068864_100481548
1232 Ga0068864_100763173
1233 Ga0068864_100836027
1234 Ga0068866_10012061
1235 Ga0068861_100009787
1236 Ga0068861_100086090
1237 Ga0068851_10388673
1238 Ga0068870_10155348
1239 Ga0068863_100015044
1240 Ga0068863_101390278
1241 Ga0068858_100979082
1242 Ga0068858_101406035
1243 Ga0068860_100293470
1244 Ga0068862_100149526
1245 Ga0081455_10012907
1246 Ga0081455_10941865
1247 Ga0081540_1000009
1248 Ga0081540_1006532
1249 Ga0081539_10000846
1250 Ga0070717_10133729
1251 Ga0070717_10206461
1252 Ga0070717_10446015
1253 Ga0070717_11219293
1254 Ga0070717_11565673
1255 Ga0075365_11043605
1256 Ga0075432_10117156
1257 Ga0070715_10029477
1258 Ga0070715_10058976
1259 Ga0070715_10084267
1260 Ga0070715_10165799
1261 Ga0070716_100289285
1262 Ga0070716_100455620
1263 Ga0070716_100463002
1264 Ga0070716_100478888
1265 Ga0070716_100581283
1266 Ga0070716_100642510
1267 Ga0070712_100013903
1268 Ga0070712_100169901
1269 Ga0070712_100273404
1270 Ga0070712_100540101
1271 Ga0070712_100721144
1272 Ga0070712_101585978
1273 Ga0097621_100132185
1274 Ga0068871_100057615
1275 Ga0068871_100289812
1276 Ga0068871_100521945
1277 Ga0075428_100040546
1278 Ga0075428_100053163
1279 Ga0075430_100062344
1280 Ga0075430_101144205
1281 Ga0075430_101404475
1282 Ga0075431_100009154
1283 Ga0075431_100105695
1284 Ga0075431_102091081
1285 Ga0075433_10286255
1286 Ga0075434_100363345
1287 Ga0075434_100474560
1288 Ga0075434_100850503
1289 Ga0075434_101239176
1290 Ga0075434_101655801
1291 Ga0075429_100001463
1292 Ga0075429_100004985
1293 Ga0075429_100322444
1294 Ga0068865_100343106
1295 Ga0075436_100384904
1296 Ga0097620_100246999
1297 Ga0075435_100064873
1298 Ga0075435_101517807
1299 Ga0099794_10157616
1300 Ga0099794_10281148
1301 Ga0105251_10216133
1302 Ga0105244_10446617
1303 Ga0105244_10592447
1304 Ga0105250_10193607
1305 Ga0105240_10005049
1306 Ga0105240_10148595
1307 Ga0105240_10530028
1308 Ga0105240_11240616
1309 Ga0111539_10095829
1310 Ga0111539_11937737
1311 Ga0105245_10879852
1312 Ga0105245_11491215
1313 Ga0105245_11928268
1314 Ga0105247_10030756
1315 Ga0105247_10093595
1316 Ga0105247_10241327
1317 Ga0105247_11565567
1318 Ga0114129_10005490
1319 Ga0114129_10011782
1320 Ga0114129_10098006
1321 Ga0114129_10191923
1322 Ga0114129_10689696
1323 Ga0114129_11136350
1324 Ga0114129_12307258
1325 Ga0105243_10147129
1326 Ga0105243_10250905
1327 Ga0105243_10442798
1328 Ga0105241_10002864
1329 Ga0105241_10009338
1330 Ga0105241_10023035
1331 Ga0105241_11157959
1332 Ga0105248_10099174
1333 Ga0105248_10133427
1334 Ga0105248_10535853
1335 Ga0105237_10006743
1336 Ga0105237_10883528
1337 Ga0105237_11150672
1338 Ga0105237_11975529
1339 Ga0105238_10015348
1340 Ga0105238_10103318
1341 Ga0105238_10428255
1342 Ga0105238_10447601
1343 Ga0105238_11780418
1344 Ga0105238_12356847
1345 Ga0105249_10423985
1346 Ga0105249_10952638
1347 Ga0099796_10208602
1348 Ga0105239_10028184
1349 Ga0105239_10996700
1350 Ga0105246_10003333
1351 Ga0105246_10067347
1352 Ga0105246_10261241
1353 Ga0157340_1005324
1354 Ga0157346_1012257
1355 Ga0157337_1002560
1356 Ga0157325_1012806
1357 Ga0157343_1000771
1358 Ga0157322_1002597
1359 Ga0157323_1025849
1360 Ga0157342_1010144
1361 Ga0157315_1054815
1362 Ga0157326_1023376
1363 Ga0157373_10080944
1364 Ga0157371_10026186
1365 Ga0157371_10028526
1366 Ga0157371_11045684
1367 Ga0157370_10096691
1368 Ga0157370_10166858
1369 Ga0157370_10415418
1370 Ga0157369_10087391
1371 Ga0157369_10192683
1372 Ga0157369_10193030
1373 Ga0157369_10207601
1374 Ga0157369_10371209
1375 Ga0157369_10421868
1376 Ga0157369_12107754
1377 Ga0157374_10005049
1378 Ga0157374_10453645
1379 Ga0157374_10790396
1380 Ga0157374_12339877
1381 Ga0157378_10641435
1382 Ga0157378_11270692
1383 Ga0163162_10460375
1384 Ga0163162_10496834
1385 Ga0157372_10333350
1386 Ga0157372_11307306
1387 Ga0157375_10154278
1388 Ga0157375_10348756
1389 Ga0163163_10131321
1390 Ga0163163_10451334
1391 Ga0163163_10993766
1392 Ga0163163_11099001
1393 Ga0163163_11550685
1394 Ga0163163_13301814
1395 Ga0157380_10476799
1396 Ga0157380_10703348
1397 Ga0182008_10066425
1398 Ga0182008_10083900
1399 Ga0157377_10046061
1400 Ga0157377_11461876
1401 Ga0157377_11670158
1402 Ga0157379_10219414
1403 Ga0157379_10370864
1404 Ga0157379_10441890
1405 Ga0157376_10268229
1406 Ga0157376_10616184
1407 Ga0157376_10661613
1408 Ga0182005_1024683
1409 Ga0163161_10165684
1410 Ga0197907_10040213
1411 Ga0197907_10134442
1412 Ga0197907_10239040
1413 Ga0197907_11079237
1414 Ga0197907_11202783
1415 Ga0197907_11233655
1416 Ga0206356_10024402
1417 Ga0206356_10473527
1418 Ga0206356_10750368
1419 Ga0206356_10822231
1420 Ga0206356_10869480
1421 Ga0206356_11238138
1422 Ga0206349_1452056
1423 Ga0206349_1676835
1424 Ga0206349_1737499
1425 Ga0206349_1774434
1426 Ga0206355_1028181
1427 Ga0206355_1662650
1428 Ga0206351_10115453
1429 Ga0206351_10982567
1430 Ga0206352_10504371
1431 Ga0206352_10694081
1432 Ga0206350_10034037
1433 Ga0206350_10358249
1434 Ga0206350_10870138
1435 Ga0206354_10379054
1436 Ga0206354_10728610
1437 Ga0206354_10896237
1438 Ga0206354_10900266
1439 Ga0206354_11642901
1440 Ga0206353_10064748
1441 Ga0206353_10104151
1442 Ga0206353_10739044
1443 Ga0206353_11147038
1444 Ga0206353_11347620
1445 Ga0206353_11694473
1446 Ga0206353_11788060
1447 Ga0213873_10205543
1448 Ga0213875_10002550
1449 Ga0213875_10016499
1450 Ga0213875_10016913
1451 Ga0213875_10025578
1452 Ga0213875_10088465
1453 Ga0213875_10202452
1454 Ga0213875_10248617
1455 Ga0224712_10014026
1456 Ga0224712_10017963
1457 Ga0224712_10031419
1458 Ga0224712_10150122
1459 Ga0224712_10584038
1460 Ga0207656_10041050
1461 Ga0207656_10355025
1462 Ga0207655_1143876
1463 Ga0207653_10030471
1464 Ga0207692_10013124
1465 Ga0207692_10021079
1466 Ga0207692_10050051
1467 Ga0207692_10085068
1468 Ga0207692_10424140
1469 Ga0207642_10077427
1470 Ga0207710_10057377
1471 Ga0207688_10017931
1472 Ga0207680_10498412
1473 Ga0207647_10006461
1474 Ga0207647_10098044
1475 Ga0207647_10569375
1476 Ga0207685_10055403
1477 Ga0207685_10121230
1478 Ga0207685_10621905
1479 Ga0207685_10681936
1480 Ga0207699_10008764
1481 Ga0207699_10073791
1482 Ga0207699_10094495
1483 Ga0207699_10103328
1484 Ga0207699_10208817
1485 Ga0207699_10247885
1486 Ga0207699_10344694
1487 Ga0207645_10041227
1488 Ga0207705_10390344
1489 Ga0207684_10040946
1490 Ga0207684_10059276
1491 Ga0207684_10172837
1492 Ga0207684_10186279
1493 Ga0207684_10408978
1494 Ga0207684_10638192
1495 Ga0207684_10852026
1496 Ga0207654_10021325
1497 Ga0207654_10073585
1498 Ga0207707_10172743
1499 Ga0207707_10198943
1500 Ga0207707_11372113
1501 Ga0207707_11609758
1502 Ga0207695_10000449
1503 Ga0207695_10352063
1504 Ga0207671_10000052
1505 Ga0207671_10112610
1506 Ga0207693_10030647
1507 Ga0207693_10040828
1508 Ga0207693_10761776
1509 Ga0207663_10016875
1510 Ga0207663_10112538
1511 Ga0207663_10193911
1512 Ga0207663_10391856
1513 Ga0207663_10931971
1514 Ga0207660_10132698
1515 Ga0207660_10324930
1516 Ga0207660_11244807
1517 Ga0207662_10004683
1518 Ga0207657_10051513
1519 Ga0207657_10101618
1520 Ga0207657_10774810
1521 Ga0207649_10061098
1522 Ga0207652_10005773
1523 Ga0207652_10106977
1524 Ga0207652_10748069
1525 Ga0207652_10758159
1526 Ga0207646_10003188
1527 Ga0207646_10131385
1528 Ga0207646_10199598
1529 Ga0207646_10510442
1530 Ga0207646_10528097
1531 Ga0207646_10726577
1532 Ga0207646_11259079
1533 Ga0207694_10000079
1534 Ga0207694_10154280
1535 Ga0207659_10183332
1536 Ga0207687_10629327
1537 Ga0207687_10750300
1538 Ga0207687_11272542
1539 Ga0207700_10013850
1540 Ga0207700_10044737
1541 Ga0207700_10062352
1542 Ga0207700_10306198
1543 Ga0207700_10420267
1544 Ga0207700_10555896
1545 Ga0207700_10656503
1546 Ga0207700_11075068
1547 Ga0207664_10021682
1548 Ga0207664_10029279
1549 Ga0207664_10035671
1550 Ga0207664_10064082
1551 Ga0207664_10145790
1552 Ga0207664_10220288
1553 Ga0207664_10384490
1554 Ga0207664_10839049
1555 Ga0207644_10297553
1556 Ga0207644_10637241
1557 Ga0207690_10081243
1558 Ga0207706_10410754
1559 Ga0207686_10120631
1560 Ga0207709_10305066
1561 Ga0207670_10097441
1562 Ga0207704_10176148
1563 Ga0207665_10008152
1564 Ga0207665_10030690
1565 Ga0207665_10056775
1566 Ga0207665_10077407
1567 Ga0207665_10896130
1568 Ga0207691_10230112
1569 Ga0207711_10195471
1570 Ga0207689_10072095
1571 Ga0207661_10024560
1572 Ga0207661_10089973
1573 Ga0207661_10153939
1574 Ga0207661_10930771
1575 Ga0207667_10017127
1576 Ga0207667_10138355
1577 Ga0207651_10318437
1578 Ga0207712_10222920
1579 Ga0207712_10301408
1580 Ga0207668_10114515
1581 Ga0207668_10578798
1582 Ga0207640_10006042
1583 Ga0207640_11816465
1584 Ga0207658_10023037
1585 Ga0207658_10187864
1586 Ga0207658_11814357
1587 Ga0207677_10328160
1588 Ga0207703_11288228
1589 Ga0207639_11679320
1590 Ga0207678_10061626
1591 Ga0207678_10228781
1592 Ga0207678_10626017
1593 Ga0207708_10067415
1594 Ga0207702_10070332
1595 Ga0207702_10079881
1596 Ga0207702_10299375
1597 Ga0207702_10389451
1598 Ga0207702_11464960
1599 Ga0207641_10043174
1600 Ga0207641_10199139
1601 Ga0207648_10048063
1602 Ga0207676_10131492
1603 Ga0207676_10955708
1604 Ga0207676_12419906
1605 Ga0207674_10020491
1606 Ga0207674_10141959
1607 Ga0207675_100016033
1608 Ga0207675_100777514
1609 Ga0207675_100854762
1610 Ga0207683_10001450
1611 Ga0207698_10052683
1612 Ga0207698_10223496
1613 Ga0207698_10434028
1614 Ga0207698_11853092
1615 Ga0209588_1200788
1616 Ga0268266_10041880
1617 Ga0268266_10080057
1618 Ga0268266_10109148
1619 Ga0268266_10121394
1620 Ga0268266_10268326
1621 Ga0268264_10253422
1622 Ga0265337_1029278
1623 Ga0265326_10007790
1624 Ga0265319_1028537
1625 Ga0265334_10009187
1626 Ga0265334_10009842
1627 Ga0265318_10070223
1628 Ga0265322_10007800
1629 Ga0265336_10012599
1630 Ga0265338_10003311
1631 Ga0265338_10101236
1632 Ga0265324_10004355
1633 Ga0265762_1022334
1634 Ga0265762_1123363
1635 Ga0265766_1001019
1636 Ga0265764_101113
1637 Ga0265772_102455
1638 Ga0265769_101054
1639 Ga0265330_10218379
1640 Ga0265332_10018388
1641 Ga0265320_10046163
1642 Ga0265325_10032851
1643 Ga0265340_10027939
1644 Ga0265316_10006980
1645 Ga0310103_132896
1646 Ga0310111_101896
1647 Ga0310114_120261
1648 Ga0316579_10053204
1649 Ga0265342_10002252
1650 Ga0316576_10317935
1651 Ga0316578_10004365
1652 Ga0307413_10537971
1653 Ga0307410_10127879
1654 Ga0307410_11321012
1655 Ga0307406_10165726
1656 Ga0307406_10836277
1657 Ga0307415_100360260
1658 Ga0316583_10015746
1659 Ga0316585_10001193
1660 Ga0316580_10002452
1661 Ga0316593_10001329
1662 Ga0307507_10202340
1663 Ga0307507_10447720
1664 Ga0307507_10517086
1665 Ga0316592_1005348
1666 Ga0316596_1002330
1667 Ga0316212_1003332
1668 Ga0316216_1007074
1669 Ga0373930_0012934
1670 Ga0373948_0005644
1671 Ga0373959_0003163
1672 Ga0373938_0018325
1673 Ga0373926_0002035
1674 Ga0373926_0006212
1675 Ga0373926_0160848
1676 Ga0373934_0007699
1677 Ga0373934_0027044
1678 Ga0373934_0093738
1679 Ga0373934_0414476
1680 Ga0373944_0009356
1681 Ga0373944_0114910
1682 Ga0373949_0008788
1683 Ga0373951_0016297
1684 Ga0373923_0000406
1685 Ga0373923_0006683
1686 Ga0373932_0054516
1687 Ga0373936_0008014
1688 Ga0373936_0015213
1689 Ga0373936_0025086
1690 Ga0373941_0011747
1691 Ga0373945_0002694
1692 Ga0373945_0093513
1693 Ga0373945_0173980
1694 Ga0373953_0010369
1695 Ga0373953_0043540
1696 Ga0373954_0003330
1697 Ga0373954_0016223
1698 Ga0373954_0041295
1699 Ga0373956_0005088
1700 Ga0373956_0056135
1701 Ga0373957_0008357
1702 Ga0373957_0028205
1703 Ga0373960_0039269
1704 Ga0373960_0078459
1705 Ga0373943_0000399
1706 Ga0373943_0000928
1707 Ga0373943_0240704
1708 Ga0373946_0000096
1709 Ga0373946_0007742
1710 Ga0373946_0590038
1711 Ga0373955_0009583
1712 Ga0373955_0026141
1713 Ga0373955_0078893
1714 Ga0373955_0216370
1715 Ga0373942_0017840
1716 Ga0373961_0110429
1717 Ga0373962_0187310
1718 Ga0316574_0078457
1719 Ga0373924_0001557
1720 Ga0373924_0006457
1721 Ga0373924_0017498
1722 Ga0373931_0117461
1723 Ga0373935_0001778
1724 Ga0373935_0002824
1725 Ga0373935_0003633
1726 Ga0373935_0087419
1727 Ga0373935_0820762
1728 Ga0373935_0870977
1729 Ga0373935_1140777
1730 Ga0373927_0002491
1731 Ga0373927_0006534
1732 Ga0373927_0158724
1733 Ga0373933_0006735
1734 Ga0373933_0010409
1735 Ga0373933_0619400
1736 Ga0373933_0833777
1737 Ga0373947_0000041
1738 Ga0373947_0012716
1739 Ga0373947_0231771
1740 Ga0373937_0025411
1741 Ga0373937_0074945
1742 Ga0373937_0212914
1743 Ga0373937_1067520
1744 Ga0265778_003501
1745 Ga0372808_008932
1746 Ga0310109_004114
1747 Ga0310109_017818
1748 Ga0316582_0022422
1749 Ga0316584_0039982
1750 Ga0373925_0000539
1751 Ga0373925_0002876
1752 Ga0373925_0004812
1753 Ga0373925_0059415
1754 Ga0373925_0103638
1755 Ga0373925_1030362
1756 Ga0395899_0022158
1757 Ga0395899_0022741
1758 Ga0395899_0469714
1759 Ga0395900_0025148
1760 Ga0395900_0231418
1761 Ga0395900_0262157
1762 Ga0395900_0443310
1763 Ga0395900_0680176
1764 Ga0395898_0003894
1765 Ga0395898_0075612
1766 Ga0395898_0120565
1767 Ga0395898_0291355
1768 Ga0395898_0655301
1769 Ga0395905_0009180
1770 Ga0395905_0749315
1771 Ga0395905_1220297
1772 Ga0316581_0010762
1773 Ga0436364_0108657
1774 Ga0436364_0263457
1775 Ga0436364_0313993
1776 Ga0436364_0620905
1777 Ga0436364_0667270
1778 Ga0436364_0746948
1779 Ga0436364_0851474
1780 Ga0436364_1234022
1781 Ga0436364_1235254
1782 Ga0436364_1382612
1783 Ga0436364_1499708
1784 Ga0436364_1512252
1785 Ga0395901_0011518
1786 Ga0395901_0012344
1787 Ga0395901_0163193
1788 Ga0395901_0755620
1789 Ga0242420_036091
1790 Ga0436365_0728596
1791 Ga0436365_0838927
1792 Ga0436365_0879082
1793 Ga0436365_1835412
1794 Ga0436360_1302274
1795 Ga0436363_0423171
1796 Ga0436363_0537553
1797 Ga0436363_0729247
1798 Ga0436363_0857353
1799 Ga0436363_1709813
1800 Ga0436362_0515179
1801 Ga0436362_0535795
1802 Ga0436362_0762648
1803 Ga0451853_2653668
1804 Ga0439448_0010736
1805 Ga0439448_0056290
1806 Ga0439448_0133650
1807 Ga0439455_0015930
1808 Ga0439463_006507
1809 Ga0439458_0197856
1810 Ga0439459_0035437
1811 Ga0439440_0031573
1812 Ga0466969_0016647
1813 Ga0466969_0155369
1814 Ga0466972_0599534
1815 Ga0466965_0480738
1816 Ga0466966_0352970
1817 Ga0466961_0010897
1818 Ga0466961_0014702
1819 Ga0466961_0184651
1820 Ga0466961_0821103
1821 Ga0466963_0191050
1822 Ga0466963_0201586
1823 Ga0466963_0205742
1824 Ga0466964_0078348
1825 Ga0466964_0581700
1826 Ga0466971_0089516
1827 Ga0466971_0139463
1828 Ga0466970_0005151
1829 Ga0466970_0728175
1830 Ga0466957_0016026
1831 Ga0466957_0068488
1832 Ga0466957_0944117
1833 Ga0466960_0055075
1834 Ga0466959_0087156
1835 Ga0466958_0010977
1836 Ga0466958_0152151
1837 Ga0466958_0388857
1838 Ga0466958_1059889
1839 Ga0466967_0018473
1840 Ga0466967_0183436
1841 Ga0466967_0336139
1842 Ga0466967_0563070
1843 Ga0466967_0947411
1844 Ga0495592_0006913
1845 Ga0495592_0128159
1846 Ga0495592_0177963
1847 Ga0495592_0722516
1848 Ga0495603_0001574
1849 Ga0495629_0003373
1850 Ga0495629_0243794
1851 Ga0495629_0572619
1852 Ga0495641_0004090
1853 Ga0495641_0025003
1854 Ga0495641_0086897
1855 Ga0495651_0004709
1856 Ga0495651_0031971
1857 Ga0495651_0036142
1858 Ga0495651_0090324
1859 Ga0495651_0095680
1860 Ga0495651_0100109
1861 Ga0495651_0252673
1862 Ga0495651_0287652
1863 Ga0495653_0007298
1864 Ga0495653_0039446
1865 Ga0495653_0071807
1866 Ga0495653_0382468
1867 Ga0495580_0018888
1868 Ga0495582_0038471
1869 Ga0495582_0364232
1870 Ga0495662_0000662
1871 Ga0495662_0240320
1872 Ga0495662_0381684
1873 Ga0495664_0002834
1874 Ga0495664_0066453
1875 Ga0495664_0071409
1876 Ga0495664_0825693
1877 Ga0495594_0006963
1878 Ga0495594_0015411
1879 Ga0495608_0006489
1880 Ga0495608_0021963
1881 Ga0495608_0026229
1882 Ga0495608_0031539
1883 Ga0495618_0009092
1884 Ga0495618_0075409
1885 Ga0495618_0114518
1886 Ga0495618_0616610
1887 Ga0495628_0012848
1888 Ga0495628_0015919
1889 Ga0495628_0018102
1890 Ga0495628_0065111
1891 Ga0495628_0380620
1892 Ga0495630_0002430
1893 Ga0495630_0018482
1894 Ga0495630_0067994
1895 Ga0495666_0004269
1896 Ga0495652_0006509
1897 Ga0495652_0037433
1898 Ga0495652_0058302
1899 Ga0495665_0001359
1900 Ga0495665_0030650
1901 Ga0495640_0025392
1902 Ga0495640_0028807
1903 Ga0495586_0041499
1904 Ga0495587_0029006
1905 Ga0495587_0043586
1906 Ga0495587_0116853
1907 Ga0495645_0029596
1908 Ga0495645_0035408
1909 Ga0495645_0041269
1910 Ga0495645_0111193
1911 Ga0495645_0551421
1912 Ga0495622_0066461
1913 Ga0495622_0079104
1914 Ga0495622_0136256
1915 Ga0495667_0005787
1916 Ga0495667_0009483
1917 Ga0495667_0059785
1918 Ga0495667_0130439
1919 Ga0495634_0010845
1920 Ga0495634_0038784
1921 Ga0495635_0006817
1922 Ga0495635_0013814
1923 Ga0495635_0040834
1924 Ga0495635_0042864
1925 Ga0495588_0014179
1926 Ga0495657_0063311
1927 Ga0495657_0077729
1928 Ga0495657_0085180
1929 Ga0495657_0123913
1930 Ga0495599_0055822
1931 Ga0495599_0069872
1932 Ga0495599_0176472
1933 Ga0495599_0301242
1934 Ga0495599_0732099
1935 Ga0495623_0042974
1936 Ga0495623_0047754
1937 Ga0495623_0139272
1938 Ga0495623_0485900
1939 Ga0495646_0017948
1940 Ga0495646_0032518
1941 Ga0495647_0080310
1942 Ga0495658_0035403
1943 Ga0495658_0421985
1944 Ga0495613_0003560
1945 Ga0495613_0535575
1946 Ga0495624_0004753
1947 Ga0495624_0008258
1948 Ga0495624_0086437
1949 Ga0495624_0968152
1950 Ga0495600_0024850
1951 Ga0495600_0025919
1952 Ga0495600_0042058
1953 Ga0495600_0059108
1954 Ga0495600_0094573
1955 Ga0495581_0000263
1956 Ga0495581_0156855
1957 Ga0495581_0625899
1958 Ga0495604_0005534
1959 Ga0495604_0008117
1960 Ga0495604_0063001
1961 Ga0495604_0359536
1962 Ga0495604_0368698
1963 Ga0495674_0025319
1964 Ga0495674_0300381
1965 Ga0495676_0004207
1966 Ga0495680_0008279
1967 Ga0495680_0041045
1968 Ga0495680_0107344
1969 Ga0495680_0446027
1970 Ga0495675_0008842
1971 Ga0495684_0004343
1972 Ga0495684_0015547
1973 Ga0495684_0150006
1974 Ga0495593_0000560
1975 Ga0495593_0071315
1976 Ga0495602_0040768
1977 Ga0495602_0075578
1978 Ga0495602_0441954
1979 Ga0495614_0002333
1980 Ga0496100_0066175
1981 Ga0496100_0115887
1982 Ga0496101_0021815
1983 Ga0496102_0016882
1984 Ga0496102_0122562
1985 Ga0496102_0304286
1986 Ga0496102_0666074
1987 Ga0496103_0541535
1988 Ga0496103_0813778
1989 Ga0496104_0168334
1990 Ga0496104_0444131
1991 Ga0496104_0485653
1992 Ga0496105_0039221
1993 Ga0496105_0329646
1994 Ga0496105_0441292
1995 Ga0496105_0736103
1996 Ga0496105_0818704
1997 Ga0496106_0002401
1998 Ga0496106_0775083
1999 Ga0496107_0088882
2000 Ga0496108_0015462
2001 Ga0496108_0058790
2002 Ga0496108_0362851
2003 Ga0496108_0749754
2004 Ga0496108_0994249
2005 Ga0496108_1648908
2006 Ga0496109_0095005
2007 Ga0496109_1392085
2008 Ga0496109_1615203
2009 Ga0496110_0016790
2010 Ga0496110_0069142
2011 Ga0496110_1051948
2012 Ga0496111_0017340
2013 Ga0496111_0047729
2014 Ga0496112_0009408
2015 Ga0496112_0050630
2016 Ga0496112_0157657
2017 Ga0496112_0173067
2018 Ga0496113_0067453
2019 Ga0496113_0133356
2020 Ga0496113_0399718
2021 Ga0496114_0490744
2022 Ga0496114_1221544
2023 Ga0496115_0059342
2024 Ga0496115_0136634
2025 Ga0496119_0028875
2026 Ga0496126_0036755
2027 Ga0496126_0652055
2028 Ga0501032_0108967
2029 Ga0501034_0001833
2030 Ga0501036_0023432
2031 Ga0501037_0449294
2032 Ga0501038_0089621
2033 Ga0501042_0067780
2034 Ga0501042_0069992
2035 Ga0501042_1134065
2036 Ga0501043_0001757
2037 Ga0501047_0012436
2038 Ga0501047_0051340
2039 Ga0501047_0479993
2040 Ga0501047_0849753
2041 Ga0501048_0069116
2042 Ga0501068_0430221
2043 Ga0501069_0984531
2044 Ga0501074_0001800
2045 Ga0501077_0090862
2046 Ga0501081_1409110
2047 Ga0501083_0078619
2048 Ga0501044_0082616
2049 Ga0501044_1642909
2050 Ga0501045_1188239
2051 nmdc:mga05p37_11220_c1
2052 nmdc:mga05p37_122880_c1
2053 nmdc:mga05p37_194513_c1
2054 nmdc:mga05p37_668592_c1
2055 nmdc:mga05p37_70709_c1
2056 nmdc:mga05p37_860663_c1
2057 nmdc:mga09592_259491_c1
2058 nmdc:mga09592_383231_c1
2059 nmdc:mga09592_4491_c1
2060 nmdc:mga09592_618634_c1
2061 nmdc:mga0qj67_36507_c1
2062 nmdc:mga06r32_11664_c1
2063 nmdc:mga06r32_942963_c1
2064 nmdc:mga08y16_1962216_c1
2065 nmdc:mga08y16_60734_c1
2066 nmdc:mga0n895_1761759_c1
2067 nmdc:mga0n895_1903317_c1
2068 nmdc:mga0n895_587277_c1
2069 nmdc:mga0n895_67166_c1
2070 nmdc:mga0rr50_36513_c1
2071 nmdc:mga08x19_17616_c1
2072 nmdc:mga08x19_96539_c1
2073 nmdc:mga0a205_457852_c1
2074 nmdc:mga0a205_63893_c1
2075 Ga0495601_0063407
2076 Ga0495601_0153359
2077 Ga0495601_0390063
2078 Ga0495612_0000642
2079 Ga0495612_0007581
2080 Ga0495612_0033877
2081 Ga0495612_0177799
2082 Ga0495595_0046484
2083 Ga0495595_0109112
2084 Ga0495619_0001852
2085 Ga0495619_0080577
2086 Ga0495619_0107503
2087 Ga0495619_0626807
2088 Ga0495619_0711752
2089 Ga0495619_0794526
2090 Ga0500630_261660
2091 Ga0501084_1444110
2092 Ga0587073_0178187
2093 Ga0587077_243622
2094 Ga0587083_0115572
2095 Ga0587098_058950
2096 Ga0587106_045502
2097 Ga0587101_030434
2098 Ga0587100_026826
2099 Ga0587111_0100849
2100 Ga0466962_0072621
2101 Ga0466962_0430172
2102 Ga0530510_0043987
2103 2554255960
2104 2619855820
2105 2620348262
2106 2676486012
2107 2862290411
2108 2895447694
2109 2935396044
2110 8053946865

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04456

DUF503

Protein of unknown function (DUF503)

25

113

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j27-assembly1.cif.gz_A crystal structure of a hypothetical protein, tt1725, from thermus thermophilus hb8 at 1.7a resolution 0.9504 2 94
7bfd-assembly1.cif.gz_K circular permutant of ribosomal protein s6, p54-55 truncated, y4a mutant. 0.7712 4 92
7b90-assembly1.cif.gz_E circular permutant of ribosomal protein s6, p54-55 truncated, i8a mutant 0.7581 4 95
7bfe-assembly1.cif.gz_E circular permutant of ribosomal protein s6, p54-55 truncated, l21a mutant. 0.7491 4 92
7bfd-assembly1.cif.gz_K circular permutant of ribosomal protein s6, p54-55 truncated, y4a mutant. 0.7322 4 92
ID Description Score Start End Superfamily
af_O33252_1_96_3.30.70.1120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.9867 1 96 3.30.70.1120
af_O33252_1_96_3.30.70.1120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.9666 1 96 3.30.70.1120
1j27A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;TT1725-like 0.9507 2 94 3.30.70.1120
af_P9WHL9_202_394_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.7463 25 77 3.30.470.20
af_A0A1D6HD72_49_115_3.30.1360.10 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;RNA polymerase, RBP11-like subunit 0.7278 5 57 3.30.1360.10
ID Description Score Start End GO Terms
AF-A0A543CDC8-F1-model_v4 DUF503 domain-containing protein 1.001 2 98
AF-A0A543IIJ2-F1-model_v4 DUF503 domain-containing protein 1.001 2 98
AF-A0A7Y9G934-F1-model_v4 DUF503 domain-containing protein 0.9983 2 98
AF-W9DAE5-F1-model_v4 deleted 0.997 1 97
AF-A0A1V2KRF2-F1-model_v4 DUF503 domain-containing protein 0.9967 1 97

Map