F489145
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1055 | 362 | 1054 | 307 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100098434|Ga0070699_1000984342 |
| Length | 350 |
| Sequence | MLLWQGTRYSRVFEVDLIGDTIQTAMLLWPIVVLVEERKRNKPMNDRIREILSWYASENPGVRTNLARMLNHGRLGGTGKMVILPVDQGFEHGPARSFAPNPAGYDPRYHFQLAIEAGCNAYAAPLGFLEAGVSDYSGDIPLILKCNNHDLLNDERDPISAVTAGVGDALRLGCVAVGFTIYPGSAQSTEMYQQLRELAEEAKAVGLAVVVWSYPRGSSLSKEGETAVDVVAYAAQIAAQLGANIIKVKLPSEHVELAEAQKVYQKYEIPIATLADRVRHVVQSSFDGRRIVIFSGGTYAADETFFEEVRAIRDGGGFGSIIGRNSFQRKKPEALKFLDTVMRIYEGSSG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 127 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 134 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 210 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 212 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 216 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 218 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 220 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 223 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 224 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 226 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 229 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 230 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 231 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 232 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 233 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 236 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 244 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 246 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 250 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 251 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 253 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 254 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 255 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 256 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 257 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 258 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 259 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 260 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 261 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 262 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 263 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 264 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 265 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 266 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 267 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 268 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 269 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 270 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 271 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 272 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 273 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 274 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 275 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 276 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 277 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 278 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 279 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 280 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 281 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 282 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 283 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 284 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 285 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 286 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 287 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 316 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 317 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 318 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 359 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 360 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.98 |
| Metatranscriptomes | 4.93 |
| Isolates | 0.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.38 |
| Nodule | 0 |
| Rhizoplane | 1.52 |
| Rhizosphere | 96.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10019328 | 3300003203 | Bacteria | 2779 |
| 2 | JGI25406J46586_10026155 | 3300003203 | Bacteria | 2255 |
| 3 | JGI25165J46597_1002109 | 3300003214 | Bacteria | 7238 |
| 4 | Ga0058859_10053121 | 3300004798 | Bacteria | 1722 |
| 5 | Ga0058863_11416325 | 3300004799 | Bacteria | 1196 |
| 6 | Ga0058861_11397491 | 3300004800 | Bacteria | 1193 |
| 7 | Ga0058860_10025827 | 3300004801 | Bacteria | 1016 |
| 8 | Ga0058860_10029594 | 3300004801 | Bacteria | 1201 |
| 9 | Ga0065707_10089909 | 3300005295 | Bacteria | 4243 |
| 10 | Ga0065707_10168871 | 3300005295 | Bacteria | 1500 |
| 11 | Ga0070658_10012641 | 3300005327 | Bacteria | 6771 |
| 12 | Ga0070658_10039295 | 3300005327 | Bacteria | 3816 |
| 13 | Ga0070676_10014988 | 3300005328 | Bacteria | 4268 |
| 14 | Ga0070690_100005668 | 3300005330 | Bacteria | 7027 |
| 15 | Ga0070690_100184434 | 3300005330 | Bacteria | 1443 |
| 16 | Ga0070690_100424453 | 3300005330 | Bacteria | 981 |
| 17 | Ga0070670_100038399 | 3300005331 | Bacteria | 4117 |
| 18 | Ga0070670_100166903 | 3300005331 | Bacteria | 1909 |
| 19 | Ga0068869_100001552 | 3300005334 | Bacteria | 13642 |
| 20 | Ga0068869_100009551 | 3300005334 | Bacteria | 6298 |
| 21 | Ga0068869_100010696 | 3300005334 | Bacteria | 5992 |
| 22 | Ga0070666_10009701 | 3300005335 | Bacteria | 6013 |
| 23 | Ga0070666_10085263 | 3300005335 | Bacteria | 2163 |
| 24 | Ga0070680_100012414 | 3300005336 | Bacteria | 6619 |
| 25 | Ga0070680_100015417 | 3300005336 | Bacteria | 5991 |
| 26 | Ga0070680_100038404 | 3300005336 | Bacteria | 3872 |
| 27 | Ga0070680_100148742 | 3300005336 | Bacteria | 1966 |
| 28 | Ga0070680_100187879 | 3300005336 | Bacteria | 1741 |
| 29 | Ga0070680_100355115 | 3300005336 | Bacteria | 1247 |
| 30 | Ga0070682_100000097 | 3300005337 | Bacteria | 78598 |
| 31 | Ga0068868_100039181 | 3300005338 | Bacteria | 3681 |
| 32 | Ga0068868_100257569 | 3300005338 | Bacteria | 1470 |
| 33 | Ga0070660_100015375 | 3300005339 | Bacteria | 5523 |
| 34 | Ga0070660_100025395 | 3300005339 | Bacteria | 4404 |
| 35 | Ga0070660_100164391 | 3300005339 | Bacteria | 1790 |
| 36 | Ga0070689_100000971 | 3300005340 | Bacteria | 17911 |
| 37 | Ga0070689_100023305 | 3300005340 | Bacteria | 4633 |
| 38 | Ga0070691_10000879 | 3300005341 | Bacteria | 12199 |
| 39 | Ga0070687_100020341 | 3300005343 | Bacteria | 3102 |
| 40 | Ga0070687_100252090 | 3300005343 | Bacteria | 1097 |
| 41 | Ga0070661_100002637 | 3300005344 | Bacteria | 12268 |
| 42 | Ga0070661_100016783 | 3300005344 | Bacteria | 5183 |
| 43 | Ga0070692_10004829 | 3300005345 | Bacteria | 5668 |
| 44 | Ga0070692_10084982 | 3300005345 | Bacteria | 1711 |
| 45 | Ga0070692_10117685 | 3300005345 | Bacteria | 1478 |
| 46 | Ga0070668_100028216 | 3300005347 | Bacteria | 4262 |
| 47 | Ga0070668_100082232 | 3300005347 | Bacteria | 2526 |
| 48 | Ga0070669_100006746 | 3300005353 | Bacteria | 8266 |
| 49 | Ga0070669_100050269 | 3300005353 | Bacteria | 3045 |
| 50 | Ga0070669_100152728 | 3300005353 | Bacteria | 1788 |
| 51 | Ga0070675_100394146 | 3300005354 | Bacteria | 1234 |
| 52 | Ga0070671_100042819 | 3300005355 | Bacteria | 3764 |
| 53 | Ga0070671_100191147 | 3300005355 | Bacteria | 1735 |
| 54 | Ga0070674_100020471 | 3300005356 | Bacteria | 4228 |
| 55 | Ga0070674_100097527 | 3300005356 | Bacteria | 2135 |
| 56 | Ga0070673_100005770 | 3300005364 | Bacteria | 7969 |
| 57 | Ga0070688_100009809 | 3300005365 | Bacteria | 5262 |
| 58 | Ga0070659_100002525 | 3300005366 | Bacteria | 12997 |
| 59 | Ga0070659_100018737 | 3300005366 | Bacteria | 5225 |
| 60 | Ga0070659_100154236 | 3300005366 | Bacteria | 1875 |
| 61 | Ga0070667_100223344 | 3300005367 | Bacteria | 1677 |
| 62 | Ga0070703_10001834 | 3300005406 | Bacteria | 6262 |
| 63 | Ga0070709_10347955 | 3300005434 | Bacteria | 1094 |
| 64 | Ga0070713_100185657 | 3300005436 | Bacteria | 1871 |
| 65 | Ga0070701_10000349 | 3300005438 | Bacteria | 15321 |
| 66 | Ga0070701_10040834 | 3300005438 | Bacteria | 2360 |
| 67 | Ga0070711_100061971 | 3300005439 | Bacteria | 2606 |
| 68 | Ga0070711_100276903 | 3300005439 | Bacteria | 1326 |
| 69 | Ga0070705_100008044 | 3300005440 | Bacteria | 5214 |
| 70 | Ga0070705_100008184 | 3300005440 | Bacteria | 5171 |
| 71 | Ga0070705_100060031 | 3300005440 | Bacteria | 2254 |
| 72 | Ga0070700_100002242 | 3300005441 | Bacteria | 9839 |
| 73 | Ga0070700_100147430 | 3300005441 | Bacteria | 1606 |
| 74 | Ga0070694_100020371 | 3300005444 | Bacteria | 4227 |
| 75 | Ga0070694_100028743 | 3300005444 | Bacteria | 3620 |
| 76 | Ga0070694_100031575 | 3300005444 | Bacteria | 3473 |
| 77 | Ga0070694_100037693 | 3300005444 | Bacteria | 3207 |
| 78 | Ga0070694_100057405 | 3300005444 | Bacteria | 2646 |
| 79 | Ga0070694_100078549 | 3300005444 | Bacteria | 2289 |
| 80 | Ga0070694_100123507 | 3300005444 | Bacteria | 1860 |
| 81 | Ga0070694_100341377 | 3300005444 | Bacteria | 1158 |
| 82 | Ga0070708_100010383 | 3300005445 | Bacteria | 7545 |
| 83 | Ga0070708_100010849 | 3300005445 | Bacteria | 7402 |
| 84 | Ga0070708_100020404 | 3300005445 | Bacteria | 5587 |
| 85 | Ga0070708_100046061 | 3300005445 | Bacteria | 3846 |
| 86 | Ga0070708_100046121 | 3300005445 | Bacteria | 3845 |
| 87 | Ga0070708_100087748 | 3300005445 | Bacteria | 2827 |
| 88 | Ga0070708_100110507 | 3300005445 | Bacteria | 2526 |
| 89 | Ga0070708_100196309 | 3300005445 | Unclassified | 1888 |
| 90 | Ga0070708_100348800 | 3300005445 | Bacteria | 1395 |
| 91 | Ga0070663_100253609 | 3300005455 | Bacteria | 1393 |
| 92 | Ga0070678_100005733 | 3300005456 | Bacteria | 7216 |
| 93 | Ga0070678_100037471 | 3300005456 | Bacteria | 3406 |
| 94 | Ga0070662_100005086 | 3300005457 | Bacteria | 8377 |
| 95 | Ga0070662_100021182 | 3300005457 | Bacteria | 4437 |
| 96 | Ga0070662_100094981 | 3300005457 | Bacteria | 2246 |
| 97 | Ga0070681_10000261 | 3300005458 | Bacteria | 42065 |
| 98 | Ga0070681_10003551 | 3300005458 | Bacteria | 14627 |
| 99 | Ga0070681_10023965 | 3300005458 | Bacteria | 6145 |
| 100 | Ga0070681_10100089 | 3300005458 | Bacteria | 2845 |
| 101 | Ga0068867_100000768 | 3300005459 | Bacteria | 21657 |
| 102 | Ga0070685_10000043 | 3300005466 | Bacteria | 75315 |
| 103 | Ga0070685_10198984 | 3300005466 | Bacteria | 1301 |
| 104 | Ga0070706_100000391 | 3300005467 | Bacteria | 52742 |
| 105 | Ga0070706_100001836 | 3300005467 | Bacteria | 21992 |
| 106 | Ga0070706_100004069 | 3300005467 | Bacteria | 14214 |
| 107 | Ga0070706_100009376 | 3300005467 | Bacteria | 9113 |
| 108 | Ga0070706_100016786 | 3300005467 | Bacteria | 6763 |
| 109 | Ga0070706_100020671 | 3300005467 | Bacteria | 6066 |
| 110 | Ga0070706_100022592 | 3300005467 | Bacteria | 5791 |
| 111 | Ga0070706_100030922 | 3300005467 | Bacteria | 4936 |
| 112 | Ga0070706_100053511 | 3300005467 | Bacteria | 3726 |
| 113 | Ga0070706_100092074 | 3300005467 | Bacteria | 2812 |
| 114 | Ga0070706_100196461 | 3300005467 | Bacteria | 1884 |
| 115 | Ga0070706_100214816 | 3300005467 | Bacteria | 1795 |
| 116 | Ga0070706_100322484 | 3300005467 | Bacteria | 1440 |
| 117 | Ga0070706_100662540 | 3300005467 | Bacteria | 969 |
| 118 | Ga0070707_100000020 | 3300005468 | Bacteria | 130967 |
| 119 | Ga0070707_100003627 | 3300005468 | Bacteria | 14563 |
| 120 | Ga0070707_100004343 | 3300005468 | Bacteria | 13280 |
| 121 | Ga0070707_100026063 | 3300005468 | Bacteria | 5548 |
| 122 | Ga0070707_100028396 | 3300005468 | Bacteria | 5325 |
| 123 | Ga0070707_100034017 | 3300005468 | Bacteria | 4862 |
| 124 | Ga0070707_100036068 | 3300005468 | Bacteria | 4717 |
| 125 | Ga0070707_100062096 | 3300005468 | Bacteria | 3584 |
| 126 | Ga0070707_100089136 | 3300005468 | Bacteria | 2984 |
| 127 | Ga0070707_100117473 | 3300005468 | Bacteria | 2581 |
| 128 | Ga0070707_100117749 | 3300005468 | Bacteria | 2578 |
| 129 | Ga0070707_100188419 | 3300005468 | Bacteria | 2011 |
| 130 | Ga0070707_100268561 | 3300005468 | Bacteria | 1659 |
| 131 | Ga0070698_100004971 | 3300005471 | Bacteria | 14568 |
| 132 | Ga0070698_100005671 | 3300005471 | Bacteria | 13667 |
| 133 | Ga0070698_100014324 | 3300005471 | Bacteria | 8381 |
| 134 | Ga0070698_100057652 | 3300005471 | Bacteria | 3930 |
| 135 | Ga0070698_100076866 | 3300005471 | Bacteria | 3339 |
| 136 | Ga0070698_100106329 | 3300005471 | Bacteria | 2775 |
| 137 | Ga0070698_100115250 | 3300005471 | Bacteria | 2652 |
| 138 | Ga0070698_100138311 | 3300005471 | Bacteria | 2388 |
| 139 | Ga0070699_100001508 | 3300005518 | Bacteria | 21294 |
| 140 | Ga0070699_100004696 | 3300005518 | Bacteria | 12083 |
| 141 | Ga0070699_100005374 | 3300005518 | Bacteria | 11237 |
| 142 | Ga0070699_100007767 | 3300005518 | Bacteria | 9322 |
| 143 | Ga0070699_100018835 | 3300005518 | Bacteria | 5930 |
| 144 | Ga0070699_100023370 | 3300005518 | Bacteria | 5324 |
| 145 | Ga0070699_100037610 | 3300005518 | Bacteria | 4190 |
| 146 | Ga0070699_100042161 | 3300005518 | Bacteria | 3949 |
| 147 | Ga0070699_100045810 | 3300005518 | Bacteria | 3785 |
| 148 | Ga0070699_100079625 | 3300005518 | Bacteria | 2854 |
| 149 | Ga0070699_100098434 | 3300005518 | Bacteria | 2563 |
| 150 | Ga0070699_100112219 | 3300005518 | Bacteria | 2394 |
| 151 | Ga0070699_100124741 | 3300005518 | Bacteria | 2266 |
| 152 | Ga0070699_100180049 | 3300005518 | Bacteria | 1875 |
| 153 | Ga0070699_100233214 | 3300005518 | Bacteria | 1641 |
| 154 | Ga0070699_100557147 | 3300005518 | Bacteria | 1044 |
| 155 | Ga0070679_100000407 | 3300005530 | Bacteria | 36623 |
| 156 | Ga0070679_100001058 | 3300005530 | Bacteria | 24000 |
| 157 | Ga0070679_100020319 | 3300005530 | Bacteria | 6472 |
| 158 | Ga0070697_100002321 | 3300005536 | Bacteria | 14620 |
| 159 | Ga0070697_100019444 | 3300005536 | Bacteria | 5365 |
| 160 | Ga0070697_100023388 | 3300005536 | Bacteria | 4913 |
| 161 | Ga0070697_100040774 | 3300005536 | Bacteria | 3757 |
| 162 | Ga0070697_100052264 | 3300005536 | Bacteria | 3320 |
| 163 | Ga0070697_100132525 | 3300005536 | Bacteria | 2091 |
| 164 | Ga0070697_100187477 | 3300005536 | Bacteria | 1755 |
| 165 | Ga0068853_100000307 | 3300005539 | Bacteria | 34337 |
| 166 | Ga0068853_100002929 | 3300005539 | Bacteria | 12979 |
| 167 | Ga0068853_100022317 | 3300005539 | Bacteria | 5285 |
| 168 | Ga0068853_100067438 | 3300005539 | Bacteria | 3109 |
| 169 | Ga0070672_100010471 | 3300005543 | Bacteria | 6432 |
| 170 | Ga0070672_100046323 | 3300005543 | Bacteria | 3369 |
| 171 | Ga0070672_100282416 | 3300005543 | Bacteria | 1404 |
| 172 | Ga0070686_100001492 | 3300005544 | Bacteria | 13175 |
| 173 | Ga0070686_100007508 | 3300005544 | Bacteria | 6085 |
| 174 | Ga0070686_100146197 | 3300005544 | Bacteria | 1651 |
| 175 | Ga0070695_100000568 | 3300005545 | Bacteria | 19470 |
| 176 | Ga0070695_100002576 | 3300005545 | Bacteria | 10465 |
| 177 | Ga0070695_100004078 | 3300005545 | Bacteria | 8542 |
| 178 | Ga0070695_100015694 | 3300005545 | Bacteria | 4576 |
| 179 | Ga0070695_100028367 | 3300005545 | Bacteria | 3473 |
| 180 | Ga0070695_100134542 | 3300005545 | Bacteria | 1707 |
| 181 | Ga0070696_100000494 | 3300005546 | Bacteria | 24818 |
| 182 | Ga0070696_100004753 | 3300005546 | Bacteria | 9071 |
| 183 | Ga0070696_100014439 | 3300005546 | Bacteria | 5297 |
| 184 | Ga0070696_100063779 | 3300005546 | Bacteria | 2581 |
| 185 | Ga0070696_100090442 | 3300005546 | Bacteria | 2178 |
| 186 | Ga0070696_100122392 | 3300005546 | Bacteria | 1884 |
| 187 | Ga0070696_100417531 | 3300005546 | Bacteria | 1052 |
| 188 | Ga0070693_100000364 | 3300005547 | Bacteria | 20532 |
| 189 | Ga0070693_100067860 | 3300005547 | Bacteria | 2092 |
| 190 | Ga0070693_100266262 | 3300005547 | Bacteria | 1142 |
| 191 | Ga0070665_100017807 | 3300005548 | Bacteria | 7132 |
| 192 | Ga0070665_100051807 | 3300005548 | Bacteria | 4116 |
| 193 | Ga0070665_100229860 | 3300005548 | Bacteria | 1855 |
| 194 | Ga0070665_100638668 | 3300005548 | Bacteria | 1078 |
| 195 | Ga0070704_100002975 | 3300005549 | Bacteria | 9631 |
| 196 | Ga0070704_100036807 | 3300005549 | Bacteria | 3337 |
| 197 | Ga0070704_100057375 | 3300005549 | Bacteria | 2768 |
| 198 | Ga0070704_100098361 | 3300005549 | Bacteria | 2198 |
| 199 | Ga0070704_100133106 | 3300005549 | Bacteria | 1930 |
| 200 | Ga0070704_100217660 | 3300005549 | Bacteria | 1551 |
| 201 | Ga0070704_100313730 | 3300005549 | Unclassified | 1311 |
| 202 | Ga0070704_100357219 | 3300005549 | Bacteria | 1235 |
| 203 | Ga0068855_100154889 | 3300005563 | Bacteria | 2604 |
| 204 | Ga0070664_100000430 | 3300005564 | Bacteria | 31417 |
| 205 | Ga0070664_100012636 | 3300005564 | Bacteria | 6873 |
| 206 | Ga0070664_100023033 | 3300005564 | Bacteria | 5139 |
| 207 | Ga0070664_100089188 | 3300005564 | Bacteria | 2668 |
| 208 | Ga0070664_100115549 | 3300005564 | Bacteria | 2345 |
| 209 | Ga0068857_100002928 | 3300005577 | Bacteria | 14074 |
| 210 | Ga0068857_100025315 | 3300005577 | Bacteria | 5225 |
| 211 | Ga0068857_100037288 | 3300005577 | Bacteria | 4305 |
| 212 | Ga0068854_100002896 | 3300005578 | Bacteria | 10659 |
| 213 | Ga0068856_100031052 | 3300005614 | Bacteria | 5225 |
| 214 | Ga0068856_100194924 | 3300005614 | Bacteria | 2040 |
| 215 | Ga0070702_100062333 | 3300005615 | Bacteria | 2174 |
| 216 | Ga0068859_100000761 | 3300005617 | Bacteria | 32461 |
| 217 | Ga0068859_100003234 | 3300005617 | Bacteria | 16590 |
| 218 | Ga0068859_100115007 | 3300005617 | Bacteria | 2755 |
| 219 | Ga0068859_100141288 | 3300005617 | Bacteria | 2481 |
| 220 | Ga0068864_100006065 | 3300005618 | Bacteria | 9918 |
| 221 | Ga0068864_100102514 | 3300005618 | Bacteria | 2540 |
| 222 | Ga0068864_100186242 | 3300005618 | Bacteria | 1900 |
| 223 | Ga0068866_10065435 | 3300005718 | Bacteria | 1901 |
| 224 | Ga0068861_100053699 | 3300005719 | Bacteria | 3067 |
| 225 | Ga0068861_100132965 | 3300005719 | Bacteria | 2021 |
| 226 | Ga0068870_10000344 | 3300005840 | Bacteria | 17399 |
| 227 | Ga0068863_100091308 | 3300005841 | Bacteria | 2888 |
| 228 | Ga0068863_100121331 | 3300005841 | Bacteria | 2493 |
| 229 | Ga0068858_100001091 | 3300005842 | Bacteria | 28097 |
| 230 | Ga0068858_100061352 | 3300005842 | Bacteria | 3476 |
| 231 | Ga0068858_100555662 | 3300005842 | Bacteria | 1111 |
| 232 | Ga0068860_100004991 | 3300005843 | Bacteria | 13519 |
| 233 | Ga0068860_100010570 | 3300005843 | Bacteria | 9118 |
| 234 | Ga0068860_100051349 | 3300005843 | Bacteria | 3923 |
| 235 | Ga0068860_100107032 | 3300005843 | Bacteria | 2672 |
| 236 | Ga0068860_100139437 | 3300005843 | Bacteria | 2330 |
| 237 | Ga0068860_100232421 | 3300005843 | Bacteria | 1792 |
| 238 | Ga0068860_100374998 | 3300005843 | Bacteria | 1404 |
| 239 | Ga0068862_100019969 | 3300005844 | Bacteria | 5592 |
| 240 | Ga0068862_100029327 | 3300005844 | Bacteria | 4636 |
| 241 | Ga0068862_100054687 | 3300005844 | Bacteria | 3417 |
| 242 | Ga0081455_10260101 | 3300005937 | Bacteria | 1264 |
| 243 | Ga0081538_10049728 | 3300005981 | Bacteria | 2540 |
| 244 | Ga0081539_10000069 | 3300005985 | Bacteria | 236854 |
| 245 | Ga0081539_10000964 | 3300005985 | Bacteria | 53913 |
| 246 | Ga0070717_10328943 | 3300006028 | Bacteria | 1363 |
| 247 | Ga0070715_10060210 | 3300006163 | Bacteria | 1664 |
| 248 | Ga0070715_10141223 | 3300006163 | Bacteria | 1170 |
| 249 | Ga0070716_100103005 | 3300006173 | Bacteria | 1754 |
| 250 | Ga0097621_100027191 | 3300006237 | Bacteria | 4497 |
| 251 | Ga0068871_100011708 | 3300006358 | Bacteria | 6441 |
| 252 | Ga0075428_100001434 | 3300006844 | Bacteria | 25452 |
| 253 | Ga0075428_100001585 | 3300006844 | Bacteria | 24368 |
| 254 | Ga0075428_100046174 | 3300006844 | Bacteria | 4785 |
| 255 | Ga0075428_100066481 | 3300006844 | Bacteria | 3947 |
| 256 | Ga0075428_100107832 | 3300006844 | Bacteria | 3035 |
| 257 | Ga0075428_100123355 | 3300006844 | Bacteria | 2820 |
| 258 | Ga0075428_100153399 | 3300006844 | Bacteria | 2502 |
| 259 | Ga0075428_100388783 | 3300006844 | Bacteria | 1495 |
| 260 | Ga0075430_100000480 | 3300006846 | Bacteria | 29854 |
| 261 | Ga0075430_100003542 | 3300006846 | Bacteria | 13074 |
| 262 | Ga0075430_100003937 | 3300006846 | Bacteria | 12528 |
| 263 | Ga0075430_100005556 | 3300006846 | Bacteria | 10650 |
| 264 | Ga0075430_100016264 | 3300006846 | Bacteria | 6335 |
| 265 | Ga0075430_100100628 | 3300006846 | Bacteria | 2414 |
| 266 | Ga0075430_100153809 | 3300006846 | Bacteria | 1915 |
| 267 | Ga0075431_100000016 | 3300006847 | Bacteria | 85421 |
| 268 | Ga0075431_100000127 | 3300006847 | Bacteria | 50561 |
| 269 | Ga0075431_100000851 | 3300006847 | Bacteria | 26781 |
| 270 | Ga0075431_100020107 | 3300006847 | Bacteria | 6819 |
| 271 | Ga0075431_100023856 | 3300006847 | Bacteria | 6262 |
| 272 | Ga0075431_100025816 | 3300006847 | Bacteria | 6022 |
| 273 | Ga0075431_100047604 | 3300006847 | Bacteria | 4421 |
| 274 | Ga0075431_100074988 | 3300006847 | Bacteria | 3491 |
| 275 | Ga0075431_100115185 | 3300006847 | Bacteria | 2775 |
| 276 | Ga0075431_100200690 | 3300006847 | Bacteria | 2041 |
| 277 | Ga0075431_100211911 | 3300006847 | Bacteria | 1979 |
| 278 | Ga0075433_10002610 | 3300006852 | Bacteria | 13744 |
| 279 | Ga0075433_10004841 | 3300006852 | Bacteria | 10525 |
| 280 | Ga0075433_10006146 | 3300006852 | Bacteria | 9464 |
| 281 | Ga0075433_10010307 | 3300006852 | Bacteria | 7495 |
| 282 | Ga0075433_10015008 | 3300006852 | Bacteria | 6342 |
| 283 | Ga0075433_10019642 | 3300006852 | Bacteria | 5634 |
| 284 | Ga0075433_10053691 | 3300006852 | Bacteria | 3514 |
| 285 | Ga0075433_10074610 | 3300006852 | Bacteria | 2984 |
| 286 | Ga0075433_10148131 | 3300006852 | Bacteria | 2087 |
| 287 | Ga0075433_10148516 | 3300006852 | Bacteria | 2085 |
| 288 | Ga0075433_10381077 | 3300006852 | Bacteria | 1245 |
| 289 | Ga0075434_100026137 | 3300006871 | Bacteria | 5717 |
| 290 | Ga0075434_100030189 | 3300006871 | Bacteria | 5337 |
| 291 | Ga0075434_100031806 | 3300006871 | Bacteria | 5203 |
| 292 | Ga0075434_100044789 | 3300006871 | Bacteria | 4389 |
| 293 | Ga0075434_100068041 | 3300006871 | Bacteria | 3547 |
| 294 | Ga0075434_100158700 | 3300006871 | Bacteria | 2282 |
| 295 | Ga0075434_100222003 | 3300006871 | Bacteria | 1909 |
| 296 | Ga0075429_100002270 | 3300006880 | Bacteria | 16114 |
| 297 | Ga0075429_100051717 | 3300006880 | Bacteria | 3574 |
| 298 | Ga0075429_100052473 | 3300006880 | Bacteria | 3548 |
| 299 | Ga0075429_100064653 | 3300006880 | Bacteria | 3186 |
| 300 | Ga0075429_100142440 | 3300006880 | Bacteria | 2099 |
| 301 | Ga0075429_100147690 | 3300006880 | Bacteria | 2058 |
| 302 | Ga0075429_100189387 | 3300006880 | Bacteria | 1803 |
| 303 | Ga0075429_100252510 | 3300006880 | Bacteria | 1544 |
| 304 | Ga0075429_100354736 | 3300006880 | Bacteria | 1284 |
| 305 | Ga0075436_100000659 | 3300006914 | Bacteria | 22772 |
| 306 | Ga0075436_100022658 | 3300006914 | Bacteria | 4315 |
| 307 | Ga0075436_100035050 | 3300006914 | Bacteria | 3462 |
| 308 | Ga0075436_100067033 | 3300006914 | Bacteria | 2481 |
| 309 | Ga0075436_100089818 | 3300006914 | Bacteria | 2135 |
| 310 | Ga0075436_100143999 | 3300006914 | Bacteria | 1676 |
| 311 | Ga0075436_100209882 | 3300006914 | Bacteria | 1380 |
| 312 | Ga0075436_100276736 | 3300006914 | Bacteria | 1199 |
| 313 | Ga0097620_100000761 | 3300006931 | Bacteria | 32461 |
| 314 | Ga0097620_100003234 | 3300006931 | Bacteria | 16590 |
| 315 | Ga0097620_100115005 | 3300006931 | Bacteria | 2755 |
| 316 | Ga0097620_100141278 | 3300006931 | Bacteria | 2481 |
| 317 | Ga0075435_100000446 | 3300007076 | Bacteria | 25321 |
| 318 | Ga0075435_100003851 | 3300007076 | Bacteria | 10230 |
| 319 | Ga0075435_100185350 | 3300007076 | Bacteria | 1760 |
| 320 | Ga0075435_100284140 | 3300007076 | Bacteria | 1413 |
| 321 | Ga0099794_10000051 | 3300007265 | Bacteria | 46560 |
| 322 | Ga0099794_10011530 | 3300007265 | Bacteria | 3786 |
| 323 | Ga0099794_10057804 | 3300007265 | Bacteria | 1879 |
| 324 | Ga0105240_10000041 | 3300009093 | Bacteria | 264078 |
| 325 | Ga0105240_10566718 | 3300009093 | Bacteria | 1255 |
| 326 | Ga0111539_10000327 | 3300009094 | Bacteria | 58082 |
| 327 | Ga0111539_10001558 | 3300009094 | Bacteria | 30523 |
| 328 | Ga0111539_10010661 | 3300009094 | Bacteria | 11575 |
| 329 | Ga0111539_10080139 | 3300009094 | Bacteria | 3841 |
| 330 | Ga0111539_10115067 | 3300009094 | Bacteria | 3155 |
| 331 | Ga0111539_10766609 | 3300009094 | Bacteria | 1123 |
| 332 | Ga0111539_10878827 | 3300009094 | Bacteria | 1043 |
| 333 | Ga0105245_10025527 | 3300009098 | Bacteria | 5197 |
| 334 | Ga0105247_10042439 | 3300009101 | Bacteria | 2786 |
| 335 | Ga0105247_10148426 | 3300009101 | Bacteria | 1543 |
| 336 | Ga0114129_10000002 | 3300009147 | Bacteria | 204413 |
| 337 | Ga0114129_10000093 | 3300009147 | Bacteria | 85690 |
| 338 | Ga0114129_10003396 | 3300009147 | Bacteria | 22367 |
| 339 | Ga0114129_10003570 | 3300009147 | Bacteria | 21893 |
| 340 | Ga0114129_10025764 | 3300009147 | Bacteria | 8331 |
| 341 | Ga0114129_10027787 | 3300009147 | Bacteria | 8011 |
| 342 | Ga0114129_10043934 | 3300009147 | Bacteria | 6286 |
| 343 | Ga0114129_10074063 | 3300009147 | Bacteria | 4743 |
| 344 | Ga0114129_10146036 | 3300009147 | Bacteria | 3240 |
| 345 | Ga0114129_10162001 | 3300009147 | Bacteria | 3055 |
| 346 | Ga0114129_10199380 | 3300009147 | Bacteria | 2712 |
| 347 | Ga0114129_10236374 | 3300009147 | Bacteria | 2458 |
| 348 | Ga0114129_10237963 | 3300009147 | Bacteria | 2449 |
| 349 | Ga0114129_10302202 | 3300009147 | Bacteria | 2132 |
| 350 | Ga0114129_10402286 | 3300009147 | Bacteria | 1804 |
| 351 | Ga0114129_10422433 | 3300009147 | Bacteria | 1753 |
| 352 | Ga0114129_10485969 | 3300009147 | Bacteria | 1615 |
| 353 | Ga0105243_10105459 | 3300009148 | Bacteria | 2348 |
| 354 | Ga0105243_10164009 | 3300009148 | Bacteria | 1918 |
| 355 | Ga0105241_10001068 | 3300009174 | Bacteria | 20901 |
| 356 | Ga0105241_10002639 | 3300009174 | Bacteria | 13430 |
| 357 | Ga0105241_10410260 | 3300009174 | Bacteria | 1190 |
| 358 | Ga0105242_10033889 | 3300009176 | Bacteria | 4092 |
| 359 | Ga0105242_10035281 | 3300009176 | Bacteria | 4011 |
| 360 | Ga0105242_10058606 | 3300009176 | Bacteria | 3158 |
| 361 | Ga0105242_10267145 | 3300009176 | Bacteria | 1548 |
| 362 | Ga0105248_10000669 | 3300009177 | Bacteria | 38860 |
| 363 | Ga0105248_10006680 | 3300009177 | Bacteria | 12660 |
| 364 | Ga0105248_10268673 | 3300009177 | Bacteria | 1920 |
| 365 | Ga0105248_10517752 | 3300009177 | Bacteria | 1345 |
| 366 | Ga0105237_10002307 | 3300009545 | Bacteria | 23709 |
| 367 | Ga0105237_10253022 | 3300009545 | Bacteria | 1764 |
| 368 | Ga0105238_10021605 | 3300009551 | Bacteria | 6555 |
| 369 | Ga0105249_10045467 | 3300009553 | Bacteria | 3993 |
| 370 | Ga0105249_10091991 | 3300009553 | Bacteria | 2839 |
| 371 | Ga0105249_10170627 | 3300009553 | Bacteria | 2109 |
| 372 | Ga0105249_10380170 | 3300009553 | Bacteria | 1438 |
| 373 | Ga0105249_10396788 | 3300009553 | Bacteria | 1409 |
| 374 | Ga0105249_10455959 | 3300009553 | Bacteria | 1318 |
| 375 | Ga0105239_10001288 | 3300010375 | Bacteria | 33843 |
| 376 | Ga0105239_10027237 | 3300010375 | Bacteria | 6292 |
| 377 | Ga0105239_10050735 | 3300010375 | Bacteria | 4549 |
| 378 | Ga0105239_10099663 | 3300010375 | Bacteria | 3212 |
| 379 | Ga0105239_10368387 | 3300010375 | Bacteria | 1623 |
| 380 | Ga0105239_10593578 | 3300010375 | Bacteria | 1263 |
| 381 | Ga0105246_10057039 | 3300011119 | Bacteria | 2701 |
| 382 | Ga0157373_10189626 | 3300013100 | Bacteria | 1449 |
| 383 | Ga0157371_10038288 | 3300013102 | Bacteria | 3431 |
| 384 | Ga0157371_10097325 | 3300013102 | Bacteria | 2086 |
| 385 | Ga0157371_10140124 | 3300013102 | Bacteria | 1723 |
| 386 | Ga0157369_10051057 | 3300013105 | Bacteria | 4476 |
| 387 | Ga0157369_10434513 | 3300013105 | Bacteria | 1360 |
| 388 | Ga0157374_10023689 | 3300013296 | Bacteria | 5495 |
| 389 | Ga0157374_10026298 | 3300013296 | Bacteria | 5235 |
| 390 | Ga0157378_10002950 | 3300013297 | Bacteria | 15127 |
| 391 | Ga0157378_10662648 | 3300013297 | Bacteria | 1060 |
| 392 | Ga0163162_10026169 | 3300013306 | Bacteria | 5766 |
| 393 | Ga0163162_10028622 | 3300013306 | Bacteria | 5514 |
| 394 | Ga0163162_10231379 | 3300013306 | Bacteria | 1979 |
| 395 | Ga0163162_10256566 | 3300013306 | Bacteria | 1880 |
| 396 | Ga0157372_10027196 | 3300013307 | Bacteria | 6227 |
| 397 | Ga0157372_10102954 | 3300013307 | Bacteria | 3262 |
| 398 | Ga0157372_10206795 | 3300013307 | Bacteria | 2274 |
| 399 | Ga0157372_10274132 | 3300013307 | Bacteria | 1961 |
| 400 | Ga0157372_10376096 | 3300013307 | Bacteria | 1655 |
| 401 | Ga0157375_10012076 | 3300013308 | Bacteria | 7650 |
| 402 | Ga0157375_10012494 | 3300013308 | Bacteria | 7536 |
| 403 | Ga0157375_10048140 | 3300013308 | Bacteria | 4168 |
| 404 | Ga0157375_10307609 | 3300013308 | Bacteria | 1749 |
| 405 | Ga0157375_10727048 | 3300013308 | Bacteria | 1145 |
| 406 | Ga0163163_10014977 | 3300014325 | Bacteria | 7147 |
| 407 | Ga0163163_10127622 | 3300014325 | Bacteria | 2582 |
| 408 | Ga0157380_10001115 | 3300014326 | Bacteria | 17333 |
| 409 | Ga0157380_10072730 | 3300014326 | Bacteria | 2786 |
| 410 | Ga0157380_10073658 | 3300014326 | Bacteria | 2770 |
| 411 | Ga0157380_10121406 | 3300014326 | Bacteria | 2214 |
| 412 | Ga0157377_10145163 | 3300014745 | Bacteria | 1462 |
| 413 | Ga0157379_10186308 | 3300014968 | Bacteria | 1876 |
| 414 | Ga0157376_10002892 | 3300014969 | Bacteria | 11771 |
| 415 | Ga0157376_10014517 | 3300014969 | Bacteria | 5916 |
| 416 | Ga0163161_10052577 | 3300017792 | Bacteria | 2953 |
| 417 | Ga0197907_10142512 | 3300020069 | Bacteria | 1199 |
| 418 | Ga0197907_10541769 | 3300020069 | Bacteria | 1298 |
| 419 | Ga0197907_10662627 | 3300020069 | Bacteria | 974 |
| 420 | Ga0197907_10674868 | 3300020069 | Unclassified | 1256 |
| 421 | Ga0197907_11056369 | 3300020069 | Bacteria | 1416 |
| 422 | Ga0197907_11169213 | 3300020069 | Unclassified | 1106 |
| 423 | Ga0206356_10244490 | 3300020070 | Bacteria | 1200 |
| 424 | Ga0206356_10979058 | 3300020070 | Bacteria | 2262 |
| 425 | Ga0206356_11515020 | 3300020070 | Unclassified | 1197 |
| 426 | Ga0206356_11856893 | 3300020070 | Bacteria | 1267 |
| 427 | Ga0206349_1060160 | 3300020075 | Bacteria | 1372 |
| 428 | Ga0206349_1067078 | 3300020075 | Bacteria | 1188 |
| 429 | Ga0206349_1239780 | 3300020075 | Bacteria | 1110 |
| 430 | Ga0206349_1240892 | 3300020075 | Bacteria | 1449 |
| 431 | Ga0206349_1284932 | 3300020075 | Bacteria | 1300 |
| 432 | Ga0206349_1615189 | 3300020075 | Bacteria | 1462 |
| 433 | Ga0206349_1909150 | 3300020075 | Bacteria | 976 |
| 434 | Ga0206355_1357135 | 3300020076 | Bacteria | 1193 |
| 435 | Ga0206351_10068540 | 3300020077 | Bacteria | 1191 |
| 436 | Ga0206351_10265613 | 3300020077 | Bacteria | 989 |
| 437 | Ga0206351_10320234 | 3300020077 | Bacteria | 1503 |
| 438 | Ga0206352_10111162 | 3300020078 | Bacteria | 1326 |
| 439 | Ga0206352_10806553 | 3300020078 | Bacteria | 1109 |
| 440 | Ga0206352_11088056 | 3300020078 | Bacteria | 2638 |
| 441 | Ga0206350_10055406 | 3300020080 | Unclassified | 1610 |
| 442 | Ga0206350_10055662 | 3300020080 | Unclassified | 1407 |
| 443 | Ga0206350_10058979 | 3300020080 | Bacteria | 1010 |
| 444 | Ga0206350_10383671 | 3300020080 | Bacteria | 1118 |
| 445 | Ga0206350_10702709 | 3300020080 | Bacteria | 1476 |
| 446 | Ga0206350_10765337 | 3300020080 | Bacteria | 3664 |
| 447 | Ga0206350_10787735 | 3300020080 | Unclassified | 1241 |
| 448 | Ga0206350_11004085 | 3300020080 | Bacteria | 1260 |
| 449 | Ga0206350_11116656 | 3300020080 | Bacteria | 1200 |
| 450 | Ga0206350_11495803 | 3300020080 | Bacteria | 1241 |
| 451 | Ga0206354_10099186 | 3300020081 | Bacteria | 1196 |
| 452 | Ga0206354_10475810 | 3300020081 | Bacteria | 1642 |
| 453 | Ga0206353_10502351 | 3300020082 | Bacteria | 2154 |
| 454 | Ga0154015_1547869 | 3300020610 | Bacteria | 1188 |
| 455 | Ga0213875_10066143 | 3300021388 | Bacteria | 1689 |
| 456 | Ga0224712_10031567 | 3300022467 | Bacteria | 1923 |
| 457 | Ga0224712_10040530 | 3300022467 | Unclassified | 1753 |
| 458 | Ga0224712_10049073 | 3300022467 | Bacteria | 1633 |
| 459 | Ga0224712_10079843 | 3300022467 | Bacteria | 1348 |
| 460 | Ga0224712_10087311 | 3300022467 | Bacteria | 1300 |
| 461 | Ga0224712_10108465 | 3300022467 | Unclassified | 1188 |
| 462 | Ga0224712_10160799 | 3300022467 | Bacteria | 1001 |
| 463 | Ga0209233_1000253 | 3300025261 | Bacteria | 82672 |
| 464 | Ga0207697_10037972 | 3300025315 | Bacteria | 1974 |
| 465 | Ga0207653_10003696 | 3300025885 | Bacteria | 4810 |
| 466 | Ga0207653_10006461 | 3300025885 | Bacteria | 3657 |
| 467 | Ga0207653_10010446 | 3300025885 | Bacteria | 2895 |
| 468 | Ga0207682_10091285 | 3300025893 | Bacteria | 1320 |
| 469 | Ga0207688_10016689 | 3300025901 | Bacteria | 3986 |
| 470 | Ga0207680_10006676 | 3300025903 | Bacteria | 5598 |
| 471 | Ga0207685_10022880 | 3300025905 | Bacteria | 2119 |
| 472 | Ga0207685_10052029 | 3300025905 | Bacteria | 1585 |
| 473 | Ga0207699_10099260 | 3300025906 | Bacteria | 1844 |
| 474 | Ga0207645_10004388 | 3300025907 | Bacteria | 10451 |
| 475 | Ga0207645_10057553 | 3300025907 | Bacteria | 2482 |
| 476 | Ga0207643_10000700 | 3300025908 | Bacteria | 20877 |
| 477 | Ga0207643_10061519 | 3300025908 | Bacteria | 2144 |
| 478 | Ga0207705_10003355 | 3300025909 | Bacteria | 12170 |
| 479 | Ga0207684_10000269 | 3300025910 | Bacteria | 77057 |
| 480 | Ga0207684_10000699 | 3300025910 | Bacteria | 39632 |
| 481 | Ga0207684_10002692 | 3300025910 | Bacteria | 17748 |
| 482 | Ga0207684_10006205 | 3300025910 | Bacteria | 10913 |
| 483 | Ga0207684_10008726 | 3300025910 | Bacteria | 8999 |
| 484 | Ga0207684_10012203 | 3300025910 | Bacteria | 7478 |
| 485 | Ga0207684_10026275 | 3300025910 | Bacteria | 4963 |
| 486 | Ga0207684_10030286 | 3300025910 | Bacteria | 4607 |
| 487 | Ga0207684_10082354 | 3300025910 | Bacteria | 2740 |
| 488 | Ga0207684_10194903 | 3300025910 | Bacteria | 1747 |
| 489 | Ga0207684_10200471 | 3300025910 | Bacteria | 1722 |
| 490 | Ga0207684_10320413 | 3300025910 | Bacteria | 1336 |
| 491 | Ga0207684_10409336 | 3300025910 | Bacteria | 1166 |
| 492 | Ga0207654_10002375 | 3300025911 | Bacteria | 9637 |
| 493 | Ga0207707_10000003 | 3300025912 | Bacteria | 642592 |
| 494 | Ga0207707_10028133 | 3300025912 | Bacteria | 4914 |
| 495 | Ga0207707_10034538 | 3300025912 | Bacteria | 4424 |
| 496 | Ga0207707_10082308 | 3300025912 | Bacteria | 2810 |
| 497 | Ga0207695_10000125 | 3300025913 | Bacteria | 228810 |
| 498 | Ga0207695_10001897 | 3300025913 | Bacteria | 32648 |
| 499 | Ga0207671_10001097 | 3300025914 | Bacteria | 32744 |
| 500 | Ga0207663_10091313 | 3300025916 | Bacteria | 2022 |
| 501 | Ga0207660_10000499 | 3300025917 | Bacteria | 26138 |
| 502 | Ga0207660_10015310 | 3300025917 | Bacteria | 5059 |
| 503 | Ga0207660_10017179 | 3300025917 | Bacteria | 4801 |
| 504 | Ga0207660_10118020 | 3300025917 | Bacteria | 2006 |
| 505 | Ga0207660_10196972 | 3300025917 | Bacteria | 1572 |
| 506 | Ga0207662_10051744 | 3300025918 | Bacteria | 2443 |
| 507 | Ga0207662_10166004 | 3300025918 | Bacteria | 1413 |
| 508 | Ga0207657_10002105 | 3300025919 | Bacteria | 21524 |
| 509 | Ga0207657_10004687 | 3300025919 | Bacteria | 14437 |
| 510 | Ga0207649_10006972 | 3300025920 | Bacteria | 6140 |
| 511 | Ga0207649_10050804 | 3300025920 | Bacteria | 2565 |
| 512 | Ga0207652_10000024 | 3300025921 | Bacteria | 157748 |
| 513 | Ga0207652_10000948 | 3300025921 | Bacteria | 27240 |
| 514 | Ga0207652_10195049 | 3300025921 | Bacteria | 1822 |
| 515 | Ga0207646_10000008 | 3300025922 | Bacteria | 457143 |
| 516 | Ga0207646_10000009 | 3300025922 | Bacteria | 453146 |
| 517 | Ga0207646_10001224 | 3300025922 | Bacteria | 32267 |
| 518 | Ga0207646_10001278 | 3300025922 | Bacteria | 31485 |
| 519 | Ga0207646_10006130 | 3300025922 | Bacteria | 12507 |
| 520 | Ga0207646_10023144 | 3300025922 | Bacteria | 5710 |
| 521 | Ga0207646_10034841 | 3300025922 | Bacteria | 4550 |
| 522 | Ga0207646_10035870 | 3300025922 | Bacteria | 4477 |
| 523 | Ga0207646_10036164 | 3300025922 | Bacteria | 4458 |
| 524 | Ga0207646_10043460 | 3300025922 | Bacteria | 4035 |
| 525 | Ga0207646_10047772 | 3300025922 | Bacteria | 3838 |
| 526 | Ga0207646_10049366 | 3300025922 | Unclassified | 3769 |
| 527 | Ga0207646_10050810 | 3300025922 | Bacteria | 3710 |
| 528 | Ga0207646_10079634 | 3300025922 | Bacteria | 2929 |
| 529 | Ga0207646_10082775 | 3300025922 | Bacteria | 2870 |
| 530 | Ga0207646_10236558 | 3300025922 | Bacteria | 1650 |
| 531 | Ga0207646_10248220 | 3300025922 | Bacteria | 1608 |
| 532 | Ga0207646_10438559 | 3300025922 | Bacteria | 1179 |
| 533 | Ga0207681_10064417 | 3300025923 | Bacteria | 2531 |
| 534 | Ga0207681_10081535 | 3300025923 | Bacteria | 2284 |
| 535 | Ga0207681_10129560 | 3300025923 | Bacteria | 1863 |
| 536 | Ga0207681_10303079 | 3300025923 | Bacteria | 1265 |
| 537 | Ga0207694_10020953 | 3300025924 | Bacteria | 4949 |
| 538 | Ga0207650_10016596 | 3300025925 | Bacteria | 5148 |
| 539 | Ga0207659_10004601 | 3300025926 | Bacteria | 8349 |
| 540 | Ga0207659_10222687 | 3300025926 | Bacteria | 1518 |
| 541 | Ga0207700_10134521 | 3300025928 | Bacteria | 2023 |
| 542 | Ga0207700_10268570 | 3300025928 | Bacteria | 1463 |
| 543 | Ga0207664_10119473 | 3300025929 | Bacteria | 2204 |
| 544 | Ga0207644_10088579 | 3300025931 | Bacteria | 2302 |
| 545 | Ga0207644_10315981 | 3300025931 | Bacteria | 1262 |
| 546 | Ga0207690_10027852 | 3300025932 | Bacteria | 3575 |
| 547 | Ga0207690_10041631 | 3300025932 | Bacteria | 3011 |
| 548 | Ga0207706_10010824 | 3300025933 | Bacteria | 8321 |
| 549 | Ga0207706_10014986 | 3300025933 | Bacteria | 7019 |
| 550 | Ga0207706_10081167 | 3300025933 | Bacteria | 2850 |
| 551 | Ga0207709_10038530 | 3300025935 | Bacteria | 2848 |
| 552 | Ga0207709_10108894 | 3300025935 | Bacteria | 1848 |
| 553 | Ga0207709_10150084 | 3300025935 | Bacteria | 1613 |
| 554 | Ga0207670_10001774 | 3300025936 | Bacteria | 11294 |
| 555 | Ga0207670_10066821 | 3300025936 | Bacteria | 2471 |
| 556 | Ga0207670_10123021 | 3300025936 | Bacteria | 1889 |
| 557 | Ga0207665_10077805 | 3300025939 | Bacteria | 2277 |
| 558 | Ga0207691_10010904 | 3300025940 | Bacteria | 8722 |
| 559 | Ga0207691_10045517 | 3300025940 | Bacteria | 4033 |
| 560 | Ga0207691_10057184 | 3300025940 | Bacteria | 3551 |
| 561 | Ga0207711_10035703 | 3300025941 | Bacteria | 4215 |
| 562 | Ga0207711_10039175 | 3300025941 | Bacteria | 4031 |
| 563 | Ga0207711_10100552 | 3300025941 | Bacteria | 2558 |
| 564 | Ga0207689_10004812 | 3300025942 | Bacteria | 12171 |
| 565 | Ga0207689_10007296 | 3300025942 | Bacteria | 9704 |
| 566 | Ga0207679_10008774 | 3300025945 | Bacteria | 6448 |
| 567 | Ga0207679_10012799 | 3300025945 | Bacteria | 5483 |
| 568 | Ga0207679_10224473 | 3300025945 | Bacteria | 1582 |
| 569 | Ga0207679_10287539 | 3300025945 | Unclassified | 1412 |
| 570 | Ga0207667_10000470 | 3300025949 | Bacteria | 53903 |
| 571 | Ga0207651_10078724 | 3300025960 | Bacteria | 2365 |
| 572 | Ga0207712_10090808 | 3300025961 | Bacteria | 2248 |
| 573 | Ga0207712_10156610 | 3300025961 | Bacteria | 1765 |
| 574 | Ga0207712_10343860 | 3300025961 | Bacteria | 1238 |
| 575 | Ga0207668_10044533 | 3300025972 | Bacteria | 3020 |
| 576 | Ga0207668_10065445 | 3300025972 | Bacteria | 2573 |
| 577 | Ga0207640_10003162 | 3300025981 | Bacteria | 8858 |
| 578 | Ga0207640_10383750 | 3300025981 | Bacteria | 1139 |
| 579 | Ga0207658_10267268 | 3300025986 | Bacteria | 1460 |
| 580 | Ga0207658_10297645 | 3300025986 | Bacteria | 1389 |
| 581 | Ga0207677_10022838 | 3300026023 | Bacteria | 3852 |
| 582 | Ga0207703_10000905 | 3300026035 | Bacteria | 29007 |
| 583 | Ga0207703_10068334 | 3300026035 | Bacteria | 2927 |
| 584 | Ga0207703_10076252 | 3300026035 | Bacteria | 2781 |
| 585 | Ga0207703_10088441 | 3300026035 | Bacteria | 2600 |
| 586 | Ga0207703_10219611 | 3300026035 | Bacteria | 1699 |
| 587 | Ga0207639_10000569 | 3300026041 | Bacteria | 25445 |
| 588 | Ga0207639_10009494 | 3300026041 | Bacteria | 6716 |
| 589 | Ga0207639_10013924 | 3300026041 | Bacteria | 5642 |
| 590 | Ga0207678_10009235 | 3300026067 | Bacteria | 8676 |
| 591 | Ga0207678_10285780 | 3300026067 | Bacteria | 1416 |
| 592 | Ga0207708_10000205 | 3300026075 | Bacteria | 46835 |
| 593 | Ga0207708_10022381 | 3300026075 | Bacteria | 4773 |
| 594 | Ga0207702_10008773 | 3300026078 | Bacteria | 8521 |
| 595 | Ga0207702_10169622 | 3300026078 | Bacteria | 2000 |
| 596 | Ga0207641_10069103 | 3300026088 | Bacteria | 3031 |
| 597 | Ga0207641_10105985 | 3300026088 | Bacteria | 2484 |
| 598 | Ga0207641_10124712 | 3300026088 | Bacteria | 2304 |
| 599 | Ga0207641_10399934 | 3300026088 | Bacteria | 1319 |
| 600 | Ga0207648_10018449 | 3300026089 | Bacteria | 6317 |
| 601 | Ga0207648_10039482 | 3300026089 | Bacteria | 4150 |
| 602 | Ga0207674_10003153 | 3300026116 | Bacteria | 20327 |
| 603 | Ga0207674_10004332 | 3300026116 | Bacteria | 17118 |
| 604 | Ga0207674_10011021 | 3300026116 | Bacteria | 10166 |
| 605 | Ga0207674_10011149 | 3300026116 | Bacteria | 10108 |
| 606 | Ga0207674_10137713 | 3300026116 | Bacteria | 2402 |
| 607 | Ga0207675_100007447 | 3300026118 | Bacteria | 10342 |
| 608 | Ga0207675_100009342 | 3300026118 | Bacteria | 9191 |
| 609 | Ga0207675_100276423 | 3300026118 | Bacteria | 1631 |
| 610 | Ga0207683_10001914 | 3300026121 | Bacteria | 18427 |
| 611 | Ga0207698_10101133 | 3300026142 | Bacteria | 2390 |
| 612 | Ga0209967_1004932 | 3300027364 | Bacteria | 1785 |
| 613 | Ga0209981_1001519 | 3300027378 | Bacteria | 2932 |
| 614 | Ga0210000_1002180 | 3300027462 | Bacteria | 2776 |
| 615 | Ga0209995_1001998 | 3300027471 | Bacteria | 3197 |
| 616 | Ga0209968_1005761 | 3300027526 | Bacteria | 1861 |
| 617 | Ga0209999_1000518 | 3300027543 | Bacteria | 6018 |
| 618 | Ga0209970_1000650 | 3300027614 | Bacteria | 6019 |
| 619 | Ga0209588_1000010 | 3300027671 | Bacteria | 159025 |
| 620 | Ga0209971_1000004 | 3300027682 | Bacteria | 110041 |
| 621 | Ga0209966_1000015 | 3300027695 | Bacteria | 78092 |
| 622 | Ga0209998_10000001 | 3300027717 | Bacteria | 203589 |
| 623 | Ga0209974_10000064 | 3300027876 | Bacteria | 28215 |
| 624 | Ga0209974_10008177 | 3300027876 | Bacteria | 3581 |
| 625 | Ga0207428_10003135 | 3300027907 | Bacteria | 16210 |
| 626 | Ga0207428_10008148 | 3300027907 | Bacteria | 9492 |
| 627 | Ga0207428_10044386 | 3300027907 | Bacteria | 3586 |
| 628 | Ga0207428_10108472 | 3300027907 | Bacteria | 2138 |
| 629 | Ga0268266_10000257 | 3300028379 | Bacteria | 89384 |
| 630 | Ga0268266_10049836 | 3300028379 | Bacteria | 3592 |
| 631 | Ga0268265_10010779 | 3300028380 | Bacteria | 6171 |
| 632 | Ga0268265_10015484 | 3300028380 | Bacteria | 5220 |
| 633 | Ga0268265_10015621 | 3300028380 | Bacteria | 5199 |
| 634 | Ga0268264_10003412 | 3300028381 | Bacteria | 13714 |
| 635 | Ga0268264_10015858 | 3300028381 | Bacteria | 6170 |
| 636 | Ga0268264_10106212 | 3300028381 | Bacteria | 2451 |
| 637 | Ga0268264_10230141 | 3300028381 | Bacteria | 1711 |
| 638 | Ga0265337_1003360 | 3300028556 | Bacteria | 6959 |
| 639 | Ga0265337_1028599 | 3300028556 | Bacteria | 1672 |
| 640 | Ga0265319_1000997 | 3300028563 | Bacteria | 17737 |
| 641 | Ga0265334_10035763 | 3300028573 | Bacteria | 1964 |
| 642 | Ga0265318_10000203 | 3300028577 | Bacteria | 51133 |
| 643 | Ga0265318_10001992 | 3300028577 | Bacteria | 11339 |
| 644 | Ga0265318_10007232 | 3300028577 | Bacteria | 5040 |
| 645 | Ga0265338_10001466 | 3300028800 | Bacteria | 38204 |
| 646 | Ga0265338_10019349 | 3300028800 | Bacteria | 7227 |
| 647 | Ga0265338_10020668 | 3300028800 | Bacteria | 6910 |
| 648 | Ga0265338_10068588 | 3300028800 | Bacteria | 3054 |
| 649 | Ga0265338_10133795 | 3300028800 | Bacteria | 1953 |
| 650 | Ga0265330_10000562 | 3300031235 | Bacteria | 24182 |
| 651 | Ga0265330_10012846 | 3300031235 | Bacteria | 3909 |
| 652 | Ga0265330_10017651 | 3300031235 | Bacteria | 3284 |
| 653 | Ga0265332_10000369 | 3300031238 | Bacteria | 33334 |
| 654 | Ga0265332_10000906 | 3300031238 | Bacteria | 17782 |
| 655 | Ga0265332_10056504 | 3300031238 | Bacteria | 1682 |
| 656 | Ga0265328_10009142 | 3300031239 | Bacteria | 4044 |
| 657 | Ga0265328_10009295 | 3300031239 | Bacteria | 4008 |
| 658 | Ga0265328_10039838 | 3300031239 | Bacteria | 1733 |
| 659 | Ga0265320_10000078 | 3300031240 | Bacteria | 84397 |
| 660 | Ga0265320_10001291 | 3300031240 | Bacteria | 18271 |
| 661 | Ga0265320_10004136 | 3300031240 | Bacteria | 9533 |
| 662 | Ga0265320_10043015 | 3300031240 | Bacteria | 2236 |
| 663 | Ga0265320_10096604 | 3300031240 | Bacteria | 1364 |
| 664 | Ga0265325_10001592 | 3300031241 | Bacteria | 15832 |
| 665 | Ga0265325_10029008 | 3300031241 | Bacteria | 2977 |
| 666 | Ga0265325_10042978 | 3300031241 | Bacteria | 2360 |
| 667 | Ga0265329_10001244 | 3300031242 | Bacteria | 12464 |
| 668 | Ga0265329_10013205 | 3300031242 | Bacteria | 2951 |
| 669 | Ga0265340_10000024 | 3300031247 | Bacteria | 77206 |
| 670 | Ga0265340_10000201 | 3300031247 | Bacteria | 29823 |
| 671 | Ga0265340_10000404 | 3300031247 | Bacteria | 23202 |
| 672 | Ga0265340_10003154 | 3300031247 | Bacteria | 9349 |
| 673 | Ga0265340_10022074 | 3300031247 | Bacteria | 3257 |
| 674 | Ga0265339_10006243 | 3300031249 | Bacteria | 7848 |
| 675 | Ga0265339_10009333 | 3300031249 | Bacteria | 6172 |
| 676 | Ga0265339_10017384 | 3300031249 | Bacteria | 4261 |
| 677 | Ga0265331_10000032 | 3300031250 | Bacteria | 210525 |
| 678 | Ga0265331_10001059 | 3300031250 | Bacteria | 21450 |
| 679 | Ga0265331_10007127 | 3300031250 | Bacteria | 6507 |
| 680 | Ga0265316_10003440 | 3300031344 | Bacteria | 16019 |
| 681 | Ga0265316_10005882 | 3300031344 | Bacteria | 11820 |
| 682 | Ga0265316_10010806 | 3300031344 | Bacteria | 8294 |
| 683 | Ga0265316_10065914 | 3300031344 | Bacteria | 2803 |
| 684 | Ga0307408_100053526 | 3300031548 | Bacteria | 2915 |
| 685 | Ga0307408_100277640 | 3300031548 | Bacteria | 1394 |
| 686 | Ga0307408_100600258 | 3300031548 | Bacteria | 978 |
| 687 | Ga0265313_10000095 | 3300031595 | Bacteria | 89645 |
| 688 | Ga0316579_10015648 | 3300031691 | Bacteria | 3299 |
| 689 | Ga0265314_10000193 | 3300031711 | Bacteria | 90595 |
| 690 | Ga0265314_10000215 | 3300031711 | Bacteria | 85711 |
| 691 | Ga0265314_10001016 | 3300031711 | Bacteria | 32760 |
| 692 | Ga0265314_10212383 | 3300031711 | Bacteria | 1135 |
| 693 | Ga0265342_10000560 | 3300031712 | Bacteria | 39323 |
| 694 | Ga0265342_10005756 | 3300031712 | Bacteria | 9372 |
| 695 | Ga0265342_10014312 | 3300031712 | Bacteria | 5270 |
| 696 | Ga0265342_10016073 | 3300031712 | Bacteria | 4901 |
| 697 | Ga0316576_10076071 | 3300031727 | Bacteria | 2484 |
| 698 | Ga0316576_10092697 | 3300031727 | Bacteria | 2251 |
| 699 | Ga0307410_10319575 | 3300031852 | Bacteria | 1231 |
| 700 | Ga0307406_10004608 | 3300031901 | Bacteria | 7507 |
| 701 | Ga0307409_100220664 | 3300031995 | Bacteria | 1711 |
| 702 | Ga0316585_10072982 | 3300032137 | Bacteria | 1115 |
| 703 | Ga0316593_10025576 | 3300032168 | Bacteria | 1880 |
| 704 | Ga0373948_0016233 | 3300034817 | Bacteria | 1374 |
| 705 | Ga0373926_0039385 | 3300035083 | Bacteria | 1685 |
| 706 | Ga0373926_0039852 | 3300035083 | Bacteria | 1676 |
| 707 | Ga0373951_0002225 | 3300035091 | Bacteria | 4931 |
| 708 | Ga0373923_0109180 | 3300035111 | Bacteria | 1227 |
| 709 | Ga0373923_0126867 | 3300035111 | Bacteria | 1144 |
| 710 | Ga0373954_0058279 | 3300035118 | Unclassified | 1820 |
| 711 | Ga0373956_0001166 | 3300035119 | Bacteria | 10862 |
| 712 | Ga0373960_0027861 | 3300035121 | Bacteria | 1555 |
| 713 | Ga0373955_0028715 | 3300035172 | Bacteria | 2887 |
| 714 | Ga0373961_0040972 | 3300035241 | Bacteria | 1337 |
| 715 | Ga0316574_0055185 | 3300035398 | Bacteria | 2483 |
| 716 | Ga0373931_0006841 | 3300035691 | Bacteria | 5362 |
| 717 | Ga0373927_0000015 | 3300035695 | Bacteria | 155974 |
| 718 | Ga0373927_0007647 | 3300035695 | Bacteria | 7312 |
| 719 | Ga0373933_0007886 | 3300035724 | Bacteria | 5813 |
| 720 | Ga0373933_0019859 | 3300035724 | Bacteria | 3803 |
| 721 | Ga0373937_0328601 | 3300036401 | Bacteria | 1447 |
| 722 | Ga0265778_007786 | 3300036457 | Bacteria | 1182 |
| 723 | Ga0316582_0188187 | 3300036647 | Bacteria | 1406 |
| 724 | Ga0316584_0051830 | 3300036712 | Bacteria | 3069 |
| 725 | Ga0373925_0147145 | 3300037068 | Bacteria | 1847 |
| 726 | Ga0395899_0005409 | 3300037312 | Bacteria | 9918 |
| 727 | Ga0395899_0023622 | 3300037312 | Bacteria | 4654 |
| 728 | Ga0395899_0055121 | 3300037312 | Bacteria | 2941 |
| 729 | Ga0395900_0000485 | 3300037418 | Bacteria | 56437 |
| 730 | Ga0395900_0118408 | 3300037418 | Bacteria | 2718 |
| 731 | Ga0395900_0264373 | 3300037418 | Bacteria | 1717 |
| 732 | Ga0395898_0002650 | 3300037466 | Bacteria | 20816 |
| 733 | Ga0395898_0008040 | 3300037466 | Bacteria | 11179 |
| 734 | Ga0395898_0192298 | 3300037466 | Bacteria | 1950 |
| 735 | Ga0395905_0013517 | 3300037471 | Bacteria | 7822 |
| 736 | Ga0316581_0057601 | 3300037588 | Bacteria | 1191 |
| 737 | Ga0436364_0112710 | 3300037853 | Bacteria | 2770 |
| 738 | Ga0436364_0678702 | 3300037853 | Bacteria | 2491 |
| 739 | Ga0395901_0000955 | 3300038443 | Bacteria | 31458 |
| 740 | Ga0395901_0018330 | 3300038443 | Bacteria | 7147 |
| 741 | Ga0395901_0159221 | 3300038443 | Bacteria | 2371 |
| 742 | Ga0400489_44064 | 3300039093 | Bacteria | 3659 |
| 743 | Ga0436365_0969405 | 3300039437 | Bacteria | 1086 |
| 744 | Ga0436365_1432522 | 3300039437 | Bacteria | 2712 |
| 745 | Ga0436360_0819436 | 3300039438 | Bacteria | 5830 |
| 746 | Ga0439448_0016202 | 3300042005 | Bacteria | 2266 |
| 747 | Ga0439450_003760 | 3300042008 | Bacteria | 2539 |
| 748 | Ga0439455_0002711 | 3300042012 | Bacteria | 3270 |
| 749 | Ga0439463_016687 | 3300042016 | Bacteria | 1816 |
| 750 | Ga0439459_0004556 | 3300042438 | Bacteria | 2233 |
| 751 | Ga0439464_0012428 | 3300042439 | Bacteria | 2268 |
| 752 | Ga0439460_0004581 | 3300042461 | Bacteria | 3375 |
| 753 | Ga0451577_0000031 | 3300042876 | Bacteria | 388524 |
| 754 | Ga0451577_0004316 | 3300042876 | Bacteria | 15093 |
| 755 | Ga0451577_0012269 | 3300042876 | Bacteria | 8052 |
| 756 | Ga0451577_0082367 | 3300042876 | Bacteria | 2870 |
| 757 | Ga0451577_0163874 | 3300042876 | Bacteria | 2003 |
| 758 | Ga0451577_0256086 | 3300042876 | Bacteria | 1584 |
| 759 | Ga0451577_0445149 | 3300042876 | Bacteria | 1176 |
| 760 | Ga0466969_0001971 | 3300044656 | Bacteria | 10979 |
| 761 | Ga0466969_0038556 | 3300044656 | Bacteria | 2404 |
| 762 | Ga0466972_0011726 | 3300044658 | Bacteria | 4401 |
| 763 | Ga0453683_0000698 | 3300044673 | Bacteria | 35139 |
| 764 | Ga0453683_0000919 | 3300044673 | Bacteria | 28095 |
| 765 | Ga0453683_0023217 | 3300044673 | Bacteria | 3953 |
| 766 | Ga0453683_0065415 | 3300044673 | Bacteria | 2273 |
| 767 | Ga0453683_0071885 | 3300044673 | Bacteria | 2165 |
| 768 | Ga0453683_0123339 | 3300044673 | Bacteria | 1631 |
| 769 | Ga0453683_0145810 | 3300044673 | Bacteria | 1495 |
| 770 | Ga0466965_0048556 | 3300044683 | Bacteria | 2103 |
| 771 | Ga0466966_0004193 | 3300044684 | Bacteria | 9519 |
| 772 | Ga0466966_0097539 | 3300044684 | Bacteria | 1820 |
| 773 | Ga0466961_0045312 | 3300044693 | Bacteria | 2814 |
| 774 | Ga0466963_0261127 | 3300044694 | Bacteria | 1216 |
| 775 | Ga0466964_0022134 | 3300044706 | Bacteria | 2463 |
| 776 | Ga0453684_0000407 | 3300044712 | Bacteria | 176667 |
| 777 | Ga0453684_0002829 | 3300044712 | Bacteria | 40909 |
| 778 | Ga0453684_0035519 | 3300044712 | Bacteria | 6886 |
| 779 | Ga0453684_0039087 | 3300044712 | Bacteria | 6471 |
| 780 | Ga0453684_0046622 | 3300044712 | Bacteria | 5761 |
| 781 | Ga0453684_0169173 | 3300044712 | Bacteria | 2577 |
| 782 | Ga0453684_0176257 | 3300044712 | Bacteria | 2514 |
| 783 | Ga0453684_0338524 | 3300044712 | Bacteria | 1699 |
| 784 | Ga0466971_0102965 | 3300044719 | Bacteria | 1313 |
| 785 | Ga0466968_0001893 | 3300044735 | Bacteria | 7569 |
| 786 | Ga0466970_0000302 | 3300044765 | Bacteria | 24047 |
| 787 | Ga0466957_0202687 | 3300044842 | Bacteria | 1304 |
| 788 | Ga0466957_0336508 | 3300044842 | Bacteria | 1021 |
| 789 | Ga0466959_0055727 | 3300045049 | Bacteria | 2885 |
| 790 | Ga0451576_0001923 | 3300045051 | Bacteria | 33277 |
| 791 | Ga0451576_0007050 | 3300045051 | Bacteria | 13578 |
| 792 | Ga0451576_0008207 | 3300045051 | Bacteria | 12292 |
| 793 | Ga0451576_0008636 | 3300045051 | Bacteria | 11932 |
| 794 | Ga0451576_0017308 | 3300045051 | Bacteria | 7931 |
| 795 | Ga0451576_0045135 | 3300045051 | Bacteria | 4642 |
| 796 | Ga0451576_0089180 | 3300045051 | Bacteria | 3207 |
| 797 | Ga0451576_0091543 | 3300045051 | Bacteria | 3163 |
| 798 | Ga0451576_0097005 | 3300045051 | Bacteria | 3066 |
| 799 | Ga0451576_0237280 | 3300045051 | Bacteria | 1904 |
| 800 | Ga0451576_0295907 | 3300045051 | Bacteria | 1692 |
| 801 | Ga0466958_0036170 | 3300045836 | Unclassified | 2954 |
| 802 | Ga0466967_0694024 | 3300045976 | Unclassified | 1008 |
| 803 | Ga0495629_0000001 | 3300046459 | Bacteria | 807972 |
| 804 | Ga0495580_0090518 | 3300046472 | Bacteria | 2130 |
| 805 | Ga0495580_0118836 | 3300046472 | Bacteria | 1835 |
| 806 | Ga0495582_0014419 | 3300046473 | Bacteria | 4345 |
| 807 | Ga0495594_0146436 | 3300046499 | Bacteria | 1340 |
| 808 | Ga0495630_0262327 | 3300046517 | Unclassified | 1320 |
| 809 | Ga0495642_0006635 | 3300046528 | Bacteria | 4444 |
| 810 | Ga0495598_0010079 | 3300046537 | Bacteria | 2254 |
| 811 | Ga0495635_0001175 | 3300046663 | Bacteria | 17454 |
| 812 | Ga0495657_0010941 | 3300046675 | Bacteria | 6805 |
| 813 | Ga0495647_0073280 | 3300046681 | Bacteria | 1375 |
| 814 | Ga0495658_0001366 | 3300046683 | Bacteria | 12794 |
| 815 | Ga0495658_0034885 | 3300046683 | Bacteria | 2763 |
| 816 | Ga0495624_0128518 | 3300046690 | Bacteria | 1554 |
| 817 | Ga0495600_0002828 | 3300046809 | Bacteria | 10095 |
| 818 | Ga0495636_0000656 | 3300047318 | Bacteria | 12699 |
| 819 | Ga0495680_0001540 | 3300047322 | Bacteria | 24673 |
| 820 | Ga0495680_0023425 | 3300047322 | Bacteria | 5134 |
| 821 | Ga0495684_0001985 | 3300047471 | Bacteria | 16444 |
| 822 | Ga0495686_0130533 | 3300047472 | Bacteria | 1490 |
| 823 | Ga0496100_0303282 | 3300048903 | Bacteria | 1196 |
| 824 | Ga0496101_0060973 | 3300048904 | Bacteria | 2738 |
| 825 | Ga0496102_0054937 | 3300048905 | Bacteria | 3632 |
| 826 | Ga0496102_0086165 | 3300048905 | Bacteria | 2901 |
| 827 | Ga0496102_0309762 | 3300048905 | Bacteria | 1488 |
| 828 | Ga0496104_0043024 | 3300048907 | Bacteria | 4241 |
| 829 | Ga0496105_0021784 | 3300048908 | Bacteria | 5188 |
| 830 | Ga0496106_0029042 | 3300048909 | Bacteria | 4121 |
| 831 | Ga0496106_0068256 | 3300048909 | Bacteria | 2712 |
| 832 | Ga0496106_0109236 | 3300048909 | Bacteria | 2152 |
| 833 | Ga0496108_0040572 | 3300048911 | Bacteria | 3881 |
| 834 | Ga0496109_0018420 | 3300048912 | Bacteria | 6134 |
| 835 | Ga0496110_0015477 | 3300048913 | Bacteria | 6350 |
| 836 | Ga0496110_0100673 | 3300048913 | Bacteria | 2590 |
| 837 | Ga0496111_0346852 | 3300048914 | Bacteria | 1099 |
| 838 | Ga0496112_0172554 | 3300048915 | Bacteria | 2128 |
| 839 | Ga0496124_0000003 | 3300048927 | Bacteria | 1300161 |
| 840 | Ga0496125_0138852 | 3300048928 | Bacteria | 1694 |
| 841 | Ga0496126_0023537 | 3300048929 | Bacteria | 5968 |
| 842 | Ga0496126_0074959 | 3300048929 | Bacteria | 3004 |
| 843 | Ga0501031_0003874 | 3300049568 | Bacteria | 9626 |
| 844 | Ga0501031_0012400 | 3300049568 | Bacteria | 5558 |
| 845 | Ga0501031_0255289 | 3300049568 | Bacteria | 1139 |
| 846 | Ga0501032_0017313 | 3300049569 | Bacteria | 5060 |
| 847 | Ga0501032_0036714 | 3300049569 | Bacteria | 3344 |
| 848 | Ga0501032_0066652 | 3300049569 | Bacteria | 2406 |
| 849 | Ga0501033_0252585 | 3300049570 | Bacteria | 1249 |
| 850 | Ga0501034_0022542 | 3300049571 | Bacteria | 6417 |
| 851 | Ga0501034_0026670 | 3300049571 | Bacteria | 5880 |
| 852 | Ga0501034_0047938 | 3300049571 | Bacteria | 4312 |
| 853 | Ga0501036_0033213 | 3300049572 | Bacteria | 4364 |
| 854 | Ga0501036_0154101 | 3300049572 | Bacteria | 1938 |
| 855 | Ga0501036_0177934 | 3300049572 | Bacteria | 1791 |
| 856 | Ga0501036_0354622 | 3300049572 | Bacteria | 1225 |
| 857 | Ga0501037_0001886 | 3300049573 | Bacteria | 15239 |
| 858 | Ga0501037_0023599 | 3300049573 | Bacteria | 4548 |
| 859 | Ga0501037_0104992 | 3300049573 | Bacteria | 2036 |
| 860 | Ga0501037_0230592 | 3300049573 | Bacteria | 1300 |
| 861 | Ga0501038_0009050 | 3300049574 | Bacteria | 9139 |
| 862 | Ga0501038_0110077 | 3300049574 | Bacteria | 2282 |
| 863 | Ga0501038_0364813 | 3300049574 | Bacteria | 1123 |
| 864 | Ga0501038_0451710 | 3300049574 | Bacteria | 988 |
| 865 | Ga0501039_0003633 | 3300049575 | Bacteria | 11559 |
| 866 | Ga0501039_0007824 | 3300049575 | Bacteria | 8148 |
| 867 | Ga0501039_0019159 | 3300049575 | Bacteria | 5251 |
| 868 | Ga0501039_0052477 | 3300049575 | Bacteria | 3155 |
| 869 | Ga0501039_0124248 | 3300049575 | Bacteria | 2023 |
| 870 | Ga0501039_0189157 | 3300049575 | Bacteria | 1619 |
| 871 | Ga0501040_0000512 | 3300049576 | Bacteria | 23238 |
| 872 | Ga0501040_0015463 | 3300049576 | Bacteria | 5043 |
| 873 | Ga0501040_0020172 | 3300049576 | Bacteria | 4440 |
| 874 | Ga0501040_0026769 | 3300049576 | Bacteria | 3879 |
| 875 | Ga0501040_0062128 | 3300049576 | Bacteria | 2570 |
| 876 | Ga0501040_0064296 | 3300049576 | Bacteria | 2526 |
| 877 | Ga0501040_0114562 | 3300049576 | Bacteria | 1887 |
| 878 | Ga0501041_0002285 | 3300049577 | Bacteria | 10844 |
| 879 | Ga0501041_0008815 | 3300049577 | Bacteria | 5938 |
| 880 | Ga0501041_0069491 | 3300049577 | Bacteria | 2160 |
| 881 | Ga0501041_0168413 | 3300049577 | Bacteria | 1370 |
| 882 | Ga0501042_0000917 | 3300049578 | Bacteria | 16532 |
| 883 | Ga0501042_0024803 | 3300049578 | Bacteria | 4209 |
| 884 | Ga0501042_0065797 | 3300049578 | Bacteria | 2590 |
| 885 | Ga0501042_0074824 | 3300049578 | Bacteria | 2423 |
| 886 | Ga0501042_0184169 | 3300049578 | Bacteria | 1506 |
| 887 | Ga0501042_0291329 | 3300049578 | Bacteria | 1179 |
| 888 | Ga0501043_0145053 | 3300049579 | Bacteria | 1859 |
| 889 | Ga0501046_0001204 | 3300049580 | Bacteria | 25159 |
| 890 | Ga0501046_0002954 | 3300049580 | Bacteria | 15734 |
| 891 | Ga0501046_0004181 | 3300049580 | Bacteria | 13141 |
| 892 | Ga0501046_0006900 | 3300049580 | Bacteria | 10009 |
| 893 | Ga0501047_0014228 | 3300049581 | Bacteria | 7563 |
| 894 | Ga0501047_0197931 | 3300049581 | Bacteria | 1871 |
| 895 | Ga0501048_0024348 | 3300049582 | Bacteria | 4420 |
| 896 | Ga0501048_0037677 | 3300049582 | Bacteria | 3472 |
| 897 | Ga0501048_0053158 | 3300049582 | Bacteria | 2882 |
| 898 | Ga0501048_0122292 | 3300049582 | Bacteria | 1839 |
| 899 | Ga0501048_0266575 | 3300049582 | Bacteria | 1217 |
| 900 | Ga0501067_0004610 | 3300049583 | Bacteria | 7631 |
| 901 | Ga0501068_0060068 | 3300049584 | Bacteria | 2308 |
| 902 | Ga0501068_0089604 | 3300049584 | Bacteria | 1897 |
| 903 | Ga0501069_0019093 | 3300049585 | Bacteria | 3704 |
| 904 | Ga0501069_0259008 | 3300049585 | Bacteria | 1015 |
| 905 | Ga0501070_0038080 | 3300049586 | Bacteria | 4013 |
| 906 | Ga0501071_0032223 | 3300049587 | Bacteria | 3721 |
| 907 | Ga0501071_0042663 | 3300049587 | Bacteria | 3251 |
| 908 | Ga0501072_0030558 | 3300049588 | Bacteria | 4214 |
| 909 | Ga0501072_0080672 | 3300049588 | Bacteria | 2578 |
| 910 | Ga0501072_0220338 | 3300049588 | Bacteria | 1512 |
| 911 | Ga0501074_0025679 | 3300049590 | Bacteria | 4275 |
| 912 | Ga0501074_0064534 | 3300049590 | Bacteria | 2636 |
| 913 | Ga0501074_0150668 | 3300049590 | Bacteria | 1663 |
| 914 | Ga0501075_0007603 | 3300049591 | Bacteria | 7519 |
| 915 | Ga0501075_0011886 | 3300049591 | Bacteria | 6176 |
| 916 | Ga0501075_0074850 | 3300049591 | Bacteria | 2561 |
| 917 | Ga0501075_0092305 | 3300049591 | Bacteria | 2298 |
| 918 | Ga0501075_0265261 | 3300049591 | Bacteria | 1309 |
| 919 | Ga0501075_0415374 | 3300049591 | Bacteria | 1026 |
| 920 | Ga0501076_0022670 | 3300049592 | Bacteria | 4827 |
| 921 | Ga0501076_0029092 | 3300049592 | Bacteria | 4295 |
| 922 | Ga0501076_0063490 | 3300049592 | Bacteria | 2942 |
| 923 | Ga0501076_0146420 | 3300049592 | Bacteria | 1920 |
| 924 | Ga0501076_0210392 | 3300049592 | Bacteria | 1589 |
| 925 | Ga0501076_0399759 | 3300049592 | Bacteria | 1130 |
| 926 | Ga0501077_0014715 | 3300049593 | Bacteria | 4915 |
| 927 | Ga0501077_0039691 | 3300049593 | Bacteria | 2999 |
| 928 | Ga0501077_0126292 | 3300049593 | Bacteria | 1621 |
| 929 | Ga0501079_0001699 | 3300049741 | Bacteria | 15679 |
| 930 | Ga0501079_0021213 | 3300049741 | Bacteria | 4967 |
| 931 | Ga0501079_0031997 | 3300049741 | Bacteria | 4042 |
| 932 | Ga0501079_0043256 | 3300049741 | Bacteria | 3476 |
| 933 | Ga0501079_0224433 | 3300049741 | Bacteria | 1468 |
| 934 | Ga0501080_0003623 | 3300049742 | Bacteria | 13614 |
| 935 | Ga0501080_0115345 | 3300049742 | Bacteria | 2490 |
| 936 | Ga0501080_0199832 | 3300049742 | Bacteria | 1836 |
| 937 | Ga0501081_0002723 | 3300049743 | Bacteria | 11188 |
| 938 | Ga0501081_0004362 | 3300049743 | Bacteria | 9073 |
| 939 | Ga0501081_0026058 | 3300049743 | Bacteria | 3939 |
| 940 | Ga0501081_0368573 | 3300049743 | Bacteria | 1060 |
| 941 | Ga0501035_0001442 | 3300049822 | Bacteria | 24365 |
| 942 | Ga0501035_0052717 | 3300049822 | Bacteria | 3639 |
| 943 | Ga0501035_0199832 | 3300049822 | Bacteria | 1715 |
| 944 | Ga0501035_0279988 | 3300049822 | Bacteria | 1410 |
| 945 | Ga0501044_0001768 | 3300049823 | Bacteria | 25268 |
| 946 | Ga0501044_0091876 | 3300049823 | Bacteria | 3061 |
| 947 | Ga0501045_0003582 | 3300049824 | Bacteria | 10665 |
| 948 | Ga0501045_0024815 | 3300049824 | Bacteria | 4306 |
| 949 | nmdc:mga05p37_1202_c1 | 3300050507 | Bacteria | 29954 |
| 950 | nmdc:mga05p37_13930_c1 | 3300050507 | Bacteria | 9639 |
| 951 | nmdc:mga05p37_14517_c1 | 3300050507 | Bacteria | 9459 |
| 952 | nmdc:mga05p37_200834_c1 | 3300050507 | Bacteria | 2415 |
| 953 | nmdc:mga05p37_20359_c1 | 3300050507 | Bacteria | 8027 |
| 954 | nmdc:mga05p37_23285_c1 | 3300050507 | Bacteria | 7513 |
| 955 | nmdc:mga05p37_28610_c1 | 3300050507 | Bacteria | 6798 |
| 956 | nmdc:mga05p37_290369_c1 | 3300050507 | Bacteria | 1947 |
| 957 | nmdc:mga05p37_3014_c1 | 3300050507 | Bacteria | 19548 |
| 958 | nmdc:mga05p37_389043_c1 | 3300050507 | Bacteria | 1631 |
| 959 | nmdc:mga05p37_414194_c1 | 3300050507 | Unclassified | 1570 |
| 960 | nmdc:mga05p37_492_c1 | 3300050507 | Bacteria | 43329 |
| 961 | nmdc:mga05p37_58168_c1 | 3300050507 | Bacteria | 4761 |
| 962 | nmdc:mga05p37_60523_c1 | 3300050507 | Bacteria | 4662 |
| 963 | nmdc:mga05p37_66414_c1 | 3300050507 | Bacteria | 4437 |
| 964 | nmdc:mga09592_109115_c1 | 3300050508 | Bacteria | 2374 |
| 965 | nmdc:mga09592_199419_c1 | 3300050508 | Bacteria | 1733 |
| 966 | nmdc:mga09592_216432_c1 | 3300050508 | Bacteria | 1660 |
| 967 | nmdc:mga09592_2702_c1 | 3300050508 | Bacteria | 14341 |
| 968 | nmdc:mga09592_292380_c1 | 3300050508 | Bacteria | 1412 |
| 969 | nmdc:mga09592_42678_c1 | 3300050508 | Bacteria | 3814 |
| 970 | nmdc:mga09592_44143_c1 | 3300050508 | Bacteria | 3751 |
| 971 | nmdc:mga09592_464949_c1 | 3300050508 | Bacteria | 1091 |
| 972 | nmdc:mga0qj67_107619_c1 | 3300050509 | Bacteria | 2249 |
| 973 | nmdc:mga0qj67_142933_c1 | 3300050509 | Bacteria | 1940 |
| 974 | nmdc:mga0qj67_1701_c1 | 3300050509 | Bacteria | 15513 |
| 975 | nmdc:mga0qj67_2178_c1 | 3300050509 | Bacteria | 13930 |
| 976 | nmdc:mga0qj67_25258_c1 | 3300050509 | Bacteria | 4589 |
| 977 | nmdc:mga0qj67_282481_c1 | 3300050509 | Bacteria | 1345 |
| 978 | nmdc:mga0qj67_4550_c1 | 3300050509 | Bacteria | 10050 |
| 979 | nmdc:mga0qj67_95788_c1 | 3300050509 | Bacteria | 2389 |
| 980 | nmdc:mga06r32_10844_c1 | 3300050510 | Bacteria | 8207 |
| 981 | nmdc:mga06r32_115477_c1 | 3300050510 | Bacteria | 2644 |
| 982 | nmdc:mga06r32_2087_c1 | 3300050510 | Bacteria | 17889 |
| 983 | nmdc:mga06r32_235873_c1 | 3300050510 | Bacteria | 1817 |
| 984 | nmdc:mga06r32_41561_c1 | 3300050510 | Bacteria | 4369 |
| 985 | nmdc:mga06r32_54648_c1 | 3300050510 | Bacteria | 3829 |
| 986 | nmdc:mga06r32_73743_c1 | 3300050510 | Bacteria | 3307 |
| 987 | nmdc:mga06r32_793_c1 | 3300050510 | Bacteria | 28013 |
| 988 | nmdc:mga06r32_84623_c1 | 3300050510 | Bacteria | 3092 |
| 989 | nmdc:mga06r32_92773_c1 | 3300050510 | Bacteria | 2952 |
| 990 | nmdc:mga06r32_95971_c1 | 3300050510 | Bacteria | 2903 |
| 991 | nmdc:mga06r32_97782_c1 | 3300050510 | Bacteria | 2877 |
| 992 | nmdc:mga08y16_11348_c1 | 3300050511 | Bacteria | 9361 |
| 993 | nmdc:mga08y16_21684_c1 | 3300050511 | Bacteria | 6781 |
| 994 | nmdc:mga08y16_52600_c1 | 3300050511 | Bacteria | 4260 |
| 995 | nmdc:mga08y16_64703_c1 | 3300050511 | Bacteria | 3818 |
| 996 | nmdc:mga08y16_6773_c1 | 3300050511 | Bacteria | 12021 |
| 997 | nmdc:mga08y16_68134_c1 | 3300050511 | Bacteria | 3711 |
| 998 | nmdc:mga08y16_72607_c1 | 3300050511 | Bacteria | 3586 |
| 999 | nmdc:mga08y16_934_c1 | 3300050511 | Bacteria | 28360 |
| 1000 | nmdc:mga0n895_3829_c1 | 3300050512 | Bacteria | 12203 |
| 1001 | nmdc:mga0n895_382_c1 | 3300050512 | Bacteria | 29949 |
| 1002 | nmdc:mga0n895_40877_c1 | 3300050512 | Bacteria | 4506 |
| 1003 | nmdc:mga0n895_52828_c1 | 3300050512 | Bacteria | 3990 |
| 1004 | nmdc:mga0n895_546338_c1 | 3300050512 | Bacteria | 1164 |
| 1005 | nmdc:mga0n895_57103_c1 | 3300050512 | Bacteria | 3847 |
| 1006 | nmdc:mga0n895_70708_c1 | 3300050512 | Bacteria | 3459 |
| 1007 | nmdc:mga0n895_83587_c1 | 3300050512 | Bacteria | 3185 |
| 1008 | nmdc:mga0n895_83910_c1 | 3300050512 | Bacteria | 3178 |
| 1009 | nmdc:mga0n895_85574_c1 | 3300050512 | Bacteria | 3148 |
| 1010 | nmdc:mga0n895_9015_c1 | 3300050512 | Bacteria | 8701 |
| 1011 | nmdc:mga0rr50_187454_c1 | 3300050513 | Bacteria | 1694 |
| 1012 | nmdc:mga0rr50_2512_c1 | 3300050513 | Bacteria | 10379 |
| 1013 | nmdc:mga0rr50_292_c1 | 3300050513 | Bacteria | 27211 |
| 1014 | nmdc:mga0rr50_434016_c1 | 3300050513 | Bacteria | 1112 |
| 1015 | nmdc:mga0rr50_590_c1 | 3300050513 | Bacteria | 19433 |
| 1016 | nmdc:mga08x19_193898_c1 | 3300050514 | Bacteria | 1391 |
| 1017 | nmdc:mga08x19_21650_c1 | 3300050514 | Bacteria | 3972 |
| 1018 | nmdc:mga08x19_2471_c1 | 3300050514 | Bacteria | 11248 |
| 1019 | nmdc:mga08x19_2518_c1 | 3300050514 | Bacteria | 11129 |
| 1020 | nmdc:mga08x19_270840_c1 | 3300050514 | Bacteria | 1175 |
| 1021 | nmdc:mga08x19_45357_c1 | 3300050514 | Bacteria | 2809 |
| 1022 | nmdc:mga08x19_46783_c1 | 3300050514 | Bacteria | 2768 |
| 1023 | nmdc:mga08x19_67624_c1 | 3300050514 | Bacteria | 2324 |
| 1024 | nmdc:mga0a205_10167_c1 | 3300050515 | Bacteria | 8640 |
| 1025 | nmdc:mga0a205_1241_c2 | 3300050515 | Bacteria | 9622 |
| 1026 | nmdc:mga0a205_14524_c1 | 3300050515 | Bacteria | 7347 |
| 1027 | nmdc:mga0a205_145326_c1 | 3300050515 | Bacteria | 2271 |
| 1028 | nmdc:mga0a205_21_c1 | 3300050515 | Bacteria | 20815 |
| 1029 | nmdc:mga0a205_2800_c1 | 3300050515 | Bacteria | 15427 |
| 1030 | nmdc:mga0a205_389381_c1 | 3300050515 | Bacteria | 1258 |
| 1031 | nmdc:mga0a205_41076_c1 | 3300050515 | Bacteria | 4454 |
| 1032 | nmdc:mga0a205_45207_c1 | 3300050515 | Bacteria | 4246 |
| 1033 | nmdc:mga0a205_53320_c1 | 3300050515 | Bacteria | 3903 |
| 1034 | nmdc:mga0a205_6584_c1 | 3300050515 | Bacteria | 10507 |
| 1035 | nmdc:mga0a205_88257_c1 | 3300050515 | Bacteria | 2997 |
| 1036 | Ga0500642_0007212 | 3300053130 | Bacteria | 3720 |
| 1037 | Ga0500637_0097293 | 3300053178 | Bacteria | 1706 |
| 1038 | Ga0501084_0006437 | 3300054114 | Bacteria | 9651 |
| 1039 | Ga0501084_0006546 | 3300054114 | Bacteria | 9576 |
| 1040 | Ga0501084_0140153 | 3300054114 | Bacteria | 2036 |
| 1041 | Ga0501084_0198229 | 3300054114 | Bacteria | 1694 |
| 1042 | Ga0501084_0199590 | 3300054114 | Bacteria | 1688 |
| 1043 | Ga0501082_0001216 | 3300060353 | Bacteria | 22625 |
| 1044 | Ga0501082_0005907 | 3300060353 | Bacteria | 10616 |
| 1045 | Ga0501082_0009246 | 3300060353 | Bacteria | 8494 |
| 1046 | Ga0501082_0135336 | 3300060353 | Bacteria | 2138 |
| 1047 | Ga0501082_0187891 | 3300060353 | Bacteria | 1798 |
| 1048 | Ga0501082_0285481 | 3300060353 | Bacteria | 1437 |
| 1049 | Ga0530510_0012872 | 3300061734 | Bacteria | 5882 |
| 1050 | Ga0530510_0016896 | 3300061734 | Bacteria | 5168 |
| 1051 | Ga0530510_0026956 | 3300061734 | Bacteria | 4116 |
| 1052 | Ga0530510_0103630 | 3300061734 | Bacteria | 2081 |
| 1053 | Ga0530510_0172160 | 3300061734 | Bacteria | 1604 |
| 1054 | Ga0530510_0181888 | 3300061734 | Bacteria | 1559 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031247 | Ga0265340_10000024 | Ga0265340_1000002426 | 268 |
| 2 | 3300031247 | Ga0265340_10022074 | Ga0265340_100220743 | 268 |
| 3 | 3300031344 | Ga0265316_10005882 | Ga0265316_100058827 | 268 |
| 4 | 3300031344 | Ga0265316_10065914 | Ga0265316_100659142 | 268 |
| 5 | 3300031712 | Ga0265342_10016073 | Ga0265342_100160734 | 268 |
| 6 | 3300050511 | nmdc:mga08y16_21684_c1 | nmdc:mga08y16_21684_c1_4105_4935 | 275 |
| 7 | 3300009551 | Ga0105238_10021605 | Ga0105238_100216056 | 281 |
| 8 | 3300013307 | Ga0157372_10376096 | Ga0157372_103760962 | 281 |
| 9 | 3300031711 | Ga0265314_10212383 | Ga0265314_102123831 | 281 |
| 10 | 3300035121 | Ga0373960_0027861 | Ga0373960_0027861_430_1278 | 281 |
| 11 | 3300035691 | Ga0373931_0006841 | Ga0373931_0006841_4070_4918 | 281 |
| 12 | 3300044842 | Ga0466957_0202687 | Ga0466957_0202687_44_892 | 281 |
| 13 | 3300044842 | Ga0466957_0336508 | Ga0466957_0336508_130_978 | 281 |
| 14 | 3300045976 | Ga0466967_0694024 | Ga0466967_0694024_131_979 | 281 |
| 15 | 3300049591 | Ga0501075_0415374 | Ga0501075_0415374_150_998 | 281 |
| 16 | 3300050511 | nmdc:mga08y16_72607_c1 | nmdc:mga08y16_72607_c1_1610_2458 | 281 |
| 17 | 3300046499 | Ga0495594_0146436 | Ga0495594_0146436_460_1308 | 282 |
| 18 | 3300050513 | nmdc:mga0rr50_434016_c1 | nmdc:mga0rr50_434016_c1_191_1039 | 282 |
| 19 | 3300031235 | Ga0265330_10017651 | Ga0265330_100176512 | 284 |
| 20 | 3300050507 | nmdc:mga05p37_1202_c1 | nmdc:mga05p37_1202_c1_13470_14372 | 284 |
| 21 | 3300050508 | nmdc:mga09592_2702_c1 | nmdc:mga09592_2702_c1_8702_9604 | 284 |
| 22 | 3300050509 | nmdc:mga0qj67_95788_c1 | nmdc:mga0qj67_95788_c1_1216_2118 | 284 |
| 23 | 3300050510 | nmdc:mga06r32_84623_c1 | nmdc:mga06r32_84623_c1_773_1675 | 284 |
| 24 | 3300036712 | Ga0316584_0051830 | Ga0316584_0051830_125_991 | 285 |
| 25 | 3300009147 | Ga0114129_10000002 | Ga0114129_1000000227 | 287 |
| 26 | 3300014326 | Ga0157380_10121406 | Ga0157380_101214062 | 287 |
| 27 | 3300049574 | Ga0501038_0451710 | Ga0501038_0451710_45_926 | 288 |
| 28 | 3300005347 | Ga0070668_100082232 | Ga0070668_1000822322 | 289 |
| 29 | 3300005543 | Ga0070672_100282416 | Ga0070672_1002824162 | 289 |
| 30 | 3300013308 | Ga0157375_10727048 | Ga0157375_107270481 | 289 |
| 31 | 3300025893 | Ga0207682_10091285 | Ga0207682_100912851 | 289 |
| 32 | 3300025940 | Ga0207691_10057184 | Ga0207691_100571842 | 289 |
| 33 | 3300025972 | Ga0207668_10044533 | Ga0207668_100445333 | 289 |
| 34 | 3300026035 | Ga0207703_10219611 | Ga0207703_102196111 | 289 |
| 35 | 3300026088 | Ga0207641_10105985 | Ga0207641_101059853 | 289 |
| 36 | 3300054114 | Ga0501084_0199590 | Ga0501084_0199590_599_1486 | 289 |
| 37 | 3300005331 | Ga0070670_100166903 | Ga0070670_1001669033 | 290 |
| 38 | 3300005539 | Ga0068853_100000307 | Ga0068853_1000003076 | 291 |
| 39 | 3300006844 | Ga0075428_100001585 | Ga0075428_1000015854 | 291 |
| 40 | 3300006846 | Ga0075430_100100628 | Ga0075430_1001006281 | 291 |
| 41 | 3300006847 | Ga0075431_100211911 | Ga0075431_1002119112 | 291 |
| 42 | 3300006880 | Ga0075429_100002270 | Ga0075429_1000022705 | 291 |
| 43 | 3300026041 | Ga0207639_10000569 | Ga0207639_100005695 | 291 |
| 44 | 3300005719 | Ga0068861_100053699 | Ga0068861_1000536992 | 292 |
| 45 | 3300025923 | Ga0207681_10303079 | Ga0207681_103030792 | 292 |
| 46 | 3300028800 | Ga0265338_10001466 | Ga0265338_100014662 | 293 |
| 47 | 3300031249 | Ga0265339_10009333 | Ga0265339_100093332 | 293 |
| 48 | 3300045051 | Ga0451576_0007050 | Ga0451576_0007050_12342_13328 | 293 |
| 49 | 3300046472 | Ga0495580_0118836 | Ga0495580_0118836_195_1118 | 293 |
| 50 | 3300006847 | Ga0075431_100047604 | Ga0075431_1000476044 | 294 |
| 51 | 3300006880 | Ga0075429_100052473 | Ga0075429_1000524734 | 294 |
| 52 | 3300009147 | Ga0114129_10025764 | Ga0114129_100257647 | 294 |
| 53 | 3300050507 | nmdc:mga05p37_14517_c1 | nmdc:mga05p37_14517_c1_5477_6397 | 294 |
| 54 | 3300050508 | nmdc:mga09592_109115_c1 | nmdc:mga09592_109115_c1_564_1484 | 294 |
| 55 | 3300050509 | nmdc:mga0qj67_107619_c1 | nmdc:mga0qj67_107619_c1_571_1491 | 294 |
| 56 | 3300050510 | nmdc:mga06r32_97782_c1 | nmdc:mga06r32_97782_c1_888_1808 | 294 |
| 57 | 3300037466 | Ga0395898_0192298 | Ga0395898_0192298_675_1706 | 295 |
| 58 | 3300036647 | Ga0316582_0188187 | Ga0316582_0188187_22_945 | 296 |
| 59 | 3300042876 | Ga0451577_0256086 | Ga0451577_0256086_135_1064 | 297 |
| 60 | 3300044712 | Ga0453684_0000407 | Ga0453684_0000407_163444_164373 | 297 |
| 61 | 3300004799 | Ga0058863_11416325 | Ga0058863_114163251 | 298 |
| 62 | 3300004800 | Ga0058861_11397491 | Ga0058861_113974912 | 298 |
| 63 | 3300005330 | Ga0070690_100184434 | Ga0070690_1001844341 | 298 |
| 64 | 3300005341 | Ga0070691_10000879 | Ga0070691_100008797 | 298 |
| 65 | 3300005354 | Ga0070675_100394146 | Ga0070675_1003941462 | 298 |
| 66 | 3300005544 | Ga0070686_100007508 | Ga0070686_1000075082 | 298 |
| 67 | 3300005577 | Ga0068857_100002928 | Ga0068857_1000029288 | 298 |
| 68 | 3300013102 | Ga0157371_10097325 | Ga0157371_100973252 | 298 |
| 69 | 3300013308 | Ga0157375_10012076 | Ga0157375_100120767 | 298 |
| 70 | 3300020069 | Ga0197907_10142512 | Ga0197907_101425121 | 298 |
| 71 | 3300020070 | Ga0206356_10244490 | Ga0206356_102444901 | 298 |
| 72 | 3300020075 | Ga0206349_1067078 | Ga0206349_10670781 | 298 |
| 73 | 3300020076 | Ga0206355_1357135 | Ga0206355_13571352 | 298 |
| 74 | 3300020077 | Ga0206351_10068540 | Ga0206351_100685401 | 298 |
| 75 | 3300020078 | Ga0206352_10111162 | Ga0206352_101111621 | 298 |
| 76 | 3300020080 | Ga0206350_11116656 | Ga0206350_111166561 | 298 |
| 77 | 3300020081 | Ga0206354_10099186 | Ga0206354_100991861 | 298 |
| 78 | 3300020610 | Ga0154015_1547869 | Ga0154015_15478692 | 298 |
| 79 | 3300022467 | Ga0224712_10031567 | Ga0224712_100315672 | 298 |
| 80 | 3300026116 | Ga0207674_10004332 | Ga0207674_100043327 | 298 |
| 81 | 3300031240 | Ga0265320_10004136 | Ga0265320_100041363 | 298 |
| 82 | 3300031241 | Ga0265325_10042978 | Ga0265325_100429782 | 298 |
| 83 | 3300005328 | Ga0070676_10014988 | Ga0070676_100149884 | 299 |
| 84 | 3300005331 | Ga0070670_100038399 | Ga0070670_1000383994 | 299 |
| 85 | 3300005335 | Ga0070666_10009701 | Ga0070666_100097013 | 299 |
| 86 | 3300005338 | Ga0068868_100039181 | Ga0068868_1000391813 | 299 |
| 87 | 3300005344 | Ga0070661_100016783 | Ga0070661_1000167835 | 299 |
| 88 | 3300005355 | Ga0070671_100042819 | Ga0070671_1000428193 | 299 |
| 89 | 3300005356 | Ga0070674_100020471 | Ga0070674_1000204714 | 299 |
| 90 | 3300005364 | Ga0070673_100005770 | Ga0070673_1000057704 | 299 |
| 91 | 3300005366 | Ga0070659_100154236 | Ga0070659_1001542362 | 299 |
| 92 | 3300005436 | Ga0070713_100185657 | Ga0070713_1001856572 | 299 |
| 93 | 3300005456 | Ga0070678_100005733 | Ga0070678_1000057334 | 299 |
| 94 | 3300005543 | Ga0070672_100010471 | Ga0070672_1000104715 | 299 |
| 95 | 3300005548 | Ga0070665_100229860 | Ga0070665_1002298602 | 299 |
| 96 | 3300005564 | Ga0070664_100089188 | Ga0070664_1000891882 | 299 |
| 97 | 3300006237 | Ga0097621_100027191 | Ga0097621_1000271912 | 299 |
| 98 | 3300006358 | Ga0068871_100011708 | Ga0068871_1000117084 | 299 |
| 99 | 3300006880 | Ga0075429_100064653 | Ga0075429_1000646532 | 299 |
| 100 | 3300009094 | Ga0111539_10000327 | Ga0111539_1000032735 | 299 |
| 101 | 3300013102 | Ga0157371_10038288 | Ga0157371_100382882 | 299 |
| 102 | 3300013296 | Ga0157374_10026298 | Ga0157374_100262984 | 299 |
| 103 | 3300013297 | Ga0157378_10002950 | Ga0157378_100029502 | 299 |
| 104 | 3300013306 | Ga0163162_10028622 | Ga0163162_100286224 | 299 |
| 105 | 3300013308 | Ga0157375_10012494 | Ga0157375_100124947 | 299 |
| 106 | 3300014745 | Ga0157377_10145163 | Ga0157377_101451632 | 299 |
| 107 | 3300014968 | Ga0157379_10186308 | Ga0157379_101863081 | 299 |
| 108 | 3300014969 | Ga0157376_10002892 | Ga0157376_1000289212 | 299 |
| 109 | 3300020081 | Ga0206354_10475810 | Ga0206354_104758102 | 299 |
| 110 | 3300025315 | Ga0207697_10037972 | Ga0207697_100379722 | 299 |
| 111 | 3300025903 | Ga0207680_10006676 | Ga0207680_100066766 | 299 |
| 112 | 3300025920 | Ga0207649_10050804 | Ga0207649_100508042 | 299 |
| 113 | 3300025925 | Ga0207650_10016596 | Ga0207650_100165964 | 299 |
| 114 | 3300025926 | Ga0207659_10004601 | Ga0207659_100046019 | 299 |
| 115 | 3300025928 | Ga0207700_10134521 | Ga0207700_101345211 | 299 |
| 116 | 3300025929 | Ga0207664_10119473 | Ga0207664_101194732 | 299 |
| 117 | 3300025931 | Ga0207644_10088579 | Ga0207644_100885792 | 299 |
| 118 | 3300025932 | Ga0207690_10027852 | Ga0207690_100278522 | 299 |
| 119 | 3300025933 | Ga0207706_10014986 | Ga0207706_100149865 | 299 |
| 120 | 3300025940 | Ga0207691_10010904 | Ga0207691_100109043 | 299 |
| 121 | 3300025960 | Ga0207651_10078724 | Ga0207651_100787242 | 299 |
| 122 | 3300025986 | Ga0207658_10267268 | Ga0207658_102672682 | 299 |
| 123 | 3300026023 | Ga0207677_10022838 | Ga0207677_100228383 | 299 |
| 124 | 3300026121 | Ga0207683_10001914 | Ga0207683_1000191414 | 299 |
| 125 | 3300027907 | Ga0207428_10008148 | Ga0207428_1000814810 | 299 |
| 126 | 3300028379 | Ga0268266_10049836 | Ga0268266_100498362 | 299 |
| 127 | 3300046517 | Ga0495630_0262327 | Ga0495630_0262327_399_1298 | 299 |
| 128 | 3300048904 | Ga0496101_0060973 | Ga0496101_0060973_851_1774 | 299 |
| 129 | 3300048905 | Ga0496102_0086165 | Ga0496102_0086165_838_1761 | 299 |
| 130 | 3300048907 | Ga0496104_0043024 | Ga0496104_0043024_2647_3570 | 299 |
| 131 | 3300048908 | Ga0496105_0021784 | Ga0496105_0021784_3895_4818 | 299 |
| 132 | 3300048909 | Ga0496106_0029042 | Ga0496106_0029042_596_1519 | 299 |
| 133 | 3300048911 | Ga0496108_0040572 | Ga0496108_0040572_641_1564 | 299 |
| 134 | 3300048912 | Ga0496109_0018420 | Ga0496109_0018420_159_1082 | 299 |
| 135 | 3300048915 | Ga0496112_0172554 | Ga0496112_0172554_497_1420 | 299 |
| 136 | 3300049582 | Ga0501048_0122292 | Ga0501048_0122292_23_922 | 299 |
| 137 | 3300050508 | nmdc:mga09592_42678_c1 | nmdc:mga09592_42678_c1_1763_2686 | 299 |
| 138 | 3300050511 | nmdc:mga08y16_934_c1 | nmdc:mga08y16_934_c1_15611_16534 | 299 |
| 139 | iso_pu_bacteria | 2842775625 | 2842776103 | 300 |
| 140 | 3300005548 | Ga0070665_100017807 | Ga0070665_1000178077 | 302 |
| 141 | 3300005549 | Ga0070704_100133106 | Ga0070704_1001331062 | 302 |
| 142 | 3300009094 | Ga0111539_10010661 | Ga0111539_100106619 | 302 |
| 143 | 3300009094 | Ga0111539_10878827 | Ga0111539_108788271 | 302 |
| 144 | 3300027907 | Ga0207428_10044386 | Ga0207428_100443863 | 302 |
| 145 | 3300028556 | Ga0265337_1003360 | Ga0265337_10033604 | 302 |
| 146 | 3300031240 | Ga0265320_10000078 | Ga0265320_1000007863 | 302 |
| 147 | 3300031727 | Ga0316576_10092697 | Ga0316576_100926972 | 302 |
| 148 | 3300037466 | Ga0395898_0002650 | Ga0395898_0002650_4010_4930 | 302 |
| 149 | 3300047318 | Ga0495636_0000656 | Ga0495636_0000656_2334_3251 | 302 |
| 150 | 3300049571 | Ga0501034_0047938 | Ga0501034_0047938_743_1663 | 302 |
| 151 | 3300050511 | nmdc:mga08y16_6773_c1 | nmdc:mga08y16_6773_c1_10629_11546 | 302 |
| 152 | 3300053130 | Ga0500642_0007212 | Ga0500642_0007212_2741_3661 | 302 |
| 153 | 3300005327 | Ga0070658_10012641 | Ga0070658_100126414 | 303 |
| 154 | 3300005336 | Ga0070680_100148742 | Ga0070680_1001487422 | 303 |
| 155 | 3300005339 | Ga0070660_100025395 | Ga0070660_1000253954 | 303 |
| 156 | 3300005366 | Ga0070659_100002525 | Ga0070659_10000252512 | 303 |
| 157 | 3300005458 | Ga0070681_10000261 | Ga0070681_1000026123 | 303 |
| 158 | 3300005530 | Ga0070679_100001058 | Ga0070679_1000010585 | 303 |
| 159 | 3300005530 | Ga0070679_100020319 | Ga0070679_1000203195 | 303 |
| 160 | 3300005539 | Ga0068853_100067438 | Ga0068853_1000674382 | 303 |
| 161 | 3300005547 | Ga0070693_100266262 | Ga0070693_1002662621 | 303 |
| 162 | 3300005563 | Ga0068855_100154889 | Ga0068855_1001548892 | 303 |
| 163 | 3300005564 | Ga0070664_100012636 | Ga0070664_1000126362 | 303 |
| 164 | 3300006844 | Ga0075428_100123355 | Ga0075428_1001233552 | 303 |
| 165 | 3300006914 | Ga0075436_100067033 | Ga0075436_1000670332 | 303 |
| 166 | 3300009553 | Ga0105249_10396788 | Ga0105249_103967881 | 303 |
| 167 | 3300010375 | Ga0105239_10027237 | Ga0105239_100272374 | 303 |
| 168 | 3300010375 | Ga0105239_10050735 | Ga0105239_100507353 | 303 |
| 169 | 3300010375 | Ga0105239_10593578 | Ga0105239_105935781 | 303 |
| 170 | 3300013100 | Ga0157373_10189626 | Ga0157373_101896263 | 303 |
| 171 | 3300013307 | Ga0157372_10102954 | Ga0157372_101029542 | 303 |
| 172 | 3300013307 | Ga0157372_10274132 | Ga0157372_102741322 | 303 |
| 173 | 3300014325 | Ga0163163_10014977 | Ga0163163_100149773 | 303 |
| 174 | 3300025909 | Ga0207705_10003355 | Ga0207705_100033553 | 303 |
| 175 | 3300025912 | Ga0207707_10000003 | Ga0207707_10000003377 | 303 |
| 176 | 3300025912 | Ga0207707_10028133 | Ga0207707_100281333 | 303 |
| 177 | 3300025913 | Ga0207695_10001897 | Ga0207695_1000189726 | 303 |
| 178 | 3300025917 | Ga0207660_10015310 | Ga0207660_100153105 | 303 |
| 179 | 3300025921 | Ga0207652_10000024 | Ga0207652_100000245 | 303 |
| 180 | 3300025921 | Ga0207652_10195049 | Ga0207652_101950493 | 303 |
| 181 | 3300025932 | Ga0207690_10041631 | Ga0207690_100416312 | 303 |
| 182 | 3300025945 | Ga0207679_10287539 | Ga0207679_102875392 | 303 |
| 183 | 3300026116 | Ga0207674_10011149 | Ga0207674_100111496 | 303 |
| 184 | 3300028556 | Ga0265337_1028599 | Ga0265337_10285992 | 303 |
| 185 | 3300028800 | Ga0265338_10068588 | Ga0265338_100685883 | 303 |
| 186 | 3300028800 | Ga0265338_10133795 | Ga0265338_101337952 | 303 |
| 187 | 3300031238 | Ga0265332_10056504 | Ga0265332_100565041 | 303 |
| 188 | 3300031241 | Ga0265325_10001592 | Ga0265325_1000159219 | 303 |
| 189 | 3300031247 | Ga0265340_10000404 | Ga0265340_1000040424 | 303 |
| 190 | 3300031249 | Ga0265339_10017384 | Ga0265339_100173843 | 303 |
| 191 | 3300031711 | Ga0265314_10000193 | Ga0265314_1000019332 | 303 |
| 192 | 3300031712 | Ga0265342_10014312 | Ga0265342_100143121 | 303 |
| 193 | 3300031727 | Ga0316576_10076071 | Ga0316576_100760713 | 303 |
| 194 | 3300035083 | Ga0373926_0039852 | Ga0373926_0039852_525_1445 | 303 |
| 195 | 3300035111 | Ga0373923_0126867 | Ga0373923_0126867_106_1029 | 303 |
| 196 | 3300035172 | Ga0373955_0028715 | Ga0373955_0028715_118_1041 | 303 |
| 197 | 3300035398 | Ga0316574_0055185 | Ga0316574_0055185_148_1062 | 303 |
| 198 | 3300035695 | Ga0373927_0007647 | Ga0373927_0007647_3445_4365 | 303 |
| 199 | 3300036401 | Ga0373937_0328601 | Ga0373937_0328601_496_1419 | 303 |
| 200 | 3300036457 | Ga0265778_007786 | Ga0265778_007786_175_1095 | 303 |
| 201 | 3300042876 | Ga0451577_0000031 | Ga0451577_0000031_285889_286806 | 303 |
| 202 | 3300042876 | Ga0451577_0445149 | Ga0451577_0445149_61_990 | 303 |
| 203 | 3300044673 | Ga0453683_0000698 | Ga0453683_0000698_20095_21018 | 303 |
| 204 | 3300044673 | Ga0453683_0065415 | Ga0453683_0065415_207_1136 | 303 |
| 205 | 3300044673 | Ga0453683_0071885 | Ga0453683_0071885_755_1684 | 303 |
| 206 | 3300044673 | Ga0453683_0123339 | Ga0453683_0123339_600_1529 | 303 |
| 207 | 3300044712 | Ga0453684_0002829 | Ga0453684_0002829_38084_39013 | 303 |
| 208 | 3300044712 | Ga0453684_0035519 | Ga0453684_0035519_4249_5166 | 303 |
| 209 | 3300044712 | Ga0453684_0039087 | Ga0453684_0039087_5093_6022 | 303 |
| 210 | 3300044712 | Ga0453684_0046622 | Ga0453684_0046622_3033_3962 | 303 |
| 211 | 3300044712 | Ga0453684_0169173 | Ga0453684_0169173_759_1688 | 303 |
| 212 | 3300044712 | Ga0453684_0338524 | Ga0453684_0338524_456_1385 | 303 |
| 213 | 3300045051 | Ga0451576_0097005 | Ga0451576_0097005_1898_2818 | 303 |
| 214 | 3300045051 | Ga0451576_0295907 | Ga0451576_0295907_628_1557 | 303 |
| 215 | 3300046683 | Ga0495658_0034885 | Ga0495658_0034885_676_1596 | 303 |
| 216 | 3300049572 | Ga0501036_0154101 | Ga0501036_0154101_971_1900 | 303 |
| 217 | 3300049590 | Ga0501074_0150668 | Ga0501074_0150668_601_1530 | 303 |
| 218 | 3300050509 | nmdc:mga0qj67_282481_c1 | nmdc:mga0qj67_282481_c1_162_1091 | 303 |
| 219 | 3300050514 | nmdc:mga08x19_45357_c1 | nmdc:mga08x19_45357_c1_608_1528 | 303 |
| 220 | 3300061734 | Ga0530510_0012872 | Ga0530510_0012872_4809_5738 | 303 |
| 221 | 3300061734 | Ga0530510_0103630 | Ga0530510_0103630_1073_2002 | 303 |
| 222 | 3300003214 | JGI25165J46597_1002109 | JGI25165J46597_10021097 | 304 |
| 223 | 3300005336 | Ga0070680_100187879 | Ga0070680_1001878791 | 304 |
| 224 | 3300005456 | Ga0070678_100037471 | Ga0070678_1000374714 | 304 |
| 225 | 3300005468 | Ga0070707_100268561 | Ga0070707_1002685613 | 304 |
| 226 | 3300005539 | Ga0068853_100002929 | Ga0068853_10000292910 | 304 |
| 227 | 3300005548 | Ga0070665_100051807 | Ga0070665_1000518072 | 304 |
| 228 | 3300005548 | Ga0070665_100638668 | Ga0070665_1006386681 | 304 |
| 229 | 3300006847 | Ga0075431_100020107 | Ga0075431_1000201076 | 304 |
| 230 | 3300006880 | Ga0075429_100354736 | Ga0075429_1003547361 | 304 |
| 231 | 3300009545 | Ga0105237_10002307 | Ga0105237_100023073 | 304 |
| 232 | 3300010375 | Ga0105239_10001288 | Ga0105239_100012888 | 304 |
| 233 | 3300025261 | Ga0209233_1000253 | Ga0209233_10002532 | 304 |
| 234 | 3300025914 | Ga0207671_10001097 | Ga0207671_1000109715 | 304 |
| 235 | 3300025917 | Ga0207660_10196972 | Ga0207660_101969721 | 304 |
| 236 | 3300025922 | Ga0207646_10248220 | Ga0207646_102482202 | 304 |
| 237 | 3300026041 | Ga0207639_10009494 | Ga0207639_100094946 | 304 |
| 238 | 3300028379 | Ga0268266_10000257 | Ga0268266_1000025723 | 304 |
| 239 | 3300031691 | Ga0316579_10015648 | Ga0316579_100156482 | 304 |
| 240 | 3300032137 | Ga0316585_10072982 | Ga0316585_100729821 | 304 |
| 241 | 3300032168 | Ga0316593_10025576 | Ga0316593_100255762 | 304 |
| 242 | 3300037418 | Ga0395900_0118408 | Ga0395900_0118408_1483_2400 | 304 |
| 243 | 3300037588 | Ga0316581_0057601 | Ga0316581_0057601_249_1172 | 304 |
| 244 | 3300039437 | Ga0436365_0969405 | Ga0436365_0969405_150_1073 | 304 |
| 245 | 3300039437 | Ga0436365_1432522 | Ga0436365_1432522_690_1613 | 304 |
| 246 | 3300039438 | Ga0436360_0819436 | Ga0436360_0819436_1216_2133 | 304 |
| 247 | 3300045051 | Ga0451576_0237280 | Ga0451576_0237280_51_971 | 304 |
| 248 | 3300046473 | Ga0495582_0014419 | Ga0495582_0014419_1668_2600 | 304 |
| 249 | 3300046537 | Ga0495598_0010079 | Ga0495598_0010079_1052_2023 | 304 |
| 250 | 3300046681 | Ga0495647_0073280 | Ga0495647_0073280_422_1354 | 304 |
| 251 | 3300046683 | Ga0495658_0001366 | Ga0495658_0001366_11677_12618 | 304 |
| 252 | 3300048909 | Ga0496106_0068256 | Ga0496106_0068256_126_1058 | 304 |
| 253 | 3300048913 | Ga0496110_0100673 | Ga0496110_0100673_347_1279 | 304 |
| 254 | 3300049592 | Ga0501076_0210392 | Ga0501076_0210392_486_1412 | 304 |
| 255 | 3300050507 | nmdc:mga05p37_414194_c1 | nmdc:mga05p37_414194_c1_479_1417 | 304 |
| 256 | 3300050510 | nmdc:mga06r32_73743_c1 | nmdc:mga06r32_73743_c1_2156_3079 | 304 |
| 257 | 3300050513 | nmdc:mga0rr50_187454_c1 | nmdc:mga0rr50_187454_c1_727_1650 | 304 |
| 258 | 3300005444 | Ga0070694_100341377 | Ga0070694_1003413771 | 305 |
| 259 | 3300005518 | Ga0070699_100004696 | Ga0070699_1000046963 | 305 |
| 260 | 3300005536 | Ga0070697_100187477 | Ga0070697_1001874772 | 305 |
| 261 | 3300005843 | Ga0068860_100004991 | Ga0068860_1000049914 | 305 |
| 262 | 3300006847 | Ga0075431_100074988 | Ga0075431_1000749884 | 305 |
| 263 | 3300006852 | Ga0075433_10006146 | Ga0075433_100061464 | 305 |
| 264 | 3300006871 | Ga0075434_100044789 | Ga0075434_1000447895 | 305 |
| 265 | 3300006914 | Ga0075436_100035050 | Ga0075436_1000350501 | 305 |
| 266 | 3300006914 | Ga0075436_100143999 | Ga0075436_1001439993 | 305 |
| 267 | 3300007265 | Ga0099794_10000051 | Ga0099794_100000518 | 305 |
| 268 | 3300007265 | Ga0099794_10057804 | Ga0099794_100578041 | 305 |
| 269 | 3300009093 | Ga0105240_10000041 | Ga0105240_10000041102 | 305 |
| 270 | 3300009553 | Ga0105249_10455959 | Ga0105249_104559591 | 305 |
| 271 | 3300010375 | Ga0105239_10099663 | Ga0105239_100996632 | 305 |
| 272 | 3300020069 | Ga0197907_11056369 | Ga0197907_110563692 | 305 |
| 273 | 3300020075 | Ga0206349_1060160 | Ga0206349_10601601 | 305 |
| 274 | 3300020075 | Ga0206349_1239780 | Ga0206349_12397801 | 305 |
| 275 | 3300020080 | Ga0206350_10765337 | Ga0206350_107653374 | 305 |
| 276 | 3300022467 | Ga0224712_10049073 | Ga0224712_100490731 | 305 |
| 277 | 3300022467 | Ga0224712_10079843 | Ga0224712_100798432 | 305 |
| 278 | 3300025913 | Ga0207695_10000125 | Ga0207695_10000125147 | 305 |
| 279 | 3300025939 | Ga0207665_10077805 | Ga0207665_100778052 | 305 |
| 280 | 3300027671 | Ga0209588_1000010 | Ga0209588_100001049 | 305 |
| 281 | 3300028381 | Ga0268264_10003412 | Ga0268264_100034128 | 305 |
| 282 | 3300031901 | Ga0307406_10004608 | Ga0307406_100046082 | 305 |
| 283 | 3300037312 | Ga0395899_0005409 | Ga0395899_0005409_4692_5693 | 305 |
| 284 | 3300046459 | Ga0495629_0000001 | Ga0495629_0000001_561868_562791 | 305 |
| 285 | 3300046663 | Ga0495635_0001175 | Ga0495635_0001175_9449_10372 | 305 |
| 286 | 3300046690 | Ga0495624_0128518 | Ga0495624_0128518_110_1033 | 305 |
| 287 | 3300046809 | Ga0495600_0002828 | Ga0495600_0002828_3930_4853 | 305 |
| 288 | 3300047322 | Ga0495680_0001540 | Ga0495680_0001540_18308_19231 | 305 |
| 289 | 3300047471 | Ga0495684_0001985 | Ga0495684_0001985_7716_8639 | 305 |
| 290 | 3300048913 | Ga0496110_0015477 | Ga0496110_0015477_4511_5434 | 305 |
| 291 | 3300048914 | Ga0496111_0346852 | Ga0496111_0346852_60_983 | 305 |
| 292 | 3300048927 | Ga0496124_0000003 | Ga0496124_0000003_695486_696409 | 305 |
| 293 | 3300048928 | Ga0496125_0138852 | Ga0496125_0138852_641_1564 | 305 |
| 294 | 3300049571 | Ga0501034_0026670 | Ga0501034_0026670_86_1012 | 305 |
| 295 | 3300049574 | Ga0501038_0364813 | Ga0501038_0364813_115_1044 | 305 |
| 296 | 3300049580 | Ga0501046_0004181 | Ga0501046_0004181_1634_2554 | 305 |
| 297 | 3300049586 | Ga0501070_0038080 | Ga0501070_0038080_1460_2380 | 305 |
| 298 | 3300049823 | Ga0501044_0091876 | Ga0501044_0091876_667_1587 | 305 |
| 299 | 3300050510 | nmdc:mga06r32_41561_c1 | nmdc:mga06r32_41561_c1_467_1411 | 305 |
| 300 | 3300050511 | nmdc:mga08y16_52600_c1 | nmdc:mga08y16_52600_c1_3212_4132 | 305 |
| 301 | 3300050512 | nmdc:mga0n895_57103_c1 | nmdc:mga0n895_57103_c1_1554_2474 | 305 |
| 302 | 3300050514 | nmdc:mga08x19_270840_c1 | nmdc:mga08x19_270840_c1_184_1104 | 305 |
| 303 | 3300050514 | nmdc:mga08x19_67624_c1 | nmdc:mga08x19_67624_c1_847_1767 | 305 |
| 304 | 3300050515 | nmdc:mga0a205_389381_c1 | nmdc:mga0a205_389381_c1_150_1070 | 305 |
| 305 | 3300003203 | JGI25406J46586_10026155 | JGI25406J46586_100261552 | 306 |
| 306 | 3300004801 | Ga0058860_10025827 | Ga0058860_100258271 | 306 |
| 307 | 3300005347 | Ga0070668_100028216 | Ga0070668_1000282162 | 306 |
| 308 | 3300005353 | Ga0070669_100006746 | Ga0070669_1000067466 | 306 |
| 309 | 3300005444 | Ga0070694_100057405 | Ga0070694_1000574052 | 306 |
| 310 | 3300005445 | Ga0070708_100010383 | Ga0070708_1000103832 | 306 |
| 311 | 3300005445 | Ga0070708_100020404 | Ga0070708_1000204043 | 306 |
| 312 | 3300005445 | Ga0070708_100046121 | Ga0070708_1000461214 | 306 |
| 313 | 3300005457 | Ga0070662_100021182 | Ga0070662_1000211823 | 306 |
| 314 | 3300005467 | Ga0070706_100016786 | Ga0070706_1000167862 | 306 |
| 315 | 3300005467 | Ga0070706_100022592 | Ga0070706_1000225922 | 306 |
| 316 | 3300005467 | Ga0070706_100196461 | Ga0070706_1001964612 | 306 |
| 317 | 3300005467 | Ga0070706_100214816 | Ga0070706_1002148162 | 306 |
| 318 | 3300005468 | Ga0070707_100003627 | Ga0070707_1000036272 | 306 |
| 319 | 3300005468 | Ga0070707_100117473 | Ga0070707_1001174732 | 306 |
| 320 | 3300005468 | Ga0070707_100117749 | Ga0070707_1001177492 | 306 |
| 321 | 3300005468 | Ga0070707_100188419 | Ga0070707_1001884192 | 306 |
| 322 | 3300005471 | Ga0070698_100004971 | Ga0070698_1000049712 | 306 |
| 323 | 3300005471 | Ga0070698_100076866 | Ga0070698_1000768663 | 306 |
| 324 | 3300005471 | Ga0070698_100138311 | Ga0070698_1001383111 | 306 |
| 325 | 3300005518 | Ga0070699_100001508 | Ga0070699_10000150813 | 306 |
| 326 | 3300005518 | Ga0070699_100098434 | Ga0070699_1000984342 | 306 |
| 327 | 3300005518 | Ga0070699_100180049 | Ga0070699_1001800492 | 306 |
| 328 | 3300005518 | Ga0070699_100233214 | Ga0070699_1002332142 | 306 |
| 329 | 3300005536 | Ga0070697_100019444 | Ga0070697_1000194442 | 306 |
| 330 | 3300005536 | Ga0070697_100040774 | Ga0070697_1000407742 | 306 |
| 331 | 3300005536 | Ga0070697_100052264 | Ga0070697_1000522643 | 306 |
| 332 | 3300005536 | Ga0070697_100132525 | Ga0070697_1001325252 | 306 |
| 333 | 3300005546 | Ga0070696_100090442 | Ga0070696_1000904422 | 306 |
| 334 | 3300005546 | Ga0070696_100122392 | Ga0070696_1001223922 | 306 |
| 335 | 3300005549 | Ga0070704_100036807 | Ga0070704_1000368072 | 306 |
| 336 | 3300005549 | Ga0070704_100313730 | Ga0070704_1003137301 | 306 |
| 337 | 3300005549 | Ga0070704_100357219 | Ga0070704_1003572191 | 306 |
| 338 | 3300005841 | Ga0068863_100091308 | Ga0068863_1000913083 | 306 |
| 339 | 3300005843 | Ga0068860_100232421 | Ga0068860_1002324212 | 306 |
| 340 | 3300005937 | Ga0081455_10260101 | Ga0081455_102601012 | 306 |
| 341 | 3300005981 | Ga0081538_10049728 | Ga0081538_100497282 | 306 |
| 342 | 3300005985 | Ga0081539_10000069 | Ga0081539_1000006943 | 306 |
| 343 | 3300006028 | Ga0070717_10328943 | Ga0070717_103289432 | 306 |
| 344 | 3300006173 | Ga0070716_100103005 | Ga0070716_1001030052 | 306 |
| 345 | 3300006844 | Ga0075428_100001434 | Ga0075428_1000014348 | 306 |
| 346 | 3300006844 | Ga0075428_100066481 | Ga0075428_1000664812 | 306 |
| 347 | 3300006846 | Ga0075430_100000480 | Ga0075430_10000048018 | 306 |
| 348 | 3300006846 | Ga0075430_100003937 | Ga0075430_1000039375 | 306 |
| 349 | 3300006846 | Ga0075430_100016264 | Ga0075430_1000162644 | 306 |
| 350 | 3300006846 | Ga0075430_100153809 | Ga0075430_1001538091 | 306 |
| 351 | 3300006847 | Ga0075431_100000016 | Ga0075431_10000001674 | 306 |
| 352 | 3300006847 | Ga0075431_100000127 | Ga0075431_10000012728 | 306 |
| 353 | 3300006847 | Ga0075431_100023856 | Ga0075431_1000238563 | 306 |
| 354 | 3300006847 | Ga0075431_100200690 | Ga0075431_1002006902 | 306 |
| 355 | 3300006852 | Ga0075433_10002610 | Ga0075433_100026109 | 306 |
| 356 | 3300006852 | Ga0075433_10053691 | Ga0075433_100536912 | 306 |
| 357 | 3300006871 | Ga0075434_100068041 | Ga0075434_1000680412 | 306 |
| 358 | 3300006880 | Ga0075429_100051717 | Ga0075429_1000517172 | 306 |
| 359 | 3300006880 | Ga0075429_100142440 | Ga0075429_1001424402 | 306 |
| 360 | 3300006880 | Ga0075429_100147690 | Ga0075429_1001476902 | 306 |
| 361 | 3300006880 | Ga0075429_100189387 | Ga0075429_1001893872 | 306 |
| 362 | 3300006914 | Ga0075436_100000659 | Ga0075436_1000006594 | 306 |
| 363 | 3300006914 | Ga0075436_100209882 | Ga0075436_1002098822 | 306 |
| 364 | 3300009094 | Ga0111539_10080139 | Ga0111539_100801393 | 306 |
| 365 | 3300009147 | Ga0114129_10000093 | Ga0114129_1000009365 | 306 |
| 366 | 3300009147 | Ga0114129_10003396 | Ga0114129_100033968 | 306 |
| 367 | 3300009147 | Ga0114129_10003570 | Ga0114129_100035702 | 306 |
| 368 | 3300009147 | Ga0114129_10043934 | Ga0114129_100439344 | 306 |
| 369 | 3300009147 | Ga0114129_10074063 | Ga0114129_100740633 | 306 |
| 370 | 3300009147 | Ga0114129_10162001 | Ga0114129_101620013 | 306 |
| 371 | 3300009147 | Ga0114129_10237963 | Ga0114129_102379631 | 306 |
| 372 | 3300009147 | Ga0114129_10302202 | Ga0114129_103022022 | 306 |
| 373 | 3300009147 | Ga0114129_10402286 | Ga0114129_104022862 | 306 |
| 374 | 3300009148 | Ga0105243_10105459 | Ga0105243_101054592 | 306 |
| 375 | 3300009174 | Ga0105241_10002639 | Ga0105241_100026396 | 306 |
| 376 | 3300009176 | Ga0105242_10267145 | Ga0105242_102671452 | 306 |
| 377 | 3300009553 | Ga0105249_10170627 | Ga0105249_101706272 | 306 |
| 378 | 3300013306 | Ga0163162_10026169 | Ga0163162_100261693 | 306 |
| 379 | 3300013308 | Ga0157375_10048140 | Ga0157375_100481403 | 306 |
| 380 | 3300014326 | Ga0157380_10072730 | Ga0157380_100727302 | 306 |
| 381 | 3300017792 | Ga0163161_10052577 | Ga0163161_100525772 | 306 |
| 382 | 3300020069 | Ga0197907_10541769 | Ga0197907_105417691 | 306 |
| 383 | 3300020069 | Ga0197907_10662627 | Ga0197907_106626271 | 306 |
| 384 | 3300020069 | Ga0197907_10674868 | Ga0197907_106748682 | 306 |
| 385 | 3300020069 | Ga0197907_11169213 | Ga0197907_111692132 | 306 |
| 386 | 3300020070 | Ga0206356_11515020 | Ga0206356_115150202 | 306 |
| 387 | 3300020070 | Ga0206356_11856893 | Ga0206356_118568931 | 306 |
| 388 | 3300020075 | Ga0206349_1240892 | Ga0206349_12408922 | 306 |
| 389 | 3300020075 | Ga0206349_1284932 | Ga0206349_12849321 | 306 |
| 390 | 3300020075 | Ga0206349_1615189 | Ga0206349_16151892 | 306 |
| 391 | 3300020075 | Ga0206349_1909150 | Ga0206349_19091501 | 306 |
| 392 | 3300020077 | Ga0206351_10265613 | Ga0206351_102656131 | 306 |
| 393 | 3300020077 | Ga0206351_10320234 | Ga0206351_103202341 | 306 |
| 394 | 3300020078 | Ga0206352_10806553 | Ga0206352_108065531 | 306 |
| 395 | 3300020078 | Ga0206352_11088056 | Ga0206352_110880561 | 306 |
| 396 | 3300020080 | Ga0206350_10055406 | Ga0206350_100554062 | 306 |
| 397 | 3300020080 | Ga0206350_10055662 | Ga0206350_100556622 | 306 |
| 398 | 3300020080 | Ga0206350_10058979 | Ga0206350_100589791 | 306 |
| 399 | 3300020080 | Ga0206350_10383671 | Ga0206350_103836711 | 306 |
| 400 | 3300020080 | Ga0206350_10702709 | Ga0206350_107027092 | 306 |
| 401 | 3300020080 | Ga0206350_10787735 | Ga0206350_107877351 | 306 |
| 402 | 3300020080 | Ga0206350_11004085 | Ga0206350_110040851 | 306 |
| 403 | 3300020080 | Ga0206350_11495803 | Ga0206350_114958031 | 306 |
| 404 | 3300020082 | Ga0206353_10502351 | Ga0206353_105023512 | 306 |
| 405 | 3300021388 | Ga0213875_10066143 | Ga0213875_100661432 | 306 |
| 406 | 3300022467 | Ga0224712_10040530 | Ga0224712_100405301 | 306 |
| 407 | 3300022467 | Ga0224712_10087311 | Ga0224712_100873111 | 306 |
| 408 | 3300022467 | Ga0224712_10108465 | Ga0224712_101084651 | 306 |
| 409 | 3300022467 | Ga0224712_10160799 | Ga0224712_101607991 | 306 |
| 410 | 3300025910 | Ga0207684_10000699 | Ga0207684_1000069916 | 306 |
| 411 | 3300025910 | Ga0207684_10006205 | Ga0207684_100062055 | 306 |
| 412 | 3300025910 | Ga0207684_10082354 | Ga0207684_100823541 | 306 |
| 413 | 3300025910 | Ga0207684_10194903 | Ga0207684_101949031 | 306 |
| 414 | 3300025922 | Ga0207646_10006130 | Ga0207646_100061304 | 306 |
| 415 | 3300025922 | Ga0207646_10034841 | Ga0207646_100348413 | 306 |
| 416 | 3300025922 | Ga0207646_10043460 | Ga0207646_100434603 | 306 |
| 417 | 3300025922 | Ga0207646_10049366 | Ga0207646_100493662 | 306 |
| 418 | 3300025923 | Ga0207681_10081535 | Ga0207681_100815352 | 306 |
| 419 | 3300025935 | Ga0207709_10108894 | Ga0207709_101088942 | 306 |
| 420 | 3300025940 | Ga0207691_10045517 | Ga0207691_100455172 | 306 |
| 421 | 3300025972 | Ga0207668_10065445 | Ga0207668_100654452 | 306 |
| 422 | 3300026035 | Ga0207703_10076252 | Ga0207703_100762522 | 306 |
| 423 | 3300026088 | Ga0207641_10069103 | Ga0207641_100691033 | 306 |
| 424 | 3300027907 | Ga0207428_10108472 | Ga0207428_101084722 | 306 |
| 425 | 3300028381 | Ga0268264_10230141 | Ga0268264_102301412 | 306 |
| 426 | 3300028563 | Ga0265319_1000997 | Ga0265319_100099711 | 306 |
| 427 | 3300028573 | Ga0265334_10035763 | Ga0265334_100357632 | 306 |
| 428 | 3300028577 | Ga0265318_10000203 | Ga0265318_1000020317 | 306 |
| 429 | 3300028577 | Ga0265318_10001992 | Ga0265318_100019923 | 306 |
| 430 | 3300028577 | Ga0265318_10007232 | Ga0265318_100072326 | 306 |
| 431 | 3300028800 | Ga0265338_10019349 | Ga0265338_100193491 | 306 |
| 432 | 3300028800 | Ga0265338_10020668 | Ga0265338_100206682 | 306 |
| 433 | 3300031235 | Ga0265330_10000562 | Ga0265330_1000056217 | 306 |
| 434 | 3300031235 | Ga0265330_10012846 | Ga0265330_100128463 | 306 |
| 435 | 3300031238 | Ga0265332_10000369 | Ga0265332_1000036917 | 306 |
| 436 | 3300031238 | Ga0265332_10000906 | Ga0265332_100009063 | 306 |
| 437 | 3300031239 | Ga0265328_10009142 | Ga0265328_100091421 | 306 |
| 438 | 3300031239 | Ga0265328_10009295 | Ga0265328_100092952 | 306 |
| 439 | 3300031239 | Ga0265328_10039838 | Ga0265328_100398382 | 306 |
| 440 | 3300031240 | Ga0265320_10001291 | Ga0265320_100012915 | 306 |
| 441 | 3300031240 | Ga0265320_10043015 | Ga0265320_100430152 | 306 |
| 442 | 3300031240 | Ga0265320_10096604 | Ga0265320_100966041 | 306 |
| 443 | 3300031241 | Ga0265325_10029008 | Ga0265325_100290082 | 306 |
| 444 | 3300031242 | Ga0265329_10001244 | Ga0265329_100012445 | 306 |
| 445 | 3300031242 | Ga0265329_10013205 | Ga0265329_100132052 | 306 |
| 446 | 3300031247 | Ga0265340_10000201 | Ga0265340_1000020113 | 306 |
| 447 | 3300031247 | Ga0265340_10003154 | Ga0265340_100031542 | 306 |
| 448 | 3300031249 | Ga0265339_10006243 | Ga0265339_100062431 | 306 |
| 449 | 3300031250 | Ga0265331_10000032 | Ga0265331_1000003290 | 306 |
| 450 | 3300031250 | Ga0265331_10001059 | Ga0265331_1000105917 | 306 |
| 451 | 3300031250 | Ga0265331_10007127 | Ga0265331_100071274 | 306 |
| 452 | 3300031344 | Ga0265316_10003440 | Ga0265316_1000344011 | 306 |
| 453 | 3300031344 | Ga0265316_10010806 | Ga0265316_100108063 | 306 |
| 454 | 3300031548 | Ga0307408_100053526 | Ga0307408_1000535262 | 306 |
| 455 | 3300031548 | Ga0307408_100277640 | Ga0307408_1002776402 | 306 |
| 456 | 3300031595 | Ga0265313_10000095 | Ga0265313_1000009561 | 306 |
| 457 | 3300031711 | Ga0265314_10000215 | Ga0265314_1000021565 | 306 |
| 458 | 3300031711 | Ga0265314_10001016 | Ga0265314_1000101611 | 306 |
| 459 | 3300031712 | Ga0265342_10000560 | Ga0265342_1000056017 | 306 |
| 460 | 3300031712 | Ga0265342_10005756 | Ga0265342_100057567 | 306 |
| 461 | 3300031995 | Ga0307409_100220664 | Ga0307409_1002206642 | 306 |
| 462 | 3300035119 | Ga0373956_0001166 | Ga0373956_0001166_8951_9874 | 306 |
| 463 | 3300035695 | Ga0373927_0000015 | Ga0373927_0000015_148066_148989 | 306 |
| 464 | 3300035724 | Ga0373933_0007886 | Ga0373933_0007886_3079_4002 | 306 |
| 465 | 3300035724 | Ga0373933_0019859 | Ga0373933_0019859_1960_2883 | 306 |
| 466 | 3300037312 | Ga0395899_0023622 | Ga0395899_0023622_3131_4060 | 306 |
| 467 | 3300037312 | Ga0395899_0055121 | Ga0395899_0055121_809_1732 | 306 |
| 468 | 3300037418 | Ga0395900_0000485 | Ga0395900_0000485_52727_53656 | 306 |
| 469 | 3300037466 | Ga0395898_0008040 | Ga0395898_0008040_9735_10664 | 306 |
| 470 | 3300037471 | Ga0395905_0013517 | Ga0395905_0013517_1874_2797 | 306 |
| 471 | 3300037853 | Ga0436364_0112710 | Ga0436364_0112710_475_1401 | 306 |
| 472 | 3300038443 | Ga0395901_0000955 | Ga0395901_0000955_23900_24829 | 306 |
| 473 | 3300038443 | Ga0395901_0018330 | Ga0395901_0018330_3404_4327 | 306 |
| 474 | 3300039093 | Ga0400489_44064 | Ga0400489_44064_2475_3401 | 306 |
| 475 | 3300044656 | Ga0466969_0001971 | Ga0466969_0001971_5853_6776 | 306 |
| 476 | 3300044656 | Ga0466969_0038556 | Ga0466969_0038556_528_1451 | 306 |
| 477 | 3300044658 | Ga0466972_0011726 | Ga0466972_0011726_2553_3476 | 306 |
| 478 | 3300044673 | Ga0453683_0000919 | Ga0453683_0000919_411_1394 | 306 |
| 479 | 3300044683 | Ga0466965_0048556 | Ga0466965_0048556_504_1427 | 306 |
| 480 | 3300044684 | Ga0466966_0004193 | Ga0466966_0004193_4419_5342 | 306 |
| 481 | 3300044684 | Ga0466966_0097539 | Ga0466966_0097539_652_1575 | 306 |
| 482 | 3300044693 | Ga0466961_0045312 | Ga0466961_0045312_845_1768 | 306 |
| 483 | 3300044706 | Ga0466964_0022134 | Ga0466964_0022134_1097_2020 | 306 |
| 484 | 3300044719 | Ga0466971_0102965 | Ga0466971_0102965_351_1274 | 306 |
| 485 | 3300044735 | Ga0466968_0001893 | Ga0466968_0001893_346_1269 | 306 |
| 486 | 3300044765 | Ga0466970_0000302 | Ga0466970_0000302_17973_18896 | 306 |
| 487 | 3300045049 | Ga0466959_0055727 | Ga0466959_0055727_1866_2789 | 306 |
| 488 | 3300045836 | Ga0466958_0036170 | Ga0466958_0036170_1383_2336 | 306 |
| 489 | 3300046528 | Ga0495642_0006635 | Ga0495642_0006635_3099_4028 | 306 |
| 490 | 3300048903 | Ga0496100_0303282 | Ga0496100_0303282_201_1130 | 306 |
| 491 | 3300048905 | Ga0496102_0309762 | Ga0496102_0309762_307_1236 | 306 |
| 492 | 3300048929 | Ga0496126_0023537 | Ga0496126_0023537_3089_4015 | 306 |
| 493 | 3300048929 | Ga0496126_0074959 | Ga0496126_0074959_799_1737 | 306 |
| 494 | 3300049570 | Ga0501033_0252585 | Ga0501033_0252585_57_980 | 306 |
| 495 | 3300049571 | Ga0501034_0022542 | Ga0501034_0022542_2169_3113 | 306 |
| 496 | 3300049573 | Ga0501037_0001886 | Ga0501037_0001886_4888_5832 | 306 |
| 497 | 3300049573 | Ga0501037_0230592 | Ga0501037_0230592_280_1203 | 306 |
| 498 | 3300049575 | Ga0501039_0052477 | Ga0501039_0052477_987_1910 | 306 |
| 499 | 3300049576 | Ga0501040_0015463 | Ga0501040_0015463_130_1053 | 306 |
| 500 | 3300049576 | Ga0501040_0064296 | Ga0501040_0064296_440_1363 | 306 |
| 501 | 3300049577 | Ga0501041_0168413 | Ga0501041_0168413_274_1197 | 306 |
| 502 | 3300049581 | Ga0501047_0197931 | Ga0501047_0197931_451_1395 | 306 |
| 503 | 3300049582 | Ga0501048_0024348 | Ga0501048_0024348_3283_4206 | 306 |
| 504 | 3300049582 | Ga0501048_0266575 | Ga0501048_0266575_261_1205 | 306 |
| 505 | 3300049583 | Ga0501067_0004610 | Ga0501067_0004610_3256_4179 | 306 |
| 506 | 3300049584 | Ga0501068_0060068 | Ga0501068_0060068_1289_2212 | 306 |
| 507 | 3300049584 | Ga0501068_0089604 | Ga0501068_0089604_454_1377 | 306 |
| 508 | 3300049585 | Ga0501069_0019093 | Ga0501069_0019093_1172_2095 | 306 |
| 509 | 3300049587 | Ga0501071_0042663 | Ga0501071_0042663_337_1260 | 306 |
| 510 | 3300049588 | Ga0501072_0030558 | Ga0501072_0030558_21_950 | 306 |
| 511 | 3300049590 | Ga0501074_0064534 | Ga0501074_0064534_1676_2599 | 306 |
| 512 | 3300049591 | Ga0501075_0007603 | Ga0501075_0007603_2739_3662 | 306 |
| 513 | 3300049592 | Ga0501076_0022670 | Ga0501076_0022670_791_1714 | 306 |
| 514 | 3300049592 | Ga0501076_0029092 | Ga0501076_0029092_1963_2892 | 306 |
| 515 | 3300049592 | Ga0501076_0146420 | Ga0501076_0146420_881_1804 | 306 |
| 516 | 3300049592 | Ga0501076_0399759 | Ga0501076_0399759_152_1081 | 306 |
| 517 | 3300049741 | Ga0501079_0043256 | Ga0501079_0043256_206_1129 | 306 |
| 518 | 3300049741 | Ga0501079_0224433 | Ga0501079_0224433_356_1285 | 306 |
| 519 | 3300049742 | Ga0501080_0115345 | Ga0501080_0115345_210_1133 | 306 |
| 520 | 3300049743 | Ga0501081_0002723 | Ga0501081_0002723_540_1463 | 306 |
| 521 | 3300049743 | Ga0501081_0368573 | Ga0501081_0368573_106_1029 | 306 |
| 522 | 3300049823 | Ga0501044_0001768 | Ga0501044_0001768_10334_11278 | 306 |
| 523 | 3300049824 | Ga0501045_0024815 | Ga0501045_0024815_2261_3184 | 306 |
| 524 | 3300050507 | nmdc:mga05p37_200834_c1 | nmdc:mga05p37_200834_c1_754_1677 | 306 |
| 525 | 3300050507 | nmdc:mga05p37_28610_c1 | nmdc:mga05p37_28610_c1_5272_6195 | 306 |
| 526 | 3300050507 | nmdc:mga05p37_290369_c1 | nmdc:mga05p37_290369_c1_33_956 | 306 |
| 527 | 3300050507 | nmdc:mga05p37_3014_c1 | nmdc:mga05p37_3014_c1_2621_3544 | 306 |
| 528 | 3300050507 | nmdc:mga05p37_389043_c1 | nmdc:mga05p37_389043_c1_363_1286 | 306 |
| 529 | 3300050507 | nmdc:mga05p37_492_c1 | nmdc:mga05p37_492_c1_23779_24702 | 306 |
| 530 | 3300050507 | nmdc:mga05p37_58168_c1 | nmdc:mga05p37_58168_c1_979_1908 | 306 |
| 531 | 3300050507 | nmdc:mga05p37_66414_c1 | nmdc:mga05p37_66414_c1_1693_2622 | 306 |
| 532 | 3300050508 | nmdc:mga09592_216432_c1 | nmdc:mga09592_216432_c1_420_1343 | 306 |
| 533 | 3300050508 | nmdc:mga09592_292380_c1 | nmdc:mga09592_292380_c1_13_945 | 306 |
| 534 | 3300050508 | nmdc:mga09592_464949_c1 | nmdc:mga09592_464949_c1_53_976 | 306 |
| 535 | 3300050509 | nmdc:mga0qj67_142933_c1 | nmdc:mga0qj67_142933_c1_908_1831 | 306 |
| 536 | 3300050509 | nmdc:mga0qj67_1701_c1 | nmdc:mga0qj67_1701_c1_13449_14378 | 306 |
| 537 | 3300050510 | nmdc:mga06r32_10844_c1 | nmdc:mga06r32_10844_c1_252_1181 | 306 |
| 538 | 3300050510 | nmdc:mga06r32_115477_c1 | nmdc:mga06r32_115477_c1_247_1170 | 306 |
| 539 | 3300050510 | nmdc:mga06r32_2087_c1 | nmdc:mga06r32_2087_c1_2010_2933 | 306 |
| 540 | 3300050510 | nmdc:mga06r32_235873_c1 | nmdc:mga06r32_235873_c1_106_1029 | 306 |
| 541 | 3300050510 | nmdc:mga06r32_95971_c1 | nmdc:mga06r32_95971_c1_1662_2585 | 306 |
| 542 | 3300050511 | nmdc:mga08y16_64703_c1 | nmdc:mga08y16_64703_c1_2678_3601 | 306 |
| 543 | 3300050512 | nmdc:mga0n895_382_c1 | nmdc:mga0n895_382_c1_14261_15184 | 306 |
| 544 | 3300050512 | nmdc:mga0n895_546338_c1 | nmdc:mga0n895_546338_c1_154_1083 | 306 |
| 545 | 3300050512 | nmdc:mga0n895_83587_c1 | nmdc:mga0n895_83587_c1_1065_1994 | 306 |
| 546 | 3300050513 | nmdc:mga0rr50_590_c1 | nmdc:mga0rr50_590_c1_3104_4027 | 306 |
| 547 | 3300050514 | nmdc:mga08x19_21650_c1 | nmdc:mga08x19_21650_c1_1720_2649 | 306 |
| 548 | 3300050514 | nmdc:mga08x19_2518_c1 | nmdc:mga08x19_2518_c1_4028_4951 | 306 |
| 549 | 3300050515 | nmdc:mga0a205_2800_c1 | nmdc:mga0a205_2800_c1_1137_2060 | 306 |
| 550 | 3300050515 | nmdc:mga0a205_53320_c1 | nmdc:mga0a205_53320_c1_236_1165 | 306 |
| 551 | 3300053178 | Ga0500637_0097293 | Ga0500637_0097293_559_1482 | 306 |
| 552 | 3300054114 | Ga0501084_0006437 | Ga0501084_0006437_6694_7617 | 306 |
| 553 | 3300054114 | Ga0501084_0198229 | Ga0501084_0198229_90_1013 | 306 |
| 554 | 3300060353 | Ga0501082_0009246 | Ga0501082_0009246_6905_7828 | 306 |
| 555 | 3300060353 | Ga0501082_0135336 | Ga0501082_0135336_496_1425 | 306 |
| 556 | 3300060353 | Ga0501082_0187891 | Ga0501082_0187891_663_1589 | 306 |
| 557 | 3300060353 | Ga0501082_0285481 | Ga0501082_0285481_284_1207 | 306 |
| 558 | 3300061734 | Ga0530510_0016896 | Ga0530510_0016896_175_1098 | 306 |
| 559 | 3300061734 | Ga0530510_0026956 | Ga0530510_0026956_1868_2797 | 306 |
| 560 | 3300061734 | Ga0530510_0181888 | Ga0530510_0181888_82_1005 | 306 |
| 561 | 3300005295 | Ga0065707_10089909 | Ga0065707_100899094 | 307 |
| 562 | 3300005295 | Ga0065707_10168871 | Ga0065707_101688711 | 307 |
| 563 | 3300005327 | Ga0070658_10039295 | Ga0070658_100392955 | 307 |
| 564 | 3300005330 | Ga0070690_100005668 | Ga0070690_1000056685 | 307 |
| 565 | 3300005334 | Ga0068869_100001552 | Ga0068869_1000015524 | 307 |
| 566 | 3300005334 | Ga0068869_100009551 | Ga0068869_1000095514 | 307 |
| 567 | 3300005334 | Ga0068869_100010696 | Ga0068869_1000106968 | 307 |
| 568 | 3300005335 | Ga0070666_10085263 | Ga0070666_100852632 | 307 |
| 569 | 3300005336 | Ga0070680_100012414 | Ga0070680_1000124144 | 307 |
| 570 | 3300005336 | Ga0070680_100015417 | Ga0070680_1000154174 | 307 |
| 571 | 3300005336 | Ga0070680_100038404 | Ga0070680_1000384042 | 307 |
| 572 | 3300005336 | Ga0070680_100355115 | Ga0070680_1003551151 | 307 |
| 573 | 3300005337 | Ga0070682_100000097 | Ga0070682_10000009755 | 307 |
| 574 | 3300005339 | Ga0070660_100015375 | Ga0070660_1000153754 | 307 |
| 575 | 3300005339 | Ga0070660_100164391 | Ga0070660_1001643912 | 307 |
| 576 | 3300005340 | Ga0070689_100000971 | Ga0070689_1000009719 | 307 |
| 577 | 3300005340 | Ga0070689_100023305 | Ga0070689_1000233054 | 307 |
| 578 | 3300005343 | Ga0070687_100020341 | Ga0070687_1000203412 | 307 |
| 579 | 3300005344 | Ga0070661_100002637 | Ga0070661_10000263710 | 307 |
| 580 | 3300005345 | Ga0070692_10004829 | Ga0070692_100048294 | 307 |
| 581 | 3300005345 | Ga0070692_10084982 | Ga0070692_100849822 | 307 |
| 582 | 3300005345 | Ga0070692_10117685 | Ga0070692_101176852 | 307 |
| 583 | 3300005353 | Ga0070669_100050269 | Ga0070669_1000502691 | 307 |
| 584 | 3300005353 | Ga0070669_100152728 | Ga0070669_1001527282 | 307 |
| 585 | 3300005355 | Ga0070671_100191147 | Ga0070671_1001911472 | 307 |
| 586 | 3300005365 | Ga0070688_100009809 | Ga0070688_1000098095 | 307 |
| 587 | 3300005366 | Ga0070659_100018737 | Ga0070659_1000187374 | 307 |
| 588 | 3300005406 | Ga0070703_10001834 | Ga0070703_100018347 | 307 |
| 589 | 3300005434 | Ga0070709_10347955 | Ga0070709_103479551 | 307 |
| 590 | 3300005438 | Ga0070701_10000349 | Ga0070701_100003498 | 307 |
| 591 | 3300005438 | Ga0070701_10040834 | Ga0070701_100408343 | 307 |
| 592 | 3300005439 | Ga0070711_100061971 | Ga0070711_1000619712 | 307 |
| 593 | 3300005439 | Ga0070711_100276903 | Ga0070711_1002769032 | 307 |
| 594 | 3300005440 | Ga0070705_100008044 | Ga0070705_1000080444 | 307 |
| 595 | 3300005440 | Ga0070705_100008184 | Ga0070705_1000081845 | 307 |
| 596 | 3300005440 | Ga0070705_100060031 | Ga0070705_1000600312 | 307 |
| 597 | 3300005441 | Ga0070700_100002242 | Ga0070700_1000022428 | 307 |
| 598 | 3300005444 | Ga0070694_100020371 | Ga0070694_1000203712 | 307 |
| 599 | 3300005444 | Ga0070694_100028743 | Ga0070694_1000287432 | 307 |
| 600 | 3300005444 | Ga0070694_100031575 | Ga0070694_1000315753 | 307 |
| 601 | 3300005444 | Ga0070694_100037693 | Ga0070694_1000376933 | 307 |
| 602 | 3300005444 | Ga0070694_100078549 | Ga0070694_1000785492 | 307 |
| 603 | 3300005444 | Ga0070694_100123507 | Ga0070694_1001235071 | 307 |
| 604 | 3300005445 | Ga0070708_100010849 | Ga0070708_1000108496 | 307 |
| 605 | 3300005445 | Ga0070708_100046061 | Ga0070708_1000460613 | 307 |
| 606 | 3300005445 | Ga0070708_100087748 | Ga0070708_1000877482 | 307 |
| 607 | 3300005445 | Ga0070708_100110507 | Ga0070708_1001105073 | 307 |
| 608 | 3300005445 | Ga0070708_100196309 | Ga0070708_1001963092 | 307 |
| 609 | 3300005445 | Ga0070708_100348800 | Ga0070708_1003488002 | 307 |
| 610 | 3300005455 | Ga0070663_100253609 | Ga0070663_1002536092 | 307 |
| 611 | 3300005457 | Ga0070662_100005086 | Ga0070662_1000050865 | 307 |
| 612 | 3300005457 | Ga0070662_100094981 | Ga0070662_1000949812 | 307 |
| 613 | 3300005458 | Ga0070681_10003551 | Ga0070681_100035514 | 307 |
| 614 | 3300005458 | Ga0070681_10023965 | Ga0070681_100239653 | 307 |
| 615 | 3300005458 | Ga0070681_10100089 | Ga0070681_101000891 | 307 |
| 616 | 3300005459 | Ga0068867_100000768 | Ga0068867_10000076820 | 307 |
| 617 | 3300005466 | Ga0070685_10000043 | Ga0070685_100000432 | 307 |
| 618 | 3300005467 | Ga0070706_100000391 | Ga0070706_10000039133 | 307 |
| 619 | 3300005467 | Ga0070706_100001836 | Ga0070706_1000018364 | 307 |
| 620 | 3300005467 | Ga0070706_100004069 | Ga0070706_10000406911 | 307 |
| 621 | 3300005467 | Ga0070706_100009376 | Ga0070706_1000093768 | 307 |
| 622 | 3300005467 | Ga0070706_100020671 | Ga0070706_1000206713 | 307 |
| 623 | 3300005467 | Ga0070706_100030922 | Ga0070706_1000309225 | 307 |
| 624 | 3300005467 | Ga0070706_100053511 | Ga0070706_1000535112 | 307 |
| 625 | 3300005467 | Ga0070706_100092074 | Ga0070706_1000920742 | 307 |
| 626 | 3300005467 | Ga0070706_100322484 | Ga0070706_1003224842 | 307 |
| 627 | 3300005467 | Ga0070706_100662540 | Ga0070706_1006625401 | 307 |
| 628 | 3300005468 | Ga0070707_100000020 | Ga0070707_10000002024 | 307 |
| 629 | 3300005468 | Ga0070707_100004343 | Ga0070707_10000434310 | 307 |
| 630 | 3300005468 | Ga0070707_100026063 | Ga0070707_1000260633 | 307 |
| 631 | 3300005468 | Ga0070707_100028396 | Ga0070707_1000283962 | 307 |
| 632 | 3300005468 | Ga0070707_100034017 | Ga0070707_1000340172 | 307 |
| 633 | 3300005468 | Ga0070707_100036068 | Ga0070707_1000360686 | 307 |
| 634 | 3300005468 | Ga0070707_100062096 | Ga0070707_1000620962 | 307 |
| 635 | 3300005468 | Ga0070707_100089136 | Ga0070707_1000891362 | 307 |
| 636 | 3300005471 | Ga0070698_100005671 | Ga0070698_10000567111 | 307 |
| 637 | 3300005471 | Ga0070698_100014324 | Ga0070698_1000143246 | 307 |
| 638 | 3300005471 | Ga0070698_100057652 | Ga0070698_1000576523 | 307 |
| 639 | 3300005471 | Ga0070698_100106329 | Ga0070698_1001063292 | 307 |
| 640 | 3300005471 | Ga0070698_100115250 | Ga0070698_1001152502 | 307 |
| 641 | 3300005518 | Ga0070699_100005374 | Ga0070699_10000537410 | 307 |
| 642 | 3300005518 | Ga0070699_100007767 | Ga0070699_1000077677 | 307 |
| 643 | 3300005518 | Ga0070699_100018835 | Ga0070699_1000188355 | 307 |
| 644 | 3300005518 | Ga0070699_100023370 | Ga0070699_1000233705 | 307 |
| 645 | 3300005518 | Ga0070699_100037610 | Ga0070699_1000376102 | 307 |
| 646 | 3300005518 | Ga0070699_100042161 | Ga0070699_1000421614 | 307 |
| 647 | 3300005518 | Ga0070699_100045810 | Ga0070699_1000458102 | 307 |
| 648 | 3300005518 | Ga0070699_100079625 | Ga0070699_1000796251 | 307 |
| 649 | 3300005518 | Ga0070699_100112219 | Ga0070699_1001122192 | 307 |
| 650 | 3300005518 | Ga0070699_100124741 | Ga0070699_1001247412 | 307 |
| 651 | 3300005518 | Ga0070699_100557147 | Ga0070699_1005571471 | 307 |
| 652 | 3300005530 | Ga0070679_100000407 | Ga0070679_1000004074 | 307 |
| 653 | 3300005536 | Ga0070697_100002321 | Ga0070697_1000023215 | 307 |
| 654 | 3300005536 | Ga0070697_100023388 | Ga0070697_1000233882 | 307 |
| 655 | 3300005539 | Ga0068853_100022317 | Ga0068853_1000223174 | 307 |
| 656 | 3300005543 | Ga0070672_100046323 | Ga0070672_1000463232 | 307 |
| 657 | 3300005544 | Ga0070686_100001492 | Ga0070686_1000014925 | 307 |
| 658 | 3300005545 | Ga0070695_100000568 | Ga0070695_10000056818 | 307 |
| 659 | 3300005545 | Ga0070695_100002576 | Ga0070695_1000025768 | 307 |
| 660 | 3300005545 | Ga0070695_100004078 | Ga0070695_1000040783 | 307 |
| 661 | 3300005545 | Ga0070695_100015694 | Ga0070695_1000156944 | 307 |
| 662 | 3300005545 | Ga0070695_100028367 | Ga0070695_1000283673 | 307 |
| 663 | 3300005545 | Ga0070695_100134542 | Ga0070695_1001345421 | 307 |
| 664 | 3300005546 | Ga0070696_100000494 | Ga0070696_10000049417 | 307 |
| 665 | 3300005546 | Ga0070696_100004753 | Ga0070696_1000047537 | 307 |
| 666 | 3300005546 | Ga0070696_100014439 | Ga0070696_1000144392 | 307 |
| 667 | 3300005546 | Ga0070696_100063779 | Ga0070696_1000637792 | 307 |
| 668 | 3300005546 | Ga0070696_100417531 | Ga0070696_1004175311 | 307 |
| 669 | 3300005547 | Ga0070693_100000364 | Ga0070693_10000036418 | 307 |
| 670 | 3300005547 | Ga0070693_100067860 | Ga0070693_1000678602 | 307 |
| 671 | 3300005549 | Ga0070704_100002975 | Ga0070704_1000029757 | 307 |
| 672 | 3300005549 | Ga0070704_100057375 | Ga0070704_1000573752 | 307 |
| 673 | 3300005549 | Ga0070704_100217660 | Ga0070704_1002176602 | 307 |
| 674 | 3300005564 | Ga0070664_100000430 | Ga0070664_1000004303 | 307 |
| 675 | 3300005564 | Ga0070664_100023033 | Ga0070664_1000230334 | 307 |
| 676 | 3300005564 | Ga0070664_100115549 | Ga0070664_1001155492 | 307 |
| 677 | 3300005577 | Ga0068857_100025315 | Ga0068857_1000253154 | 307 |
| 678 | 3300005577 | Ga0068857_100037288 | Ga0068857_1000372882 | 307 |
| 679 | 3300005578 | Ga0068854_100002896 | Ga0068854_10000289610 | 307 |
| 680 | 3300005614 | Ga0068856_100031052 | Ga0068856_1000310524 | 307 |
| 681 | 3300005614 | Ga0068856_100194924 | Ga0068856_1001949242 | 307 |
| 682 | 3300005615 | Ga0070702_100062333 | Ga0070702_1000623332 | 307 |
| 683 | 3300005617 | Ga0068859_100000761 | Ga0068859_10000076118 | 307 |
| 684 | 3300005617 | Ga0068859_100003234 | Ga0068859_1000032343 | 307 |
| 685 | 3300005617 | Ga0068859_100115007 | Ga0068859_1001150072 | 307 |
| 686 | 3300005617 | Ga0068859_100141288 | Ga0068859_1001412882 | 307 |
| 687 | 3300005618 | Ga0068864_100006065 | Ga0068864_1000060658 | 307 |
| 688 | 3300005618 | Ga0068864_100102514 | Ga0068864_1001025142 | 307 |
| 689 | 3300005618 | Ga0068864_100186242 | Ga0068864_1001862422 | 307 |
| 690 | 3300005718 | Ga0068866_10065435 | Ga0068866_100654352 | 307 |
| 691 | 3300005840 | Ga0068870_10000344 | Ga0068870_1000034415 | 307 |
| 692 | 3300005841 | Ga0068863_100121331 | Ga0068863_1001213312 | 307 |
| 693 | 3300005842 | Ga0068858_100001091 | Ga0068858_10000109122 | 307 |
| 694 | 3300005842 | Ga0068858_100061352 | Ga0068858_1000613522 | 307 |
| 695 | 3300005843 | Ga0068860_100010570 | Ga0068860_1000105705 | 307 |
| 696 | 3300005843 | Ga0068860_100051349 | Ga0068860_1000513492 | 307 |
| 697 | 3300005843 | Ga0068860_100107032 | Ga0068860_1001070323 | 307 |
| 698 | 3300005843 | Ga0068860_100374998 | Ga0068860_1003749982 | 307 |
| 699 | 3300005844 | Ga0068862_100019969 | Ga0068862_1000199694 | 307 |
| 700 | 3300005844 | Ga0068862_100029327 | Ga0068862_1000293276 | 307 |
| 701 | 3300005844 | Ga0068862_100054687 | Ga0068862_1000546874 | 307 |
| 702 | 3300006163 | Ga0070715_10060210 | Ga0070715_100602102 | 307 |
| 703 | 3300006163 | Ga0070715_10141223 | Ga0070715_101412232 | 307 |
| 704 | 3300006844 | Ga0075428_100046174 | Ga0075428_1000461746 | 307 |
| 705 | 3300006844 | Ga0075428_100107832 | Ga0075428_1001078323 | 307 |
| 706 | 3300006844 | Ga0075428_100388783 | Ga0075428_1003887832 | 307 |
| 707 | 3300006846 | Ga0075430_100003542 | Ga0075430_10000354215 | 307 |
| 708 | 3300006846 | Ga0075430_100005556 | Ga0075430_1000055568 | 307 |
| 709 | 3300006847 | Ga0075431_100000851 | Ga0075431_10000085123 | 307 |
| 710 | 3300006847 | Ga0075431_100025816 | Ga0075431_1000258165 | 307 |
| 711 | 3300006852 | Ga0075433_10004841 | Ga0075433_100048419 | 307 |
| 712 | 3300006852 | Ga0075433_10010307 | Ga0075433_100103076 | 307 |
| 713 | 3300006852 | Ga0075433_10015008 | Ga0075433_100150084 | 307 |
| 714 | 3300006852 | Ga0075433_10019642 | Ga0075433_100196424 | 307 |
| 715 | 3300006852 | Ga0075433_10074610 | Ga0075433_100746104 | 307 |
| 716 | 3300006852 | Ga0075433_10148131 | Ga0075433_101481312 | 307 |
| 717 | 3300006852 | Ga0075433_10148516 | Ga0075433_101485162 | 307 |
| 718 | 3300006852 | Ga0075433_10381077 | Ga0075433_103810771 | 307 |
| 719 | 3300006871 | Ga0075434_100026137 | Ga0075434_1000261377 | 307 |
| 720 | 3300006871 | Ga0075434_100030189 | Ga0075434_1000301895 | 307 |
| 721 | 3300006871 | Ga0075434_100031806 | Ga0075434_1000318062 | 307 |
| 722 | 3300006871 | Ga0075434_100158700 | Ga0075434_1001587001 | 307 |
| 723 | 3300006871 | Ga0075434_100222003 | Ga0075434_1002220032 | 307 |
| 724 | 3300006880 | Ga0075429_100252510 | Ga0075429_1002525102 | 307 |
| 725 | 3300006914 | Ga0075436_100022658 | Ga0075436_1000226584 | 307 |
| 726 | 3300006914 | Ga0075436_100089818 | Ga0075436_1000898182 | 307 |
| 727 | 3300006914 | Ga0075436_100276736 | Ga0075436_1002767362 | 307 |
| 728 | 3300006931 | Ga0097620_100000761 | Ga0097620_10000076118 | 307 |
| 729 | 3300006931 | Ga0097620_100003234 | Ga0097620_1000032343 | 307 |
| 730 | 3300006931 | Ga0097620_100115005 | Ga0097620_1001150052 | 307 |
| 731 | 3300006931 | Ga0097620_100141278 | Ga0097620_1001412782 | 307 |
| 732 | 3300007076 | Ga0075435_100000446 | Ga0075435_10000044616 | 307 |
| 733 | 3300007076 | Ga0075435_100003851 | Ga0075435_10000385110 | 307 |
| 734 | 3300007076 | Ga0075435_100185350 | Ga0075435_1001853502 | 307 |
| 735 | 3300007076 | Ga0075435_100284140 | Ga0075435_1002841402 | 307 |
| 736 | 3300007265 | Ga0099794_10011530 | Ga0099794_100115303 | 307 |
| 737 | 3300009093 | Ga0105240_10566718 | Ga0105240_105667182 | 307 |
| 738 | 3300009094 | Ga0111539_10001558 | Ga0111539_100015586 | 307 |
| 739 | 3300009094 | Ga0111539_10766609 | Ga0111539_107666091 | 307 |
| 740 | 3300009098 | Ga0105245_10025527 | Ga0105245_100255276 | 307 |
| 741 | 3300009101 | Ga0105247_10148426 | Ga0105247_101484262 | 307 |
| 742 | 3300009147 | Ga0114129_10027787 | Ga0114129_100277875 | 307 |
| 743 | 3300009147 | Ga0114129_10146036 | Ga0114129_101460362 | 307 |
| 744 | 3300009147 | Ga0114129_10199380 | Ga0114129_101993803 | 307 |
| 745 | 3300009147 | Ga0114129_10422433 | Ga0114129_104224332 | 307 |
| 746 | 3300009147 | Ga0114129_10485969 | Ga0114129_104859692 | 307 |
| 747 | 3300009148 | Ga0105243_10164009 | Ga0105243_101640092 | 307 |
| 748 | 3300009174 | Ga0105241_10001068 | Ga0105241_100010684 | 307 |
| 749 | 3300009174 | Ga0105241_10410260 | Ga0105241_104102601 | 307 |
| 750 | 3300009176 | Ga0105242_10033889 | Ga0105242_100338895 | 307 |
| 751 | 3300009176 | Ga0105242_10035281 | Ga0105242_100352812 | 307 |
| 752 | 3300009176 | Ga0105242_10058606 | Ga0105242_100586062 | 307 |
| 753 | 3300009177 | Ga0105248_10000669 | Ga0105248_1000066910 | 307 |
| 754 | 3300009177 | Ga0105248_10006680 | Ga0105248_100066808 | 307 |
| 755 | 3300009177 | Ga0105248_10268673 | Ga0105248_102686731 | 307 |
| 756 | 3300009177 | Ga0105248_10517752 | Ga0105248_105177522 | 307 |
| 757 | 3300009545 | Ga0105237_10253022 | Ga0105237_102530222 | 307 |
| 758 | 3300009553 | Ga0105249_10091991 | Ga0105249_100919912 | 307 |
| 759 | 3300009553 | Ga0105249_10380170 | Ga0105249_103801702 | 307 |
| 760 | 3300010375 | Ga0105239_10368387 | Ga0105239_103683871 | 307 |
| 761 | 3300013102 | Ga0157371_10140124 | Ga0157371_101401242 | 307 |
| 762 | 3300013105 | Ga0157369_10051057 | Ga0157369_100510574 | 307 |
| 763 | 3300013105 | Ga0157369_10434513 | Ga0157369_104345131 | 307 |
| 764 | 3300013296 | Ga0157374_10023689 | Ga0157374_100236892 | 307 |
| 765 | 3300013297 | Ga0157378_10662648 | Ga0157378_106626481 | 307 |
| 766 | 3300013306 | Ga0163162_10231379 | Ga0163162_102313792 | 307 |
| 767 | 3300013307 | Ga0157372_10027196 | Ga0157372_100271966 | 307 |
| 768 | 3300013307 | Ga0157372_10206795 | Ga0157372_102067952 | 307 |
| 769 | 3300014326 | Ga0157380_10001115 | Ga0157380_1000111517 | 307 |
| 770 | 3300014969 | Ga0157376_10014517 | Ga0157376_100145173 | 307 |
| 771 | 3300020070 | Ga0206356_10979058 | Ga0206356_109790582 | 307 |
| 772 | 3300025885 | Ga0207653_10003696 | Ga0207653_100036966 | 307 |
| 773 | 3300025885 | Ga0207653_10006461 | Ga0207653_100064612 | 307 |
| 774 | 3300025885 | Ga0207653_10010446 | Ga0207653_100104462 | 307 |
| 775 | 3300025901 | Ga0207688_10016689 | Ga0207688_100166892 | 307 |
| 776 | 3300025905 | Ga0207685_10022880 | Ga0207685_100228802 | 307 |
| 777 | 3300025905 | Ga0207685_10052029 | Ga0207685_100520292 | 307 |
| 778 | 3300025906 | Ga0207699_10099260 | Ga0207699_100992602 | 307 |
| 779 | 3300025907 | Ga0207645_10004388 | Ga0207645_1000438810 | 307 |
| 780 | 3300025907 | Ga0207645_10057553 | Ga0207645_100575533 | 307 |
| 781 | 3300025908 | Ga0207643_10000700 | Ga0207643_1000070018 | 307 |
| 782 | 3300025908 | Ga0207643_10061519 | Ga0207643_100615192 | 307 |
| 783 | 3300025910 | Ga0207684_10000269 | Ga0207684_1000026923 | 307 |
| 784 | 3300025910 | Ga0207684_10002692 | Ga0207684_1000269211 | 307 |
| 785 | 3300025910 | Ga0207684_10008726 | Ga0207684_100087268 | 307 |
| 786 | 3300025910 | Ga0207684_10012203 | Ga0207684_100122036 | 307 |
| 787 | 3300025910 | Ga0207684_10026275 | Ga0207684_100262755 | 307 |
| 788 | 3300025910 | Ga0207684_10030286 | Ga0207684_100302865 | 307 |
| 789 | 3300025910 | Ga0207684_10200471 | Ga0207684_102004711 | 307 |
| 790 | 3300025910 | Ga0207684_10320413 | Ga0207684_103204132 | 307 |
| 791 | 3300025910 | Ga0207684_10409336 | Ga0207684_104093361 | 307 |
| 792 | 3300025911 | Ga0207654_10002375 | Ga0207654_100023753 | 307 |
| 793 | 3300025912 | Ga0207707_10034538 | Ga0207707_100345384 | 307 |
| 794 | 3300025912 | Ga0207707_10082308 | Ga0207707_100823082 | 307 |
| 795 | 3300025916 | Ga0207663_10091313 | Ga0207663_100913132 | 307 |
| 796 | 3300025917 | Ga0207660_10000499 | Ga0207660_1000049923 | 307 |
| 797 | 3300025917 | Ga0207660_10017179 | Ga0207660_100171792 | 307 |
| 798 | 3300025917 | Ga0207660_10118020 | Ga0207660_101180202 | 307 |
| 799 | 3300025918 | Ga0207662_10051744 | Ga0207662_100517443 | 307 |
| 800 | 3300025918 | Ga0207662_10166004 | Ga0207662_101660041 | 307 |
| 801 | 3300025919 | Ga0207657_10002105 | Ga0207657_1000210520 | 307 |
| 802 | 3300025919 | Ga0207657_10004687 | Ga0207657_100046876 | 307 |
| 803 | 3300025920 | Ga0207649_10006972 | Ga0207649_100069725 | 307 |
| 804 | 3300025921 | Ga0207652_10000948 | Ga0207652_100009484 | 307 |
| 805 | 3300025922 | Ga0207646_10000008 | Ga0207646_10000008380 | 307 |
| 806 | 3300025922 | Ga0207646_10000009 | Ga0207646_1000000976 | 307 |
| 807 | 3300025922 | Ga0207646_10001224 | Ga0207646_100012243 | 307 |
| 808 | 3300025922 | Ga0207646_10001278 | Ga0207646_100012784 | 307 |
| 809 | 3300025922 | Ga0207646_10023144 | Ga0207646_100231445 | 307 |
| 810 | 3300025922 | Ga0207646_10035870 | Ga0207646_100358702 | 307 |
| 811 | 3300025922 | Ga0207646_10036164 | Ga0207646_100361644 | 307 |
| 812 | 3300025922 | Ga0207646_10047772 | Ga0207646_100477724 | 307 |
| 813 | 3300025922 | Ga0207646_10050810 | Ga0207646_100508103 | 307 |
| 814 | 3300025922 | Ga0207646_10079634 | Ga0207646_100796342 | 307 |
| 815 | 3300025922 | Ga0207646_10082775 | Ga0207646_100827752 | 307 |
| 816 | 3300025922 | Ga0207646_10236558 | Ga0207646_102365582 | 307 |
| 817 | 3300025922 | Ga0207646_10438559 | Ga0207646_104385592 | 307 |
| 818 | 3300025923 | Ga0207681_10064417 | Ga0207681_100644172 | 307 |
| 819 | 3300025923 | Ga0207681_10129560 | Ga0207681_101295602 | 307 |
| 820 | 3300025924 | Ga0207694_10020953 | Ga0207694_100209533 | 307 |
| 821 | 3300025926 | Ga0207659_10222687 | Ga0207659_102226871 | 307 |
| 822 | 3300025928 | Ga0207700_10268570 | Ga0207700_102685702 | 307 |
| 823 | 3300025931 | Ga0207644_10315981 | Ga0207644_103159811 | 307 |
| 824 | 3300025933 | Ga0207706_10010824 | Ga0207706_100108248 | 307 |
| 825 | 3300025933 | Ga0207706_10081167 | Ga0207706_100811672 | 307 |
| 826 | 3300025935 | Ga0207709_10038530 | Ga0207709_100385302 | 307 |
| 827 | 3300025935 | Ga0207709_10150084 | Ga0207709_101500842 | 307 |
| 828 | 3300025936 | Ga0207670_10001774 | Ga0207670_100017742 | 307 |
| 829 | 3300025936 | Ga0207670_10066821 | Ga0207670_100668213 | 307 |
| 830 | 3300025936 | Ga0207670_10123021 | Ga0207670_101230212 | 307 |
| 831 | 3300025941 | Ga0207711_10035703 | Ga0207711_100357034 | 307 |
| 832 | 3300025941 | Ga0207711_10039175 | Ga0207711_100391755 | 307 |
| 833 | 3300025941 | Ga0207711_10100552 | Ga0207711_101005522 | 307 |
| 834 | 3300025942 | Ga0207689_10004812 | Ga0207689_100048124 | 307 |
| 835 | 3300025942 | Ga0207689_10007296 | Ga0207689_100072968 | 307 |
| 836 | 3300025945 | Ga0207679_10008774 | Ga0207679_100087745 | 307 |
| 837 | 3300025945 | Ga0207679_10012799 | Ga0207679_100127992 | 307 |
| 838 | 3300025945 | Ga0207679_10224473 | Ga0207679_102244731 | 307 |
| 839 | 3300025949 | Ga0207667_10000470 | Ga0207667_1000047018 | 307 |
| 840 | 3300025961 | Ga0207712_10090808 | Ga0207712_100908082 | 307 |
| 841 | 3300025961 | Ga0207712_10156610 | Ga0207712_101566101 | 307 |
| 842 | 3300025981 | Ga0207640_10003162 | Ga0207640_100031622 | 307 |
| 843 | 3300025981 | Ga0207640_10383750 | Ga0207640_103837501 | 307 |
| 844 | 3300025986 | Ga0207658_10297645 | Ga0207658_102976452 | 307 |
| 845 | 3300026035 | Ga0207703_10000905 | Ga0207703_1000090510 | 307 |
| 846 | 3300026035 | Ga0207703_10068334 | Ga0207703_100683342 | 307 |
| 847 | 3300026035 | Ga0207703_10088441 | Ga0207703_100884412 | 307 |
| 848 | 3300026041 | Ga0207639_10013924 | Ga0207639_100139244 | 307 |
| 849 | 3300026067 | Ga0207678_10009235 | Ga0207678_100092352 | 307 |
| 850 | 3300026067 | Ga0207678_10285780 | Ga0207678_102857802 | 307 |
| 851 | 3300026075 | Ga0207708_10000205 | Ga0207708_100002055 | 307 |
| 852 | 3300026078 | Ga0207702_10008773 | Ga0207702_100087735 | 307 |
| 853 | 3300026078 | Ga0207702_10169622 | Ga0207702_101696222 | 307 |
| 854 | 3300026088 | Ga0207641_10124712 | Ga0207641_101247122 | 307 |
| 855 | 3300026088 | Ga0207641_10399934 | Ga0207641_103999342 | 307 |
| 856 | 3300026089 | Ga0207648_10018449 | Ga0207648_100184495 | 307 |
| 857 | 3300026089 | Ga0207648_10039482 | Ga0207648_100394823 | 307 |
| 858 | 3300026116 | Ga0207674_10003153 | Ga0207674_100031534 | 307 |
| 859 | 3300026116 | Ga0207674_10011021 | Ga0207674_100110212 | 307 |
| 860 | 3300026116 | Ga0207674_10137713 | Ga0207674_101377132 | 307 |
| 861 | 3300026118 | Ga0207675_100007447 | Ga0207675_10000744710 | 307 |
| 862 | 3300026118 | Ga0207675_100009342 | Ga0207675_1000093427 | 307 |
| 863 | 3300026142 | Ga0207698_10101133 | Ga0207698_101011333 | 307 |
| 864 | 3300027364 | Ga0209967_1004932 | Ga0209967_10049322 | 307 |
| 865 | 3300027378 | Ga0209981_1001519 | Ga0209981_10015192 | 307 |
| 866 | 3300027462 | Ga0210000_1002180 | Ga0210000_10021802 | 307 |
| 867 | 3300027471 | Ga0209995_1001998 | Ga0209995_10019982 | 307 |
| 868 | 3300027526 | Ga0209968_1005761 | Ga0209968_10057612 | 307 |
| 869 | 3300027543 | Ga0209999_1000518 | Ga0209999_10005182 | 307 |
| 870 | 3300027614 | Ga0209970_1000650 | Ga0209970_10006502 | 307 |
| 871 | 3300027682 | Ga0209971_1000004 | Ga0209971_10000046 | 307 |
| 872 | 3300027695 | Ga0209966_1000015 | Ga0209966_100001574 | 307 |
| 873 | 3300027717 | Ga0209998_10000001 | Ga0209998_1000000142 | 307 |
| 874 | 3300027876 | Ga0209974_10000064 | Ga0209974_1000006424 | 307 |
| 875 | 3300027876 | Ga0209974_10008177 | Ga0209974_100081773 | 307 |
| 876 | 3300027907 | Ga0207428_10003135 | Ga0207428_100031357 | 307 |
| 877 | 3300028380 | Ga0268265_10010779 | Ga0268265_100107794 | 307 |
| 878 | 3300028380 | Ga0268265_10015484 | Ga0268265_100154844 | 307 |
| 879 | 3300028380 | Ga0268265_10015621 | Ga0268265_100156213 | 307 |
| 880 | 3300028381 | Ga0268264_10015858 | Ga0268264_100158584 | 307 |
| 881 | 3300031548 | Ga0307408_100600258 | Ga0307408_1006002581 | 307 |
| 882 | 3300031852 | Ga0307410_10319575 | Ga0307410_103195752 | 307 |
| 883 | 3300034817 | Ga0373948_0016233 | Ga0373948_0016233_379_1305 | 307 |
| 884 | 3300035083 | Ga0373926_0039385 | Ga0373926_0039385_339_1262 | 307 |
| 885 | 3300035091 | Ga0373951_0002225 | Ga0373951_0002225_2453_3379 | 307 |
| 886 | 3300035111 | Ga0373923_0109180 | Ga0373923_0109180_157_1080 | 307 |
| 887 | 3300035118 | Ga0373954_0058279 | Ga0373954_0058279_198_1121 | 307 |
| 888 | 3300035241 | Ga0373961_0040972 | Ga0373961_0040972_168_1091 | 307 |
| 889 | 3300037068 | Ga0373925_0147145 | Ga0373925_0147145_824_1747 | 307 |
| 890 | 3300037418 | Ga0395900_0264373 | Ga0395900_0264373_743_1675 | 307 |
| 891 | 3300037853 | Ga0436364_0678702 | Ga0436364_0678702_228_1154 | 307 |
| 892 | 3300038443 | Ga0395901_0159221 | Ga0395901_0159221_618_1550 | 307 |
| 893 | 3300042005 | Ga0439448_0016202 | Ga0439448_0016202_405_1331 | 307 |
| 894 | 3300042008 | Ga0439450_003760 | Ga0439450_003760_1438_2361 | 307 |
| 895 | 3300042012 | Ga0439455_0002711 | Ga0439455_0002711_1243_2169 | 307 |
| 896 | 3300042016 | Ga0439463_016687 | Ga0439463_016687_603_1529 | 307 |
| 897 | 3300042438 | Ga0439459_0004556 | Ga0439459_0004556_622_1548 | 307 |
| 898 | 3300042439 | Ga0439464_0012428 | Ga0439464_0012428_1106_2032 | 307 |
| 899 | 3300042461 | Ga0439460_0004581 | Ga0439460_0004581_150_1073 | 307 |
| 900 | 3300042876 | Ga0451577_0004316 | Ga0451577_0004316_13796_14722 | 307 |
| 901 | 3300042876 | Ga0451577_0012269 | Ga0451577_0012269_3819_4745 | 307 |
| 902 | 3300042876 | Ga0451577_0082367 | Ga0451577_0082367_1702_2628 | 307 |
| 903 | 3300042876 | Ga0451577_0163874 | Ga0451577_0163874_598_1521 | 307 |
| 904 | 3300044673 | Ga0453683_0023217 | Ga0453683_0023217_1395_2321 | 307 |
| 905 | 3300044673 | Ga0453683_0145810 | Ga0453683_0145810_341_1267 | 307 |
| 906 | 3300044694 | Ga0466963_0261127 | Ga0466963_0261127_32_955 | 307 |
| 907 | 3300044712 | Ga0453684_0176257 | Ga0453684_0176257_1038_1964 | 307 |
| 908 | 3300045051 | Ga0451576_0001923 | Ga0451576_0001923_6115_7038 | 307 |
| 909 | 3300045051 | Ga0451576_0008207 | Ga0451576_0008207_4214_5140 | 307 |
| 910 | 3300045051 | Ga0451576_0008636 | Ga0451576_0008636_10936_11862 | 307 |
| 911 | 3300045051 | Ga0451576_0017308 | Ga0451576_0017308_3490_4416 | 307 |
| 912 | 3300045051 | Ga0451576_0045135 | Ga0451576_0045135_1517_2443 | 307 |
| 913 | 3300045051 | Ga0451576_0089180 | Ga0451576_0089180_1928_2854 | 307 |
| 914 | 3300045051 | Ga0451576_0091543 | Ga0451576_0091543_1531_2457 | 307 |
| 915 | 3300046472 | Ga0495580_0090518 | Ga0495580_0090518_50_976 | 307 |
| 916 | 3300046675 | Ga0495657_0010941 | Ga0495657_0010941_4745_5668 | 307 |
| 917 | 3300047322 | Ga0495680_0023425 | Ga0495680_0023425_2571_3494 | 307 |
| 918 | 3300047472 | Ga0495686_0130533 | Ga0495686_0130533_313_1239 | 307 |
| 919 | 3300048905 | Ga0496102_0054937 | Ga0496102_0054937_1055_1978 | 307 |
| 920 | 3300048909 | Ga0496106_0109236 | Ga0496106_0109236_67_993 | 307 |
| 921 | 3300049568 | Ga0501031_0003874 | Ga0501031_0003874_847_1770 | 307 |
| 922 | 3300049568 | Ga0501031_0012400 | Ga0501031_0012400_442_1365 | 307 |
| 923 | 3300049568 | Ga0501031_0255289 | Ga0501031_0255289_165_1091 | 307 |
| 924 | 3300049569 | Ga0501032_0017313 | Ga0501032_0017313_719_1642 | 307 |
| 925 | 3300049569 | Ga0501032_0036714 | Ga0501032_0036714_1517_2440 | 307 |
| 926 | 3300049569 | Ga0501032_0066652 | Ga0501032_0066652_1437_2360 | 307 |
| 927 | 3300049572 | Ga0501036_0033213 | Ga0501036_0033213_2761_3684 | 307 |
| 928 | 3300049572 | Ga0501036_0177934 | Ga0501036_0177934_180_1103 | 307 |
| 929 | 3300049572 | Ga0501036_0354622 | Ga0501036_0354622_23_946 | 307 |
| 930 | 3300049573 | Ga0501037_0023599 | Ga0501037_0023599_216_1139 | 307 |
| 931 | 3300049573 | Ga0501037_0104992 | Ga0501037_0104992_26_949 | 307 |
| 932 | 3300049574 | Ga0501038_0009050 | Ga0501038_0009050_5536_6459 | 307 |
| 933 | 3300049574 | Ga0501038_0110077 | Ga0501038_0110077_379_1302 | 307 |
| 934 | 3300049575 | Ga0501039_0003633 | Ga0501039_0003633_433_1356 | 307 |
| 935 | 3300049575 | Ga0501039_0007824 | Ga0501039_0007824_5111_6034 | 307 |
| 936 | 3300049575 | Ga0501039_0019159 | Ga0501039_0019159_349_1272 | 307 |
| 937 | 3300049575 | Ga0501039_0124248 | Ga0501039_0124248_26_949 | 307 |
| 938 | 3300049575 | Ga0501039_0189157 | Ga0501039_0189157_371_1294 | 307 |
| 939 | 3300049576 | Ga0501040_0000512 | Ga0501040_0000512_7404_8330 | 307 |
| 940 | 3300049576 | Ga0501040_0020172 | Ga0501040_0020172_3315_4238 | 307 |
| 941 | 3300049576 | Ga0501040_0026769 | Ga0501040_0026769_1609_2535 | 307 |
| 942 | 3300049576 | Ga0501040_0062128 | Ga0501040_0062128_250_1173 | 307 |
| 943 | 3300049576 | Ga0501040_0114562 | Ga0501040_0114562_163_1122 | 307 |
| 944 | 3300049577 | Ga0501041_0002285 | Ga0501041_0002285_1268_2191 | 307 |
| 945 | 3300049577 | Ga0501041_0008815 | Ga0501041_0008815_4554_5477 | 307 |
| 946 | 3300049577 | Ga0501041_0069491 | Ga0501041_0069491_1020_1943 | 307 |
| 947 | 3300049578 | Ga0501042_0000917 | Ga0501042_0000917_10038_10961 | 307 |
| 948 | 3300049578 | Ga0501042_0024803 | Ga0501042_0024803_2038_2961 | 307 |
| 949 | 3300049578 | Ga0501042_0065797 | Ga0501042_0065797_1150_2073 | 307 |
| 950 | 3300049578 | Ga0501042_0074824 | Ga0501042_0074824_876_1802 | 307 |
| 951 | 3300049578 | Ga0501042_0184169 | Ga0501042_0184169_503_1429 | 307 |
| 952 | 3300049578 | Ga0501042_0291329 | Ga0501042_0291329_78_1004 | 307 |
| 953 | 3300049579 | Ga0501043_0145053 | Ga0501043_0145053_58_981 | 307 |
| 954 | 3300049580 | Ga0501046_0001204 | Ga0501046_0001204_10525_11451 | 307 |
| 955 | 3300049580 | Ga0501046_0002954 | Ga0501046_0002954_3081_4004 | 307 |
| 956 | 3300049580 | Ga0501046_0006900 | Ga0501046_0006900_4103_5026 | 307 |
| 957 | 3300049581 | Ga0501047_0014228 | Ga0501047_0014228_2953_3879 | 307 |
| 958 | 3300049582 | Ga0501048_0037677 | Ga0501048_0037677_847_1770 | 307 |
| 959 | 3300049582 | Ga0501048_0053158 | Ga0501048_0053158_1197_2123 | 307 |
| 960 | 3300049585 | Ga0501069_0259008 | Ga0501069_0259008_32_958 | 307 |
| 961 | 3300049587 | Ga0501071_0032223 | Ga0501071_0032223_1338_2261 | 307 |
| 962 | 3300049588 | Ga0501072_0080672 | Ga0501072_0080672_1204_2127 | 307 |
| 963 | 3300049588 | Ga0501072_0220338 | Ga0501072_0220338_377_1303 | 307 |
| 964 | 3300049590 | Ga0501074_0025679 | Ga0501074_0025679_1529_2455 | 307 |
| 965 | 3300049591 | Ga0501075_0011886 | Ga0501075_0011886_1992_2918 | 307 |
| 966 | 3300049591 | Ga0501075_0074850 | Ga0501075_0074850_1497_2423 | 307 |
| 967 | 3300049591 | Ga0501075_0092305 | Ga0501075_0092305_177_1100 | 307 |
| 968 | 3300049591 | Ga0501075_0265261 | Ga0501075_0265261_26_949 | 307 |
| 969 | 3300049592 | Ga0501076_0063490 | Ga0501076_0063490_1440_2363 | 307 |
| 970 | 3300049593 | Ga0501077_0014715 | Ga0501077_0014715_2899_3822 | 307 |
| 971 | 3300049593 | Ga0501077_0039691 | Ga0501077_0039691_1954_2880 | 307 |
| 972 | 3300049593 | Ga0501077_0126292 | Ga0501077_0126292_37_960 | 307 |
| 973 | 3300049741 | Ga0501079_0001699 | Ga0501079_0001699_4363_5289 | 307 |
| 974 | 3300049741 | Ga0501079_0021213 | Ga0501079_0021213_1479_2402 | 307 |
| 975 | 3300049741 | Ga0501079_0031997 | Ga0501079_0031997_1129_2055 | 307 |
| 976 | 3300049742 | Ga0501080_0003623 | Ga0501080_0003623_11230_12156 | 307 |
| 977 | 3300049742 | Ga0501080_0199832 | Ga0501080_0199832_674_1597 | 307 |
| 978 | 3300049743 | Ga0501081_0004362 | Ga0501081_0004362_2525_3451 | 307 |
| 979 | 3300049743 | Ga0501081_0026058 | Ga0501081_0026058_2776_3702 | 307 |
| 980 | 3300049822 | Ga0501035_0001442 | Ga0501035_0001442_15388_16311 | 307 |
| 981 | 3300049822 | Ga0501035_0052717 | Ga0501035_0052717_1141_2064 | 307 |
| 982 | 3300049822 | Ga0501035_0199832 | Ga0501035_0199832_497_1420 | 307 |
| 983 | 3300049822 | Ga0501035_0279988 | Ga0501035_0279988_229_1155 | 307 |
| 984 | 3300049824 | Ga0501045_0003582 | Ga0501045_0003582_4085_5011 | 307 |
| 985 | 3300050507 | nmdc:mga05p37_13930_c1 | nmdc:mga05p37_13930_c1_13_939 | 307 |
| 986 | 3300050507 | nmdc:mga05p37_20359_c1 | nmdc:mga05p37_20359_c1_5909_6835 | 307 |
| 987 | 3300050507 | nmdc:mga05p37_23285_c1 | nmdc:mga05p37_23285_c1_4913_5839 | 307 |
| 988 | 3300050507 | nmdc:mga05p37_60523_c1 | nmdc:mga05p37_60523_c1_2823_3746 | 307 |
| 989 | 3300050508 | nmdc:mga09592_199419_c1 | nmdc:mga09592_199419_c1_193_1116 | 307 |
| 990 | 3300050508 | nmdc:mga09592_44143_c1 | nmdc:mga09592_44143_c1_2105_3031 | 307 |
| 991 | 3300050509 | nmdc:mga0qj67_2178_c1 | nmdc:mga0qj67_2178_c1_11105_12028 | 307 |
| 992 | 3300050509 | nmdc:mga0qj67_25258_c1 | nmdc:mga0qj67_25258_c1_2273_3244 | 307 |
| 993 | 3300050509 | nmdc:mga0qj67_4550_c1 | nmdc:mga0qj67_4550_c1_5449_6372 | 307 |
| 994 | 3300050510 | nmdc:mga06r32_54648_c1 | nmdc:mga06r32_54648_c1_265_1188 | 307 |
| 995 | 3300050510 | nmdc:mga06r32_793_c1 | nmdc:mga06r32_793_c1_22575_23501 | 307 |
| 996 | 3300050511 | nmdc:mga08y16_11348_c1 | nmdc:mga08y16_11348_c1_3962_4888 | 307 |
| 997 | 3300050511 | nmdc:mga08y16_68134_c1 | nmdc:mga08y16_68134_c1_991_1965 | 307 |
| 998 | 3300050512 | nmdc:mga0n895_3829_c1 | nmdc:mga0n895_3829_c1_1337_2326 | 307 |
| 999 | 3300050512 | nmdc:mga0n895_40877_c1 | nmdc:mga0n895_40877_c1_213_1184 | 307 |
| 1000 | 3300050512 | nmdc:mga0n895_52828_c1 | nmdc:mga0n895_52828_c1_2382_3308 | 307 |
| 1001 | 3300050512 | nmdc:mga0n895_70708_c1 | nmdc:mga0n895_70708_c1_2487_3413 | 307 |
| 1002 | 3300050512 | nmdc:mga0n895_83910_c1 | nmdc:mga0n895_83910_c1_1353_2327 | 307 |
| 1003 | 3300050512 | nmdc:mga0n895_85574_c1 | nmdc:mga0n895_85574_c1_633_1559 | 307 |
| 1004 | 3300050512 | nmdc:mga0n895_9015_c1 | nmdc:mga0n895_9015_c1_6350_7276 | 307 |
| 1005 | 3300050513 | nmdc:mga0rr50_2512_c1 | nmdc:mga0rr50_2512_c1_6669_7595 | 307 |
| 1006 | 3300050513 | nmdc:mga0rr50_292_c1 | nmdc:mga0rr50_292_c1_11033_12022 | 307 |
| 1007 | 3300050514 | nmdc:mga08x19_193898_c1 | nmdc:mga08x19_193898_c1_104_1093 | 307 |
| 1008 | 3300050514 | nmdc:mga08x19_2471_c1 | nmdc:mga08x19_2471_c1_5690_6616 | 307 |
| 1009 | 3300050514 | nmdc:mga08x19_46783_c1 | nmdc:mga08x19_46783_c1_19_1008 | 307 |
| 1010 | 3300050515 | nmdc:mga0a205_10167_c1 | nmdc:mga0a205_10167_c1_515_1486 | 307 |
| 1011 | 3300050515 | nmdc:mga0a205_1241_c2 | nmdc:mga0a205_1241_c2_4510_5436 | 307 |
| 1012 | 3300050515 | nmdc:mga0a205_14524_c1 | nmdc:mga0a205_14524_c1_4083_5009 | 307 |
| 1013 | 3300050515 | nmdc:mga0a205_145326_c1 | nmdc:mga0a205_145326_c1_638_1612 | 307 |
| 1014 | 3300050515 | nmdc:mga0a205_21_c1 | nmdc:mga0a205_21_c1_19010_19999 | 307 |
| 1015 | 3300050515 | nmdc:mga0a205_41076_c1 | nmdc:mga0a205_41076_c1_1437_2363 | 307 |
| 1016 | 3300050515 | nmdc:mga0a205_45207_c1 | nmdc:mga0a205_45207_c1_1190_2116 | 307 |
| 1017 | 3300050515 | nmdc:mga0a205_6584_c1 | nmdc:mga0a205_6584_c1_7126_8052 | 307 |
| 1018 | 3300050515 | nmdc:mga0a205_88257_c1 | nmdc:mga0a205_88257_c1_463_1386 | 307 |
| 1019 | 3300054114 | Ga0501084_0006546 | Ga0501084_0006546_6658_7584 | 307 |
| 1020 | 3300054114 | Ga0501084_0140153 | Ga0501084_0140153_1080_2006 | 307 |
| 1021 | 3300060353 | Ga0501082_0001216 | Ga0501082_0001216_16567_17493 | 307 |
| 1022 | 3300060353 | Ga0501082_0005907 | Ga0501082_0005907_8233_9159 | 307 |
| 1023 | 3300061734 | Ga0530510_0172160 | Ga0530510_0172160_99_1022 | 307 |
| 1024 | 3300003203 | JGI25406J46586_10019328 | JGI25406J46586_100193283 | 308 |
| 1025 | 3300004798 | Ga0058859_10053121 | Ga0058859_100531211 | 308 |
| 1026 | 3300004801 | Ga0058860_10029594 | Ga0058860_100295941 | 308 |
| 1027 | 3300005330 | Ga0070690_100424453 | Ga0070690_1004244531 | 308 |
| 1028 | 3300005338 | Ga0068868_100257569 | Ga0068868_1002575692 | 308 |
| 1029 | 3300005343 | Ga0070687_100252090 | Ga0070687_1002520901 | 308 |
| 1030 | 3300005356 | Ga0070674_100097527 | Ga0070674_1000975271 | 308 |
| 1031 | 3300005367 | Ga0070667_100223344 | Ga0070667_1002233441 | 308 |
| 1032 | 3300005441 | Ga0070700_100147430 | Ga0070700_1001474302 | 308 |
| 1033 | 3300005466 | Ga0070685_10198984 | Ga0070685_101989841 | 308 |
| 1034 | 3300005544 | Ga0070686_100146197 | Ga0070686_1001461972 | 308 |
| 1035 | 3300005549 | Ga0070704_100098361 | Ga0070704_1000983611 | 308 |
| 1036 | 3300005719 | Ga0068861_100132965 | Ga0068861_1001329651 | 308 |
| 1037 | 3300005842 | Ga0068858_100555662 | Ga0068858_1005556621 | 308 |
| 1038 | 3300005843 | Ga0068860_100139437 | Ga0068860_1001394371 | 308 |
| 1039 | 3300005985 | Ga0081539_10000964 | Ga0081539_1000096436 | 308 |
| 1040 | 3300006844 | Ga0075428_100153399 | Ga0075428_1001533992 | 308 |
| 1041 | 3300006847 | Ga0075431_100115185 | Ga0075431_1001151852 | 308 |
| 1042 | 3300009094 | Ga0111539_10115067 | Ga0111539_101150673 | 308 |
| 1043 | 3300009101 | Ga0105247_10042439 | Ga0105247_100424392 | 308 |
| 1044 | 3300009147 | Ga0114129_10236374 | Ga0114129_102363743 | 308 |
| 1045 | 3300009553 | Ga0105249_10045467 | Ga0105249_100454674 | 308 |
| 1046 | 3300011119 | Ga0105246_10057039 | Ga0105246_100570392 | 308 |
| 1047 | 3300013306 | Ga0163162_10256566 | Ga0163162_102565662 | 308 |
| 1048 | 3300013308 | Ga0157375_10307609 | Ga0157375_103076091 | 308 |
| 1049 | 3300014325 | Ga0163163_10127622 | Ga0163163_101276222 | 308 |
| 1050 | 3300014326 | Ga0157380_10073658 | Ga0157380_100736581 | 308 |
| 1051 | 3300025961 | Ga0207712_10343860 | Ga0207712_103438601 | 308 |
| 1052 | 3300026075 | Ga0207708_10022381 | Ga0207708_100223813 | 308 |
| 1053 | 3300026118 | Ga0207675_100276423 | Ga0207675_1002764232 | 308 |
| 1054 | 3300028381 | Ga0268264_10106212 | Ga0268264_101062122 | 308 |
| 1055 | 3300050510 | nmdc:mga06r32_92773_c1 | nmdc:mga06r32_92773_c1_1854_2780 | 308 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1w8s-assembly1.cif.gz_A | the mechanism of the schiff base forming fructose-1,6-bisphosphate aldolase: structural analysis of reaction intermediates | 0.938 | 22 | 303 |
| 2yce-assembly1.cif.gz_E | structure of an archaeal fructose-1,6-bisphosphate aldolase with the catalytic lys covalently bound to the carbinolamine intermediate of the substrate. | 0.936 | 22 | 308 |
| 2qjg-assembly2.cif.gz_S | m. jannaschii adh synthase complexed with f1,6p | 0.9353 | 16 | 308 |
| 1ok6-assembly1.cif.gz_A | orthorhombic crystal form of an archaeal fructose 1,6-bisphosphate aldolase | 0.9349 | 22 | 307 |
| 2qjg-assembly1.cif.gz_O | m. jannaschii adh synthase complexed with f1,6p | 0.9313 | 16 | 308 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ok6A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9349 | 22 | 307 | 3.20.20.70 |
| 1ok6A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9208 | 22 | 307 | 3.20.20.70 |
| 2qjgK00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9142 | 22 | 308 | 3.20.20.70 |
| af_P0A991_40_348_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9137 | 15 | 304 | 3.20.20.70 |
| 3glcA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.887 | 11 | 308 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1J0I3Z2-F1-model_v4 | fructose-bisphosphate aldolase (EC 4.1.2.13) | 1.002 | 124 | 213 |
GO:0016829
|
| AF-A0A1J0I4I1-F1-model_v4 | fructose-bisphosphate aldolase (EC 4.1.2.13) | 0.9988 | 133 | 208 |
GO:0016829
|
| AF-A0A1Q7ANT5-F1-model_v4 | fructose-bisphosphate aldolase (EC 4.1.2.13) | 0.9984 | 1 | 206 |
GO:0016829
|
| AF-A0A535AHM2-F1-model_v4 | fructose-bisphosphate aldolase (EC 4.1.2.13) | 0.998 | 1 | 248 |
GO:0004332
|
| AF-A0A2V6U933-F1-model_v4 | fructose-bisphosphate aldolase (EC 4.1.2.13) | 0.9976 | 1 | 308 |
GO:0004332
GO:0005737 GO:0042132 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar