F489145

General Info

Members Datasets Scaffolds Average Seq Length
1055 362 1054 307

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100098434|Ga0070699_1000984342
Length 350
Sequence MLLWQGTRYSRVFEVDLIGDTIQTAMLLWPIVVLVEERKRNKPMNDRIREILSWYASENPGVRTNLARMLNHGRLGGTGKMVILPVDQGFEHGPARSFAPNPAGYDPRYHFQLAIEAGCNAYAAPLGFLEAGVSDYSGDIPLILKCNNHDLLNDERDPISAVTAGVGDALRLGCVAVGFTIYPGSAQSTEMYQQLRELAEEAKAVGLAVVVWSYPRGSSLSKEGETAVDVVAYAAQIAAQLGANIIKVKLPSEHVELAEAQKVYQKYEIPIATLADRVRHVVQSSFDGRRIVIFSGGTYAADETFFEEVRAIRDGGGFGSIIGRNSFQRKKPEALKFLDTVMRIYEGSSG

Samples

Sample ID Description Type Environment
1 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
127 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
134 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
209 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
210 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
211 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
212 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
213 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
214 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
215 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
216 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
217 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
218 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
219 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
220 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
221 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
222 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
225 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
226 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
227 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
228 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
229 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
230 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
231 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
232 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
233 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
235 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
236 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
237 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
239 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
240 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
241 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
242 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
243 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
244 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
245 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
246 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
250 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
253 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
254 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
255 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
256 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
257 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
258 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
259 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
260 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
261 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
262 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
263 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
264 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
265 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
266 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
267 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
268 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
269 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
270 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
271 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
272 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
273 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
274 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
275 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
276 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
277 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
278 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
279 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
280 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
281 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
282 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
283 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
284 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
285 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
286 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
287 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
288 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
289 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
292 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
293 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
296 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
297 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
298 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
299 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
300 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
301 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
316 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
334 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
335 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
336 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
337 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
338 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
339 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
340 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
341 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
342 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
343 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
344 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
345 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
346 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
349 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
350 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
351 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
352 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
353 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
356 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
357 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
358 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
359 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
360 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
361 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
362 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.98
Metatranscriptomes 4.93
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 1.52
Rhizosphere 96.78
Stem 0
Stem Tuber 0
Unclassified 1.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10019328 3300003203 Bacteria 2779
2 JGI25406J46586_10026155 3300003203 Bacteria 2255
3 JGI25165J46597_1002109 3300003214 Bacteria 7238
4 Ga0058859_10053121 3300004798 Bacteria 1722
5 Ga0058863_11416325 3300004799 Bacteria 1196
6 Ga0058861_11397491 3300004800 Bacteria 1193
7 Ga0058860_10025827 3300004801 Bacteria 1016
8 Ga0058860_10029594 3300004801 Bacteria 1201
9 Ga0065707_10089909 3300005295 Bacteria 4243
10 Ga0065707_10168871 3300005295 Bacteria 1500
11 Ga0070658_10012641 3300005327 Bacteria 6771
12 Ga0070658_10039295 3300005327 Bacteria 3816
13 Ga0070676_10014988 3300005328 Bacteria 4268
14 Ga0070690_100005668 3300005330 Bacteria 7027
15 Ga0070690_100184434 3300005330 Bacteria 1443
16 Ga0070690_100424453 3300005330 Bacteria 981
17 Ga0070670_100038399 3300005331 Bacteria 4117
18 Ga0070670_100166903 3300005331 Bacteria 1909
19 Ga0068869_100001552 3300005334 Bacteria 13642
20 Ga0068869_100009551 3300005334 Bacteria 6298
21 Ga0068869_100010696 3300005334 Bacteria 5992
22 Ga0070666_10009701 3300005335 Bacteria 6013
23 Ga0070666_10085263 3300005335 Bacteria 2163
24 Ga0070680_100012414 3300005336 Bacteria 6619
25 Ga0070680_100015417 3300005336 Bacteria 5991
26 Ga0070680_100038404 3300005336 Bacteria 3872
27 Ga0070680_100148742 3300005336 Bacteria 1966
28 Ga0070680_100187879 3300005336 Bacteria 1741
29 Ga0070680_100355115 3300005336 Bacteria 1247
30 Ga0070682_100000097 3300005337 Bacteria 78598
31 Ga0068868_100039181 3300005338 Bacteria 3681
32 Ga0068868_100257569 3300005338 Bacteria 1470
33 Ga0070660_100015375 3300005339 Bacteria 5523
34 Ga0070660_100025395 3300005339 Bacteria 4404
35 Ga0070660_100164391 3300005339 Bacteria 1790
36 Ga0070689_100000971 3300005340 Bacteria 17911
37 Ga0070689_100023305 3300005340 Bacteria 4633
38 Ga0070691_10000879 3300005341 Bacteria 12199
39 Ga0070687_100020341 3300005343 Bacteria 3102
40 Ga0070687_100252090 3300005343 Bacteria 1097
41 Ga0070661_100002637 3300005344 Bacteria 12268
42 Ga0070661_100016783 3300005344 Bacteria 5183
43 Ga0070692_10004829 3300005345 Bacteria 5668
44 Ga0070692_10084982 3300005345 Bacteria 1711
45 Ga0070692_10117685 3300005345 Bacteria 1478
46 Ga0070668_100028216 3300005347 Bacteria 4262
47 Ga0070668_100082232 3300005347 Bacteria 2526
48 Ga0070669_100006746 3300005353 Bacteria 8266
49 Ga0070669_100050269 3300005353 Bacteria 3045
50 Ga0070669_100152728 3300005353 Bacteria 1788
51 Ga0070675_100394146 3300005354 Bacteria 1234
52 Ga0070671_100042819 3300005355 Bacteria 3764
53 Ga0070671_100191147 3300005355 Bacteria 1735
54 Ga0070674_100020471 3300005356 Bacteria 4228
55 Ga0070674_100097527 3300005356 Bacteria 2135
56 Ga0070673_100005770 3300005364 Bacteria 7969
57 Ga0070688_100009809 3300005365 Bacteria 5262
58 Ga0070659_100002525 3300005366 Bacteria 12997
59 Ga0070659_100018737 3300005366 Bacteria 5225
60 Ga0070659_100154236 3300005366 Bacteria 1875
61 Ga0070667_100223344 3300005367 Bacteria 1677
62 Ga0070703_10001834 3300005406 Bacteria 6262
63 Ga0070709_10347955 3300005434 Bacteria 1094
64 Ga0070713_100185657 3300005436 Bacteria 1871
65 Ga0070701_10000349 3300005438 Bacteria 15321
66 Ga0070701_10040834 3300005438 Bacteria 2360
67 Ga0070711_100061971 3300005439 Bacteria 2606
68 Ga0070711_100276903 3300005439 Bacteria 1326
69 Ga0070705_100008044 3300005440 Bacteria 5214
70 Ga0070705_100008184 3300005440 Bacteria 5171
71 Ga0070705_100060031 3300005440 Bacteria 2254
72 Ga0070700_100002242 3300005441 Bacteria 9839
73 Ga0070700_100147430 3300005441 Bacteria 1606
74 Ga0070694_100020371 3300005444 Bacteria 4227
75 Ga0070694_100028743 3300005444 Bacteria 3620
76 Ga0070694_100031575 3300005444 Bacteria 3473
77 Ga0070694_100037693 3300005444 Bacteria 3207
78 Ga0070694_100057405 3300005444 Bacteria 2646
79 Ga0070694_100078549 3300005444 Bacteria 2289
80 Ga0070694_100123507 3300005444 Bacteria 1860
81 Ga0070694_100341377 3300005444 Bacteria 1158
82 Ga0070708_100010383 3300005445 Bacteria 7545
83 Ga0070708_100010849 3300005445 Bacteria 7402
84 Ga0070708_100020404 3300005445 Bacteria 5587
85 Ga0070708_100046061 3300005445 Bacteria 3846
86 Ga0070708_100046121 3300005445 Bacteria 3845
87 Ga0070708_100087748 3300005445 Bacteria 2827
88 Ga0070708_100110507 3300005445 Bacteria 2526
89 Ga0070708_100196309 3300005445 Unclassified 1888
90 Ga0070708_100348800 3300005445 Bacteria 1395
91 Ga0070663_100253609 3300005455 Bacteria 1393
92 Ga0070678_100005733 3300005456 Bacteria 7216
93 Ga0070678_100037471 3300005456 Bacteria 3406
94 Ga0070662_100005086 3300005457 Bacteria 8377
95 Ga0070662_100021182 3300005457 Bacteria 4437
96 Ga0070662_100094981 3300005457 Bacteria 2246
97 Ga0070681_10000261 3300005458 Bacteria 42065
98 Ga0070681_10003551 3300005458 Bacteria 14627
99 Ga0070681_10023965 3300005458 Bacteria 6145
100 Ga0070681_10100089 3300005458 Bacteria 2845
101 Ga0068867_100000768 3300005459 Bacteria 21657
102 Ga0070685_10000043 3300005466 Bacteria 75315
103 Ga0070685_10198984 3300005466 Bacteria 1301
104 Ga0070706_100000391 3300005467 Bacteria 52742
105 Ga0070706_100001836 3300005467 Bacteria 21992
106 Ga0070706_100004069 3300005467 Bacteria 14214
107 Ga0070706_100009376 3300005467 Bacteria 9113
108 Ga0070706_100016786 3300005467 Bacteria 6763
109 Ga0070706_100020671 3300005467 Bacteria 6066
110 Ga0070706_100022592 3300005467 Bacteria 5791
111 Ga0070706_100030922 3300005467 Bacteria 4936
112 Ga0070706_100053511 3300005467 Bacteria 3726
113 Ga0070706_100092074 3300005467 Bacteria 2812
114 Ga0070706_100196461 3300005467 Bacteria 1884
115 Ga0070706_100214816 3300005467 Bacteria 1795
116 Ga0070706_100322484 3300005467 Bacteria 1440
117 Ga0070706_100662540 3300005467 Bacteria 969
118 Ga0070707_100000020 3300005468 Bacteria 130967
119 Ga0070707_100003627 3300005468 Bacteria 14563
120 Ga0070707_100004343 3300005468 Bacteria 13280
121 Ga0070707_100026063 3300005468 Bacteria 5548
122 Ga0070707_100028396 3300005468 Bacteria 5325
123 Ga0070707_100034017 3300005468 Bacteria 4862
124 Ga0070707_100036068 3300005468 Bacteria 4717
125 Ga0070707_100062096 3300005468 Bacteria 3584
126 Ga0070707_100089136 3300005468 Bacteria 2984
127 Ga0070707_100117473 3300005468 Bacteria 2581
128 Ga0070707_100117749 3300005468 Bacteria 2578
129 Ga0070707_100188419 3300005468 Bacteria 2011
130 Ga0070707_100268561 3300005468 Bacteria 1659
131 Ga0070698_100004971 3300005471 Bacteria 14568
132 Ga0070698_100005671 3300005471 Bacteria 13667
133 Ga0070698_100014324 3300005471 Bacteria 8381
134 Ga0070698_100057652 3300005471 Bacteria 3930
135 Ga0070698_100076866 3300005471 Bacteria 3339
136 Ga0070698_100106329 3300005471 Bacteria 2775
137 Ga0070698_100115250 3300005471 Bacteria 2652
138 Ga0070698_100138311 3300005471 Bacteria 2388
139 Ga0070699_100001508 3300005518 Bacteria 21294
140 Ga0070699_100004696 3300005518 Bacteria 12083
141 Ga0070699_100005374 3300005518 Bacteria 11237
142 Ga0070699_100007767 3300005518 Bacteria 9322
143 Ga0070699_100018835 3300005518 Bacteria 5930
144 Ga0070699_100023370 3300005518 Bacteria 5324
145 Ga0070699_100037610 3300005518 Bacteria 4190
146 Ga0070699_100042161 3300005518 Bacteria 3949
147 Ga0070699_100045810 3300005518 Bacteria 3785
148 Ga0070699_100079625 3300005518 Bacteria 2854
149 Ga0070699_100098434 3300005518 Bacteria 2563
150 Ga0070699_100112219 3300005518 Bacteria 2394
151 Ga0070699_100124741 3300005518 Bacteria 2266
152 Ga0070699_100180049 3300005518 Bacteria 1875
153 Ga0070699_100233214 3300005518 Bacteria 1641
154 Ga0070699_100557147 3300005518 Bacteria 1044
155 Ga0070679_100000407 3300005530 Bacteria 36623
156 Ga0070679_100001058 3300005530 Bacteria 24000
157 Ga0070679_100020319 3300005530 Bacteria 6472
158 Ga0070697_100002321 3300005536 Bacteria 14620
159 Ga0070697_100019444 3300005536 Bacteria 5365
160 Ga0070697_100023388 3300005536 Bacteria 4913
161 Ga0070697_100040774 3300005536 Bacteria 3757
162 Ga0070697_100052264 3300005536 Bacteria 3320
163 Ga0070697_100132525 3300005536 Bacteria 2091
164 Ga0070697_100187477 3300005536 Bacteria 1755
165 Ga0068853_100000307 3300005539 Bacteria 34337
166 Ga0068853_100002929 3300005539 Bacteria 12979
167 Ga0068853_100022317 3300005539 Bacteria 5285
168 Ga0068853_100067438 3300005539 Bacteria 3109
169 Ga0070672_100010471 3300005543 Bacteria 6432
170 Ga0070672_100046323 3300005543 Bacteria 3369
171 Ga0070672_100282416 3300005543 Bacteria 1404
172 Ga0070686_100001492 3300005544 Bacteria 13175
173 Ga0070686_100007508 3300005544 Bacteria 6085
174 Ga0070686_100146197 3300005544 Bacteria 1651
175 Ga0070695_100000568 3300005545 Bacteria 19470
176 Ga0070695_100002576 3300005545 Bacteria 10465
177 Ga0070695_100004078 3300005545 Bacteria 8542
178 Ga0070695_100015694 3300005545 Bacteria 4576
179 Ga0070695_100028367 3300005545 Bacteria 3473
180 Ga0070695_100134542 3300005545 Bacteria 1707
181 Ga0070696_100000494 3300005546 Bacteria 24818
182 Ga0070696_100004753 3300005546 Bacteria 9071
183 Ga0070696_100014439 3300005546 Bacteria 5297
184 Ga0070696_100063779 3300005546 Bacteria 2581
185 Ga0070696_100090442 3300005546 Bacteria 2178
186 Ga0070696_100122392 3300005546 Bacteria 1884
187 Ga0070696_100417531 3300005546 Bacteria 1052
188 Ga0070693_100000364 3300005547 Bacteria 20532
189 Ga0070693_100067860 3300005547 Bacteria 2092
190 Ga0070693_100266262 3300005547 Bacteria 1142
191 Ga0070665_100017807 3300005548 Bacteria 7132
192 Ga0070665_100051807 3300005548 Bacteria 4116
193 Ga0070665_100229860 3300005548 Bacteria 1855
194 Ga0070665_100638668 3300005548 Bacteria 1078
195 Ga0070704_100002975 3300005549 Bacteria 9631
196 Ga0070704_100036807 3300005549 Bacteria 3337
197 Ga0070704_100057375 3300005549 Bacteria 2768
198 Ga0070704_100098361 3300005549 Bacteria 2198
199 Ga0070704_100133106 3300005549 Bacteria 1930
200 Ga0070704_100217660 3300005549 Bacteria 1551
201 Ga0070704_100313730 3300005549 Unclassified 1311
202 Ga0070704_100357219 3300005549 Bacteria 1235
203 Ga0068855_100154889 3300005563 Bacteria 2604
204 Ga0070664_100000430 3300005564 Bacteria 31417
205 Ga0070664_100012636 3300005564 Bacteria 6873
206 Ga0070664_100023033 3300005564 Bacteria 5139
207 Ga0070664_100089188 3300005564 Bacteria 2668
208 Ga0070664_100115549 3300005564 Bacteria 2345
209 Ga0068857_100002928 3300005577 Bacteria 14074
210 Ga0068857_100025315 3300005577 Bacteria 5225
211 Ga0068857_100037288 3300005577 Bacteria 4305
212 Ga0068854_100002896 3300005578 Bacteria 10659
213 Ga0068856_100031052 3300005614 Bacteria 5225
214 Ga0068856_100194924 3300005614 Bacteria 2040
215 Ga0070702_100062333 3300005615 Bacteria 2174
216 Ga0068859_100000761 3300005617 Bacteria 32461
217 Ga0068859_100003234 3300005617 Bacteria 16590
218 Ga0068859_100115007 3300005617 Bacteria 2755
219 Ga0068859_100141288 3300005617 Bacteria 2481
220 Ga0068864_100006065 3300005618 Bacteria 9918
221 Ga0068864_100102514 3300005618 Bacteria 2540
222 Ga0068864_100186242 3300005618 Bacteria 1900
223 Ga0068866_10065435 3300005718 Bacteria 1901
224 Ga0068861_100053699 3300005719 Bacteria 3067
225 Ga0068861_100132965 3300005719 Bacteria 2021
226 Ga0068870_10000344 3300005840 Bacteria 17399
227 Ga0068863_100091308 3300005841 Bacteria 2888
228 Ga0068863_100121331 3300005841 Bacteria 2493
229 Ga0068858_100001091 3300005842 Bacteria 28097
230 Ga0068858_100061352 3300005842 Bacteria 3476
231 Ga0068858_100555662 3300005842 Bacteria 1111
232 Ga0068860_100004991 3300005843 Bacteria 13519
233 Ga0068860_100010570 3300005843 Bacteria 9118
234 Ga0068860_100051349 3300005843 Bacteria 3923
235 Ga0068860_100107032 3300005843 Bacteria 2672
236 Ga0068860_100139437 3300005843 Bacteria 2330
237 Ga0068860_100232421 3300005843 Bacteria 1792
238 Ga0068860_100374998 3300005843 Bacteria 1404
239 Ga0068862_100019969 3300005844 Bacteria 5592
240 Ga0068862_100029327 3300005844 Bacteria 4636
241 Ga0068862_100054687 3300005844 Bacteria 3417
242 Ga0081455_10260101 3300005937 Bacteria 1264
243 Ga0081538_10049728 3300005981 Bacteria 2540
244 Ga0081539_10000069 3300005985 Bacteria 236854
245 Ga0081539_10000964 3300005985 Bacteria 53913
246 Ga0070717_10328943 3300006028 Bacteria 1363
247 Ga0070715_10060210 3300006163 Bacteria 1664
248 Ga0070715_10141223 3300006163 Bacteria 1170
249 Ga0070716_100103005 3300006173 Bacteria 1754
250 Ga0097621_100027191 3300006237 Bacteria 4497
251 Ga0068871_100011708 3300006358 Bacteria 6441
252 Ga0075428_100001434 3300006844 Bacteria 25452
253 Ga0075428_100001585 3300006844 Bacteria 24368
254 Ga0075428_100046174 3300006844 Bacteria 4785
255 Ga0075428_100066481 3300006844 Bacteria 3947
256 Ga0075428_100107832 3300006844 Bacteria 3035
257 Ga0075428_100123355 3300006844 Bacteria 2820
258 Ga0075428_100153399 3300006844 Bacteria 2502
259 Ga0075428_100388783 3300006844 Bacteria 1495
260 Ga0075430_100000480 3300006846 Bacteria 29854
261 Ga0075430_100003542 3300006846 Bacteria 13074
262 Ga0075430_100003937 3300006846 Bacteria 12528
263 Ga0075430_100005556 3300006846 Bacteria 10650
264 Ga0075430_100016264 3300006846 Bacteria 6335
265 Ga0075430_100100628 3300006846 Bacteria 2414
266 Ga0075430_100153809 3300006846 Bacteria 1915
267 Ga0075431_100000016 3300006847 Bacteria 85421
268 Ga0075431_100000127 3300006847 Bacteria 50561
269 Ga0075431_100000851 3300006847 Bacteria 26781
270 Ga0075431_100020107 3300006847 Bacteria 6819
271 Ga0075431_100023856 3300006847 Bacteria 6262
272 Ga0075431_100025816 3300006847 Bacteria 6022
273 Ga0075431_100047604 3300006847 Bacteria 4421
274 Ga0075431_100074988 3300006847 Bacteria 3491
275 Ga0075431_100115185 3300006847 Bacteria 2775
276 Ga0075431_100200690 3300006847 Bacteria 2041
277 Ga0075431_100211911 3300006847 Bacteria 1979
278 Ga0075433_10002610 3300006852 Bacteria 13744
279 Ga0075433_10004841 3300006852 Bacteria 10525
280 Ga0075433_10006146 3300006852 Bacteria 9464
281 Ga0075433_10010307 3300006852 Bacteria 7495
282 Ga0075433_10015008 3300006852 Bacteria 6342
283 Ga0075433_10019642 3300006852 Bacteria 5634
284 Ga0075433_10053691 3300006852 Bacteria 3514
285 Ga0075433_10074610 3300006852 Bacteria 2984
286 Ga0075433_10148131 3300006852 Bacteria 2087
287 Ga0075433_10148516 3300006852 Bacteria 2085
288 Ga0075433_10381077 3300006852 Bacteria 1245
289 Ga0075434_100026137 3300006871 Bacteria 5717
290 Ga0075434_100030189 3300006871 Bacteria 5337
291 Ga0075434_100031806 3300006871 Bacteria 5203
292 Ga0075434_100044789 3300006871 Bacteria 4389
293 Ga0075434_100068041 3300006871 Bacteria 3547
294 Ga0075434_100158700 3300006871 Bacteria 2282
295 Ga0075434_100222003 3300006871 Bacteria 1909
296 Ga0075429_100002270 3300006880 Bacteria 16114
297 Ga0075429_100051717 3300006880 Bacteria 3574
298 Ga0075429_100052473 3300006880 Bacteria 3548
299 Ga0075429_100064653 3300006880 Bacteria 3186
300 Ga0075429_100142440 3300006880 Bacteria 2099
301 Ga0075429_100147690 3300006880 Bacteria 2058
302 Ga0075429_100189387 3300006880 Bacteria 1803
303 Ga0075429_100252510 3300006880 Bacteria 1544
304 Ga0075429_100354736 3300006880 Bacteria 1284
305 Ga0075436_100000659 3300006914 Bacteria 22772
306 Ga0075436_100022658 3300006914 Bacteria 4315
307 Ga0075436_100035050 3300006914 Bacteria 3462
308 Ga0075436_100067033 3300006914 Bacteria 2481
309 Ga0075436_100089818 3300006914 Bacteria 2135
310 Ga0075436_100143999 3300006914 Bacteria 1676
311 Ga0075436_100209882 3300006914 Bacteria 1380
312 Ga0075436_100276736 3300006914 Bacteria 1199
313 Ga0097620_100000761 3300006931 Bacteria 32461
314 Ga0097620_100003234 3300006931 Bacteria 16590
315 Ga0097620_100115005 3300006931 Bacteria 2755
316 Ga0097620_100141278 3300006931 Bacteria 2481
317 Ga0075435_100000446 3300007076 Bacteria 25321
318 Ga0075435_100003851 3300007076 Bacteria 10230
319 Ga0075435_100185350 3300007076 Bacteria 1760
320 Ga0075435_100284140 3300007076 Bacteria 1413
321 Ga0099794_10000051 3300007265 Bacteria 46560
322 Ga0099794_10011530 3300007265 Bacteria 3786
323 Ga0099794_10057804 3300007265 Bacteria 1879
324 Ga0105240_10000041 3300009093 Bacteria 264078
325 Ga0105240_10566718 3300009093 Bacteria 1255
326 Ga0111539_10000327 3300009094 Bacteria 58082
327 Ga0111539_10001558 3300009094 Bacteria 30523
328 Ga0111539_10010661 3300009094 Bacteria 11575
329 Ga0111539_10080139 3300009094 Bacteria 3841
330 Ga0111539_10115067 3300009094 Bacteria 3155
331 Ga0111539_10766609 3300009094 Bacteria 1123
332 Ga0111539_10878827 3300009094 Bacteria 1043
333 Ga0105245_10025527 3300009098 Bacteria 5197
334 Ga0105247_10042439 3300009101 Bacteria 2786
335 Ga0105247_10148426 3300009101 Bacteria 1543
336 Ga0114129_10000002 3300009147 Bacteria 204413
337 Ga0114129_10000093 3300009147 Bacteria 85690
338 Ga0114129_10003396 3300009147 Bacteria 22367
339 Ga0114129_10003570 3300009147 Bacteria 21893
340 Ga0114129_10025764 3300009147 Bacteria 8331
341 Ga0114129_10027787 3300009147 Bacteria 8011
342 Ga0114129_10043934 3300009147 Bacteria 6286
343 Ga0114129_10074063 3300009147 Bacteria 4743
344 Ga0114129_10146036 3300009147 Bacteria 3240
345 Ga0114129_10162001 3300009147 Bacteria 3055
346 Ga0114129_10199380 3300009147 Bacteria 2712
347 Ga0114129_10236374 3300009147 Bacteria 2458
348 Ga0114129_10237963 3300009147 Bacteria 2449
349 Ga0114129_10302202 3300009147 Bacteria 2132
350 Ga0114129_10402286 3300009147 Bacteria 1804
351 Ga0114129_10422433 3300009147 Bacteria 1753
352 Ga0114129_10485969 3300009147 Bacteria 1615
353 Ga0105243_10105459 3300009148 Bacteria 2348
354 Ga0105243_10164009 3300009148 Bacteria 1918
355 Ga0105241_10001068 3300009174 Bacteria 20901
356 Ga0105241_10002639 3300009174 Bacteria 13430
357 Ga0105241_10410260 3300009174 Bacteria 1190
358 Ga0105242_10033889 3300009176 Bacteria 4092
359 Ga0105242_10035281 3300009176 Bacteria 4011
360 Ga0105242_10058606 3300009176 Bacteria 3158
361 Ga0105242_10267145 3300009176 Bacteria 1548
362 Ga0105248_10000669 3300009177 Bacteria 38860
363 Ga0105248_10006680 3300009177 Bacteria 12660
364 Ga0105248_10268673 3300009177 Bacteria 1920
365 Ga0105248_10517752 3300009177 Bacteria 1345
366 Ga0105237_10002307 3300009545 Bacteria 23709
367 Ga0105237_10253022 3300009545 Bacteria 1764
368 Ga0105238_10021605 3300009551 Bacteria 6555
369 Ga0105249_10045467 3300009553 Bacteria 3993
370 Ga0105249_10091991 3300009553 Bacteria 2839
371 Ga0105249_10170627 3300009553 Bacteria 2109
372 Ga0105249_10380170 3300009553 Bacteria 1438
373 Ga0105249_10396788 3300009553 Bacteria 1409
374 Ga0105249_10455959 3300009553 Bacteria 1318
375 Ga0105239_10001288 3300010375 Bacteria 33843
376 Ga0105239_10027237 3300010375 Bacteria 6292
377 Ga0105239_10050735 3300010375 Bacteria 4549
378 Ga0105239_10099663 3300010375 Bacteria 3212
379 Ga0105239_10368387 3300010375 Bacteria 1623
380 Ga0105239_10593578 3300010375 Bacteria 1263
381 Ga0105246_10057039 3300011119 Bacteria 2701
382 Ga0157373_10189626 3300013100 Bacteria 1449
383 Ga0157371_10038288 3300013102 Bacteria 3431
384 Ga0157371_10097325 3300013102 Bacteria 2086
385 Ga0157371_10140124 3300013102 Bacteria 1723
386 Ga0157369_10051057 3300013105 Bacteria 4476
387 Ga0157369_10434513 3300013105 Bacteria 1360
388 Ga0157374_10023689 3300013296 Bacteria 5495
389 Ga0157374_10026298 3300013296 Bacteria 5235
390 Ga0157378_10002950 3300013297 Bacteria 15127
391 Ga0157378_10662648 3300013297 Bacteria 1060
392 Ga0163162_10026169 3300013306 Bacteria 5766
393 Ga0163162_10028622 3300013306 Bacteria 5514
394 Ga0163162_10231379 3300013306 Bacteria 1979
395 Ga0163162_10256566 3300013306 Bacteria 1880
396 Ga0157372_10027196 3300013307 Bacteria 6227
397 Ga0157372_10102954 3300013307 Bacteria 3262
398 Ga0157372_10206795 3300013307 Bacteria 2274
399 Ga0157372_10274132 3300013307 Bacteria 1961
400 Ga0157372_10376096 3300013307 Bacteria 1655
401 Ga0157375_10012076 3300013308 Bacteria 7650
402 Ga0157375_10012494 3300013308 Bacteria 7536
403 Ga0157375_10048140 3300013308 Bacteria 4168
404 Ga0157375_10307609 3300013308 Bacteria 1749
405 Ga0157375_10727048 3300013308 Bacteria 1145
406 Ga0163163_10014977 3300014325 Bacteria 7147
407 Ga0163163_10127622 3300014325 Bacteria 2582
408 Ga0157380_10001115 3300014326 Bacteria 17333
409 Ga0157380_10072730 3300014326 Bacteria 2786
410 Ga0157380_10073658 3300014326 Bacteria 2770
411 Ga0157380_10121406 3300014326 Bacteria 2214
412 Ga0157377_10145163 3300014745 Bacteria 1462
413 Ga0157379_10186308 3300014968 Bacteria 1876
414 Ga0157376_10002892 3300014969 Bacteria 11771
415 Ga0157376_10014517 3300014969 Bacteria 5916
416 Ga0163161_10052577 3300017792 Bacteria 2953
417 Ga0197907_10142512 3300020069 Bacteria 1199
418 Ga0197907_10541769 3300020069 Bacteria 1298
419 Ga0197907_10662627 3300020069 Bacteria 974
420 Ga0197907_10674868 3300020069 Unclassified 1256
421 Ga0197907_11056369 3300020069 Bacteria 1416
422 Ga0197907_11169213 3300020069 Unclassified 1106
423 Ga0206356_10244490 3300020070 Bacteria 1200
424 Ga0206356_10979058 3300020070 Bacteria 2262
425 Ga0206356_11515020 3300020070 Unclassified 1197
426 Ga0206356_11856893 3300020070 Bacteria 1267
427 Ga0206349_1060160 3300020075 Bacteria 1372
428 Ga0206349_1067078 3300020075 Bacteria 1188
429 Ga0206349_1239780 3300020075 Bacteria 1110
430 Ga0206349_1240892 3300020075 Bacteria 1449
431 Ga0206349_1284932 3300020075 Bacteria 1300
432 Ga0206349_1615189 3300020075 Bacteria 1462
433 Ga0206349_1909150 3300020075 Bacteria 976
434 Ga0206355_1357135 3300020076 Bacteria 1193
435 Ga0206351_10068540 3300020077 Bacteria 1191
436 Ga0206351_10265613 3300020077 Bacteria 989
437 Ga0206351_10320234 3300020077 Bacteria 1503
438 Ga0206352_10111162 3300020078 Bacteria 1326
439 Ga0206352_10806553 3300020078 Bacteria 1109
440 Ga0206352_11088056 3300020078 Bacteria 2638
441 Ga0206350_10055406 3300020080 Unclassified 1610
442 Ga0206350_10055662 3300020080 Unclassified 1407
443 Ga0206350_10058979 3300020080 Bacteria 1010
444 Ga0206350_10383671 3300020080 Bacteria 1118
445 Ga0206350_10702709 3300020080 Bacteria 1476
446 Ga0206350_10765337 3300020080 Bacteria 3664
447 Ga0206350_10787735 3300020080 Unclassified 1241
448 Ga0206350_11004085 3300020080 Bacteria 1260
449 Ga0206350_11116656 3300020080 Bacteria 1200
450 Ga0206350_11495803 3300020080 Bacteria 1241
451 Ga0206354_10099186 3300020081 Bacteria 1196
452 Ga0206354_10475810 3300020081 Bacteria 1642
453 Ga0206353_10502351 3300020082 Bacteria 2154
454 Ga0154015_1547869 3300020610 Bacteria 1188
455 Ga0213875_10066143 3300021388 Bacteria 1689
456 Ga0224712_10031567 3300022467 Bacteria 1923
457 Ga0224712_10040530 3300022467 Unclassified 1753
458 Ga0224712_10049073 3300022467 Bacteria 1633
459 Ga0224712_10079843 3300022467 Bacteria 1348
460 Ga0224712_10087311 3300022467 Bacteria 1300
461 Ga0224712_10108465 3300022467 Unclassified 1188
462 Ga0224712_10160799 3300022467 Bacteria 1001
463 Ga0209233_1000253 3300025261 Bacteria 82672
464 Ga0207697_10037972 3300025315 Bacteria 1974
465 Ga0207653_10003696 3300025885 Bacteria 4810
466 Ga0207653_10006461 3300025885 Bacteria 3657
467 Ga0207653_10010446 3300025885 Bacteria 2895
468 Ga0207682_10091285 3300025893 Bacteria 1320
469 Ga0207688_10016689 3300025901 Bacteria 3986
470 Ga0207680_10006676 3300025903 Bacteria 5598
471 Ga0207685_10022880 3300025905 Bacteria 2119
472 Ga0207685_10052029 3300025905 Bacteria 1585
473 Ga0207699_10099260 3300025906 Bacteria 1844
474 Ga0207645_10004388 3300025907 Bacteria 10451
475 Ga0207645_10057553 3300025907 Bacteria 2482
476 Ga0207643_10000700 3300025908 Bacteria 20877
477 Ga0207643_10061519 3300025908 Bacteria 2144
478 Ga0207705_10003355 3300025909 Bacteria 12170
479 Ga0207684_10000269 3300025910 Bacteria 77057
480 Ga0207684_10000699 3300025910 Bacteria 39632
481 Ga0207684_10002692 3300025910 Bacteria 17748
482 Ga0207684_10006205 3300025910 Bacteria 10913
483 Ga0207684_10008726 3300025910 Bacteria 8999
484 Ga0207684_10012203 3300025910 Bacteria 7478
485 Ga0207684_10026275 3300025910 Bacteria 4963
486 Ga0207684_10030286 3300025910 Bacteria 4607
487 Ga0207684_10082354 3300025910 Bacteria 2740
488 Ga0207684_10194903 3300025910 Bacteria 1747
489 Ga0207684_10200471 3300025910 Bacteria 1722
490 Ga0207684_10320413 3300025910 Bacteria 1336
491 Ga0207684_10409336 3300025910 Bacteria 1166
492 Ga0207654_10002375 3300025911 Bacteria 9637
493 Ga0207707_10000003 3300025912 Bacteria 642592
494 Ga0207707_10028133 3300025912 Bacteria 4914
495 Ga0207707_10034538 3300025912 Bacteria 4424
496 Ga0207707_10082308 3300025912 Bacteria 2810
497 Ga0207695_10000125 3300025913 Bacteria 228810
498 Ga0207695_10001897 3300025913 Bacteria 32648
499 Ga0207671_10001097 3300025914 Bacteria 32744
500 Ga0207663_10091313 3300025916 Bacteria 2022
501 Ga0207660_10000499 3300025917 Bacteria 26138
502 Ga0207660_10015310 3300025917 Bacteria 5059
503 Ga0207660_10017179 3300025917 Bacteria 4801
504 Ga0207660_10118020 3300025917 Bacteria 2006
505 Ga0207660_10196972 3300025917 Bacteria 1572
506 Ga0207662_10051744 3300025918 Bacteria 2443
507 Ga0207662_10166004 3300025918 Bacteria 1413
508 Ga0207657_10002105 3300025919 Bacteria 21524
509 Ga0207657_10004687 3300025919 Bacteria 14437
510 Ga0207649_10006972 3300025920 Bacteria 6140
511 Ga0207649_10050804 3300025920 Bacteria 2565
512 Ga0207652_10000024 3300025921 Bacteria 157748
513 Ga0207652_10000948 3300025921 Bacteria 27240
514 Ga0207652_10195049 3300025921 Bacteria 1822
515 Ga0207646_10000008 3300025922 Bacteria 457143
516 Ga0207646_10000009 3300025922 Bacteria 453146
517 Ga0207646_10001224 3300025922 Bacteria 32267
518 Ga0207646_10001278 3300025922 Bacteria 31485
519 Ga0207646_10006130 3300025922 Bacteria 12507
520 Ga0207646_10023144 3300025922 Bacteria 5710
521 Ga0207646_10034841 3300025922 Bacteria 4550
522 Ga0207646_10035870 3300025922 Bacteria 4477
523 Ga0207646_10036164 3300025922 Bacteria 4458
524 Ga0207646_10043460 3300025922 Bacteria 4035
525 Ga0207646_10047772 3300025922 Bacteria 3838
526 Ga0207646_10049366 3300025922 Unclassified 3769
527 Ga0207646_10050810 3300025922 Bacteria 3710
528 Ga0207646_10079634 3300025922 Bacteria 2929
529 Ga0207646_10082775 3300025922 Bacteria 2870
530 Ga0207646_10236558 3300025922 Bacteria 1650
531 Ga0207646_10248220 3300025922 Bacteria 1608
532 Ga0207646_10438559 3300025922 Bacteria 1179
533 Ga0207681_10064417 3300025923 Bacteria 2531
534 Ga0207681_10081535 3300025923 Bacteria 2284
535 Ga0207681_10129560 3300025923 Bacteria 1863
536 Ga0207681_10303079 3300025923 Bacteria 1265
537 Ga0207694_10020953 3300025924 Bacteria 4949
538 Ga0207650_10016596 3300025925 Bacteria 5148
539 Ga0207659_10004601 3300025926 Bacteria 8349
540 Ga0207659_10222687 3300025926 Bacteria 1518
541 Ga0207700_10134521 3300025928 Bacteria 2023
542 Ga0207700_10268570 3300025928 Bacteria 1463
543 Ga0207664_10119473 3300025929 Bacteria 2204
544 Ga0207644_10088579 3300025931 Bacteria 2302
545 Ga0207644_10315981 3300025931 Bacteria 1262
546 Ga0207690_10027852 3300025932 Bacteria 3575
547 Ga0207690_10041631 3300025932 Bacteria 3011
548 Ga0207706_10010824 3300025933 Bacteria 8321
549 Ga0207706_10014986 3300025933 Bacteria 7019
550 Ga0207706_10081167 3300025933 Bacteria 2850
551 Ga0207709_10038530 3300025935 Bacteria 2848
552 Ga0207709_10108894 3300025935 Bacteria 1848
553 Ga0207709_10150084 3300025935 Bacteria 1613
554 Ga0207670_10001774 3300025936 Bacteria 11294
555 Ga0207670_10066821 3300025936 Bacteria 2471
556 Ga0207670_10123021 3300025936 Bacteria 1889
557 Ga0207665_10077805 3300025939 Bacteria 2277
558 Ga0207691_10010904 3300025940 Bacteria 8722
559 Ga0207691_10045517 3300025940 Bacteria 4033
560 Ga0207691_10057184 3300025940 Bacteria 3551
561 Ga0207711_10035703 3300025941 Bacteria 4215
562 Ga0207711_10039175 3300025941 Bacteria 4031
563 Ga0207711_10100552 3300025941 Bacteria 2558
564 Ga0207689_10004812 3300025942 Bacteria 12171
565 Ga0207689_10007296 3300025942 Bacteria 9704
566 Ga0207679_10008774 3300025945 Bacteria 6448
567 Ga0207679_10012799 3300025945 Bacteria 5483
568 Ga0207679_10224473 3300025945 Bacteria 1582
569 Ga0207679_10287539 3300025945 Unclassified 1412
570 Ga0207667_10000470 3300025949 Bacteria 53903
571 Ga0207651_10078724 3300025960 Bacteria 2365
572 Ga0207712_10090808 3300025961 Bacteria 2248
573 Ga0207712_10156610 3300025961 Bacteria 1765
574 Ga0207712_10343860 3300025961 Bacteria 1238
575 Ga0207668_10044533 3300025972 Bacteria 3020
576 Ga0207668_10065445 3300025972 Bacteria 2573
577 Ga0207640_10003162 3300025981 Bacteria 8858
578 Ga0207640_10383750 3300025981 Bacteria 1139
579 Ga0207658_10267268 3300025986 Bacteria 1460
580 Ga0207658_10297645 3300025986 Bacteria 1389
581 Ga0207677_10022838 3300026023 Bacteria 3852
582 Ga0207703_10000905 3300026035 Bacteria 29007
583 Ga0207703_10068334 3300026035 Bacteria 2927
584 Ga0207703_10076252 3300026035 Bacteria 2781
585 Ga0207703_10088441 3300026035 Bacteria 2600
586 Ga0207703_10219611 3300026035 Bacteria 1699
587 Ga0207639_10000569 3300026041 Bacteria 25445
588 Ga0207639_10009494 3300026041 Bacteria 6716
589 Ga0207639_10013924 3300026041 Bacteria 5642
590 Ga0207678_10009235 3300026067 Bacteria 8676
591 Ga0207678_10285780 3300026067 Bacteria 1416
592 Ga0207708_10000205 3300026075 Bacteria 46835
593 Ga0207708_10022381 3300026075 Bacteria 4773
594 Ga0207702_10008773 3300026078 Bacteria 8521
595 Ga0207702_10169622 3300026078 Bacteria 2000
596 Ga0207641_10069103 3300026088 Bacteria 3031
597 Ga0207641_10105985 3300026088 Bacteria 2484
598 Ga0207641_10124712 3300026088 Bacteria 2304
599 Ga0207641_10399934 3300026088 Bacteria 1319
600 Ga0207648_10018449 3300026089 Bacteria 6317
601 Ga0207648_10039482 3300026089 Bacteria 4150
602 Ga0207674_10003153 3300026116 Bacteria 20327
603 Ga0207674_10004332 3300026116 Bacteria 17118
604 Ga0207674_10011021 3300026116 Bacteria 10166
605 Ga0207674_10011149 3300026116 Bacteria 10108
606 Ga0207674_10137713 3300026116 Bacteria 2402
607 Ga0207675_100007447 3300026118 Bacteria 10342
608 Ga0207675_100009342 3300026118 Bacteria 9191
609 Ga0207675_100276423 3300026118 Bacteria 1631
610 Ga0207683_10001914 3300026121 Bacteria 18427
611 Ga0207698_10101133 3300026142 Bacteria 2390
612 Ga0209967_1004932 3300027364 Bacteria 1785
613 Ga0209981_1001519 3300027378 Bacteria 2932
614 Ga0210000_1002180 3300027462 Bacteria 2776
615 Ga0209995_1001998 3300027471 Bacteria 3197
616 Ga0209968_1005761 3300027526 Bacteria 1861
617 Ga0209999_1000518 3300027543 Bacteria 6018
618 Ga0209970_1000650 3300027614 Bacteria 6019
619 Ga0209588_1000010 3300027671 Bacteria 159025
620 Ga0209971_1000004 3300027682 Bacteria 110041
621 Ga0209966_1000015 3300027695 Bacteria 78092
622 Ga0209998_10000001 3300027717 Bacteria 203589
623 Ga0209974_10000064 3300027876 Bacteria 28215
624 Ga0209974_10008177 3300027876 Bacteria 3581
625 Ga0207428_10003135 3300027907 Bacteria 16210
626 Ga0207428_10008148 3300027907 Bacteria 9492
627 Ga0207428_10044386 3300027907 Bacteria 3586
628 Ga0207428_10108472 3300027907 Bacteria 2138
629 Ga0268266_10000257 3300028379 Bacteria 89384
630 Ga0268266_10049836 3300028379 Bacteria 3592
631 Ga0268265_10010779 3300028380 Bacteria 6171
632 Ga0268265_10015484 3300028380 Bacteria 5220
633 Ga0268265_10015621 3300028380 Bacteria 5199
634 Ga0268264_10003412 3300028381 Bacteria 13714
635 Ga0268264_10015858 3300028381 Bacteria 6170
636 Ga0268264_10106212 3300028381 Bacteria 2451
637 Ga0268264_10230141 3300028381 Bacteria 1711
638 Ga0265337_1003360 3300028556 Bacteria 6959
639 Ga0265337_1028599 3300028556 Bacteria 1672
640 Ga0265319_1000997 3300028563 Bacteria 17737
641 Ga0265334_10035763 3300028573 Bacteria 1964
642 Ga0265318_10000203 3300028577 Bacteria 51133
643 Ga0265318_10001992 3300028577 Bacteria 11339
644 Ga0265318_10007232 3300028577 Bacteria 5040
645 Ga0265338_10001466 3300028800 Bacteria 38204
646 Ga0265338_10019349 3300028800 Bacteria 7227
647 Ga0265338_10020668 3300028800 Bacteria 6910
648 Ga0265338_10068588 3300028800 Bacteria 3054
649 Ga0265338_10133795 3300028800 Bacteria 1953
650 Ga0265330_10000562 3300031235 Bacteria 24182
651 Ga0265330_10012846 3300031235 Bacteria 3909
652 Ga0265330_10017651 3300031235 Bacteria 3284
653 Ga0265332_10000369 3300031238 Bacteria 33334
654 Ga0265332_10000906 3300031238 Bacteria 17782
655 Ga0265332_10056504 3300031238 Bacteria 1682
656 Ga0265328_10009142 3300031239 Bacteria 4044
657 Ga0265328_10009295 3300031239 Bacteria 4008
658 Ga0265328_10039838 3300031239 Bacteria 1733
659 Ga0265320_10000078 3300031240 Bacteria 84397
660 Ga0265320_10001291 3300031240 Bacteria 18271
661 Ga0265320_10004136 3300031240 Bacteria 9533
662 Ga0265320_10043015 3300031240 Bacteria 2236
663 Ga0265320_10096604 3300031240 Bacteria 1364
664 Ga0265325_10001592 3300031241 Bacteria 15832
665 Ga0265325_10029008 3300031241 Bacteria 2977
666 Ga0265325_10042978 3300031241 Bacteria 2360
667 Ga0265329_10001244 3300031242 Bacteria 12464
668 Ga0265329_10013205 3300031242 Bacteria 2951
669 Ga0265340_10000024 3300031247 Bacteria 77206
670 Ga0265340_10000201 3300031247 Bacteria 29823
671 Ga0265340_10000404 3300031247 Bacteria 23202
672 Ga0265340_10003154 3300031247 Bacteria 9349
673 Ga0265340_10022074 3300031247 Bacteria 3257
674 Ga0265339_10006243 3300031249 Bacteria 7848
675 Ga0265339_10009333 3300031249 Bacteria 6172
676 Ga0265339_10017384 3300031249 Bacteria 4261
677 Ga0265331_10000032 3300031250 Bacteria 210525
678 Ga0265331_10001059 3300031250 Bacteria 21450
679 Ga0265331_10007127 3300031250 Bacteria 6507
680 Ga0265316_10003440 3300031344 Bacteria 16019
681 Ga0265316_10005882 3300031344 Bacteria 11820
682 Ga0265316_10010806 3300031344 Bacteria 8294
683 Ga0265316_10065914 3300031344 Bacteria 2803
684 Ga0307408_100053526 3300031548 Bacteria 2915
685 Ga0307408_100277640 3300031548 Bacteria 1394
686 Ga0307408_100600258 3300031548 Bacteria 978
687 Ga0265313_10000095 3300031595 Bacteria 89645
688 Ga0316579_10015648 3300031691 Bacteria 3299
689 Ga0265314_10000193 3300031711 Bacteria 90595
690 Ga0265314_10000215 3300031711 Bacteria 85711
691 Ga0265314_10001016 3300031711 Bacteria 32760
692 Ga0265314_10212383 3300031711 Bacteria 1135
693 Ga0265342_10000560 3300031712 Bacteria 39323
694 Ga0265342_10005756 3300031712 Bacteria 9372
695 Ga0265342_10014312 3300031712 Bacteria 5270
696 Ga0265342_10016073 3300031712 Bacteria 4901
697 Ga0316576_10076071 3300031727 Bacteria 2484
698 Ga0316576_10092697 3300031727 Bacteria 2251
699 Ga0307410_10319575 3300031852 Bacteria 1231
700 Ga0307406_10004608 3300031901 Bacteria 7507
701 Ga0307409_100220664 3300031995 Bacteria 1711
702 Ga0316585_10072982 3300032137 Bacteria 1115
703 Ga0316593_10025576 3300032168 Bacteria 1880
704 Ga0373948_0016233 3300034817 Bacteria 1374
705 Ga0373926_0039385 3300035083 Bacteria 1685
706 Ga0373926_0039852 3300035083 Bacteria 1676
707 Ga0373951_0002225 3300035091 Bacteria 4931
708 Ga0373923_0109180 3300035111 Bacteria 1227
709 Ga0373923_0126867 3300035111 Bacteria 1144
710 Ga0373954_0058279 3300035118 Unclassified 1820
711 Ga0373956_0001166 3300035119 Bacteria 10862
712 Ga0373960_0027861 3300035121 Bacteria 1555
713 Ga0373955_0028715 3300035172 Bacteria 2887
714 Ga0373961_0040972 3300035241 Bacteria 1337
715 Ga0316574_0055185 3300035398 Bacteria 2483
716 Ga0373931_0006841 3300035691 Bacteria 5362
717 Ga0373927_0000015 3300035695 Bacteria 155974
718 Ga0373927_0007647 3300035695 Bacteria 7312
719 Ga0373933_0007886 3300035724 Bacteria 5813
720 Ga0373933_0019859 3300035724 Bacteria 3803
721 Ga0373937_0328601 3300036401 Bacteria 1447
722 Ga0265778_007786 3300036457 Bacteria 1182
723 Ga0316582_0188187 3300036647 Bacteria 1406
724 Ga0316584_0051830 3300036712 Bacteria 3069
725 Ga0373925_0147145 3300037068 Bacteria 1847
726 Ga0395899_0005409 3300037312 Bacteria 9918
727 Ga0395899_0023622 3300037312 Bacteria 4654
728 Ga0395899_0055121 3300037312 Bacteria 2941
729 Ga0395900_0000485 3300037418 Bacteria 56437
730 Ga0395900_0118408 3300037418 Bacteria 2718
731 Ga0395900_0264373 3300037418 Bacteria 1717
732 Ga0395898_0002650 3300037466 Bacteria 20816
733 Ga0395898_0008040 3300037466 Bacteria 11179
734 Ga0395898_0192298 3300037466 Bacteria 1950
735 Ga0395905_0013517 3300037471 Bacteria 7822
736 Ga0316581_0057601 3300037588 Bacteria 1191
737 Ga0436364_0112710 3300037853 Bacteria 2770
738 Ga0436364_0678702 3300037853 Bacteria 2491
739 Ga0395901_0000955 3300038443 Bacteria 31458
740 Ga0395901_0018330 3300038443 Bacteria 7147
741 Ga0395901_0159221 3300038443 Bacteria 2371
742 Ga0400489_44064 3300039093 Bacteria 3659
743 Ga0436365_0969405 3300039437 Bacteria 1086
744 Ga0436365_1432522 3300039437 Bacteria 2712
745 Ga0436360_0819436 3300039438 Bacteria 5830
746 Ga0439448_0016202 3300042005 Bacteria 2266
747 Ga0439450_003760 3300042008 Bacteria 2539
748 Ga0439455_0002711 3300042012 Bacteria 3270
749 Ga0439463_016687 3300042016 Bacteria 1816
750 Ga0439459_0004556 3300042438 Bacteria 2233
751 Ga0439464_0012428 3300042439 Bacteria 2268
752 Ga0439460_0004581 3300042461 Bacteria 3375
753 Ga0451577_0000031 3300042876 Bacteria 388524
754 Ga0451577_0004316 3300042876 Bacteria 15093
755 Ga0451577_0012269 3300042876 Bacteria 8052
756 Ga0451577_0082367 3300042876 Bacteria 2870
757 Ga0451577_0163874 3300042876 Bacteria 2003
758 Ga0451577_0256086 3300042876 Bacteria 1584
759 Ga0451577_0445149 3300042876 Bacteria 1176
760 Ga0466969_0001971 3300044656 Bacteria 10979
761 Ga0466969_0038556 3300044656 Bacteria 2404
762 Ga0466972_0011726 3300044658 Bacteria 4401
763 Ga0453683_0000698 3300044673 Bacteria 35139
764 Ga0453683_0000919 3300044673 Bacteria 28095
765 Ga0453683_0023217 3300044673 Bacteria 3953
766 Ga0453683_0065415 3300044673 Bacteria 2273
767 Ga0453683_0071885 3300044673 Bacteria 2165
768 Ga0453683_0123339 3300044673 Bacteria 1631
769 Ga0453683_0145810 3300044673 Bacteria 1495
770 Ga0466965_0048556 3300044683 Bacteria 2103
771 Ga0466966_0004193 3300044684 Bacteria 9519
772 Ga0466966_0097539 3300044684 Bacteria 1820
773 Ga0466961_0045312 3300044693 Bacteria 2814
774 Ga0466963_0261127 3300044694 Bacteria 1216
775 Ga0466964_0022134 3300044706 Bacteria 2463
776 Ga0453684_0000407 3300044712 Bacteria 176667
777 Ga0453684_0002829 3300044712 Bacteria 40909
778 Ga0453684_0035519 3300044712 Bacteria 6886
779 Ga0453684_0039087 3300044712 Bacteria 6471
780 Ga0453684_0046622 3300044712 Bacteria 5761
781 Ga0453684_0169173 3300044712 Bacteria 2577
782 Ga0453684_0176257 3300044712 Bacteria 2514
783 Ga0453684_0338524 3300044712 Bacteria 1699
784 Ga0466971_0102965 3300044719 Bacteria 1313
785 Ga0466968_0001893 3300044735 Bacteria 7569
786 Ga0466970_0000302 3300044765 Bacteria 24047
787 Ga0466957_0202687 3300044842 Bacteria 1304
788 Ga0466957_0336508 3300044842 Bacteria 1021
789 Ga0466959_0055727 3300045049 Bacteria 2885
790 Ga0451576_0001923 3300045051 Bacteria 33277
791 Ga0451576_0007050 3300045051 Bacteria 13578
792 Ga0451576_0008207 3300045051 Bacteria 12292
793 Ga0451576_0008636 3300045051 Bacteria 11932
794 Ga0451576_0017308 3300045051 Bacteria 7931
795 Ga0451576_0045135 3300045051 Bacteria 4642
796 Ga0451576_0089180 3300045051 Bacteria 3207
797 Ga0451576_0091543 3300045051 Bacteria 3163
798 Ga0451576_0097005 3300045051 Bacteria 3066
799 Ga0451576_0237280 3300045051 Bacteria 1904
800 Ga0451576_0295907 3300045051 Bacteria 1692
801 Ga0466958_0036170 3300045836 Unclassified 2954
802 Ga0466967_0694024 3300045976 Unclassified 1008
803 Ga0495629_0000001 3300046459 Bacteria 807972
804 Ga0495580_0090518 3300046472 Bacteria 2130
805 Ga0495580_0118836 3300046472 Bacteria 1835
806 Ga0495582_0014419 3300046473 Bacteria 4345
807 Ga0495594_0146436 3300046499 Bacteria 1340
808 Ga0495630_0262327 3300046517 Unclassified 1320
809 Ga0495642_0006635 3300046528 Bacteria 4444
810 Ga0495598_0010079 3300046537 Bacteria 2254
811 Ga0495635_0001175 3300046663 Bacteria 17454
812 Ga0495657_0010941 3300046675 Bacteria 6805
813 Ga0495647_0073280 3300046681 Bacteria 1375
814 Ga0495658_0001366 3300046683 Bacteria 12794
815 Ga0495658_0034885 3300046683 Bacteria 2763
816 Ga0495624_0128518 3300046690 Bacteria 1554
817 Ga0495600_0002828 3300046809 Bacteria 10095
818 Ga0495636_0000656 3300047318 Bacteria 12699
819 Ga0495680_0001540 3300047322 Bacteria 24673
820 Ga0495680_0023425 3300047322 Bacteria 5134
821 Ga0495684_0001985 3300047471 Bacteria 16444
822 Ga0495686_0130533 3300047472 Bacteria 1490
823 Ga0496100_0303282 3300048903 Bacteria 1196
824 Ga0496101_0060973 3300048904 Bacteria 2738
825 Ga0496102_0054937 3300048905 Bacteria 3632
826 Ga0496102_0086165 3300048905 Bacteria 2901
827 Ga0496102_0309762 3300048905 Bacteria 1488
828 Ga0496104_0043024 3300048907 Bacteria 4241
829 Ga0496105_0021784 3300048908 Bacteria 5188
830 Ga0496106_0029042 3300048909 Bacteria 4121
831 Ga0496106_0068256 3300048909 Bacteria 2712
832 Ga0496106_0109236 3300048909 Bacteria 2152
833 Ga0496108_0040572 3300048911 Bacteria 3881
834 Ga0496109_0018420 3300048912 Bacteria 6134
835 Ga0496110_0015477 3300048913 Bacteria 6350
836 Ga0496110_0100673 3300048913 Bacteria 2590
837 Ga0496111_0346852 3300048914 Bacteria 1099
838 Ga0496112_0172554 3300048915 Bacteria 2128
839 Ga0496124_0000003 3300048927 Bacteria 1300161
840 Ga0496125_0138852 3300048928 Bacteria 1694
841 Ga0496126_0023537 3300048929 Bacteria 5968
842 Ga0496126_0074959 3300048929 Bacteria 3004
843 Ga0501031_0003874 3300049568 Bacteria 9626
844 Ga0501031_0012400 3300049568 Bacteria 5558
845 Ga0501031_0255289 3300049568 Bacteria 1139
846 Ga0501032_0017313 3300049569 Bacteria 5060
847 Ga0501032_0036714 3300049569 Bacteria 3344
848 Ga0501032_0066652 3300049569 Bacteria 2406
849 Ga0501033_0252585 3300049570 Bacteria 1249
850 Ga0501034_0022542 3300049571 Bacteria 6417
851 Ga0501034_0026670 3300049571 Bacteria 5880
852 Ga0501034_0047938 3300049571 Bacteria 4312
853 Ga0501036_0033213 3300049572 Bacteria 4364
854 Ga0501036_0154101 3300049572 Bacteria 1938
855 Ga0501036_0177934 3300049572 Bacteria 1791
856 Ga0501036_0354622 3300049572 Bacteria 1225
857 Ga0501037_0001886 3300049573 Bacteria 15239
858 Ga0501037_0023599 3300049573 Bacteria 4548
859 Ga0501037_0104992 3300049573 Bacteria 2036
860 Ga0501037_0230592 3300049573 Bacteria 1300
861 Ga0501038_0009050 3300049574 Bacteria 9139
862 Ga0501038_0110077 3300049574 Bacteria 2282
863 Ga0501038_0364813 3300049574 Bacteria 1123
864 Ga0501038_0451710 3300049574 Bacteria 988
865 Ga0501039_0003633 3300049575 Bacteria 11559
866 Ga0501039_0007824 3300049575 Bacteria 8148
867 Ga0501039_0019159 3300049575 Bacteria 5251
868 Ga0501039_0052477 3300049575 Bacteria 3155
869 Ga0501039_0124248 3300049575 Bacteria 2023
870 Ga0501039_0189157 3300049575 Bacteria 1619
871 Ga0501040_0000512 3300049576 Bacteria 23238
872 Ga0501040_0015463 3300049576 Bacteria 5043
873 Ga0501040_0020172 3300049576 Bacteria 4440
874 Ga0501040_0026769 3300049576 Bacteria 3879
875 Ga0501040_0062128 3300049576 Bacteria 2570
876 Ga0501040_0064296 3300049576 Bacteria 2526
877 Ga0501040_0114562 3300049576 Bacteria 1887
878 Ga0501041_0002285 3300049577 Bacteria 10844
879 Ga0501041_0008815 3300049577 Bacteria 5938
880 Ga0501041_0069491 3300049577 Bacteria 2160
881 Ga0501041_0168413 3300049577 Bacteria 1370
882 Ga0501042_0000917 3300049578 Bacteria 16532
883 Ga0501042_0024803 3300049578 Bacteria 4209
884 Ga0501042_0065797 3300049578 Bacteria 2590
885 Ga0501042_0074824 3300049578 Bacteria 2423
886 Ga0501042_0184169 3300049578 Bacteria 1506
887 Ga0501042_0291329 3300049578 Bacteria 1179
888 Ga0501043_0145053 3300049579 Bacteria 1859
889 Ga0501046_0001204 3300049580 Bacteria 25159
890 Ga0501046_0002954 3300049580 Bacteria 15734
891 Ga0501046_0004181 3300049580 Bacteria 13141
892 Ga0501046_0006900 3300049580 Bacteria 10009
893 Ga0501047_0014228 3300049581 Bacteria 7563
894 Ga0501047_0197931 3300049581 Bacteria 1871
895 Ga0501048_0024348 3300049582 Bacteria 4420
896 Ga0501048_0037677 3300049582 Bacteria 3472
897 Ga0501048_0053158 3300049582 Bacteria 2882
898 Ga0501048_0122292 3300049582 Bacteria 1839
899 Ga0501048_0266575 3300049582 Bacteria 1217
900 Ga0501067_0004610 3300049583 Bacteria 7631
901 Ga0501068_0060068 3300049584 Bacteria 2308
902 Ga0501068_0089604 3300049584 Bacteria 1897
903 Ga0501069_0019093 3300049585 Bacteria 3704
904 Ga0501069_0259008 3300049585 Bacteria 1015
905 Ga0501070_0038080 3300049586 Bacteria 4013
906 Ga0501071_0032223 3300049587 Bacteria 3721
907 Ga0501071_0042663 3300049587 Bacteria 3251
908 Ga0501072_0030558 3300049588 Bacteria 4214
909 Ga0501072_0080672 3300049588 Bacteria 2578
910 Ga0501072_0220338 3300049588 Bacteria 1512
911 Ga0501074_0025679 3300049590 Bacteria 4275
912 Ga0501074_0064534 3300049590 Bacteria 2636
913 Ga0501074_0150668 3300049590 Bacteria 1663
914 Ga0501075_0007603 3300049591 Bacteria 7519
915 Ga0501075_0011886 3300049591 Bacteria 6176
916 Ga0501075_0074850 3300049591 Bacteria 2561
917 Ga0501075_0092305 3300049591 Bacteria 2298
918 Ga0501075_0265261 3300049591 Bacteria 1309
919 Ga0501075_0415374 3300049591 Bacteria 1026
920 Ga0501076_0022670 3300049592 Bacteria 4827
921 Ga0501076_0029092 3300049592 Bacteria 4295
922 Ga0501076_0063490 3300049592 Bacteria 2942
923 Ga0501076_0146420 3300049592 Bacteria 1920
924 Ga0501076_0210392 3300049592 Bacteria 1589
925 Ga0501076_0399759 3300049592 Bacteria 1130
926 Ga0501077_0014715 3300049593 Bacteria 4915
927 Ga0501077_0039691 3300049593 Bacteria 2999
928 Ga0501077_0126292 3300049593 Bacteria 1621
929 Ga0501079_0001699 3300049741 Bacteria 15679
930 Ga0501079_0021213 3300049741 Bacteria 4967
931 Ga0501079_0031997 3300049741 Bacteria 4042
932 Ga0501079_0043256 3300049741 Bacteria 3476
933 Ga0501079_0224433 3300049741 Bacteria 1468
934 Ga0501080_0003623 3300049742 Bacteria 13614
935 Ga0501080_0115345 3300049742 Bacteria 2490
936 Ga0501080_0199832 3300049742 Bacteria 1836
937 Ga0501081_0002723 3300049743 Bacteria 11188
938 Ga0501081_0004362 3300049743 Bacteria 9073
939 Ga0501081_0026058 3300049743 Bacteria 3939
940 Ga0501081_0368573 3300049743 Bacteria 1060
941 Ga0501035_0001442 3300049822 Bacteria 24365
942 Ga0501035_0052717 3300049822 Bacteria 3639
943 Ga0501035_0199832 3300049822 Bacteria 1715
944 Ga0501035_0279988 3300049822 Bacteria 1410
945 Ga0501044_0001768 3300049823 Bacteria 25268
946 Ga0501044_0091876 3300049823 Bacteria 3061
947 Ga0501045_0003582 3300049824 Bacteria 10665
948 Ga0501045_0024815 3300049824 Bacteria 4306
949 nmdc:mga05p37_1202_c1 3300050507 Bacteria 29954
950 nmdc:mga05p37_13930_c1 3300050507 Bacteria 9639
951 nmdc:mga05p37_14517_c1 3300050507 Bacteria 9459
952 nmdc:mga05p37_200834_c1 3300050507 Bacteria 2415
953 nmdc:mga05p37_20359_c1 3300050507 Bacteria 8027
954 nmdc:mga05p37_23285_c1 3300050507 Bacteria 7513
955 nmdc:mga05p37_28610_c1 3300050507 Bacteria 6798
956 nmdc:mga05p37_290369_c1 3300050507 Bacteria 1947
957 nmdc:mga05p37_3014_c1 3300050507 Bacteria 19548
958 nmdc:mga05p37_389043_c1 3300050507 Bacteria 1631
959 nmdc:mga05p37_414194_c1 3300050507 Unclassified 1570
960 nmdc:mga05p37_492_c1 3300050507 Bacteria 43329
961 nmdc:mga05p37_58168_c1 3300050507 Bacteria 4761
962 nmdc:mga05p37_60523_c1 3300050507 Bacteria 4662
963 nmdc:mga05p37_66414_c1 3300050507 Bacteria 4437
964 nmdc:mga09592_109115_c1 3300050508 Bacteria 2374
965 nmdc:mga09592_199419_c1 3300050508 Bacteria 1733
966 nmdc:mga09592_216432_c1 3300050508 Bacteria 1660
967 nmdc:mga09592_2702_c1 3300050508 Bacteria 14341
968 nmdc:mga09592_292380_c1 3300050508 Bacteria 1412
969 nmdc:mga09592_42678_c1 3300050508 Bacteria 3814
970 nmdc:mga09592_44143_c1 3300050508 Bacteria 3751
971 nmdc:mga09592_464949_c1 3300050508 Bacteria 1091
972 nmdc:mga0qj67_107619_c1 3300050509 Bacteria 2249
973 nmdc:mga0qj67_142933_c1 3300050509 Bacteria 1940
974 nmdc:mga0qj67_1701_c1 3300050509 Bacteria 15513
975 nmdc:mga0qj67_2178_c1 3300050509 Bacteria 13930
976 nmdc:mga0qj67_25258_c1 3300050509 Bacteria 4589
977 nmdc:mga0qj67_282481_c1 3300050509 Bacteria 1345
978 nmdc:mga0qj67_4550_c1 3300050509 Bacteria 10050
979 nmdc:mga0qj67_95788_c1 3300050509 Bacteria 2389
980 nmdc:mga06r32_10844_c1 3300050510 Bacteria 8207
981 nmdc:mga06r32_115477_c1 3300050510 Bacteria 2644
982 nmdc:mga06r32_2087_c1 3300050510 Bacteria 17889
983 nmdc:mga06r32_235873_c1 3300050510 Bacteria 1817
984 nmdc:mga06r32_41561_c1 3300050510 Bacteria 4369
985 nmdc:mga06r32_54648_c1 3300050510 Bacteria 3829
986 nmdc:mga06r32_73743_c1 3300050510 Bacteria 3307
987 nmdc:mga06r32_793_c1 3300050510 Bacteria 28013
988 nmdc:mga06r32_84623_c1 3300050510 Bacteria 3092
989 nmdc:mga06r32_92773_c1 3300050510 Bacteria 2952
990 nmdc:mga06r32_95971_c1 3300050510 Bacteria 2903
991 nmdc:mga06r32_97782_c1 3300050510 Bacteria 2877
992 nmdc:mga08y16_11348_c1 3300050511 Bacteria 9361
993 nmdc:mga08y16_21684_c1 3300050511 Bacteria 6781
994 nmdc:mga08y16_52600_c1 3300050511 Bacteria 4260
995 nmdc:mga08y16_64703_c1 3300050511 Bacteria 3818
996 nmdc:mga08y16_6773_c1 3300050511 Bacteria 12021
997 nmdc:mga08y16_68134_c1 3300050511 Bacteria 3711
998 nmdc:mga08y16_72607_c1 3300050511 Bacteria 3586
999 nmdc:mga08y16_934_c1 3300050511 Bacteria 28360
1000 nmdc:mga0n895_3829_c1 3300050512 Bacteria 12203
1001 nmdc:mga0n895_382_c1 3300050512 Bacteria 29949
1002 nmdc:mga0n895_40877_c1 3300050512 Bacteria 4506
1003 nmdc:mga0n895_52828_c1 3300050512 Bacteria 3990
1004 nmdc:mga0n895_546338_c1 3300050512 Bacteria 1164
1005 nmdc:mga0n895_57103_c1 3300050512 Bacteria 3847
1006 nmdc:mga0n895_70708_c1 3300050512 Bacteria 3459
1007 nmdc:mga0n895_83587_c1 3300050512 Bacteria 3185
1008 nmdc:mga0n895_83910_c1 3300050512 Bacteria 3178
1009 nmdc:mga0n895_85574_c1 3300050512 Bacteria 3148
1010 nmdc:mga0n895_9015_c1 3300050512 Bacteria 8701
1011 nmdc:mga0rr50_187454_c1 3300050513 Bacteria 1694
1012 nmdc:mga0rr50_2512_c1 3300050513 Bacteria 10379
1013 nmdc:mga0rr50_292_c1 3300050513 Bacteria 27211
1014 nmdc:mga0rr50_434016_c1 3300050513 Bacteria 1112
1015 nmdc:mga0rr50_590_c1 3300050513 Bacteria 19433
1016 nmdc:mga08x19_193898_c1 3300050514 Bacteria 1391
1017 nmdc:mga08x19_21650_c1 3300050514 Bacteria 3972
1018 nmdc:mga08x19_2471_c1 3300050514 Bacteria 11248
1019 nmdc:mga08x19_2518_c1 3300050514 Bacteria 11129
1020 nmdc:mga08x19_270840_c1 3300050514 Bacteria 1175
1021 nmdc:mga08x19_45357_c1 3300050514 Bacteria 2809
1022 nmdc:mga08x19_46783_c1 3300050514 Bacteria 2768
1023 nmdc:mga08x19_67624_c1 3300050514 Bacteria 2324
1024 nmdc:mga0a205_10167_c1 3300050515 Bacteria 8640
1025 nmdc:mga0a205_1241_c2 3300050515 Bacteria 9622
1026 nmdc:mga0a205_14524_c1 3300050515 Bacteria 7347
1027 nmdc:mga0a205_145326_c1 3300050515 Bacteria 2271
1028 nmdc:mga0a205_21_c1 3300050515 Bacteria 20815
1029 nmdc:mga0a205_2800_c1 3300050515 Bacteria 15427
1030 nmdc:mga0a205_389381_c1 3300050515 Bacteria 1258
1031 nmdc:mga0a205_41076_c1 3300050515 Bacteria 4454
1032 nmdc:mga0a205_45207_c1 3300050515 Bacteria 4246
1033 nmdc:mga0a205_53320_c1 3300050515 Bacteria 3903
1034 nmdc:mga0a205_6584_c1 3300050515 Bacteria 10507
1035 nmdc:mga0a205_88257_c1 3300050515 Bacteria 2997
1036 Ga0500642_0007212 3300053130 Bacteria 3720
1037 Ga0500637_0097293 3300053178 Bacteria 1706
1038 Ga0501084_0006437 3300054114 Bacteria 9651
1039 Ga0501084_0006546 3300054114 Bacteria 9576
1040 Ga0501084_0140153 3300054114 Bacteria 2036
1041 Ga0501084_0198229 3300054114 Bacteria 1694
1042 Ga0501084_0199590 3300054114 Bacteria 1688
1043 Ga0501082_0001216 3300060353 Bacteria 22625
1044 Ga0501082_0005907 3300060353 Bacteria 10616
1045 Ga0501082_0009246 3300060353 Bacteria 8494
1046 Ga0501082_0135336 3300060353 Bacteria 2138
1047 Ga0501082_0187891 3300060353 Bacteria 1798
1048 Ga0501082_0285481 3300060353 Bacteria 1437
1049 Ga0530510_0012872 3300061734 Bacteria 5882
1050 Ga0530510_0016896 3300061734 Bacteria 5168
1051 Ga0530510_0026956 3300061734 Bacteria 4116
1052 Ga0530510_0103630 3300061734 Bacteria 2081
1053 Ga0530510_0172160 3300061734 Bacteria 1604
1054 Ga0530510_0181888 3300061734 Bacteria 1559

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031247 Ga0265340_10000024 Ga0265340_1000002426 268
2 3300031247 Ga0265340_10022074 Ga0265340_100220743 268
3 3300031344 Ga0265316_10005882 Ga0265316_100058827 268
4 3300031344 Ga0265316_10065914 Ga0265316_100659142 268
5 3300031712 Ga0265342_10016073 Ga0265342_100160734 268
6 3300050511 nmdc:mga08y16_21684_c1 nmdc:mga08y16_21684_c1_4105_4935 275
7 3300009551 Ga0105238_10021605 Ga0105238_100216056 281
8 3300013307 Ga0157372_10376096 Ga0157372_103760962 281
9 3300031711 Ga0265314_10212383 Ga0265314_102123831 281
10 3300035121 Ga0373960_0027861 Ga0373960_0027861_430_1278 281
11 3300035691 Ga0373931_0006841 Ga0373931_0006841_4070_4918 281
12 3300044842 Ga0466957_0202687 Ga0466957_0202687_44_892 281
13 3300044842 Ga0466957_0336508 Ga0466957_0336508_130_978 281
14 3300045976 Ga0466967_0694024 Ga0466967_0694024_131_979 281
15 3300049591 Ga0501075_0415374 Ga0501075_0415374_150_998 281
16 3300050511 nmdc:mga08y16_72607_c1 nmdc:mga08y16_72607_c1_1610_2458 281
17 3300046499 Ga0495594_0146436 Ga0495594_0146436_460_1308 282
18 3300050513 nmdc:mga0rr50_434016_c1 nmdc:mga0rr50_434016_c1_191_1039 282
19 3300031235 Ga0265330_10017651 Ga0265330_100176512 284
20 3300050507 nmdc:mga05p37_1202_c1 nmdc:mga05p37_1202_c1_13470_14372 284
21 3300050508 nmdc:mga09592_2702_c1 nmdc:mga09592_2702_c1_8702_9604 284
22 3300050509 nmdc:mga0qj67_95788_c1 nmdc:mga0qj67_95788_c1_1216_2118 284
23 3300050510 nmdc:mga06r32_84623_c1 nmdc:mga06r32_84623_c1_773_1675 284
24 3300036712 Ga0316584_0051830 Ga0316584_0051830_125_991 285
25 3300009147 Ga0114129_10000002 Ga0114129_1000000227 287
26 3300014326 Ga0157380_10121406 Ga0157380_101214062 287
27 3300049574 Ga0501038_0451710 Ga0501038_0451710_45_926 288
28 3300005347 Ga0070668_100082232 Ga0070668_1000822322 289
29 3300005543 Ga0070672_100282416 Ga0070672_1002824162 289
30 3300013308 Ga0157375_10727048 Ga0157375_107270481 289
31 3300025893 Ga0207682_10091285 Ga0207682_100912851 289
32 3300025940 Ga0207691_10057184 Ga0207691_100571842 289
33 3300025972 Ga0207668_10044533 Ga0207668_100445333 289
34 3300026035 Ga0207703_10219611 Ga0207703_102196111 289
35 3300026088 Ga0207641_10105985 Ga0207641_101059853 289
36 3300054114 Ga0501084_0199590 Ga0501084_0199590_599_1486 289
37 3300005331 Ga0070670_100166903 Ga0070670_1001669033 290
38 3300005539 Ga0068853_100000307 Ga0068853_1000003076 291
39 3300006844 Ga0075428_100001585 Ga0075428_1000015854 291
40 3300006846 Ga0075430_100100628 Ga0075430_1001006281 291
41 3300006847 Ga0075431_100211911 Ga0075431_1002119112 291
42 3300006880 Ga0075429_100002270 Ga0075429_1000022705 291
43 3300026041 Ga0207639_10000569 Ga0207639_100005695 291
44 3300005719 Ga0068861_100053699 Ga0068861_1000536992 292
45 3300025923 Ga0207681_10303079 Ga0207681_103030792 292
46 3300028800 Ga0265338_10001466 Ga0265338_100014662 293
47 3300031249 Ga0265339_10009333 Ga0265339_100093332 293
48 3300045051 Ga0451576_0007050 Ga0451576_0007050_12342_13328 293
49 3300046472 Ga0495580_0118836 Ga0495580_0118836_195_1118 293
50 3300006847 Ga0075431_100047604 Ga0075431_1000476044 294
51 3300006880 Ga0075429_100052473 Ga0075429_1000524734 294
52 3300009147 Ga0114129_10025764 Ga0114129_100257647 294
53 3300050507 nmdc:mga05p37_14517_c1 nmdc:mga05p37_14517_c1_5477_6397 294
54 3300050508 nmdc:mga09592_109115_c1 nmdc:mga09592_109115_c1_564_1484 294
55 3300050509 nmdc:mga0qj67_107619_c1 nmdc:mga0qj67_107619_c1_571_1491 294
56 3300050510 nmdc:mga06r32_97782_c1 nmdc:mga06r32_97782_c1_888_1808 294
57 3300037466 Ga0395898_0192298 Ga0395898_0192298_675_1706 295
58 3300036647 Ga0316582_0188187 Ga0316582_0188187_22_945 296
59 3300042876 Ga0451577_0256086 Ga0451577_0256086_135_1064 297
60 3300044712 Ga0453684_0000407 Ga0453684_0000407_163444_164373 297
61 3300004799 Ga0058863_11416325 Ga0058863_114163251 298
62 3300004800 Ga0058861_11397491 Ga0058861_113974912 298
63 3300005330 Ga0070690_100184434 Ga0070690_1001844341 298
64 3300005341 Ga0070691_10000879 Ga0070691_100008797 298
65 3300005354 Ga0070675_100394146 Ga0070675_1003941462 298
66 3300005544 Ga0070686_100007508 Ga0070686_1000075082 298
67 3300005577 Ga0068857_100002928 Ga0068857_1000029288 298
68 3300013102 Ga0157371_10097325 Ga0157371_100973252 298
69 3300013308 Ga0157375_10012076 Ga0157375_100120767 298
70 3300020069 Ga0197907_10142512 Ga0197907_101425121 298
71 3300020070 Ga0206356_10244490 Ga0206356_102444901 298
72 3300020075 Ga0206349_1067078 Ga0206349_10670781 298
73 3300020076 Ga0206355_1357135 Ga0206355_13571352 298
74 3300020077 Ga0206351_10068540 Ga0206351_100685401 298
75 3300020078 Ga0206352_10111162 Ga0206352_101111621 298
76 3300020080 Ga0206350_11116656 Ga0206350_111166561 298
77 3300020081 Ga0206354_10099186 Ga0206354_100991861 298
78 3300020610 Ga0154015_1547869 Ga0154015_15478692 298
79 3300022467 Ga0224712_10031567 Ga0224712_100315672 298
80 3300026116 Ga0207674_10004332 Ga0207674_100043327 298
81 3300031240 Ga0265320_10004136 Ga0265320_100041363 298
82 3300031241 Ga0265325_10042978 Ga0265325_100429782 298
83 3300005328 Ga0070676_10014988 Ga0070676_100149884 299
84 3300005331 Ga0070670_100038399 Ga0070670_1000383994 299
85 3300005335 Ga0070666_10009701 Ga0070666_100097013 299
86 3300005338 Ga0068868_100039181 Ga0068868_1000391813 299
87 3300005344 Ga0070661_100016783 Ga0070661_1000167835 299
88 3300005355 Ga0070671_100042819 Ga0070671_1000428193 299
89 3300005356 Ga0070674_100020471 Ga0070674_1000204714 299
90 3300005364 Ga0070673_100005770 Ga0070673_1000057704 299
91 3300005366 Ga0070659_100154236 Ga0070659_1001542362 299
92 3300005436 Ga0070713_100185657 Ga0070713_1001856572 299
93 3300005456 Ga0070678_100005733 Ga0070678_1000057334 299
94 3300005543 Ga0070672_100010471 Ga0070672_1000104715 299
95 3300005548 Ga0070665_100229860 Ga0070665_1002298602 299
96 3300005564 Ga0070664_100089188 Ga0070664_1000891882 299
97 3300006237 Ga0097621_100027191 Ga0097621_1000271912 299
98 3300006358 Ga0068871_100011708 Ga0068871_1000117084 299
99 3300006880 Ga0075429_100064653 Ga0075429_1000646532 299
100 3300009094 Ga0111539_10000327 Ga0111539_1000032735 299
101 3300013102 Ga0157371_10038288 Ga0157371_100382882 299
102 3300013296 Ga0157374_10026298 Ga0157374_100262984 299
103 3300013297 Ga0157378_10002950 Ga0157378_100029502 299
104 3300013306 Ga0163162_10028622 Ga0163162_100286224 299
105 3300013308 Ga0157375_10012494 Ga0157375_100124947 299
106 3300014745 Ga0157377_10145163 Ga0157377_101451632 299
107 3300014968 Ga0157379_10186308 Ga0157379_101863081 299
108 3300014969 Ga0157376_10002892 Ga0157376_1000289212 299
109 3300020081 Ga0206354_10475810 Ga0206354_104758102 299
110 3300025315 Ga0207697_10037972 Ga0207697_100379722 299
111 3300025903 Ga0207680_10006676 Ga0207680_100066766 299
112 3300025920 Ga0207649_10050804 Ga0207649_100508042 299
113 3300025925 Ga0207650_10016596 Ga0207650_100165964 299
114 3300025926 Ga0207659_10004601 Ga0207659_100046019 299
115 3300025928 Ga0207700_10134521 Ga0207700_101345211 299
116 3300025929 Ga0207664_10119473 Ga0207664_101194732 299
117 3300025931 Ga0207644_10088579 Ga0207644_100885792 299
118 3300025932 Ga0207690_10027852 Ga0207690_100278522 299
119 3300025933 Ga0207706_10014986 Ga0207706_100149865 299
120 3300025940 Ga0207691_10010904 Ga0207691_100109043 299
121 3300025960 Ga0207651_10078724 Ga0207651_100787242 299
122 3300025986 Ga0207658_10267268 Ga0207658_102672682 299
123 3300026023 Ga0207677_10022838 Ga0207677_100228383 299
124 3300026121 Ga0207683_10001914 Ga0207683_1000191414 299
125 3300027907 Ga0207428_10008148 Ga0207428_1000814810 299
126 3300028379 Ga0268266_10049836 Ga0268266_100498362 299
127 3300046517 Ga0495630_0262327 Ga0495630_0262327_399_1298 299
128 3300048904 Ga0496101_0060973 Ga0496101_0060973_851_1774 299
129 3300048905 Ga0496102_0086165 Ga0496102_0086165_838_1761 299
130 3300048907 Ga0496104_0043024 Ga0496104_0043024_2647_3570 299
131 3300048908 Ga0496105_0021784 Ga0496105_0021784_3895_4818 299
132 3300048909 Ga0496106_0029042 Ga0496106_0029042_596_1519 299
133 3300048911 Ga0496108_0040572 Ga0496108_0040572_641_1564 299
134 3300048912 Ga0496109_0018420 Ga0496109_0018420_159_1082 299
135 3300048915 Ga0496112_0172554 Ga0496112_0172554_497_1420 299
136 3300049582 Ga0501048_0122292 Ga0501048_0122292_23_922 299
137 3300050508 nmdc:mga09592_42678_c1 nmdc:mga09592_42678_c1_1763_2686 299
138 3300050511 nmdc:mga08y16_934_c1 nmdc:mga08y16_934_c1_15611_16534 299
139 iso_pu_bacteria 2842775625 2842776103 300
140 3300005548 Ga0070665_100017807 Ga0070665_1000178077 302
141 3300005549 Ga0070704_100133106 Ga0070704_1001331062 302
142 3300009094 Ga0111539_10010661 Ga0111539_100106619 302
143 3300009094 Ga0111539_10878827 Ga0111539_108788271 302
144 3300027907 Ga0207428_10044386 Ga0207428_100443863 302
145 3300028556 Ga0265337_1003360 Ga0265337_10033604 302
146 3300031240 Ga0265320_10000078 Ga0265320_1000007863 302
147 3300031727 Ga0316576_10092697 Ga0316576_100926972 302
148 3300037466 Ga0395898_0002650 Ga0395898_0002650_4010_4930 302
149 3300047318 Ga0495636_0000656 Ga0495636_0000656_2334_3251 302
150 3300049571 Ga0501034_0047938 Ga0501034_0047938_743_1663 302
151 3300050511 nmdc:mga08y16_6773_c1 nmdc:mga08y16_6773_c1_10629_11546 302
152 3300053130 Ga0500642_0007212 Ga0500642_0007212_2741_3661 302
153 3300005327 Ga0070658_10012641 Ga0070658_100126414 303
154 3300005336 Ga0070680_100148742 Ga0070680_1001487422 303
155 3300005339 Ga0070660_100025395 Ga0070660_1000253954 303
156 3300005366 Ga0070659_100002525 Ga0070659_10000252512 303
157 3300005458 Ga0070681_10000261 Ga0070681_1000026123 303
158 3300005530 Ga0070679_100001058 Ga0070679_1000010585 303
159 3300005530 Ga0070679_100020319 Ga0070679_1000203195 303
160 3300005539 Ga0068853_100067438 Ga0068853_1000674382 303
161 3300005547 Ga0070693_100266262 Ga0070693_1002662621 303
162 3300005563 Ga0068855_100154889 Ga0068855_1001548892 303
163 3300005564 Ga0070664_100012636 Ga0070664_1000126362 303
164 3300006844 Ga0075428_100123355 Ga0075428_1001233552 303
165 3300006914 Ga0075436_100067033 Ga0075436_1000670332 303
166 3300009553 Ga0105249_10396788 Ga0105249_103967881 303
167 3300010375 Ga0105239_10027237 Ga0105239_100272374 303
168 3300010375 Ga0105239_10050735 Ga0105239_100507353 303
169 3300010375 Ga0105239_10593578 Ga0105239_105935781 303
170 3300013100 Ga0157373_10189626 Ga0157373_101896263 303
171 3300013307 Ga0157372_10102954 Ga0157372_101029542 303
172 3300013307 Ga0157372_10274132 Ga0157372_102741322 303
173 3300014325 Ga0163163_10014977 Ga0163163_100149773 303
174 3300025909 Ga0207705_10003355 Ga0207705_100033553 303
175 3300025912 Ga0207707_10000003 Ga0207707_10000003377 303
176 3300025912 Ga0207707_10028133 Ga0207707_100281333 303
177 3300025913 Ga0207695_10001897 Ga0207695_1000189726 303
178 3300025917 Ga0207660_10015310 Ga0207660_100153105 303
179 3300025921 Ga0207652_10000024 Ga0207652_100000245 303
180 3300025921 Ga0207652_10195049 Ga0207652_101950493 303
181 3300025932 Ga0207690_10041631 Ga0207690_100416312 303
182 3300025945 Ga0207679_10287539 Ga0207679_102875392 303
183 3300026116 Ga0207674_10011149 Ga0207674_100111496 303
184 3300028556 Ga0265337_1028599 Ga0265337_10285992 303
185 3300028800 Ga0265338_10068588 Ga0265338_100685883 303
186 3300028800 Ga0265338_10133795 Ga0265338_101337952 303
187 3300031238 Ga0265332_10056504 Ga0265332_100565041 303
188 3300031241 Ga0265325_10001592 Ga0265325_1000159219 303
189 3300031247 Ga0265340_10000404 Ga0265340_1000040424 303
190 3300031249 Ga0265339_10017384 Ga0265339_100173843 303
191 3300031711 Ga0265314_10000193 Ga0265314_1000019332 303
192 3300031712 Ga0265342_10014312 Ga0265342_100143121 303
193 3300031727 Ga0316576_10076071 Ga0316576_100760713 303
194 3300035083 Ga0373926_0039852 Ga0373926_0039852_525_1445 303
195 3300035111 Ga0373923_0126867 Ga0373923_0126867_106_1029 303
196 3300035172 Ga0373955_0028715 Ga0373955_0028715_118_1041 303
197 3300035398 Ga0316574_0055185 Ga0316574_0055185_148_1062 303
198 3300035695 Ga0373927_0007647 Ga0373927_0007647_3445_4365 303
199 3300036401 Ga0373937_0328601 Ga0373937_0328601_496_1419 303
200 3300036457 Ga0265778_007786 Ga0265778_007786_175_1095 303
201 3300042876 Ga0451577_0000031 Ga0451577_0000031_285889_286806 303
202 3300042876 Ga0451577_0445149 Ga0451577_0445149_61_990 303
203 3300044673 Ga0453683_0000698 Ga0453683_0000698_20095_21018 303
204 3300044673 Ga0453683_0065415 Ga0453683_0065415_207_1136 303
205 3300044673 Ga0453683_0071885 Ga0453683_0071885_755_1684 303
206 3300044673 Ga0453683_0123339 Ga0453683_0123339_600_1529 303
207 3300044712 Ga0453684_0002829 Ga0453684_0002829_38084_39013 303
208 3300044712 Ga0453684_0035519 Ga0453684_0035519_4249_5166 303
209 3300044712 Ga0453684_0039087 Ga0453684_0039087_5093_6022 303
210 3300044712 Ga0453684_0046622 Ga0453684_0046622_3033_3962 303
211 3300044712 Ga0453684_0169173 Ga0453684_0169173_759_1688 303
212 3300044712 Ga0453684_0338524 Ga0453684_0338524_456_1385 303
213 3300045051 Ga0451576_0097005 Ga0451576_0097005_1898_2818 303
214 3300045051 Ga0451576_0295907 Ga0451576_0295907_628_1557 303
215 3300046683 Ga0495658_0034885 Ga0495658_0034885_676_1596 303
216 3300049572 Ga0501036_0154101 Ga0501036_0154101_971_1900 303
217 3300049590 Ga0501074_0150668 Ga0501074_0150668_601_1530 303
218 3300050509 nmdc:mga0qj67_282481_c1 nmdc:mga0qj67_282481_c1_162_1091 303
219 3300050514 nmdc:mga08x19_45357_c1 nmdc:mga08x19_45357_c1_608_1528 303
220 3300061734 Ga0530510_0012872 Ga0530510_0012872_4809_5738 303
221 3300061734 Ga0530510_0103630 Ga0530510_0103630_1073_2002 303
222 3300003214 JGI25165J46597_1002109 JGI25165J46597_10021097 304
223 3300005336 Ga0070680_100187879 Ga0070680_1001878791 304
224 3300005456 Ga0070678_100037471 Ga0070678_1000374714 304
225 3300005468 Ga0070707_100268561 Ga0070707_1002685613 304
226 3300005539 Ga0068853_100002929 Ga0068853_10000292910 304
227 3300005548 Ga0070665_100051807 Ga0070665_1000518072 304
228 3300005548 Ga0070665_100638668 Ga0070665_1006386681 304
229 3300006847 Ga0075431_100020107 Ga0075431_1000201076 304
230 3300006880 Ga0075429_100354736 Ga0075429_1003547361 304
231 3300009545 Ga0105237_10002307 Ga0105237_100023073 304
232 3300010375 Ga0105239_10001288 Ga0105239_100012888 304
233 3300025261 Ga0209233_1000253 Ga0209233_10002532 304
234 3300025914 Ga0207671_10001097 Ga0207671_1000109715 304
235 3300025917 Ga0207660_10196972 Ga0207660_101969721 304
236 3300025922 Ga0207646_10248220 Ga0207646_102482202 304
237 3300026041 Ga0207639_10009494 Ga0207639_100094946 304
238 3300028379 Ga0268266_10000257 Ga0268266_1000025723 304
239 3300031691 Ga0316579_10015648 Ga0316579_100156482 304
240 3300032137 Ga0316585_10072982 Ga0316585_100729821 304
241 3300032168 Ga0316593_10025576 Ga0316593_100255762 304
242 3300037418 Ga0395900_0118408 Ga0395900_0118408_1483_2400 304
243 3300037588 Ga0316581_0057601 Ga0316581_0057601_249_1172 304
244 3300039437 Ga0436365_0969405 Ga0436365_0969405_150_1073 304
245 3300039437 Ga0436365_1432522 Ga0436365_1432522_690_1613 304
246 3300039438 Ga0436360_0819436 Ga0436360_0819436_1216_2133 304
247 3300045051 Ga0451576_0237280 Ga0451576_0237280_51_971 304
248 3300046473 Ga0495582_0014419 Ga0495582_0014419_1668_2600 304
249 3300046537 Ga0495598_0010079 Ga0495598_0010079_1052_2023 304
250 3300046681 Ga0495647_0073280 Ga0495647_0073280_422_1354 304
251 3300046683 Ga0495658_0001366 Ga0495658_0001366_11677_12618 304
252 3300048909 Ga0496106_0068256 Ga0496106_0068256_126_1058 304
253 3300048913 Ga0496110_0100673 Ga0496110_0100673_347_1279 304
254 3300049592 Ga0501076_0210392 Ga0501076_0210392_486_1412 304
255 3300050507 nmdc:mga05p37_414194_c1 nmdc:mga05p37_414194_c1_479_1417 304
256 3300050510 nmdc:mga06r32_73743_c1 nmdc:mga06r32_73743_c1_2156_3079 304
257 3300050513 nmdc:mga0rr50_187454_c1 nmdc:mga0rr50_187454_c1_727_1650 304
258 3300005444 Ga0070694_100341377 Ga0070694_1003413771 305
259 3300005518 Ga0070699_100004696 Ga0070699_1000046963 305
260 3300005536 Ga0070697_100187477 Ga0070697_1001874772 305
261 3300005843 Ga0068860_100004991 Ga0068860_1000049914 305
262 3300006847 Ga0075431_100074988 Ga0075431_1000749884 305
263 3300006852 Ga0075433_10006146 Ga0075433_100061464 305
264 3300006871 Ga0075434_100044789 Ga0075434_1000447895 305
265 3300006914 Ga0075436_100035050 Ga0075436_1000350501 305
266 3300006914 Ga0075436_100143999 Ga0075436_1001439993 305
267 3300007265 Ga0099794_10000051 Ga0099794_100000518 305
268 3300007265 Ga0099794_10057804 Ga0099794_100578041 305
269 3300009093 Ga0105240_10000041 Ga0105240_10000041102 305
270 3300009553 Ga0105249_10455959 Ga0105249_104559591 305
271 3300010375 Ga0105239_10099663 Ga0105239_100996632 305
272 3300020069 Ga0197907_11056369 Ga0197907_110563692 305
273 3300020075 Ga0206349_1060160 Ga0206349_10601601 305
274 3300020075 Ga0206349_1239780 Ga0206349_12397801 305
275 3300020080 Ga0206350_10765337 Ga0206350_107653374 305
276 3300022467 Ga0224712_10049073 Ga0224712_100490731 305
277 3300022467 Ga0224712_10079843 Ga0224712_100798432 305
278 3300025913 Ga0207695_10000125 Ga0207695_10000125147 305
279 3300025939 Ga0207665_10077805 Ga0207665_100778052 305
280 3300027671 Ga0209588_1000010 Ga0209588_100001049 305
281 3300028381 Ga0268264_10003412 Ga0268264_100034128 305
282 3300031901 Ga0307406_10004608 Ga0307406_100046082 305
283 3300037312 Ga0395899_0005409 Ga0395899_0005409_4692_5693 305
284 3300046459 Ga0495629_0000001 Ga0495629_0000001_561868_562791 305
285 3300046663 Ga0495635_0001175 Ga0495635_0001175_9449_10372 305
286 3300046690 Ga0495624_0128518 Ga0495624_0128518_110_1033 305
287 3300046809 Ga0495600_0002828 Ga0495600_0002828_3930_4853 305
288 3300047322 Ga0495680_0001540 Ga0495680_0001540_18308_19231 305
289 3300047471 Ga0495684_0001985 Ga0495684_0001985_7716_8639 305
290 3300048913 Ga0496110_0015477 Ga0496110_0015477_4511_5434 305
291 3300048914 Ga0496111_0346852 Ga0496111_0346852_60_983 305
292 3300048927 Ga0496124_0000003 Ga0496124_0000003_695486_696409 305
293 3300048928 Ga0496125_0138852 Ga0496125_0138852_641_1564 305
294 3300049571 Ga0501034_0026670 Ga0501034_0026670_86_1012 305
295 3300049574 Ga0501038_0364813 Ga0501038_0364813_115_1044 305
296 3300049580 Ga0501046_0004181 Ga0501046_0004181_1634_2554 305
297 3300049586 Ga0501070_0038080 Ga0501070_0038080_1460_2380 305
298 3300049823 Ga0501044_0091876 Ga0501044_0091876_667_1587 305
299 3300050510 nmdc:mga06r32_41561_c1 nmdc:mga06r32_41561_c1_467_1411 305
300 3300050511 nmdc:mga08y16_52600_c1 nmdc:mga08y16_52600_c1_3212_4132 305
301 3300050512 nmdc:mga0n895_57103_c1 nmdc:mga0n895_57103_c1_1554_2474 305
302 3300050514 nmdc:mga08x19_270840_c1 nmdc:mga08x19_270840_c1_184_1104 305
303 3300050514 nmdc:mga08x19_67624_c1 nmdc:mga08x19_67624_c1_847_1767 305
304 3300050515 nmdc:mga0a205_389381_c1 nmdc:mga0a205_389381_c1_150_1070 305
305 3300003203 JGI25406J46586_10026155 JGI25406J46586_100261552 306
306 3300004801 Ga0058860_10025827 Ga0058860_100258271 306
307 3300005347 Ga0070668_100028216 Ga0070668_1000282162 306
308 3300005353 Ga0070669_100006746 Ga0070669_1000067466 306
309 3300005444 Ga0070694_100057405 Ga0070694_1000574052 306
310 3300005445 Ga0070708_100010383 Ga0070708_1000103832 306
311 3300005445 Ga0070708_100020404 Ga0070708_1000204043 306
312 3300005445 Ga0070708_100046121 Ga0070708_1000461214 306
313 3300005457 Ga0070662_100021182 Ga0070662_1000211823 306
314 3300005467 Ga0070706_100016786 Ga0070706_1000167862 306
315 3300005467 Ga0070706_100022592 Ga0070706_1000225922 306
316 3300005467 Ga0070706_100196461 Ga0070706_1001964612 306
317 3300005467 Ga0070706_100214816 Ga0070706_1002148162 306
318 3300005468 Ga0070707_100003627 Ga0070707_1000036272 306
319 3300005468 Ga0070707_100117473 Ga0070707_1001174732 306
320 3300005468 Ga0070707_100117749 Ga0070707_1001177492 306
321 3300005468 Ga0070707_100188419 Ga0070707_1001884192 306
322 3300005471 Ga0070698_100004971 Ga0070698_1000049712 306
323 3300005471 Ga0070698_100076866 Ga0070698_1000768663 306
324 3300005471 Ga0070698_100138311 Ga0070698_1001383111 306
325 3300005518 Ga0070699_100001508 Ga0070699_10000150813 306
326 3300005518 Ga0070699_100098434 Ga0070699_1000984342 306
327 3300005518 Ga0070699_100180049 Ga0070699_1001800492 306
328 3300005518 Ga0070699_100233214 Ga0070699_1002332142 306
329 3300005536 Ga0070697_100019444 Ga0070697_1000194442 306
330 3300005536 Ga0070697_100040774 Ga0070697_1000407742 306
331 3300005536 Ga0070697_100052264 Ga0070697_1000522643 306
332 3300005536 Ga0070697_100132525 Ga0070697_1001325252 306
333 3300005546 Ga0070696_100090442 Ga0070696_1000904422 306
334 3300005546 Ga0070696_100122392 Ga0070696_1001223922 306
335 3300005549 Ga0070704_100036807 Ga0070704_1000368072 306
336 3300005549 Ga0070704_100313730 Ga0070704_1003137301 306
337 3300005549 Ga0070704_100357219 Ga0070704_1003572191 306
338 3300005841 Ga0068863_100091308 Ga0068863_1000913083 306
339 3300005843 Ga0068860_100232421 Ga0068860_1002324212 306
340 3300005937 Ga0081455_10260101 Ga0081455_102601012 306
341 3300005981 Ga0081538_10049728 Ga0081538_100497282 306
342 3300005985 Ga0081539_10000069 Ga0081539_1000006943 306
343 3300006028 Ga0070717_10328943 Ga0070717_103289432 306
344 3300006173 Ga0070716_100103005 Ga0070716_1001030052 306
345 3300006844 Ga0075428_100001434 Ga0075428_1000014348 306
346 3300006844 Ga0075428_100066481 Ga0075428_1000664812 306
347 3300006846 Ga0075430_100000480 Ga0075430_10000048018 306
348 3300006846 Ga0075430_100003937 Ga0075430_1000039375 306
349 3300006846 Ga0075430_100016264 Ga0075430_1000162644 306
350 3300006846 Ga0075430_100153809 Ga0075430_1001538091 306
351 3300006847 Ga0075431_100000016 Ga0075431_10000001674 306
352 3300006847 Ga0075431_100000127 Ga0075431_10000012728 306
353 3300006847 Ga0075431_100023856 Ga0075431_1000238563 306
354 3300006847 Ga0075431_100200690 Ga0075431_1002006902 306
355 3300006852 Ga0075433_10002610 Ga0075433_100026109 306
356 3300006852 Ga0075433_10053691 Ga0075433_100536912 306
357 3300006871 Ga0075434_100068041 Ga0075434_1000680412 306
358 3300006880 Ga0075429_100051717 Ga0075429_1000517172 306
359 3300006880 Ga0075429_100142440 Ga0075429_1001424402 306
360 3300006880 Ga0075429_100147690 Ga0075429_1001476902 306
361 3300006880 Ga0075429_100189387 Ga0075429_1001893872 306
362 3300006914 Ga0075436_100000659 Ga0075436_1000006594 306
363 3300006914 Ga0075436_100209882 Ga0075436_1002098822 306
364 3300009094 Ga0111539_10080139 Ga0111539_100801393 306
365 3300009147 Ga0114129_10000093 Ga0114129_1000009365 306
366 3300009147 Ga0114129_10003396 Ga0114129_100033968 306
367 3300009147 Ga0114129_10003570 Ga0114129_100035702 306
368 3300009147 Ga0114129_10043934 Ga0114129_100439344 306
369 3300009147 Ga0114129_10074063 Ga0114129_100740633 306
370 3300009147 Ga0114129_10162001 Ga0114129_101620013 306
371 3300009147 Ga0114129_10237963 Ga0114129_102379631 306
372 3300009147 Ga0114129_10302202 Ga0114129_103022022 306
373 3300009147 Ga0114129_10402286 Ga0114129_104022862 306
374 3300009148 Ga0105243_10105459 Ga0105243_101054592 306
375 3300009174 Ga0105241_10002639 Ga0105241_100026396 306
376 3300009176 Ga0105242_10267145 Ga0105242_102671452 306
377 3300009553 Ga0105249_10170627 Ga0105249_101706272 306
378 3300013306 Ga0163162_10026169 Ga0163162_100261693 306
379 3300013308 Ga0157375_10048140 Ga0157375_100481403 306
380 3300014326 Ga0157380_10072730 Ga0157380_100727302 306
381 3300017792 Ga0163161_10052577 Ga0163161_100525772 306
382 3300020069 Ga0197907_10541769 Ga0197907_105417691 306
383 3300020069 Ga0197907_10662627 Ga0197907_106626271 306
384 3300020069 Ga0197907_10674868 Ga0197907_106748682 306
385 3300020069 Ga0197907_11169213 Ga0197907_111692132 306
386 3300020070 Ga0206356_11515020 Ga0206356_115150202 306
387 3300020070 Ga0206356_11856893 Ga0206356_118568931 306
388 3300020075 Ga0206349_1240892 Ga0206349_12408922 306
389 3300020075 Ga0206349_1284932 Ga0206349_12849321 306
390 3300020075 Ga0206349_1615189 Ga0206349_16151892 306
391 3300020075 Ga0206349_1909150 Ga0206349_19091501 306
392 3300020077 Ga0206351_10265613 Ga0206351_102656131 306
393 3300020077 Ga0206351_10320234 Ga0206351_103202341 306
394 3300020078 Ga0206352_10806553 Ga0206352_108065531 306
395 3300020078 Ga0206352_11088056 Ga0206352_110880561 306
396 3300020080 Ga0206350_10055406 Ga0206350_100554062 306
397 3300020080 Ga0206350_10055662 Ga0206350_100556622 306
398 3300020080 Ga0206350_10058979 Ga0206350_100589791 306
399 3300020080 Ga0206350_10383671 Ga0206350_103836711 306
400 3300020080 Ga0206350_10702709 Ga0206350_107027092 306
401 3300020080 Ga0206350_10787735 Ga0206350_107877351 306
402 3300020080 Ga0206350_11004085 Ga0206350_110040851 306
403 3300020080 Ga0206350_11495803 Ga0206350_114958031 306
404 3300020082 Ga0206353_10502351 Ga0206353_105023512 306
405 3300021388 Ga0213875_10066143 Ga0213875_100661432 306
406 3300022467 Ga0224712_10040530 Ga0224712_100405301 306
407 3300022467 Ga0224712_10087311 Ga0224712_100873111 306
408 3300022467 Ga0224712_10108465 Ga0224712_101084651 306
409 3300022467 Ga0224712_10160799 Ga0224712_101607991 306
410 3300025910 Ga0207684_10000699 Ga0207684_1000069916 306
411 3300025910 Ga0207684_10006205 Ga0207684_100062055 306
412 3300025910 Ga0207684_10082354 Ga0207684_100823541 306
413 3300025910 Ga0207684_10194903 Ga0207684_101949031 306
414 3300025922 Ga0207646_10006130 Ga0207646_100061304 306
415 3300025922 Ga0207646_10034841 Ga0207646_100348413 306
416 3300025922 Ga0207646_10043460 Ga0207646_100434603 306
417 3300025922 Ga0207646_10049366 Ga0207646_100493662 306
418 3300025923 Ga0207681_10081535 Ga0207681_100815352 306
419 3300025935 Ga0207709_10108894 Ga0207709_101088942 306
420 3300025940 Ga0207691_10045517 Ga0207691_100455172 306
421 3300025972 Ga0207668_10065445 Ga0207668_100654452 306
422 3300026035 Ga0207703_10076252 Ga0207703_100762522 306
423 3300026088 Ga0207641_10069103 Ga0207641_100691033 306
424 3300027907 Ga0207428_10108472 Ga0207428_101084722 306
425 3300028381 Ga0268264_10230141 Ga0268264_102301412 306
426 3300028563 Ga0265319_1000997 Ga0265319_100099711 306
427 3300028573 Ga0265334_10035763 Ga0265334_100357632 306
428 3300028577 Ga0265318_10000203 Ga0265318_1000020317 306
429 3300028577 Ga0265318_10001992 Ga0265318_100019923 306
430 3300028577 Ga0265318_10007232 Ga0265318_100072326 306
431 3300028800 Ga0265338_10019349 Ga0265338_100193491 306
432 3300028800 Ga0265338_10020668 Ga0265338_100206682 306
433 3300031235 Ga0265330_10000562 Ga0265330_1000056217 306
434 3300031235 Ga0265330_10012846 Ga0265330_100128463 306
435 3300031238 Ga0265332_10000369 Ga0265332_1000036917 306
436 3300031238 Ga0265332_10000906 Ga0265332_100009063 306
437 3300031239 Ga0265328_10009142 Ga0265328_100091421 306
438 3300031239 Ga0265328_10009295 Ga0265328_100092952 306
439 3300031239 Ga0265328_10039838 Ga0265328_100398382 306
440 3300031240 Ga0265320_10001291 Ga0265320_100012915 306
441 3300031240 Ga0265320_10043015 Ga0265320_100430152 306
442 3300031240 Ga0265320_10096604 Ga0265320_100966041 306
443 3300031241 Ga0265325_10029008 Ga0265325_100290082 306
444 3300031242 Ga0265329_10001244 Ga0265329_100012445 306
445 3300031242 Ga0265329_10013205 Ga0265329_100132052 306
446 3300031247 Ga0265340_10000201 Ga0265340_1000020113 306
447 3300031247 Ga0265340_10003154 Ga0265340_100031542 306
448 3300031249 Ga0265339_10006243 Ga0265339_100062431 306
449 3300031250 Ga0265331_10000032 Ga0265331_1000003290 306
450 3300031250 Ga0265331_10001059 Ga0265331_1000105917 306
451 3300031250 Ga0265331_10007127 Ga0265331_100071274 306
452 3300031344 Ga0265316_10003440 Ga0265316_1000344011 306
453 3300031344 Ga0265316_10010806 Ga0265316_100108063 306
454 3300031548 Ga0307408_100053526 Ga0307408_1000535262 306
455 3300031548 Ga0307408_100277640 Ga0307408_1002776402 306
456 3300031595 Ga0265313_10000095 Ga0265313_1000009561 306
457 3300031711 Ga0265314_10000215 Ga0265314_1000021565 306
458 3300031711 Ga0265314_10001016 Ga0265314_1000101611 306
459 3300031712 Ga0265342_10000560 Ga0265342_1000056017 306
460 3300031712 Ga0265342_10005756 Ga0265342_100057567 306
461 3300031995 Ga0307409_100220664 Ga0307409_1002206642 306
462 3300035119 Ga0373956_0001166 Ga0373956_0001166_8951_9874 306
463 3300035695 Ga0373927_0000015 Ga0373927_0000015_148066_148989 306
464 3300035724 Ga0373933_0007886 Ga0373933_0007886_3079_4002 306
465 3300035724 Ga0373933_0019859 Ga0373933_0019859_1960_2883 306
466 3300037312 Ga0395899_0023622 Ga0395899_0023622_3131_4060 306
467 3300037312 Ga0395899_0055121 Ga0395899_0055121_809_1732 306
468 3300037418 Ga0395900_0000485 Ga0395900_0000485_52727_53656 306
469 3300037466 Ga0395898_0008040 Ga0395898_0008040_9735_10664 306
470 3300037471 Ga0395905_0013517 Ga0395905_0013517_1874_2797 306
471 3300037853 Ga0436364_0112710 Ga0436364_0112710_475_1401 306
472 3300038443 Ga0395901_0000955 Ga0395901_0000955_23900_24829 306
473 3300038443 Ga0395901_0018330 Ga0395901_0018330_3404_4327 306
474 3300039093 Ga0400489_44064 Ga0400489_44064_2475_3401 306
475 3300044656 Ga0466969_0001971 Ga0466969_0001971_5853_6776 306
476 3300044656 Ga0466969_0038556 Ga0466969_0038556_528_1451 306
477 3300044658 Ga0466972_0011726 Ga0466972_0011726_2553_3476 306
478 3300044673 Ga0453683_0000919 Ga0453683_0000919_411_1394 306
479 3300044683 Ga0466965_0048556 Ga0466965_0048556_504_1427 306
480 3300044684 Ga0466966_0004193 Ga0466966_0004193_4419_5342 306
481 3300044684 Ga0466966_0097539 Ga0466966_0097539_652_1575 306
482 3300044693 Ga0466961_0045312 Ga0466961_0045312_845_1768 306
483 3300044706 Ga0466964_0022134 Ga0466964_0022134_1097_2020 306
484 3300044719 Ga0466971_0102965 Ga0466971_0102965_351_1274 306
485 3300044735 Ga0466968_0001893 Ga0466968_0001893_346_1269 306
486 3300044765 Ga0466970_0000302 Ga0466970_0000302_17973_18896 306
487 3300045049 Ga0466959_0055727 Ga0466959_0055727_1866_2789 306
488 3300045836 Ga0466958_0036170 Ga0466958_0036170_1383_2336 306
489 3300046528 Ga0495642_0006635 Ga0495642_0006635_3099_4028 306
490 3300048903 Ga0496100_0303282 Ga0496100_0303282_201_1130 306
491 3300048905 Ga0496102_0309762 Ga0496102_0309762_307_1236 306
492 3300048929 Ga0496126_0023537 Ga0496126_0023537_3089_4015 306
493 3300048929 Ga0496126_0074959 Ga0496126_0074959_799_1737 306
494 3300049570 Ga0501033_0252585 Ga0501033_0252585_57_980 306
495 3300049571 Ga0501034_0022542 Ga0501034_0022542_2169_3113 306
496 3300049573 Ga0501037_0001886 Ga0501037_0001886_4888_5832 306
497 3300049573 Ga0501037_0230592 Ga0501037_0230592_280_1203 306
498 3300049575 Ga0501039_0052477 Ga0501039_0052477_987_1910 306
499 3300049576 Ga0501040_0015463 Ga0501040_0015463_130_1053 306
500 3300049576 Ga0501040_0064296 Ga0501040_0064296_440_1363 306
501 3300049577 Ga0501041_0168413 Ga0501041_0168413_274_1197 306
502 3300049581 Ga0501047_0197931 Ga0501047_0197931_451_1395 306
503 3300049582 Ga0501048_0024348 Ga0501048_0024348_3283_4206 306
504 3300049582 Ga0501048_0266575 Ga0501048_0266575_261_1205 306
505 3300049583 Ga0501067_0004610 Ga0501067_0004610_3256_4179 306
506 3300049584 Ga0501068_0060068 Ga0501068_0060068_1289_2212 306
507 3300049584 Ga0501068_0089604 Ga0501068_0089604_454_1377 306
508 3300049585 Ga0501069_0019093 Ga0501069_0019093_1172_2095 306
509 3300049587 Ga0501071_0042663 Ga0501071_0042663_337_1260 306
510 3300049588 Ga0501072_0030558 Ga0501072_0030558_21_950 306
511 3300049590 Ga0501074_0064534 Ga0501074_0064534_1676_2599 306
512 3300049591 Ga0501075_0007603 Ga0501075_0007603_2739_3662 306
513 3300049592 Ga0501076_0022670 Ga0501076_0022670_791_1714 306
514 3300049592 Ga0501076_0029092 Ga0501076_0029092_1963_2892 306
515 3300049592 Ga0501076_0146420 Ga0501076_0146420_881_1804 306
516 3300049592 Ga0501076_0399759 Ga0501076_0399759_152_1081 306
517 3300049741 Ga0501079_0043256 Ga0501079_0043256_206_1129 306
518 3300049741 Ga0501079_0224433 Ga0501079_0224433_356_1285 306
519 3300049742 Ga0501080_0115345 Ga0501080_0115345_210_1133 306
520 3300049743 Ga0501081_0002723 Ga0501081_0002723_540_1463 306
521 3300049743 Ga0501081_0368573 Ga0501081_0368573_106_1029 306
522 3300049823 Ga0501044_0001768 Ga0501044_0001768_10334_11278 306
523 3300049824 Ga0501045_0024815 Ga0501045_0024815_2261_3184 306
524 3300050507 nmdc:mga05p37_200834_c1 nmdc:mga05p37_200834_c1_754_1677 306
525 3300050507 nmdc:mga05p37_28610_c1 nmdc:mga05p37_28610_c1_5272_6195 306
526 3300050507 nmdc:mga05p37_290369_c1 nmdc:mga05p37_290369_c1_33_956 306
527 3300050507 nmdc:mga05p37_3014_c1 nmdc:mga05p37_3014_c1_2621_3544 306
528 3300050507 nmdc:mga05p37_389043_c1 nmdc:mga05p37_389043_c1_363_1286 306
529 3300050507 nmdc:mga05p37_492_c1 nmdc:mga05p37_492_c1_23779_24702 306
530 3300050507 nmdc:mga05p37_58168_c1 nmdc:mga05p37_58168_c1_979_1908 306
531 3300050507 nmdc:mga05p37_66414_c1 nmdc:mga05p37_66414_c1_1693_2622 306
532 3300050508 nmdc:mga09592_216432_c1 nmdc:mga09592_216432_c1_420_1343 306
533 3300050508 nmdc:mga09592_292380_c1 nmdc:mga09592_292380_c1_13_945 306
534 3300050508 nmdc:mga09592_464949_c1 nmdc:mga09592_464949_c1_53_976 306
535 3300050509 nmdc:mga0qj67_142933_c1 nmdc:mga0qj67_142933_c1_908_1831 306
536 3300050509 nmdc:mga0qj67_1701_c1 nmdc:mga0qj67_1701_c1_13449_14378 306
537 3300050510 nmdc:mga06r32_10844_c1 nmdc:mga06r32_10844_c1_252_1181 306
538 3300050510 nmdc:mga06r32_115477_c1 nmdc:mga06r32_115477_c1_247_1170 306
539 3300050510 nmdc:mga06r32_2087_c1 nmdc:mga06r32_2087_c1_2010_2933 306
540 3300050510 nmdc:mga06r32_235873_c1 nmdc:mga06r32_235873_c1_106_1029 306
541 3300050510 nmdc:mga06r32_95971_c1 nmdc:mga06r32_95971_c1_1662_2585 306
542 3300050511 nmdc:mga08y16_64703_c1 nmdc:mga08y16_64703_c1_2678_3601 306
543 3300050512 nmdc:mga0n895_382_c1 nmdc:mga0n895_382_c1_14261_15184 306
544 3300050512 nmdc:mga0n895_546338_c1 nmdc:mga0n895_546338_c1_154_1083 306
545 3300050512 nmdc:mga0n895_83587_c1 nmdc:mga0n895_83587_c1_1065_1994 306
546 3300050513 nmdc:mga0rr50_590_c1 nmdc:mga0rr50_590_c1_3104_4027 306
547 3300050514 nmdc:mga08x19_21650_c1 nmdc:mga08x19_21650_c1_1720_2649 306
548 3300050514 nmdc:mga08x19_2518_c1 nmdc:mga08x19_2518_c1_4028_4951 306
549 3300050515 nmdc:mga0a205_2800_c1 nmdc:mga0a205_2800_c1_1137_2060 306
550 3300050515 nmdc:mga0a205_53320_c1 nmdc:mga0a205_53320_c1_236_1165 306
551 3300053178 Ga0500637_0097293 Ga0500637_0097293_559_1482 306
552 3300054114 Ga0501084_0006437 Ga0501084_0006437_6694_7617 306
553 3300054114 Ga0501084_0198229 Ga0501084_0198229_90_1013 306
554 3300060353 Ga0501082_0009246 Ga0501082_0009246_6905_7828 306
555 3300060353 Ga0501082_0135336 Ga0501082_0135336_496_1425 306
556 3300060353 Ga0501082_0187891 Ga0501082_0187891_663_1589 306
557 3300060353 Ga0501082_0285481 Ga0501082_0285481_284_1207 306
558 3300061734 Ga0530510_0016896 Ga0530510_0016896_175_1098 306
559 3300061734 Ga0530510_0026956 Ga0530510_0026956_1868_2797 306
560 3300061734 Ga0530510_0181888 Ga0530510_0181888_82_1005 306
561 3300005295 Ga0065707_10089909 Ga0065707_100899094 307
562 3300005295 Ga0065707_10168871 Ga0065707_101688711 307
563 3300005327 Ga0070658_10039295 Ga0070658_100392955 307
564 3300005330 Ga0070690_100005668 Ga0070690_1000056685 307
565 3300005334 Ga0068869_100001552 Ga0068869_1000015524 307
566 3300005334 Ga0068869_100009551 Ga0068869_1000095514 307
567 3300005334 Ga0068869_100010696 Ga0068869_1000106968 307
568 3300005335 Ga0070666_10085263 Ga0070666_100852632 307
569 3300005336 Ga0070680_100012414 Ga0070680_1000124144 307
570 3300005336 Ga0070680_100015417 Ga0070680_1000154174 307
571 3300005336 Ga0070680_100038404 Ga0070680_1000384042 307
572 3300005336 Ga0070680_100355115 Ga0070680_1003551151 307
573 3300005337 Ga0070682_100000097 Ga0070682_10000009755 307
574 3300005339 Ga0070660_100015375 Ga0070660_1000153754 307
575 3300005339 Ga0070660_100164391 Ga0070660_1001643912 307
576 3300005340 Ga0070689_100000971 Ga0070689_1000009719 307
577 3300005340 Ga0070689_100023305 Ga0070689_1000233054 307
578 3300005343 Ga0070687_100020341 Ga0070687_1000203412 307
579 3300005344 Ga0070661_100002637 Ga0070661_10000263710 307
580 3300005345 Ga0070692_10004829 Ga0070692_100048294 307
581 3300005345 Ga0070692_10084982 Ga0070692_100849822 307
582 3300005345 Ga0070692_10117685 Ga0070692_101176852 307
583 3300005353 Ga0070669_100050269 Ga0070669_1000502691 307
584 3300005353 Ga0070669_100152728 Ga0070669_1001527282 307
585 3300005355 Ga0070671_100191147 Ga0070671_1001911472 307
586 3300005365 Ga0070688_100009809 Ga0070688_1000098095 307
587 3300005366 Ga0070659_100018737 Ga0070659_1000187374 307
588 3300005406 Ga0070703_10001834 Ga0070703_100018347 307
589 3300005434 Ga0070709_10347955 Ga0070709_103479551 307
590 3300005438 Ga0070701_10000349 Ga0070701_100003498 307
591 3300005438 Ga0070701_10040834 Ga0070701_100408343 307
592 3300005439 Ga0070711_100061971 Ga0070711_1000619712 307
593 3300005439 Ga0070711_100276903 Ga0070711_1002769032 307
594 3300005440 Ga0070705_100008044 Ga0070705_1000080444 307
595 3300005440 Ga0070705_100008184 Ga0070705_1000081845 307
596 3300005440 Ga0070705_100060031 Ga0070705_1000600312 307
597 3300005441 Ga0070700_100002242 Ga0070700_1000022428 307
598 3300005444 Ga0070694_100020371 Ga0070694_1000203712 307
599 3300005444 Ga0070694_100028743 Ga0070694_1000287432 307
600 3300005444 Ga0070694_100031575 Ga0070694_1000315753 307
601 3300005444 Ga0070694_100037693 Ga0070694_1000376933 307
602 3300005444 Ga0070694_100078549 Ga0070694_1000785492 307
603 3300005444 Ga0070694_100123507 Ga0070694_1001235071 307
604 3300005445 Ga0070708_100010849 Ga0070708_1000108496 307
605 3300005445 Ga0070708_100046061 Ga0070708_1000460613 307
606 3300005445 Ga0070708_100087748 Ga0070708_1000877482 307
607 3300005445 Ga0070708_100110507 Ga0070708_1001105073 307
608 3300005445 Ga0070708_100196309 Ga0070708_1001963092 307
609 3300005445 Ga0070708_100348800 Ga0070708_1003488002 307
610 3300005455 Ga0070663_100253609 Ga0070663_1002536092 307
611 3300005457 Ga0070662_100005086 Ga0070662_1000050865 307
612 3300005457 Ga0070662_100094981 Ga0070662_1000949812 307
613 3300005458 Ga0070681_10003551 Ga0070681_100035514 307
614 3300005458 Ga0070681_10023965 Ga0070681_100239653 307
615 3300005458 Ga0070681_10100089 Ga0070681_101000891 307
616 3300005459 Ga0068867_100000768 Ga0068867_10000076820 307
617 3300005466 Ga0070685_10000043 Ga0070685_100000432 307
618 3300005467 Ga0070706_100000391 Ga0070706_10000039133 307
619 3300005467 Ga0070706_100001836 Ga0070706_1000018364 307
620 3300005467 Ga0070706_100004069 Ga0070706_10000406911 307
621 3300005467 Ga0070706_100009376 Ga0070706_1000093768 307
622 3300005467 Ga0070706_100020671 Ga0070706_1000206713 307
623 3300005467 Ga0070706_100030922 Ga0070706_1000309225 307
624 3300005467 Ga0070706_100053511 Ga0070706_1000535112 307
625 3300005467 Ga0070706_100092074 Ga0070706_1000920742 307
626 3300005467 Ga0070706_100322484 Ga0070706_1003224842 307
627 3300005467 Ga0070706_100662540 Ga0070706_1006625401 307
628 3300005468 Ga0070707_100000020 Ga0070707_10000002024 307
629 3300005468 Ga0070707_100004343 Ga0070707_10000434310 307
630 3300005468 Ga0070707_100026063 Ga0070707_1000260633 307
631 3300005468 Ga0070707_100028396 Ga0070707_1000283962 307
632 3300005468 Ga0070707_100034017 Ga0070707_1000340172 307
633 3300005468 Ga0070707_100036068 Ga0070707_1000360686 307
634 3300005468 Ga0070707_100062096 Ga0070707_1000620962 307
635 3300005468 Ga0070707_100089136 Ga0070707_1000891362 307
636 3300005471 Ga0070698_100005671 Ga0070698_10000567111 307
637 3300005471 Ga0070698_100014324 Ga0070698_1000143246 307
638 3300005471 Ga0070698_100057652 Ga0070698_1000576523 307
639 3300005471 Ga0070698_100106329 Ga0070698_1001063292 307
640 3300005471 Ga0070698_100115250 Ga0070698_1001152502 307
641 3300005518 Ga0070699_100005374 Ga0070699_10000537410 307
642 3300005518 Ga0070699_100007767 Ga0070699_1000077677 307
643 3300005518 Ga0070699_100018835 Ga0070699_1000188355 307
644 3300005518 Ga0070699_100023370 Ga0070699_1000233705 307
645 3300005518 Ga0070699_100037610 Ga0070699_1000376102 307
646 3300005518 Ga0070699_100042161 Ga0070699_1000421614 307
647 3300005518 Ga0070699_100045810 Ga0070699_1000458102 307
648 3300005518 Ga0070699_100079625 Ga0070699_1000796251 307
649 3300005518 Ga0070699_100112219 Ga0070699_1001122192 307
650 3300005518 Ga0070699_100124741 Ga0070699_1001247412 307
651 3300005518 Ga0070699_100557147 Ga0070699_1005571471 307
652 3300005530 Ga0070679_100000407 Ga0070679_1000004074 307
653 3300005536 Ga0070697_100002321 Ga0070697_1000023215 307
654 3300005536 Ga0070697_100023388 Ga0070697_1000233882 307
655 3300005539 Ga0068853_100022317 Ga0068853_1000223174 307
656 3300005543 Ga0070672_100046323 Ga0070672_1000463232 307
657 3300005544 Ga0070686_100001492 Ga0070686_1000014925 307
658 3300005545 Ga0070695_100000568 Ga0070695_10000056818 307
659 3300005545 Ga0070695_100002576 Ga0070695_1000025768 307
660 3300005545 Ga0070695_100004078 Ga0070695_1000040783 307
661 3300005545 Ga0070695_100015694 Ga0070695_1000156944 307
662 3300005545 Ga0070695_100028367 Ga0070695_1000283673 307
663 3300005545 Ga0070695_100134542 Ga0070695_1001345421 307
664 3300005546 Ga0070696_100000494 Ga0070696_10000049417 307
665 3300005546 Ga0070696_100004753 Ga0070696_1000047537 307
666 3300005546 Ga0070696_100014439 Ga0070696_1000144392 307
667 3300005546 Ga0070696_100063779 Ga0070696_1000637792 307
668 3300005546 Ga0070696_100417531 Ga0070696_1004175311 307
669 3300005547 Ga0070693_100000364 Ga0070693_10000036418 307
670 3300005547 Ga0070693_100067860 Ga0070693_1000678602 307
671 3300005549 Ga0070704_100002975 Ga0070704_1000029757 307
672 3300005549 Ga0070704_100057375 Ga0070704_1000573752 307
673 3300005549 Ga0070704_100217660 Ga0070704_1002176602 307
674 3300005564 Ga0070664_100000430 Ga0070664_1000004303 307
675 3300005564 Ga0070664_100023033 Ga0070664_1000230334 307
676 3300005564 Ga0070664_100115549 Ga0070664_1001155492 307
677 3300005577 Ga0068857_100025315 Ga0068857_1000253154 307
678 3300005577 Ga0068857_100037288 Ga0068857_1000372882 307
679 3300005578 Ga0068854_100002896 Ga0068854_10000289610 307
680 3300005614 Ga0068856_100031052 Ga0068856_1000310524 307
681 3300005614 Ga0068856_100194924 Ga0068856_1001949242 307
682 3300005615 Ga0070702_100062333 Ga0070702_1000623332 307
683 3300005617 Ga0068859_100000761 Ga0068859_10000076118 307
684 3300005617 Ga0068859_100003234 Ga0068859_1000032343 307
685 3300005617 Ga0068859_100115007 Ga0068859_1001150072 307
686 3300005617 Ga0068859_100141288 Ga0068859_1001412882 307
687 3300005618 Ga0068864_100006065 Ga0068864_1000060658 307
688 3300005618 Ga0068864_100102514 Ga0068864_1001025142 307
689 3300005618 Ga0068864_100186242 Ga0068864_1001862422 307
690 3300005718 Ga0068866_10065435 Ga0068866_100654352 307
691 3300005840 Ga0068870_10000344 Ga0068870_1000034415 307
692 3300005841 Ga0068863_100121331 Ga0068863_1001213312 307
693 3300005842 Ga0068858_100001091 Ga0068858_10000109122 307
694 3300005842 Ga0068858_100061352 Ga0068858_1000613522 307
695 3300005843 Ga0068860_100010570 Ga0068860_1000105705 307
696 3300005843 Ga0068860_100051349 Ga0068860_1000513492 307
697 3300005843 Ga0068860_100107032 Ga0068860_1001070323 307
698 3300005843 Ga0068860_100374998 Ga0068860_1003749982 307
699 3300005844 Ga0068862_100019969 Ga0068862_1000199694 307
700 3300005844 Ga0068862_100029327 Ga0068862_1000293276 307
701 3300005844 Ga0068862_100054687 Ga0068862_1000546874 307
702 3300006163 Ga0070715_10060210 Ga0070715_100602102 307
703 3300006163 Ga0070715_10141223 Ga0070715_101412232 307
704 3300006844 Ga0075428_100046174 Ga0075428_1000461746 307
705 3300006844 Ga0075428_100107832 Ga0075428_1001078323 307
706 3300006844 Ga0075428_100388783 Ga0075428_1003887832 307
707 3300006846 Ga0075430_100003542 Ga0075430_10000354215 307
708 3300006846 Ga0075430_100005556 Ga0075430_1000055568 307
709 3300006847 Ga0075431_100000851 Ga0075431_10000085123 307
710 3300006847 Ga0075431_100025816 Ga0075431_1000258165 307
711 3300006852 Ga0075433_10004841 Ga0075433_100048419 307
712 3300006852 Ga0075433_10010307 Ga0075433_100103076 307
713 3300006852 Ga0075433_10015008 Ga0075433_100150084 307
714 3300006852 Ga0075433_10019642 Ga0075433_100196424 307
715 3300006852 Ga0075433_10074610 Ga0075433_100746104 307
716 3300006852 Ga0075433_10148131 Ga0075433_101481312 307
717 3300006852 Ga0075433_10148516 Ga0075433_101485162 307
718 3300006852 Ga0075433_10381077 Ga0075433_103810771 307
719 3300006871 Ga0075434_100026137 Ga0075434_1000261377 307
720 3300006871 Ga0075434_100030189 Ga0075434_1000301895 307
721 3300006871 Ga0075434_100031806 Ga0075434_1000318062 307
722 3300006871 Ga0075434_100158700 Ga0075434_1001587001 307
723 3300006871 Ga0075434_100222003 Ga0075434_1002220032 307
724 3300006880 Ga0075429_100252510 Ga0075429_1002525102 307
725 3300006914 Ga0075436_100022658 Ga0075436_1000226584 307
726 3300006914 Ga0075436_100089818 Ga0075436_1000898182 307
727 3300006914 Ga0075436_100276736 Ga0075436_1002767362 307
728 3300006931 Ga0097620_100000761 Ga0097620_10000076118 307
729 3300006931 Ga0097620_100003234 Ga0097620_1000032343 307
730 3300006931 Ga0097620_100115005 Ga0097620_1001150052 307
731 3300006931 Ga0097620_100141278 Ga0097620_1001412782 307
732 3300007076 Ga0075435_100000446 Ga0075435_10000044616 307
733 3300007076 Ga0075435_100003851 Ga0075435_10000385110 307
734 3300007076 Ga0075435_100185350 Ga0075435_1001853502 307
735 3300007076 Ga0075435_100284140 Ga0075435_1002841402 307
736 3300007265 Ga0099794_10011530 Ga0099794_100115303 307
737 3300009093 Ga0105240_10566718 Ga0105240_105667182 307
738 3300009094 Ga0111539_10001558 Ga0111539_100015586 307
739 3300009094 Ga0111539_10766609 Ga0111539_107666091 307
740 3300009098 Ga0105245_10025527 Ga0105245_100255276 307
741 3300009101 Ga0105247_10148426 Ga0105247_101484262 307
742 3300009147 Ga0114129_10027787 Ga0114129_100277875 307
743 3300009147 Ga0114129_10146036 Ga0114129_101460362 307
744 3300009147 Ga0114129_10199380 Ga0114129_101993803 307
745 3300009147 Ga0114129_10422433 Ga0114129_104224332 307
746 3300009147 Ga0114129_10485969 Ga0114129_104859692 307
747 3300009148 Ga0105243_10164009 Ga0105243_101640092 307
748 3300009174 Ga0105241_10001068 Ga0105241_100010684 307
749 3300009174 Ga0105241_10410260 Ga0105241_104102601 307
750 3300009176 Ga0105242_10033889 Ga0105242_100338895 307
751 3300009176 Ga0105242_10035281 Ga0105242_100352812 307
752 3300009176 Ga0105242_10058606 Ga0105242_100586062 307
753 3300009177 Ga0105248_10000669 Ga0105248_1000066910 307
754 3300009177 Ga0105248_10006680 Ga0105248_100066808 307
755 3300009177 Ga0105248_10268673 Ga0105248_102686731 307
756 3300009177 Ga0105248_10517752 Ga0105248_105177522 307
757 3300009545 Ga0105237_10253022 Ga0105237_102530222 307
758 3300009553 Ga0105249_10091991 Ga0105249_100919912 307
759 3300009553 Ga0105249_10380170 Ga0105249_103801702 307
760 3300010375 Ga0105239_10368387 Ga0105239_103683871 307
761 3300013102 Ga0157371_10140124 Ga0157371_101401242 307
762 3300013105 Ga0157369_10051057 Ga0157369_100510574 307
763 3300013105 Ga0157369_10434513 Ga0157369_104345131 307
764 3300013296 Ga0157374_10023689 Ga0157374_100236892 307
765 3300013297 Ga0157378_10662648 Ga0157378_106626481 307
766 3300013306 Ga0163162_10231379 Ga0163162_102313792 307
767 3300013307 Ga0157372_10027196 Ga0157372_100271966 307
768 3300013307 Ga0157372_10206795 Ga0157372_102067952 307
769 3300014326 Ga0157380_10001115 Ga0157380_1000111517 307
770 3300014969 Ga0157376_10014517 Ga0157376_100145173 307
771 3300020070 Ga0206356_10979058 Ga0206356_109790582 307
772 3300025885 Ga0207653_10003696 Ga0207653_100036966 307
773 3300025885 Ga0207653_10006461 Ga0207653_100064612 307
774 3300025885 Ga0207653_10010446 Ga0207653_100104462 307
775 3300025901 Ga0207688_10016689 Ga0207688_100166892 307
776 3300025905 Ga0207685_10022880 Ga0207685_100228802 307
777 3300025905 Ga0207685_10052029 Ga0207685_100520292 307
778 3300025906 Ga0207699_10099260 Ga0207699_100992602 307
779 3300025907 Ga0207645_10004388 Ga0207645_1000438810 307
780 3300025907 Ga0207645_10057553 Ga0207645_100575533 307
781 3300025908 Ga0207643_10000700 Ga0207643_1000070018 307
782 3300025908 Ga0207643_10061519 Ga0207643_100615192 307
783 3300025910 Ga0207684_10000269 Ga0207684_1000026923 307
784 3300025910 Ga0207684_10002692 Ga0207684_1000269211 307
785 3300025910 Ga0207684_10008726 Ga0207684_100087268 307
786 3300025910 Ga0207684_10012203 Ga0207684_100122036 307
787 3300025910 Ga0207684_10026275 Ga0207684_100262755 307
788 3300025910 Ga0207684_10030286 Ga0207684_100302865 307
789 3300025910 Ga0207684_10200471 Ga0207684_102004711 307
790 3300025910 Ga0207684_10320413 Ga0207684_103204132 307
791 3300025910 Ga0207684_10409336 Ga0207684_104093361 307
792 3300025911 Ga0207654_10002375 Ga0207654_100023753 307
793 3300025912 Ga0207707_10034538 Ga0207707_100345384 307
794 3300025912 Ga0207707_10082308 Ga0207707_100823082 307
795 3300025916 Ga0207663_10091313 Ga0207663_100913132 307
796 3300025917 Ga0207660_10000499 Ga0207660_1000049923 307
797 3300025917 Ga0207660_10017179 Ga0207660_100171792 307
798 3300025917 Ga0207660_10118020 Ga0207660_101180202 307
799 3300025918 Ga0207662_10051744 Ga0207662_100517443 307
800 3300025918 Ga0207662_10166004 Ga0207662_101660041 307
801 3300025919 Ga0207657_10002105 Ga0207657_1000210520 307
802 3300025919 Ga0207657_10004687 Ga0207657_100046876 307
803 3300025920 Ga0207649_10006972 Ga0207649_100069725 307
804 3300025921 Ga0207652_10000948 Ga0207652_100009484 307
805 3300025922 Ga0207646_10000008 Ga0207646_10000008380 307
806 3300025922 Ga0207646_10000009 Ga0207646_1000000976 307
807 3300025922 Ga0207646_10001224 Ga0207646_100012243 307
808 3300025922 Ga0207646_10001278 Ga0207646_100012784 307
809 3300025922 Ga0207646_10023144 Ga0207646_100231445 307
810 3300025922 Ga0207646_10035870 Ga0207646_100358702 307
811 3300025922 Ga0207646_10036164 Ga0207646_100361644 307
812 3300025922 Ga0207646_10047772 Ga0207646_100477724 307
813 3300025922 Ga0207646_10050810 Ga0207646_100508103 307
814 3300025922 Ga0207646_10079634 Ga0207646_100796342 307
815 3300025922 Ga0207646_10082775 Ga0207646_100827752 307
816 3300025922 Ga0207646_10236558 Ga0207646_102365582 307
817 3300025922 Ga0207646_10438559 Ga0207646_104385592 307
818 3300025923 Ga0207681_10064417 Ga0207681_100644172 307
819 3300025923 Ga0207681_10129560 Ga0207681_101295602 307
820 3300025924 Ga0207694_10020953 Ga0207694_100209533 307
821 3300025926 Ga0207659_10222687 Ga0207659_102226871 307
822 3300025928 Ga0207700_10268570 Ga0207700_102685702 307
823 3300025931 Ga0207644_10315981 Ga0207644_103159811 307
824 3300025933 Ga0207706_10010824 Ga0207706_100108248 307
825 3300025933 Ga0207706_10081167 Ga0207706_100811672 307
826 3300025935 Ga0207709_10038530 Ga0207709_100385302 307
827 3300025935 Ga0207709_10150084 Ga0207709_101500842 307
828 3300025936 Ga0207670_10001774 Ga0207670_100017742 307
829 3300025936 Ga0207670_10066821 Ga0207670_100668213 307
830 3300025936 Ga0207670_10123021 Ga0207670_101230212 307
831 3300025941 Ga0207711_10035703 Ga0207711_100357034 307
832 3300025941 Ga0207711_10039175 Ga0207711_100391755 307
833 3300025941 Ga0207711_10100552 Ga0207711_101005522 307
834 3300025942 Ga0207689_10004812 Ga0207689_100048124 307
835 3300025942 Ga0207689_10007296 Ga0207689_100072968 307
836 3300025945 Ga0207679_10008774 Ga0207679_100087745 307
837 3300025945 Ga0207679_10012799 Ga0207679_100127992 307
838 3300025945 Ga0207679_10224473 Ga0207679_102244731 307
839 3300025949 Ga0207667_10000470 Ga0207667_1000047018 307
840 3300025961 Ga0207712_10090808 Ga0207712_100908082 307
841 3300025961 Ga0207712_10156610 Ga0207712_101566101 307
842 3300025981 Ga0207640_10003162 Ga0207640_100031622 307
843 3300025981 Ga0207640_10383750 Ga0207640_103837501 307
844 3300025986 Ga0207658_10297645 Ga0207658_102976452 307
845 3300026035 Ga0207703_10000905 Ga0207703_1000090510 307
846 3300026035 Ga0207703_10068334 Ga0207703_100683342 307
847 3300026035 Ga0207703_10088441 Ga0207703_100884412 307
848 3300026041 Ga0207639_10013924 Ga0207639_100139244 307
849 3300026067 Ga0207678_10009235 Ga0207678_100092352 307
850 3300026067 Ga0207678_10285780 Ga0207678_102857802 307
851 3300026075 Ga0207708_10000205 Ga0207708_100002055 307
852 3300026078 Ga0207702_10008773 Ga0207702_100087735 307
853 3300026078 Ga0207702_10169622 Ga0207702_101696222 307
854 3300026088 Ga0207641_10124712 Ga0207641_101247122 307
855 3300026088 Ga0207641_10399934 Ga0207641_103999342 307
856 3300026089 Ga0207648_10018449 Ga0207648_100184495 307
857 3300026089 Ga0207648_10039482 Ga0207648_100394823 307
858 3300026116 Ga0207674_10003153 Ga0207674_100031534 307
859 3300026116 Ga0207674_10011021 Ga0207674_100110212 307
860 3300026116 Ga0207674_10137713 Ga0207674_101377132 307
861 3300026118 Ga0207675_100007447 Ga0207675_10000744710 307
862 3300026118 Ga0207675_100009342 Ga0207675_1000093427 307
863 3300026142 Ga0207698_10101133 Ga0207698_101011333 307
864 3300027364 Ga0209967_1004932 Ga0209967_10049322 307
865 3300027378 Ga0209981_1001519 Ga0209981_10015192 307
866 3300027462 Ga0210000_1002180 Ga0210000_10021802 307
867 3300027471 Ga0209995_1001998 Ga0209995_10019982 307
868 3300027526 Ga0209968_1005761 Ga0209968_10057612 307
869 3300027543 Ga0209999_1000518 Ga0209999_10005182 307
870 3300027614 Ga0209970_1000650 Ga0209970_10006502 307
871 3300027682 Ga0209971_1000004 Ga0209971_10000046 307
872 3300027695 Ga0209966_1000015 Ga0209966_100001574 307
873 3300027717 Ga0209998_10000001 Ga0209998_1000000142 307
874 3300027876 Ga0209974_10000064 Ga0209974_1000006424 307
875 3300027876 Ga0209974_10008177 Ga0209974_100081773 307
876 3300027907 Ga0207428_10003135 Ga0207428_100031357 307
877 3300028380 Ga0268265_10010779 Ga0268265_100107794 307
878 3300028380 Ga0268265_10015484 Ga0268265_100154844 307
879 3300028380 Ga0268265_10015621 Ga0268265_100156213 307
880 3300028381 Ga0268264_10015858 Ga0268264_100158584 307
881 3300031548 Ga0307408_100600258 Ga0307408_1006002581 307
882 3300031852 Ga0307410_10319575 Ga0307410_103195752 307
883 3300034817 Ga0373948_0016233 Ga0373948_0016233_379_1305 307
884 3300035083 Ga0373926_0039385 Ga0373926_0039385_339_1262 307
885 3300035091 Ga0373951_0002225 Ga0373951_0002225_2453_3379 307
886 3300035111 Ga0373923_0109180 Ga0373923_0109180_157_1080 307
887 3300035118 Ga0373954_0058279 Ga0373954_0058279_198_1121 307
888 3300035241 Ga0373961_0040972 Ga0373961_0040972_168_1091 307
889 3300037068 Ga0373925_0147145 Ga0373925_0147145_824_1747 307
890 3300037418 Ga0395900_0264373 Ga0395900_0264373_743_1675 307
891 3300037853 Ga0436364_0678702 Ga0436364_0678702_228_1154 307
892 3300038443 Ga0395901_0159221 Ga0395901_0159221_618_1550 307
893 3300042005 Ga0439448_0016202 Ga0439448_0016202_405_1331 307
894 3300042008 Ga0439450_003760 Ga0439450_003760_1438_2361 307
895 3300042012 Ga0439455_0002711 Ga0439455_0002711_1243_2169 307
896 3300042016 Ga0439463_016687 Ga0439463_016687_603_1529 307
897 3300042438 Ga0439459_0004556 Ga0439459_0004556_622_1548 307
898 3300042439 Ga0439464_0012428 Ga0439464_0012428_1106_2032 307
899 3300042461 Ga0439460_0004581 Ga0439460_0004581_150_1073 307
900 3300042876 Ga0451577_0004316 Ga0451577_0004316_13796_14722 307
901 3300042876 Ga0451577_0012269 Ga0451577_0012269_3819_4745 307
902 3300042876 Ga0451577_0082367 Ga0451577_0082367_1702_2628 307
903 3300042876 Ga0451577_0163874 Ga0451577_0163874_598_1521 307
904 3300044673 Ga0453683_0023217 Ga0453683_0023217_1395_2321 307
905 3300044673 Ga0453683_0145810 Ga0453683_0145810_341_1267 307
906 3300044694 Ga0466963_0261127 Ga0466963_0261127_32_955 307
907 3300044712 Ga0453684_0176257 Ga0453684_0176257_1038_1964 307
908 3300045051 Ga0451576_0001923 Ga0451576_0001923_6115_7038 307
909 3300045051 Ga0451576_0008207 Ga0451576_0008207_4214_5140 307
910 3300045051 Ga0451576_0008636 Ga0451576_0008636_10936_11862 307
911 3300045051 Ga0451576_0017308 Ga0451576_0017308_3490_4416 307
912 3300045051 Ga0451576_0045135 Ga0451576_0045135_1517_2443 307
913 3300045051 Ga0451576_0089180 Ga0451576_0089180_1928_2854 307
914 3300045051 Ga0451576_0091543 Ga0451576_0091543_1531_2457 307
915 3300046472 Ga0495580_0090518 Ga0495580_0090518_50_976 307
916 3300046675 Ga0495657_0010941 Ga0495657_0010941_4745_5668 307
917 3300047322 Ga0495680_0023425 Ga0495680_0023425_2571_3494 307
918 3300047472 Ga0495686_0130533 Ga0495686_0130533_313_1239 307
919 3300048905 Ga0496102_0054937 Ga0496102_0054937_1055_1978 307
920 3300048909 Ga0496106_0109236 Ga0496106_0109236_67_993 307
921 3300049568 Ga0501031_0003874 Ga0501031_0003874_847_1770 307
922 3300049568 Ga0501031_0012400 Ga0501031_0012400_442_1365 307
923 3300049568 Ga0501031_0255289 Ga0501031_0255289_165_1091 307
924 3300049569 Ga0501032_0017313 Ga0501032_0017313_719_1642 307
925 3300049569 Ga0501032_0036714 Ga0501032_0036714_1517_2440 307
926 3300049569 Ga0501032_0066652 Ga0501032_0066652_1437_2360 307
927 3300049572 Ga0501036_0033213 Ga0501036_0033213_2761_3684 307
928 3300049572 Ga0501036_0177934 Ga0501036_0177934_180_1103 307
929 3300049572 Ga0501036_0354622 Ga0501036_0354622_23_946 307
930 3300049573 Ga0501037_0023599 Ga0501037_0023599_216_1139 307
931 3300049573 Ga0501037_0104992 Ga0501037_0104992_26_949 307
932 3300049574 Ga0501038_0009050 Ga0501038_0009050_5536_6459 307
933 3300049574 Ga0501038_0110077 Ga0501038_0110077_379_1302 307
934 3300049575 Ga0501039_0003633 Ga0501039_0003633_433_1356 307
935 3300049575 Ga0501039_0007824 Ga0501039_0007824_5111_6034 307
936 3300049575 Ga0501039_0019159 Ga0501039_0019159_349_1272 307
937 3300049575 Ga0501039_0124248 Ga0501039_0124248_26_949 307
938 3300049575 Ga0501039_0189157 Ga0501039_0189157_371_1294 307
939 3300049576 Ga0501040_0000512 Ga0501040_0000512_7404_8330 307
940 3300049576 Ga0501040_0020172 Ga0501040_0020172_3315_4238 307
941 3300049576 Ga0501040_0026769 Ga0501040_0026769_1609_2535 307
942 3300049576 Ga0501040_0062128 Ga0501040_0062128_250_1173 307
943 3300049576 Ga0501040_0114562 Ga0501040_0114562_163_1122 307
944 3300049577 Ga0501041_0002285 Ga0501041_0002285_1268_2191 307
945 3300049577 Ga0501041_0008815 Ga0501041_0008815_4554_5477 307
946 3300049577 Ga0501041_0069491 Ga0501041_0069491_1020_1943 307
947 3300049578 Ga0501042_0000917 Ga0501042_0000917_10038_10961 307
948 3300049578 Ga0501042_0024803 Ga0501042_0024803_2038_2961 307
949 3300049578 Ga0501042_0065797 Ga0501042_0065797_1150_2073 307
950 3300049578 Ga0501042_0074824 Ga0501042_0074824_876_1802 307
951 3300049578 Ga0501042_0184169 Ga0501042_0184169_503_1429 307
952 3300049578 Ga0501042_0291329 Ga0501042_0291329_78_1004 307
953 3300049579 Ga0501043_0145053 Ga0501043_0145053_58_981 307
954 3300049580 Ga0501046_0001204 Ga0501046_0001204_10525_11451 307
955 3300049580 Ga0501046_0002954 Ga0501046_0002954_3081_4004 307
956 3300049580 Ga0501046_0006900 Ga0501046_0006900_4103_5026 307
957 3300049581 Ga0501047_0014228 Ga0501047_0014228_2953_3879 307
958 3300049582 Ga0501048_0037677 Ga0501048_0037677_847_1770 307
959 3300049582 Ga0501048_0053158 Ga0501048_0053158_1197_2123 307
960 3300049585 Ga0501069_0259008 Ga0501069_0259008_32_958 307
961 3300049587 Ga0501071_0032223 Ga0501071_0032223_1338_2261 307
962 3300049588 Ga0501072_0080672 Ga0501072_0080672_1204_2127 307
963 3300049588 Ga0501072_0220338 Ga0501072_0220338_377_1303 307
964 3300049590 Ga0501074_0025679 Ga0501074_0025679_1529_2455 307
965 3300049591 Ga0501075_0011886 Ga0501075_0011886_1992_2918 307
966 3300049591 Ga0501075_0074850 Ga0501075_0074850_1497_2423 307
967 3300049591 Ga0501075_0092305 Ga0501075_0092305_177_1100 307
968 3300049591 Ga0501075_0265261 Ga0501075_0265261_26_949 307
969 3300049592 Ga0501076_0063490 Ga0501076_0063490_1440_2363 307
970 3300049593 Ga0501077_0014715 Ga0501077_0014715_2899_3822 307
971 3300049593 Ga0501077_0039691 Ga0501077_0039691_1954_2880 307
972 3300049593 Ga0501077_0126292 Ga0501077_0126292_37_960 307
973 3300049741 Ga0501079_0001699 Ga0501079_0001699_4363_5289 307
974 3300049741 Ga0501079_0021213 Ga0501079_0021213_1479_2402 307
975 3300049741 Ga0501079_0031997 Ga0501079_0031997_1129_2055 307
976 3300049742 Ga0501080_0003623 Ga0501080_0003623_11230_12156 307
977 3300049742 Ga0501080_0199832 Ga0501080_0199832_674_1597 307
978 3300049743 Ga0501081_0004362 Ga0501081_0004362_2525_3451 307
979 3300049743 Ga0501081_0026058 Ga0501081_0026058_2776_3702 307
980 3300049822 Ga0501035_0001442 Ga0501035_0001442_15388_16311 307
981 3300049822 Ga0501035_0052717 Ga0501035_0052717_1141_2064 307
982 3300049822 Ga0501035_0199832 Ga0501035_0199832_497_1420 307
983 3300049822 Ga0501035_0279988 Ga0501035_0279988_229_1155 307
984 3300049824 Ga0501045_0003582 Ga0501045_0003582_4085_5011 307
985 3300050507 nmdc:mga05p37_13930_c1 nmdc:mga05p37_13930_c1_13_939 307
986 3300050507 nmdc:mga05p37_20359_c1 nmdc:mga05p37_20359_c1_5909_6835 307
987 3300050507 nmdc:mga05p37_23285_c1 nmdc:mga05p37_23285_c1_4913_5839 307
988 3300050507 nmdc:mga05p37_60523_c1 nmdc:mga05p37_60523_c1_2823_3746 307
989 3300050508 nmdc:mga09592_199419_c1 nmdc:mga09592_199419_c1_193_1116 307
990 3300050508 nmdc:mga09592_44143_c1 nmdc:mga09592_44143_c1_2105_3031 307
991 3300050509 nmdc:mga0qj67_2178_c1 nmdc:mga0qj67_2178_c1_11105_12028 307
992 3300050509 nmdc:mga0qj67_25258_c1 nmdc:mga0qj67_25258_c1_2273_3244 307
993 3300050509 nmdc:mga0qj67_4550_c1 nmdc:mga0qj67_4550_c1_5449_6372 307
994 3300050510 nmdc:mga06r32_54648_c1 nmdc:mga06r32_54648_c1_265_1188 307
995 3300050510 nmdc:mga06r32_793_c1 nmdc:mga06r32_793_c1_22575_23501 307
996 3300050511 nmdc:mga08y16_11348_c1 nmdc:mga08y16_11348_c1_3962_4888 307
997 3300050511 nmdc:mga08y16_68134_c1 nmdc:mga08y16_68134_c1_991_1965 307
998 3300050512 nmdc:mga0n895_3829_c1 nmdc:mga0n895_3829_c1_1337_2326 307
999 3300050512 nmdc:mga0n895_40877_c1 nmdc:mga0n895_40877_c1_213_1184 307
1000 3300050512 nmdc:mga0n895_52828_c1 nmdc:mga0n895_52828_c1_2382_3308 307
1001 3300050512 nmdc:mga0n895_70708_c1 nmdc:mga0n895_70708_c1_2487_3413 307
1002 3300050512 nmdc:mga0n895_83910_c1 nmdc:mga0n895_83910_c1_1353_2327 307
1003 3300050512 nmdc:mga0n895_85574_c1 nmdc:mga0n895_85574_c1_633_1559 307
1004 3300050512 nmdc:mga0n895_9015_c1 nmdc:mga0n895_9015_c1_6350_7276 307
1005 3300050513 nmdc:mga0rr50_2512_c1 nmdc:mga0rr50_2512_c1_6669_7595 307
1006 3300050513 nmdc:mga0rr50_292_c1 nmdc:mga0rr50_292_c1_11033_12022 307
1007 3300050514 nmdc:mga08x19_193898_c1 nmdc:mga08x19_193898_c1_104_1093 307
1008 3300050514 nmdc:mga08x19_2471_c1 nmdc:mga08x19_2471_c1_5690_6616 307
1009 3300050514 nmdc:mga08x19_46783_c1 nmdc:mga08x19_46783_c1_19_1008 307
1010 3300050515 nmdc:mga0a205_10167_c1 nmdc:mga0a205_10167_c1_515_1486 307
1011 3300050515 nmdc:mga0a205_1241_c2 nmdc:mga0a205_1241_c2_4510_5436 307
1012 3300050515 nmdc:mga0a205_14524_c1 nmdc:mga0a205_14524_c1_4083_5009 307
1013 3300050515 nmdc:mga0a205_145326_c1 nmdc:mga0a205_145326_c1_638_1612 307
1014 3300050515 nmdc:mga0a205_21_c1 nmdc:mga0a205_21_c1_19010_19999 307
1015 3300050515 nmdc:mga0a205_41076_c1 nmdc:mga0a205_41076_c1_1437_2363 307
1016 3300050515 nmdc:mga0a205_45207_c1 nmdc:mga0a205_45207_c1_1190_2116 307
1017 3300050515 nmdc:mga0a205_6584_c1 nmdc:mga0a205_6584_c1_7126_8052 307
1018 3300050515 nmdc:mga0a205_88257_c1 nmdc:mga0a205_88257_c1_463_1386 307
1019 3300054114 Ga0501084_0006546 Ga0501084_0006546_6658_7584 307
1020 3300054114 Ga0501084_0140153 Ga0501084_0140153_1080_2006 307
1021 3300060353 Ga0501082_0001216 Ga0501082_0001216_16567_17493 307
1022 3300060353 Ga0501082_0005907 Ga0501082_0005907_8233_9159 307
1023 3300061734 Ga0530510_0172160 Ga0530510_0172160_99_1022 307
1024 3300003203 JGI25406J46586_10019328 JGI25406J46586_100193283 308
1025 3300004798 Ga0058859_10053121 Ga0058859_100531211 308
1026 3300004801 Ga0058860_10029594 Ga0058860_100295941 308
1027 3300005330 Ga0070690_100424453 Ga0070690_1004244531 308
1028 3300005338 Ga0068868_100257569 Ga0068868_1002575692 308
1029 3300005343 Ga0070687_100252090 Ga0070687_1002520901 308
1030 3300005356 Ga0070674_100097527 Ga0070674_1000975271 308
1031 3300005367 Ga0070667_100223344 Ga0070667_1002233441 308
1032 3300005441 Ga0070700_100147430 Ga0070700_1001474302 308
1033 3300005466 Ga0070685_10198984 Ga0070685_101989841 308
1034 3300005544 Ga0070686_100146197 Ga0070686_1001461972 308
1035 3300005549 Ga0070704_100098361 Ga0070704_1000983611 308
1036 3300005719 Ga0068861_100132965 Ga0068861_1001329651 308
1037 3300005842 Ga0068858_100555662 Ga0068858_1005556621 308
1038 3300005843 Ga0068860_100139437 Ga0068860_1001394371 308
1039 3300005985 Ga0081539_10000964 Ga0081539_1000096436 308
1040 3300006844 Ga0075428_100153399 Ga0075428_1001533992 308
1041 3300006847 Ga0075431_100115185 Ga0075431_1001151852 308
1042 3300009094 Ga0111539_10115067 Ga0111539_101150673 308
1043 3300009101 Ga0105247_10042439 Ga0105247_100424392 308
1044 3300009147 Ga0114129_10236374 Ga0114129_102363743 308
1045 3300009553 Ga0105249_10045467 Ga0105249_100454674 308
1046 3300011119 Ga0105246_10057039 Ga0105246_100570392 308
1047 3300013306 Ga0163162_10256566 Ga0163162_102565662 308
1048 3300013308 Ga0157375_10307609 Ga0157375_103076091 308
1049 3300014325 Ga0163163_10127622 Ga0163163_101276222 308
1050 3300014326 Ga0157380_10073658 Ga0157380_100736581 308
1051 3300025961 Ga0207712_10343860 Ga0207712_103438601 308
1052 3300026075 Ga0207708_10022381 Ga0207708_100223813 308
1053 3300026118 Ga0207675_100276423 Ga0207675_1002764232 308
1054 3300028381 Ga0268264_10106212 Ga0268264_101062122 308
1055 3300050510 nmdc:mga06r32_92773_c1 nmdc:mga06r32_92773_c1_1854_2780 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01791

DeoC

DeoC/LacD family aldolase

81

329

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w8s-assembly1.cif.gz_A the mechanism of the schiff base forming fructose-1,6-bisphosphate aldolase: structural analysis of reaction intermediates 0.938 22 303
2yce-assembly1.cif.gz_E structure of an archaeal fructose-1,6-bisphosphate aldolase with the catalytic lys covalently bound to the carbinolamine intermediate of the substrate. 0.936 22 308
2qjg-assembly2.cif.gz_S m. jannaschii adh synthase complexed with f1,6p 0.9353 16 308
1ok6-assembly1.cif.gz_A orthorhombic crystal form of an archaeal fructose 1,6-bisphosphate aldolase 0.9349 22 307
2qjg-assembly1.cif.gz_O m. jannaschii adh synthase complexed with f1,6p 0.9313 16 308
ID Description Score Start End Superfamily
1ok6A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9349 22 307 3.20.20.70
1ok6A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9208 22 307 3.20.20.70
2qjgK00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9142 22 308 3.20.20.70
af_P0A991_40_348_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9137 15 304 3.20.20.70
3glcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.887 11 308 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1J0I3Z2-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) 1.002 124 213 GO:0016829
AF-A0A1J0I4I1-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9988 133 208 GO:0016829
AF-A0A1Q7ANT5-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9984 1 206 GO:0016829
AF-A0A535AHM2-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) 0.998 1 248 GO:0004332
AF-A0A2V6U933-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9976 1 308 GO:0004332
GO:0005737
GO:0042132

Feature Viewer

pLDDT pTM Quality
95.88 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map