F488964

General Info

Members Datasets Scaffolds Average Seq Length
1046 489 1029 336

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0043517|Ga0466966_0043517_843_1931
Length 362
Sequence VDKRNWNYGPDGARDFSKFVKVGAAMGHESRKAGTRVLVTGGTGFIGQHLVAALVARDRKVRVLDRRPPVCAAPGVEYLSGSVLDTGLVDESLRDADEVYHLAGLPGMWLPDKDDFHAVNFKGTEIVIGAARKRGIARFLHCSTESILFRPASSQKDSGEPSLLPPEQMPGVYTRSKMLAEQSAAQAAAAGFPLVIGTPTMPIGPHDHNLTPPTAMLRQFLHGRVQMYLDFIVNLVDVRDVATGLILAMERGQIGQRYILGGESISLKKILKLMASISGRHTFAIPVPGKIAEIAAGVLEFISDHLTHTPPSGTAEGVRIALRATELSIEKAQRELGYAPRPIEPALRDTIAYLLSQSKPGR

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
5 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
6 2791355199
7 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
8 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
9 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
10 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
11 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
12 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
13 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
14 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
15 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
16 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
17 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
18 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
19 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
20 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
21 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
22 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
23 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
24 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
28 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
29 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
30 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
31 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
32 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
33 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
34 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
35 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
38 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
40 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
41 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
56 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
65 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
68 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
69 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
70 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
71 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
72 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
73 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
74 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
75 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
76 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
77 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
84 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
85 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
86 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
87 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
88 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
92 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
93 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
94 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
109 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
110 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
111 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
112 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
113 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
114 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
115 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
116 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
117 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
118 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
119 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
120 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
121 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
122 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
123 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
124 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
125 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
126 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
127 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
128 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
130 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
131 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
132 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
135 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
136 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
137 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
138 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
139 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
145 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
146 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
151 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
152 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
157 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
158 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
159 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
160 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
161 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
162 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
163 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
164 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
165 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
166 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
167 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
168 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
169 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
172 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
175 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
247 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
251 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
252 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
253 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
254 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
255 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
256 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
257 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
258 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
259 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
260 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
261 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
262 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
263 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
264 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
265 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
266 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
267 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
268 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
269 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
270 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
271 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
272 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
273 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
274 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
275 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
276 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
277 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
278 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
279 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
280 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
281 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
282 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
283 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
284 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
285 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
286 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
287 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
288 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
289 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
290 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
291 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
292 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
293 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
294 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
295 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
296 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
297 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
298 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
299 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
300 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
301 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
302 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
303 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
304 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
305 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
306 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
307 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
308 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
309 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
310 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
311 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
312 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
313 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
314 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
315 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
316 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
317 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
318 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
319 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
320 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
321 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
322 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
323 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
324 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
325 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
326 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
327 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
328 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
329 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
330 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
331 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
332 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
333 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
334 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
335 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
336 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
337 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
338 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
339 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
340 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
341 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
342 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
343 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
344 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
345 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
346 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
347 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
348 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
349 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
350 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
351 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
352 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
353 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
354 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
355 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
356 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
357 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
358 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
359 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
360 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
361 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
362 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
363 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
364 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
365 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
366 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
367 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
368 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
369 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
370 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
371 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
372 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
373 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
374 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
375 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
376 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
377 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
378 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
379 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
380 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
381 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
382 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
383 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
384 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
385 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
386 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
387 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
388 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
389 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
390 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
391 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
392 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
393 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
394 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
395 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
396 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
397 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
398 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
399 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
400 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
401 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
402 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
403 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
404 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
405 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
406 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
407 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
408 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
409 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
410 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
411 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
412 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
413 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
414 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
415 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
416 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
417 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
418 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
419 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
420 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
421 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
422 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
423 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
436 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
437 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
438 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
439 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
440 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
441 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
442 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
443 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
444 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
445 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
446 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
447 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
448 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
450 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
451 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
452 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
453 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
454 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
455 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
456 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
457 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
458 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
459 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
460 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
461 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
462 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
463 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
464 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
465 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
466 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
467 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
468 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
469 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
470 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
471 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
472 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
473 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
474 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
475 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
476 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
477 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
478 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
479 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
480 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
481 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
482 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
483 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
484 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
485 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
486 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
487 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
488 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
489 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 0
Isolates 1.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.3
Nodule 1.15
Rhizoplane 5.07
Rhizosphere 84.89
Stem 0
Stem Tuber 0
Unclassified 4.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214544922 2209111006 Bacteria 19930
2 ARcpr5oldR_c000056 3300000041 Bacteria 20790
3 ARSoilYngRDRAFT_c00038 3300000042 Bacteria 20556
4 ARcpr5yngRDRAFT_c000037 3300000043 Bacteria 20897
5 ARSoilOldRDRAFT_c000060 3300000044 Bacteria 22426
6 ARCol0oldRDRAFT_c00065 3300000045 Bacteria 8499
7 CNAas_1002143 3300000532 Bacteria 1463
8 ARCol0yngRDRAFT_1000262 3300000652 Bacteria 8470
9 JGI24736J21556_1008999 3300001904 Bacteria 1654
10 JGI24752J21851_1004571 3300001976 Bacteria 1813
11 JGI24746J21847_1000770 3300001977 Bacteria 4927
12 JGI24747J21853_1001345 3300001978 Bacteria 1822
13 JGI24739J22299_10001705 3300001989 Bacteria 8356
14 JGI24737J22298_10000400 3300001990 Bacteria 14807
15 JGI24737J22298_10002365 3300001990 Bacteria 6723
16 JGI24743J22301_10008225 3300001991 Bacteria 1826
17 JGI24750J21931_1000217 3300002070 Bacteria 9762
18 JGI24745J21846_1000133 3300002073 Bacteria 5710
19 JGI24748J21848_1002725 3300002074 Bacteria 2009
20 JGI24738J21930_10000277 3300002075 Bacteria 14047
21 JGI24744J21845_10000893 3300002077 Bacteria 5635
22 JGI24035J26624_1000096 3300002126 Bacteria 7440
23 JGI24742J22300_10000345 3300002244 Bacteria 6819
24 JGI24751J29686_10004930 3300002459 Bacteria 2719
25 JGI25153J46596_10003096 3300003215 Bacteria 9375
26 rootH2_10164564 3300003320 Bacteria 2357
27 JGI25405J52794_10001360 3300003911 Bacteria 4015
28 JGI25405J52794_10002356 3300003911 Bacteria 3244
29 Ga0065704_10077082 3300005289 Bacteria 4839
30 Ga0065712_10006696 3300005290 Bacteria 4601
31 Ga0065712_10071749 3300005290 Bacteria 5082
32 Ga0065712_10098936 3300005290 Bacteria 2087
33 Ga0065715_10001161 3300005293 Bacteria 10533
34 Ga0065715_10131782 3300005293 Bacteria 2002
35 Ga0070658_10174508 3300005327 Bacteria 1807
36 Ga0070658_10210823 3300005327 Bacteria 1641
37 Ga0070676_10000813 3300005328 Bacteria 15426
38 Ga0070683_100000240 3300005329 Bacteria 37588
39 Ga0070683_100066349 3300005329 Bacteria 3362
40 Ga0070683_100327347 3300005329 Bacteria 1459
41 Ga0070690_100000428 3300005330 Bacteria 21329
42 Ga0070690_100028240 3300005330 Bacteria 3474
43 Ga0070690_100077522 3300005330 Unclassified 2170
44 Ga0070670_100048534 3300005331 Bacteria 3653
45 Ga0070677_10000294 3300005333 Bacteria 17512
46 Ga0068869_100000189 3300005334 Bacteria 31886
47 Ga0068869_100019911 3300005334 Bacteria 4594
48 Ga0068869_100021975 3300005334 Bacteria 4391
49 Ga0070666_10017675 3300005335 Bacteria 4575
50 Ga0070666_10269350 3300005335 Unclassified 1208
51 Ga0070680_100025642 3300005336 Bacteria 4713
52 Ga0070680_100046905 3300005336 Bacteria 3516
53 Ga0070680_100064986 3300005336 Bacteria 2990
54 Ga0070682_100000202 3300005337 Bacteria 44018
55 Ga0070682_100175815 3300005337 Bacteria 1491
56 Ga0068868_100000614 3300005338 Bacteria 23959
57 Ga0068868_100049205 3300005338 Bacteria 3308
58 Ga0070660_100000223 3300005339 Bacteria 37464
59 Ga0070660_100011233 3300005339 Bacteria 6357
60 Ga0070660_100027221 3300005339 Bacteria 4265
61 Ga0070660_100131688 3300005339 Bacteria 2001
62 Ga0070660_100319570 3300005339 Bacteria 1275
63 Ga0070689_100000187 3300005340 Bacteria 37473
64 Ga0070691_10003410 3300005341 Bacteria 7145
65 Ga0070691_10027437 3300005341 Bacteria 2657
66 Ga0070691_10061506 3300005341 Bacteria 1807
67 Ga0070687_100000200 3300005343 Bacteria 20836
68 Ga0070661_100000298 3300005344 Bacteria 40083
69 Ga0070692_10000016 3300005345 Bacteria 34456
70 Ga0070668_100051691 3300005347 Bacteria 3167
71 Ga0070668_100056874 3300005347 Bacteria 3021
72 Ga0070668_100088836 3300005347 Bacteria 2433
73 Ga0070668_100127841 3300005347 Bacteria 2037
74 Ga0070669_100001525 3300005353 Bacteria 16755
75 Ga0070675_100000215 3300005354 Bacteria 37364
76 Ga0070675_100387630 3300005354 Bacteria 1245
77 Ga0070671_100000402 3300005355 Bacteria 29873
78 Ga0070671_100100481 3300005355 Bacteria 2427
79 Ga0070674_100000511 3300005356 Bacteria 19453
80 Ga0070674_100049852 3300005356 Bacteria 2881
81 Ga0070673_100000035 3300005364 Bacteria 57163
82 Ga0070673_100243554 3300005364 Bacteria 1564
83 Ga0070688_100000130 3300005365 Bacteria 40342
84 Ga0070688_100000837 3300005365 Bacteria 15251
85 Ga0070659_100000583 3300005366 Bacteria 26638
86 Ga0070659_100064239 3300005366 Bacteria 2905
87 Ga0070659_100104482 3300005366 Bacteria 2282
88 Ga0070667_100000712 3300005367 Bacteria 32083
89 Ga0070667_100381390 3300005367 Bacteria 1280
90 Ga0070703_10004424 3300005406 Bacteria 3954
91 Ga0070709_10000625 3300005434 Bacteria 20227
92 Ga0070709_10001920 3300005434 Bacteria 11296
93 Ga0070714_100008485 3300005435 Bacteria 8029
94 Ga0070713_100008487 3300005436 Bacteria 7289
95 Ga0070713_100216547 3300005436 Bacteria 1736
96 Ga0070710_10000834 3300005437 Bacteria 14840
97 Ga0070710_10006043 3300005437 Bacteria 5786
98 Ga0070710_10071343 3300005437 Bacteria 2003
99 Ga0070701_10000081 3300005438 Bacteria 26416
100 Ga0070701_10005239 3300005438 Bacteria 5336
101 Ga0070701_10149198 3300005438 Bacteria 1345
102 Ga0070711_100000773 3300005439 Bacteria 16663
103 Ga0070711_100002593 3300005439 Bacteria 10353
104 Ga0070705_100002491 3300005440 Bacteria 9254
105 Ga0070700_100027063 3300005441 Bacteria 3396
106 Ga0070694_100000129 3300005444 Bacteria 37699
107 Ga0070694_100031644 3300005444 Bacteria 3469
108 Ga0070694_100042284 3300005444 Bacteria 3044
109 Ga0070694_100151364 3300005444 Bacteria 1695
110 Ga0070663_100016592 3300005455 Bacteria 4788
111 Ga0070663_100041781 3300005455 Bacteria 3219
112 Ga0070663_100042996 3300005455 Bacteria 3177
113 Ga0070678_100023973 3300005456 Bacteria 4076
114 Ga0070662_100000933 3300005457 Bacteria 17890
115 Ga0070662_100024884 3300005457 Bacteria 4130
116 Ga0070662_100037881 3300005457 Bacteria 3421
117 Ga0070662_100202938 3300005457 Bacteria 1574
118 Ga0070662_100219442 3300005457 Bacteria 1517
119 Ga0070681_10001286 3300005458 Bacteria 21879
120 Ga0068867_100000369 3300005459 Bacteria 29980
121 Ga0068867_100203912 3300005459 Bacteria 1585
122 Ga0070706_100033904 3300005467 Bacteria 4713
123 Ga0070698_100020555 3300005471 Bacteria 6922
124 Ga0070698_100352531 3300005471 Bacteria 1403
125 Ga0070699_100000003 3300005518 Bacteria 418047
126 Ga0070699_100157602 3300005518 Bacteria 2009
127 Ga0070679_100000553 3300005530 Bacteria 31683
128 Ga0070679_100012149 3300005530 Bacteria 8226
129 Ga0070679_100148843 3300005530 Bacteria 2318
130 Ga0070684_100000246 3300005535 Bacteria 37600
131 Ga0070684_100004778 3300005535 Bacteria 10350
132 Ga0070684_100067615 3300005535 Bacteria 3139
133 Ga0070697_100050991 3300005536 Bacteria 3362
134 Ga0068853_100000243 3300005539 Bacteria 38327
135 Ga0068853_100053503 3300005539 Bacteria 3476
136 Ga0070672_100000157 3300005543 Bacteria 37598
137 Ga0070672_100026481 3300005543 Bacteria 4316
138 Ga0070672_100030913 3300005543 Bacteria 4027
139 Ga0070686_100000260 3300005544 Bacteria 36083
140 Ga0070686_100070937 3300005544 Bacteria 2279
141 Ga0070686_100186981 3300005544 Bacteria 1476
142 Ga0070686_100229675 3300005544 Bacteria 1345
143 Ga0070695_100001653 3300005545 Bacteria 12525
144 Ga0070695_100024912 3300005545 Bacteria 3690
145 Ga0070695_100111657 3300005545 Bacteria 1856
146 Ga0070696_100006359 3300005546 Bacteria 7905
147 Ga0070696_100017316 3300005546 Bacteria 4865
148 Ga0070696_100244732 3300005546 Bacteria 1354
149 Ga0070693_100005607 3300005547 Bacteria 6051
150 Ga0070665_100007892 3300005548 Bacteria 10798
151 Ga0070665_100014837 3300005548 Bacteria 7820
152 Ga0070665_100096914 3300005548 Bacteria 2954
153 Ga0070704_100000171 3300005549 Bacteria 25774
154 Ga0070704_100005236 3300005549 Bacteria 7551
155 Ga0068855_100001637 3300005563 Bacteria 28084
156 Ga0068855_100005012 3300005563 Bacteria 16165
157 Ga0068855_100163498 3300005563 Unclassified 2525
158 Ga0068855_100208345 3300005563 Bacteria 2198
159 Ga0068855_100305002 3300005563 Bacteria 1763
160 Ga0070664_100000269 3300005564 Bacteria 37475
161 Ga0070664_100290171 3300005564 Bacteria 1477
162 Ga0068857_100000174 3300005577 Bacteria 40766
163 Ga0068857_100027809 3300005577 Bacteria 4987
164 Ga0068854_100000211 3300005578 Bacteria 39059
165 Ga0068854_100044425 3300005578 Bacteria 3153
166 Ga0068854_100145194 3300005578 Bacteria 1824
167 Ga0068856_100000600 3300005614 Bacteria 39415
168 Ga0068856_100421857 3300005614 Bacteria 1354
169 Ga0070702_100000312 3300005615 Bacteria 16802
170 Ga0070702_100027299 3300005615 Bacteria 3078
171 Ga0068852_100003615 3300005616 Bacteria 10822
172 Ga0068852_100015387 3300005616 Bacteria 5931
173 Ga0068852_100060621 3300005616 Bacteria 3285
174 Ga0068852_100267487 3300005616 Bacteria 1644
175 Ga0068859_100000894 3300005617 Bacteria 30361
176 Ga0068859_100076274 3300005617 Bacteria 3393
177 Ga0068859_100104579 3300005617 Unclassified 2890
178 Ga0068859_100135028 3300005617 Bacteria 2540
179 Ga0068864_100000329 3300005618 Bacteria 41801
180 Ga0068864_100016060 3300005618 Bacteria 6229
181 Ga0068866_10000177 3300005718 Bacteria 29851
182 Ga0068861_100000329 3300005719 Bacteria 26778
183 Ga0068861_100022570 3300005719 Bacteria 4535
184 Ga0068861_100065282 3300005719 Bacteria 2803
185 Ga0068861_100094617 3300005719 Bacteria 2364
186 Ga0068861_100122970 3300005719 Bacteria 2096
187 Ga0068851_10002336 3300005834 Bacteria 8351
188 Ga0068851_10020010 3300005834 Bacteria 3237
189 Ga0068851_10035065 3300005834 Bacteria 2507
190 Ga0068870_10000056 3300005840 Bacteria 36039
191 Ga0068863_100000278 3300005841 Bacteria 53024
192 Ga0068863_100324847 3300005841 Bacteria 1495
193 Ga0068858_100001048 3300005842 Bacteria 28582
194 Ga0068858_100061574 3300005842 Bacteria 3469
195 Ga0068858_100076154 3300005842 Bacteria 3116
196 Ga0068858_100152128 3300005842 Bacteria 2176
197 Ga0068860_100000149 3300005843 Bacteria 113068
198 Ga0068860_100000985 3300005843 Bacteria 31478
199 Ga0068860_100030464 3300005843 Bacteria 5189
200 Ga0068860_100092315 3300005843 Bacteria 2885
201 Ga0068862_100000593 3300005844 Bacteria 37703
202 Ga0068862_100016002 3300005844 Bacteria 6236
203 Ga0068862_100039915 3300005844 Bacteria 3988
204 Ga0081455_10001601 3300005937 Bacteria 27658
205 Ga0081455_10001818 3300005937 Bacteria 25693
206 Ga0081455_10004887 3300005937 Bacteria 14853
207 Ga0081455_10006854 3300005937 Bacteria 12135
208 Ga0081455_10020372 3300005937 Bacteria 6247
209 Ga0081455_10058657 3300005937 Bacteria 3255
210 Ga0081538_10038173 3300005981 Bacteria 3104
211 Ga0081540_1002358 3300005983 Bacteria 15431
212 Ga0081540_1002564 3300005983 Bacteria 14745
213 Ga0081540_1007041 3300005983 Bacteria 8086
214 Ga0081540_1019943 3300005983 Bacteria 4052
215 Ga0081540_1023695 3300005983 Bacteria 3583
216 Ga0081540_1050507 3300005983 Bacteria 2065
217 Ga0081539_10034119 3300005985 Bacteria 3086
218 Ga0070717_10004617 3300006028 Bacteria 9981
219 Ga0075368_10011454 3300006042 Bacteria 3227
220 Ga0075368_10011795 3300006042 Bacteria 3187
221 Ga0075363_100030366 3300006048 Bacteria 2797
222 Ga0075364_10044632 3300006051 Bacteria 2883
223 Ga0070715_10000830 3300006163 Bacteria 8479
224 Ga0070716_100002010 3300006173 Bacteria 9287
225 Ga0070716_100023686 3300006173 Bacteria 3258
226 Ga0070716_100038710 3300006173 Bacteria 2642
227 Ga0070712_100060074 3300006175 Bacteria 2679
228 Ga0070712_100141188 3300006175 Bacteria 1838
229 Ga0070712_100166059 3300006175 Bacteria 1709
230 Ga0075362_10018572 3300006177 Bacteria 2880
231 Ga0075367_10009757 3300006178 Bacteria 5028
232 Ga0075367_10019907 3300006178 Bacteria 3729
233 Ga0075367_10062759 3300006178 Bacteria 2220
234 Ga0075369_10025683 3300006186 Bacteria 2451
235 Ga0097621_100000504 3300006237 Bacteria 27335
236 Ga0097621_100216422 3300006237 Bacteria 1668
237 Ga0068871_100000815 3300006358 Bacteria 20895
238 Ga0068871_100123836 3300006358 Bacteria 2186
239 Ga0075433_10011448 3300006852 Bacteria 7145
240 Ga0075434_100000244 3300006871 Bacteria 38039
241 Ga0075434_100056527 3300006871 Unclassified 3900
242 Ga0068865_100000332 3300006881 Bacteria 26180
243 Ga0068865_100242097 3300006881 Bacteria 1420
244 Ga0097620_100000894 3300006931 Bacteria 30361
245 Ga0097620_100076272 3300006931 Bacteria 3393
246 Ga0097620_100104582 3300006931 Unclassified 2890
247 Ga0097620_100135034 3300006931 Bacteria 2540
248 Ga0099794_10007686 3300007265 Bacteria 4442
249 Ga0099794_10009781 3300007265 Bacteria 4048
250 Ga0099795_10005073 3300007788 Bacteria 3466
251 Ga0099795_10007212 3300007788 Bacteria 3087
252 Ga0105251_10029811 3300009011 Bacteria 2745
253 Ga0105250_10014671 3300009092 Bacteria 3216
254 Ga0105240_10169358 3300009093 Bacteria 2588
255 Ga0105240_10314210 3300009093 Bacteria 1788
256 Ga0111539_10001076 3300009094 Bacteria 36048
257 Ga0111539_10004346 3300009094 Bacteria 18556
258 Ga0111539_10018601 3300009094 Bacteria 8607
259 Ga0111539_10037099 3300009094 Bacteria 5889
260 Ga0105245_10000451 3300009098 Bacteria 37705
261 Ga0105245_10010020 3300009098 Bacteria 8252
262 Ga0105247_10001016 3300009101 Bacteria 21159
263 Ga0105247_10015146 3300009101 Bacteria 4623
264 Ga0105247_10041969 3300009101 Bacteria 2800
265 Ga0105247_10115949 3300009101 Bacteria 1729
266 Ga0114129_10067676 3300009147 Bacteria 4981
267 Ga0105243_10002173 3300009148 Bacteria 16567
268 Ga0105243_10028538 3300009148 Bacteria 4284
269 Ga0105241_10001549 3300009174 Bacteria 17620
270 Ga0105241_10003089 3300009174 Bacteria 12402
271 Ga0105241_10033060 3300009174 Bacteria 3881
272 Ga0105241_10095469 3300009174 Unclassified 2354
273 Ga0105242_10000947 3300009176 Bacteria 22652
274 Ga0105242_10079700 3300009176 Bacteria 2735
275 Ga0105248_10000837 3300009177 Bacteria 34570
276 Ga0105248_10019175 3300009177 Bacteria 7568
277 Ga0105248_10102973 3300009177 Bacteria 3217
278 Ga0105248_10399841 3300009177 Bacteria 1547
279 Ga0105237_10007227 3300009545 Bacteria 12185
280 Ga0105237_10013803 3300009545 Bacteria 8455
281 Ga0105237_10068310 3300009545 Bacteria 3547
282 Ga0105237_10098472 3300009545 Bacteria 2915
283 Ga0105237_10245793 3300009545 Unclassified 1791
284 Ga0105238_10002126 3300009551 Bacteria 20001
285 Ga0105238_10008316 3300009551 Bacteria 10376
286 Ga0105238_10047126 3300009551 Bacteria 4347
287 Ga0105249_10000976 3300009553 Bacteria 25338
288 Ga0105249_10002863 3300009553 Bacteria 14901
289 Ga0105249_10032554 3300009553 Bacteria 4717
290 Ga0105249_10077505 3300009553 Bacteria 3082
291 Ga0105249_10391717 3300009553 Bacteria 1418
292 Ga0099796_10024353 3300010159 Bacteria 1900
293 Ga0099796_10057587 3300010159 Bacteria 1367
294 Ga0105239_10040227 3300010375 Bacteria 5123
295 Ga0105239_10049131 3300010375 Bacteria 4626
296 Ga0105239_10049768 3300010375 Bacteria 4595
297 Ga0105239_10050199 3300010375 Bacteria 4576
298 Ga0105239_10055969 3300010375 Bacteria 4327
299 Ga0105239_10111085 3300010375 Bacteria 3038
300 Ga0105239_10143485 3300010375 Bacteria 2662
301 Ga0105239_10386026 3300010375 Bacteria 1584
302 Ga0105239_10441185 3300010375 Bacteria 1476
303 Ga0105246_10000100 3300011119 Bacteria 37689
304 Ga0105246_10005103 3300011119 Bacteria 7987
305 Ga0157373_10138365 3300013100 Bacteria 1712
306 Ga0157371_10001676 3300013102 Bacteria 22625
307 Ga0157370_10035405 3300013104 Bacteria 4852
308 Ga0157374_10000956 3300013296 Bacteria 25071
309 Ga0157374_10084181 3300013296 Bacteria 3023
310 Ga0157378_10001544 3300013297 Bacteria 20818
311 Ga0157378_10050788 3300013297 Bacteria 3689
312 Ga0157378_10214547 3300013297 Bacteria 1826
313 Ga0157378_10297262 3300013297 Bacteria 1561
314 Ga0157378_10337345 3300013297 Bacteria 1469
315 Ga0163162_10001003 3300013306 Bacteria 26222
316 Ga0163162_10027342 3300013306 Bacteria 5641
317 Ga0163162_10133725 3300013306 Bacteria 2590
318 Ga0163162_10239709 3300013306 Bacteria 1944
319 Ga0157372_10003782 3300013307 Bacteria 16248
320 Ga0157375_10000464 3300013308 Bacteria 36915
321 Ga0163163_10003318 3300014325 Bacteria 13651
322 Ga0163163_10003907 3300014325 Bacteria 12711
323 Ga0163163_10010710 3300014325 Bacteria 8266
324 Ga0163163_10088226 3300014325 Bacteria 3113
325 Ga0157380_10000145 3300014326 Bacteria 40211
326 Ga0182008_10044170 3300014497 Bacteria 2217
327 Ga0157377_10000179 3300014745 Bacteria 36682
328 Ga0157379_10000067 3300014968 Bacteria 66051
329 Ga0157379_10012965 3300014968 Bacteria 7293
330 Ga0157376_10023037 3300014969 Unclassified 4866
331 Ga0163161_10001462 3300017792 Bacteria 17455
332 Ga0213876_10003374 3300021384 Bacteria 9140
333 Ga0209677_101310 3300025253 Bacteria 11029
334 Ga0209148_1003403 3300025254 Bacteria 4426
335 Ga0209233_1007754 3300025261 Bacteria 3373
336 Ga0207666_1000002 3300025271 Bacteria 62717
337 Ga0207666_1000947 3300025271 Bacteria 3443
338 Ga0209455_1005530 3300025272 Bacteria 3883
339 Ga0209758_1007162 3300025297 Bacteria 7694
340 Ga0207697_10000113 3300025315 Bacteria 37772
341 Ga0207697_10053399 3300025315 Bacteria 1674
342 Ga0207653_10001270 3300025885 Bacteria 8227
343 Ga0207682_10000094 3300025893 Bacteria 41188
344 Ga0207692_10000538 3300025898 Bacteria 13413
345 Ga0207692_10001089 3300025898 Bacteria 9953
346 Ga0207692_10041923 3300025898 Bacteria 2269
347 Ga0207642_10014853 3300025899 Bacteria 2885
348 Ga0207642_10049816 3300025899 Bacteria 1885
349 Ga0207642_10151026 3300025899 Bacteria 1236
350 Ga0207710_10000795 3300025900 Bacteria 17144
351 Ga0207710_10022769 3300025900 Bacteria 2689
352 Ga0207710_10023206 3300025900 Bacteria 2666
353 Ga0207688_10000074 3300025901 Bacteria 37681
354 Ga0207688_10019408 3300025901 Bacteria 3704
355 Ga0207688_10141845 3300025901 Bacteria 1414
356 Ga0207680_10010896 3300025903 Bacteria 4570
357 Ga0207647_10000218 3300025904 Bacteria 46963
358 Ga0207647_10015942 3300025904 Bacteria 5137
359 Ga0207647_10025737 3300025904 Bacteria 3860
360 Ga0207647_10048560 3300025904 Bacteria 2635
361 Ga0207685_10013726 3300025905 Bacteria 2514
362 Ga0207699_10000984 3300025906 Bacteria 13541
363 Ga0207699_10001601 3300025906 Bacteria 10746
364 Ga0207645_10000247 3300025907 Bacteria 44983
365 Ga0207643_10000004 3300025908 Bacteria 187006
366 Ga0207705_10148064 3300025909 Bacteria 1757
367 Ga0207684_10019778 3300025910 Bacteria 5759
368 Ga0207684_10228828 3300025910 Unclassified 1604
369 Ga0207654_10000152 3300025911 Bacteria 43823
370 Ga0207707_10000618 3300025912 Bacteria 35350
371 Ga0207707_10008271 3300025912 Bacteria 9028
372 Ga0207707_10377474 3300025912 Bacteria 1219
373 Ga0207695_10003119 3300025913 Bacteria 23708
374 Ga0207695_10019340 3300025913 Bacteria 7842
375 Ga0207695_10045656 3300025913 Bacteria 4649
376 Ga0207671_10010899 3300025914 Bacteria 7448
377 Ga0207671_10014218 3300025914 Bacteria 6300
378 Ga0207693_10000633 3300025915 Bacteria 31452
379 Ga0207693_10008274 3300025915 Bacteria 8517
380 Ga0207693_10072976 3300025915 Bacteria 2687
381 Ga0207663_10010136 3300025916 Bacteria 5002
382 Ga0207663_10021758 3300025916 Bacteria 3656
383 Ga0207660_10000741 3300025917 Bacteria 21651
384 Ga0207660_10006792 3300025917 Bacteria 7412
385 Ga0207662_10000119 3300025918 Bacteria 37770
386 Ga0207662_10002690 3300025918 Bacteria 8961
387 Ga0207657_10000316 3300025919 Bacteria 51145
388 Ga0207657_10059870 3300025919 Bacteria 3270
389 Ga0207657_10133039 3300025919 Bacteria 2037
390 Ga0207649_10000090 3300025920 Bacteria 75387
391 Ga0207652_10000847 3300025921 Bacteria 29115
392 Ga0207652_10046491 3300025921 Bacteria 3703
393 Ga0207652_10154122 3300025921 Bacteria 2058
394 Ga0207652_10338806 3300025921 Unclassified 1357
395 Ga0207681_10000370 3300025923 Bacteria 31836
396 Ga0207681_10037300 3300025923 Bacteria 3212
397 Ga0207681_10077875 3300025923 Bacteria 2332
398 Ga0207694_10000106 3300025924 Bacteria 88467
399 Ga0207694_10110720 3300025924 Bacteria 2184
400 Ga0207694_10124010 3300025924 Bacteria 2065
401 Ga0207650_10017812 3300025925 Bacteria 4976
402 Ga0207659_10000038 3300025926 Bacteria 93848
403 Ga0207687_10000784 3300025927 Bacteria 21392
404 Ga0207687_10022557 3300025927 Bacteria 4191
405 Ga0207700_10048583 3300025928 Bacteria 3152
406 Ga0207664_10014626 3300025929 Bacteria 5675
407 Ga0207644_10001053 3300025931 Bacteria 17640
408 Ga0207644_10055397 3300025931 Bacteria 2858
409 Ga0207690_10000239 3300025932 Bacteria 39850
410 Ga0207706_10000424 3300025933 Bacteria 45410
411 Ga0207706_10045250 3300025933 Bacteria 3900
412 Ga0207706_10078566 3300025933 Bacteria 2902
413 Ga0207706_10123181 3300025933 Bacteria 2281
414 Ga0207686_10001203 3300025934 Bacteria 15007
415 Ga0207709_10000379 3300025935 Bacteria 44189
416 Ga0207709_10004757 3300025935 Bacteria 7792
417 Ga0207709_10010467 3300025935 Bacteria 5105
418 Ga0207670_10000176 3300025936 Bacteria 42483
419 Ga0207669_10000165 3300025937 Bacteria 31741
420 Ga0207669_10018298 3300025937 Bacteria 3618
421 Ga0207704_10001709 3300025938 Bacteria 9819
422 Ga0207665_10003827 3300025939 Bacteria 10058
423 Ga0207665_10004109 3300025939 Bacteria 9707
424 Ga0207665_10022548 3300025939 Bacteria 4143
425 Ga0207691_10000358 3300025940 Bacteria 46095
426 Ga0207691_10044524 3300025940 Bacteria 4084
427 Ga0207691_10045591 3300025940 Bacteria 4029
428 Ga0207691_10117883 3300025940 Bacteria 2355
429 Ga0207711_10000780 3300025941 Bacteria 31295
430 Ga0207711_10043524 3300025941 Unclassified 3831
431 Ga0207711_10148884 3300025941 Bacteria 2111
432 Ga0207689_10000479 3300025942 Bacteria 37696
433 Ga0207689_10022242 3300025942 Bacteria 5331
434 Ga0207689_10057913 3300025942 Bacteria 3187
435 Ga0207689_10192610 3300025942 Bacteria 1682
436 Ga0207689_10341529 3300025942 Bacteria 1244
437 Ga0207661_10000604 3300025944 Bacteria 22956
438 Ga0207661_10088670 3300025944 Bacteria 2572
439 Ga0207661_10092221 3300025944 Bacteria 2525
440 Ga0207679_10000139 3300025945 Bacteria 59804
441 Ga0207679_10135058 3300025945 Bacteria 1985
442 Ga0207679_10159170 3300025945 Bacteria 1847
443 Ga0207667_10003492 3300025949 Bacteria 19417
444 Ga0207667_10011749 3300025949 Bacteria 10153
445 Ga0207667_10034706 3300025949 Bacteria 5414
446 Ga0207667_10095670 3300025949 Bacteria 3065
447 Ga0207667_10121867 3300025949 Unclassified 2687
448 Ga0207667_10223546 3300025949 Bacteria 1929
449 Ga0207667_10233633 3300025949 Bacteria 1882
450 Ga0207651_10000072 3300025960 Bacteria 46009
451 Ga0207712_10000588 3300025961 Bacteria 29188
452 Ga0207712_10038903 3300025961 Bacteria 3255
453 Ga0207668_10000168 3300025972 Bacteria 45205
454 Ga0207668_10019110 3300025972 Bacteria 4325
455 Ga0207668_10066608 3300025972 Bacteria 2553
456 Ga0207668_10068636 3300025972 Plasmid 2521
457 Ga0207668_10235129 3300025972 Bacteria 1479
458 Ga0207640_10000242 3300025981 Bacteria 37007
459 Ga0207658_10000667 3300025986 Bacteria 29975
460 Ga0207677_10004440 3300026023 Bacteria 7533
461 Ga0207677_10076780 3300026023 Bacteria 2380
462 Ga0207703_10000463 3300026035 Bacteria 42725
463 Ga0207703_10219227 3300026035 Bacteria 1700
464 Ga0207703_10222606 3300026035 Bacteria 1688
465 Ga0207639_10000745 3300026041 Bacteria 22238
466 Ga0207639_10047187 3300026041 Bacteria 3254
467 Ga0207639_10088492 3300026041 Bacteria 2471
468 Ga0207639_10109237 3300026041 Bacteria 2250
469 Ga0207639_10308800 3300026041 Bacteria 1400
470 Ga0207678_10000447 3300026067 Bacteria 37597
471 Ga0207678_10033426 3300026067 Bacteria 4481
472 Ga0207708_10000293 3300026075 Bacteria 39298
473 Ga0207708_10001642 3300026075 Bacteria 16642
474 Ga0207708_10053637 3300026075 Bacteria 3072
475 Ga0207702_10000004 3300026078 Bacteria 422182
476 Ga0207702_10007213 3300026078 Bacteria 9510
477 Ga0207702_10358044 3300026078 Bacteria 1398
478 Ga0207641_10000724 3300026088 Bacteria 35413
479 Ga0207648_10000223 3300026089 Bacteria 61064
480 Ga0207648_10248151 3300026089 Bacteria 1587
481 Ga0207676_10000392 3300026095 Bacteria 37207
482 Ga0207674_10000955 3300026116 Bacteria 37769
483 Ga0207674_10015429 3300026116 Bacteria 8393
484 Ga0207674_10038075 3300026116 Bacteria 4997
485 Ga0207674_10043252 3300026116 Bacteria 4645
486 Ga0207675_100000364 3300026118 Bacteria 43420
487 Ga0207675_100015329 3300026118 Bacteria 7152
488 Ga0207675_100019492 3300026118 Bacteria 6330
489 Ga0207675_100024249 3300026118 Bacteria 5642
490 Ga0207675_100038369 3300026118 Bacteria 4470
491 Ga0207675_100094123 3300026118 Bacteria 2818
492 Ga0207675_100236859 3300026118 Bacteria 1762
493 Ga0207683_10000397 3300026121 Bacteria 39911
494 Ga0207698_10003705 3300026142 Bacteria 9239
495 Ga0207698_10007410 3300026142 Bacteria 6873
496 Ga0207698_10132253 3300026142 Bacteria 2134
497 Ga0207698_10157066 3300026142 Bacteria 1983
498 Ga0209984_1002742 3300027424 Unclassified 1982
499 Ga0209179_1001356 3300027512 Bacteria 2970
500 Ga0209588_1010276 3300027671 Bacteria 2812
501 Ga0209998_10000535 3300027717 Bacteria 10223
502 Ga0209998_10012119 3300027717 Bacteria 1789
503 Ga0209998_10012410 3300027717 Bacteria 1769
504 Ga0209974_10001185 3300027876 Bacteria 9317
505 Ga0209974_10039574 3300027876 Unclassified 1568
506 Ga0207428_10000164 3300027907 Bacteria 91968
507 Ga0207428_10000439 3300027907 Bacteria 50911
508 Ga0268266_10001331 3300028379 Bacteria 29945
509 Ga0268266_10001870 3300028379 Bacteria 23767
510 Ga0268266_10008599 3300028379 Bacteria 9068
511 Ga0268266_10094578 3300028379 Bacteria 2623
512 Ga0268265_10001307 3300028380 Bacteria 21379
513 Ga0268265_10016028 3300028380 Bacteria 5142
514 Ga0268265_10016324 3300028380 Bacteria 5098
515 Ga0268265_10052521 3300028380 Bacteria 3083
516 Ga0268265_10300383 3300028380 Bacteria 1445
517 Ga0268264_10000084 3300028381 Bacteria 242128
518 Ga0268264_10000890 3300028381 Bacteria 31465
519 Ga0268264_10055833 3300028381 Bacteria 3300
520 Ga0268264_10120126 3300028381 Bacteria 2315
521 Ga0265334_10036455 3300028573 Bacteria 1942
522 Ga0265336_10005233 3300028666 Bacteria 4808
523 Ga0307515_10260329 3300028794 Bacteria 1472
524 Ga0265338_10000328 3300028800 Bacteria 86546
525 Ga0307511_10091324 3300030521 Bacteria 2061
526 Ga0265330_10007778 3300031235 Bacteria 5203
527 Ga0265340_10005751 3300031247 Bacteria 6852
528 Ga0265339_10008893 3300031249 Bacteria 6359
529 Ga0265339_10039873 3300031249 Bacteria 2612
530 Ga0307513_10208314 3300031456 Bacteria 1789
531 Ga0307509_10022959 3300031507 Bacteria 7015
532 Ga0307509_10033098 3300031507 Bacteria 5691
533 Ga0307508_10000105 3300031616 Bacteria 99107
534 Ga0265342_10050824 3300031712 Bacteria 2475
535 Ga0307516_10006693 3300031730 Bacteria 13466
536 Ga0307516_10029708 3300031730 Bacteria 5523
537 Ga0307516_10117785 3300031730 Bacteria 2450
538 Ga0307416_100169867 3300032002 Bacteria 2028
539 Ga0307507_10041585 3300033179 Bacteria 4596
540 Ga0307510_10021386 3300033180 Bacteria 7538
541 Ga0373930_0000249 3300034816 Bacteria 6839
542 Ga0373950_0000554 3300034818 Bacteria 4574
543 Ga0373958_0000184 3300034819 Bacteria 7209
544 Ga0373958_0000847 3300034819 Bacteria 3931
545 Ga0373938_0007981 3300034957 Unclassified 1879
546 Ga0373928_0000961 3300035084 Bacteria 5654
547 Ga0373928_0014002 3300035084 Bacteria 1616
548 Ga0373934_0013639 3300035086 Bacteria 3076
549 Ga0373940_0000149 3300035088 Bacteria 9064
550 Ga0373940_0009491 3300035088 Bacteria 2264
551 Ga0373944_0002242 3300035089 Bacteria 4916
552 Ga0373949_0000476 3300035090 Bacteria 13682
553 Ga0373949_0006745 3300035090 Bacteria 2520
554 Ga0373951_0000556 3300035091 Bacteria 10428
555 Ga0373952_0000375 3300035092 Bacteria 7612
556 Ga0373952_0000491 3300035092 Bacteria 6857
557 Ga0373923_0001200 3300035111 Bacteria 7251
558 Ga0373923_0004465 3300035111 Bacteria 4644
559 Ga0373932_0000419 3300035112 Bacteria 12972
560 Ga0373936_0002403 3300035113 Bacteria 7009
561 Ga0373936_0010433 3300035113 Bacteria 3505
562 Ga0373939_0000671 3300035114 Bacteria 8492
563 Ga0373939_0001011 3300035114 Bacteria 6955
564 Ga0373941_0000283 3300035115 Bacteria 9807
565 Ga0373941_0002421 3300035115 Bacteria 4103
566 Ga0373945_0013151 3300035116 Bacteria 2758
567 Ga0373953_0000986 3300035117 Bacteria 7999
568 Ga0373953_0013697 3300035117 Bacteria 2901
569 Ga0373953_0017919 3300035117 Bacteria 2611
570 Ga0373953_0097070 3300035117 Bacteria 1237
571 Ga0373953_0108640 3300035117 Bacteria 1172
572 Ga0373954_0000377 3300035118 Bacteria 16536
573 Ga0373954_0034619 3300035118 Bacteria 2340
574 Ga0373956_0002477 3300035119 Bacteria 7510
575 Ga0373956_0007446 3300035119 Bacteria 4411
576 Ga0373956_0044890 3300035119 Bacteria 1971
577 Ga0373956_0046690 3300035119 Bacteria 1936
578 Ga0373957_0000292 3300035120 Bacteria 12522
579 Ga0373960_0000720 3300035121 Bacteria 6888
580 Ga0373960_0001077 3300035121 Bacteria 5890
581 Ga0373943_0001653 3300035170 Bacteria 10127
582 Ga0373943_0004339 3300035170 Bacteria 6436
583 Ga0373943_0005625 3300035170 Bacteria 5622
584 Ga0373943_0019645 3300035170 Bacteria 3108
585 Ga0373946_0014033 3300035171 Bacteria 3017
586 Ga0373946_0017711 3300035171 Bacteria 2728
587 Ga0373955_0000348 3300035172 Bacteria 19454
588 Ga0373955_0066110 3300035172 Bacteria 2009
589 Ga0373955_0096554 3300035172 Bacteria 1691
590 Ga0373955_0099978 3300035172 Unclassified 1663
591 Ga0373942_0002656 3300035207 Bacteria 4298
592 Ga0373961_0001332 3300035241 Bacteria 7449
593 Ga0373962_0005337 3300035242 Bacteria 3109
594 Ga0373962_0014338 3300035242 Bacteria 2019
595 Ga0373924_0014135 3300035410 Bacteria 3012
596 Ga0373924_0034063 3300035410 Bacteria 2060
597 Ga0373931_0000089 3300035691 Bacteria 42136
598 Ga0373931_0003734 3300035691 Bacteria 6889
599 Ga0373931_0046094 3300035691 Bacteria 2304
600 Ga0373935_0007646 3300035692 Bacteria 6476
601 Ga0373935_0008907 3300035692 Bacteria 6004
602 Ga0373935_0032361 3300035692 Bacteria 3250
603 Ga0373935_0064740 3300035692 Bacteria 2345
604 Ga0373935_0086918 3300035692 Bacteria 2041
605 Ga0373927_0000990 3300035695 Bacteria 21639
606 Ga0373927_0008010 3300035695 Bacteria 7132
607 Ga0373927_0066789 3300035695 Bacteria 2327
608 Ga0373927_0152087 3300035695 Bacteria 1515
609 Ga0373933_0004936 3300035724 Bacteria 7273
610 Ga0373933_0034036 3300035724 Bacteria 2967
611 Ga0373933_0048919 3300035724 Bacteria 2519
612 Ga0373933_0096607 3300035724 Bacteria 1829
613 Ga0373933_0220365 3300035724 Bacteria 1217
614 Ga0373947_0001990 3300035725 Bacteria 12497
615 Ga0373947_0038205 3300035725 Bacteria 2850
616 Ga0373947_0106761 3300035725 Bacteria 1765
617 Ga0373947_0109252 3300035725 Bacteria 1746
618 Ga0373947_0272258 3300035725 Bacteria 1124
619 Ga0373937_0006630 3300036401 Bacteria 9995
620 Ga0373937_0061646 3300036401 Bacteria 3448
621 Ga0373937_0089832 3300036401 Bacteria 2845
622 Ga0373937_0134577 3300036401 Bacteria 2310
623 Ga0373937_0156945 3300036401 Bacteria 2133
624 Ga0373925_0000863 3300037068 Bacteria 27740
625 Ga0373925_0004100 3300037068 Bacteria 11056
626 Ga0373925_0046571 3300037068 Bacteria 3225
627 Ga0373925_0074250 3300037068 Bacteria 2575
628 Ga0373925_0078861 3300037068 Bacteria 2501
629 Ga0395898_0441057 3300037466 Bacteria 1240
630 Ga0395905_0170975 3300037471 Bacteria 2041
631 Ga0395905_0332748 3300037471 Bacteria 1409
632 Ga0436365_0245719 3300039437 Bacteria 27624
633 Ga0436361_0192460 3300039447 Bacteria 2916
634 Ga0436363_0021603 3300039450 Bacteria 2025
635 Ga0436362_0125439 3300039453 Bacteria 8541
636 Ga0451789_0437480 3300041443 Bacteria 1671
637 Ga0451802_0821672 3300041460 Bacteria 1688
638 Ga0451802_1192777 3300041460 Bacteria 1431
639 Ga0439448_0033854 3300042005 Unclassified 1631
640 Ga0439455_0005262 3300042012 Bacteria 2616
641 Ga0466969_0129318 3300044656 Bacteria 1171
642 Ga0453683_0012196 3300044673 Bacteria 5638
643 Ga0466966_0043517 3300044684 Bacteria 2878
644 Ga0466957_0062115 3300044842 Bacteria 2294
645 Ga0451576_0153537 3300045051 Bacteria 2401
646 Ga0495617_009150 3300046452 Bacteria 3407
647 Ga0495627_068260 3300046453 Bacteria 1042
648 Ga0495592_0001421 3300046454 Bacteria 16615
649 Ga0495592_0049016 3300046454 Bacteria 3140
650 Ga0495592_0051951 3300046454 Bacteria 3044
651 Ga0495592_0058218 3300046454 Bacteria 2850
652 Ga0495592_0061171 3300046454 Bacteria 2768
653 Ga0495603_0000091 3300046455 Bacteria 41074
654 Ga0495603_0007129 3300046455 Bacteria 6709
655 Ga0495603_0042395 3300046455 Bacteria 2720
656 Ga0495603_0156822 3300046455 Bacteria 1321
657 Ga0495629_0000011 3300046459 Bacteria 268675
658 Ga0495629_0000583 3300046459 Bacteria 29653
659 Ga0495629_0002565 3300046459 Bacteria 13924
660 Ga0495629_0029527 3300046459 Bacteria 3887
661 Ga0495629_0062559 3300046459 Bacteria 2599
662 Ga0495638_0019825 3300046460 Bacteria 4446
663 Ga0495641_0003388 3300046461 Bacteria 11954
664 Ga0495641_0016919 3300046461 Bacteria 3820
665 Ga0495651_0012272 3300046462 Bacteria 6603
666 Ga0495651_0017917 3300046462 Bacteria 5484
667 Ga0495651_0057255 3300046462 Bacteria 2992
668 Ga0495651_0232807 3300046462 Bacteria 1268
669 Ga0495653_0021441 3300046463 Bacteria 5234
670 Ga0495653_0021760 3300046463 Bacteria 5192
671 Ga0495653_0051973 3300046463 Bacteria 3143
672 Ga0495653_0120600 3300046463 Bacteria 1870
673 Ga0495580_0009686 3300046472 Bacteria 7560
674 Ga0495580_0019072 3300046472 Bacteria 5099
675 Ga0495582_0000049 3300046473 Bacteria 59194
676 Ga0495582_0010994 3300046473 Bacteria 4982
677 Ga0495582_0054597 3300046473 Bacteria 2203
678 Ga0495582_0253854 3300046473 Bacteria 1009
679 Ga0495605_0044201 3300046474 Bacteria 2204
680 Ga0495605_0089094 3300046474 Bacteria 1432
681 Ga0495605_0095109 3300046474 Bacteria 1375
682 Ga0495639_0000303 3300046475 Bacteria 23998
683 Ga0495639_0000815 3300046475 Bacteria 14292
684 Ga0495639_0026553 3300046475 Bacteria 2560
685 Ga0495639_0052876 3300046475 Bacteria 1849
686 Ga0495662_0000387 3300046476 Bacteria 19598
687 Ga0495662_0015027 3300046476 Bacteria 3761
688 Ga0495662_0134505 3300046476 Unclassified 1216
689 Ga0495664_0002459 3300046477 Bacteria 9973
690 Ga0495664_0009480 3300046477 Bacteria 5449
691 Ga0495584_0021432 3300046491 Bacteria 3283
692 Ga0495584_0027251 3300046491 Bacteria 2895
693 Ga0495584_0152203 3300046491 Bacteria 1175
694 Ga0495585_0004147 3300046492 Bacteria 9483
695 Ga0495585_0057680 3300046492 Bacteria 2142
696 Ga0495585_0159766 3300046492 Bacteria 1170
697 Ga0495594_0000641 3300046499 Bacteria 18022
698 Ga0495594_0020339 3300046499 Bacteria 3535
699 Ga0495594_0026882 3300046499 Bacteria 3098
700 Ga0495607_0022202 3300046501 Bacteria 3990
701 Ga0495583_0038379 3300046506 Bacteria 2263
702 Ga0495583_0107340 3300046506 Bacteria 1186
703 Ga0495608_0011931 3300046511 Bacteria 6042
704 Ga0495608_0012258 3300046511 Bacteria 5954
705 Ga0495608_0061334 3300046511 Bacteria 2473
706 Ga0495610_0047845 3300046512 Bacteria 2102
707 Ga0495616_0016601 3300046513 Bacteria 4072
708 Ga0495616_0061922 3300046513 Bacteria 1834
709 Ga0495618_0017431 3300046514 Bacteria 4404
710 Ga0495618_0269276 3300046514 Unclassified 1065
711 Ga0495628_0012236 3300046516 Bacteria 7233
712 Ga0495628_0053918 3300046516 Bacteria 3171
713 Ga0495628_0155743 3300046516 Unclassified 1738
714 Ga0495630_0045453 3300046517 Bacteria 3281
715 Ga0495631_0033478 3300046518 Bacteria 2308
716 Ga0495632_0051846 3300046519 Bacteria 2018
717 Ga0495643_0081441 3300046522 Bacteria 1683
718 Ga0495644_0002015 3300046523 Bacteria 8171
719 Ga0495648_0000436 3300046524 Bacteria 45329
720 Ga0495648_0053962 3300046524 Bacteria 2431
721 Ga0495648_0091052 3300046524 Bacteria 1707
722 Ga0495663_0013129 3300046525 Bacteria 2315
723 Ga0495666_0001631 3300046526 Bacteria 11046
724 Ga0495666_0017973 3300046526 Bacteria 3521
725 Ga0495652_0055002 3300046529 Bacteria 3386
726 Ga0495652_0067614 3300046529 Bacteria 2995
727 Ga0495652_0078831 3300046529 Bacteria 2725
728 Ga0495652_0096797 3300046529 Bacteria 2402
729 Ga0495665_0000101 3300046531 Bacteria 40147
730 Ga0495640_0003445 3300046533 Bacteria 12727
731 Ga0495640_0016301 3300046533 Bacteria 5562
732 Ga0495640_0048081 3300046533 Bacteria 2950
733 Ga0495640_0050502 3300046533 Bacteria 2865
734 Ga0495640_0098440 3300046533 Bacteria 1922
735 Ga0495640_0254266 3300046533 Bacteria 1099
736 Ga0495586_0000755 3300046535 Bacteria 18590
737 Ga0495587_0013085 3300046536 Bacteria 5217
738 Ga0495587_0016782 3300046536 Bacteria 4552
739 Ga0495587_0075499 3300046536 Bacteria 1957
740 Ga0495598_0006129 3300046537 Bacteria 2701
741 Ga0495598_0019419 3300046537 Bacteria 1782
742 Ga0495609_0094471 3300046538 Bacteria 1298
743 Ga0495645_0002559 3300046543 Bacteria 12352
744 Ga0495645_0004167 3300046543 Bacteria 9882
745 Ga0495622_0004249 3300046557 Bacteria 6671
746 Ga0495622_0007367 3300046557 Bacteria 5105
747 Ga0495622_0059416 3300046557 Bacteria 1770
748 Ga0495633_0080437 3300046558 Bacteria 1516
749 Ga0495667_0013983 3300046559 Bacteria 5419
750 Ga0495667_0020621 3300046559 Bacteria 4446
751 Ga0495667_0035233 3300046559 Bacteria 3345
752 Ga0495667_0066122 3300046559 Bacteria 2364
753 Ga0495656_0000562 3300046615 Bacteria 12127
754 Ga0495656_0168225 3300046615 Bacteria 1070
755 Ga0495668_0023571 3300046616 Bacteria 3507
756 Ga0495668_0085540 3300046616 Bacteria 1729
757 Ga0495668_0229152 3300046616 Bacteria 1017
758 Ga0495634_0000267 3300046642 Bacteria 49323
759 Ga0495634_0150493 3300046642 Unclassified 1472
760 Ga0495611_0004220 3300046648 Bacteria 6257
761 Ga0495611_0070779 3300046648 Bacteria 1594
762 Ga0495611_0077025 3300046648 Bacteria 1529
763 Ga0495625_0042249 3300046660 Bacteria 3314
764 Ga0495625_0114974 3300046660 Bacteria 1836
765 Ga0495625_0172313 3300046660 Bacteria 1444
766 Ga0495635_0000084 3300046663 Bacteria 56456
767 Ga0495635_0006470 3300046663 Bacteria 8168
768 Ga0495635_0009263 3300046663 Bacteria 6877
769 Ga0495635_0015264 3300046663 Bacteria 5373
770 Ga0495635_0015655 3300046663 Bacteria 5297
771 Ga0495635_0092474 3300046663 Bacteria 2068
772 Ga0495659_0029506 3300046664 Bacteria 1905
773 Ga0495661_0054221 3300046665 Bacteria 2408
774 Ga0495588_0004581 3300046674 Bacteria 6109
775 Ga0495657_0017064 3300046675 Bacteria 5276
776 Ga0495657_0084392 3300046675 Unclassified 2049
777 Ga0495657_0136886 3300046675 Bacteria 1530
778 Ga0495599_0035912 3300046678 Bacteria 3110
779 Ga0495599_0043703 3300046678 Bacteria 2812
780 Ga0495599_0092688 3300046678 Bacteria 1885
781 Ga0495623_0014573 3300046679 Bacteria 5085
782 Ga0495623_0200844 3300046679 Bacteria 1146
783 Ga0495646_0006452 3300046680 Bacteria 7439
784 Ga0495646_0009027 3300046680 Bacteria 6323
785 Ga0495646_0023402 3300046680 Bacteria 3890
786 Ga0495646_0024146 3300046680 Bacteria 3829
787 Ga0495647_0003483 3300046681 Bacteria 5034
788 Ga0495647_0007118 3300046681 Bacteria 3736
789 Ga0495647_0076376 3300046681 Bacteria 1350
790 Ga0495658_0000173 3300046683 Bacteria 36536
791 Ga0495658_0057813 3300046683 Bacteria 2216
792 Ga0495669_0024503 3300046684 Bacteria 2627
793 Ga0495613_0005231 3300046689 Bacteria 9747
794 Ga0495613_0011762 3300046689 Bacteria 6504
795 Ga0495613_0025072 3300046689 Bacteria 4444
796 Ga0495613_0128414 3300046689 Bacteria 1816
797 Ga0495624_0001263 3300046690 Bacteria 19959
798 Ga0495624_0078806 3300046690 Bacteria 2043
799 Ga0495670_0006473 3300046691 Bacteria 5755
800 Ga0495670_0032727 3300046691 Bacteria 2586
801 Ga0495670_0100940 3300046691 Bacteria 1486
802 Ga0495671_0036879 3300046692 Bacteria 2475
803 Ga0495671_0108984 3300046692 Bacteria 1352
804 Ga0495649_0108048 3300046694 Bacteria 1476
805 Ga0495589_0071633 3300046794 Bacteria 1693
806 Ga0495589_0075273 3300046794 Bacteria 1646
807 Ga0495600_0007694 3300046809 Bacteria 6599
808 Ga0495600_0040507 3300046809 Bacteria 3034
809 Ga0495600_0074224 3300046809 Bacteria 2221
810 Ga0495600_0197010 3300046809 Bacteria 1294
811 Ga0495660_0084157 3300046810 Bacteria 1664
812 Ga0495660_0145671 3300046810 Bacteria 1174
813 Ga0495581_0000864 3300047315 Bacteria 16170
814 Ga0495581_0008649 3300047315 Bacteria 5897
815 Ga0495581_0188756 3300047315 Unclassified 1205
816 Ga0495604_0010756 3300047317 Bacteria 7265
817 Ga0495604_0015977 3300047317 Bacteria 5993
818 Ga0495604_0045948 3300047317 Bacteria 3406
819 Ga0495674_0049391 3300047319 Bacteria 3718
820 Ga0495674_0118586 3300047319 Bacteria 2237
821 Ga0495672_0063988 3300047320 Bacteria 2108
822 Ga0495676_0004982 3300047321 Bacteria 12177
823 Ga0495676_0016365 3300047321 Bacteria 6586
824 Ga0495676_0029827 3300047321 Bacteria 4638
825 Ga0495676_0062408 3300047321 Bacteria 2909
826 Ga0495676_0126239 3300047321 Bacteria 1854
827 Ga0495680_0001934 3300047322 Bacteria 21789
828 Ga0495680_0018136 3300047322 Bacteria 5985
829 Ga0495680_0020444 3300047322 Bacteria 5570
830 Ga0495680_0029773 3300047322 Bacteria 4467
831 Ga0495680_0054136 3300047322 Bacteria 3117
832 Ga0495680_0186033 3300047322 Unclassified 1496
833 Ga0495680_0227149 3300047322 Bacteria 1330
834 Ga0495683_0144769 3300047323 Bacteria 1111
835 Ga0495675_0000862 3300047444 Bacteria 18517
836 Ga0495675_0044349 3300047444 Unclassified 2833
837 Ga0495675_0142250 3300047444 Bacteria 1486
838 Ga0495675_0249785 3300047444 Bacteria 1066
839 Ga0495679_011605 3300047446 Bacteria 3389
840 Ga0495681_0075638 3300047470 Bacteria 1515
841 Ga0495684_0000701 3300047471 Bacteria 26925
842 Ga0495684_0041413 3300047471 Bacteria 3530
843 Ga0495684_0145506 3300047471 Bacteria 1775
844 Ga0495593_0000016 3300047673 Bacteria 80178
845 Ga0495593_0026325 3300047673 Bacteria 3212
846 Ga0495593_0060225 3300047673 Unclassified 1988
847 Ga0495602_0011145 3300048088 Bacteria 9305
848 Ga0495602_0022469 3300048088 Bacteria 6173
849 Ga0495602_0152802 3300048088 Bacteria 1812
850 Ga0495614_0071916 3300048089 Bacteria 1491
851 Ga0496100_0000200 3300048903 Bacteria 32909
852 Ga0496100_0060876 3300048903 Bacteria 2486
853 Ga0496100_0337258 3300048903 Bacteria 1136
854 Ga0496101_0000339 3300048904 Bacteria 31619
855 Ga0496102_0000729 3300048905 Bacteria 32340
856 Ga0496102_0016911 3300048905 Bacteria 6383
857 Ga0496102_0032117 3300048905 Bacteria 4716
858 Ga0496102_0054713 3300048905 Bacteria 3640
859 Ga0496102_0290402 3300048905 Bacteria 1541
860 Ga0496102_0336808 3300048905 Bacteria 1421
861 Ga0496103_0001639 3300048906 Bacteria 14682
862 Ga0496104_0002526 3300048907 Bacteria 15766
863 Ga0496104_0330946 3300048907 Bacteria 1436
864 Ga0496104_0482350 3300048907 Bacteria 1151
865 Ga0496105_0044036 3300048908 Bacteria 3680
866 Ga0496105_0233258 3300048908 Bacteria 1495
867 Ga0496106_0000202 3300048909 Bacteria 41819
868 Ga0496106_0005687 3300048909 Bacteria 9220
869 Ga0496106_0064478 3300048909 Bacteria 2787
870 Ga0496106_0072449 3300048909 Bacteria 2635
871 Ga0496106_0188979 3300048909 Bacteria 1637
872 Ga0496106_0394675 3300048909 Bacteria 1112
873 Ga0496107_0000066 3300048910 Bacteria 52207
874 Ga0496107_0010112 3300048910 Bacteria 6545
875 Ga0496108_0009303 3300048911 Bacteria 7954
876 Ga0496108_0011418 3300048911 Bacteria 7221
877 Ga0496108_0015918 3300048911 Bacteria 6130
878 Ga0496108_0043555 3300048911 Bacteria 3749
879 Ga0496109_0000595 3300048912 Bacteria 30262
880 Ga0496109_0020680 3300048912 Bacteria 5814
881 Ga0496109_0038245 3300048912 Bacteria 4337
882 Ga0496109_0099281 3300048912 Bacteria 2700
883 Ga0496109_0143391 3300048912 Bacteria 2234
884 Ga0496110_0064886 3300048913 Bacteria 3228
885 Ga0496110_0253987 3300048913 Unclassified 1600
886 Ga0496111_0016577 3300048914 Bacteria 5080
887 Ga0496112_0005122 3300048915 Bacteria 11265
888 Ga0496112_0007966 3300048915 Bacteria 9447
889 Ga0496112_0013236 3300048915 Bacteria 7612
890 Ga0496112_0043635 3300048915 Unclassified 4390
891 Ga0496112_0205776 3300048915 Bacteria 1926
892 Ga0496113_0008065 3300048916 Bacteria 6834
893 Ga0496113_0041677 3300048916 Bacteria 3389
894 Ga0496113_0420805 3300048916 Bacteria 1073
895 Ga0496114_0023336 3300048917 Bacteria 5048
896 Ga0496114_0248749 3300048917 Bacteria 1564
897 Ga0496115_0001197 3300048918 Bacteria 18589
898 Ga0496115_0022519 3300048918 Bacteria 4883
899 Ga0496115_0058265 3300048918 Bacteria 3108
900 Ga0496115_0102550 3300048918 Bacteria 2347
901 Ga0496116_0151268 3300048919 Bacteria 1289
902 Ga0496117_0035051 3300048920 Bacteria 3773
903 Ga0496118_0002112 3300048921 Bacteria 27854
904 Ga0496118_0052143 3300048921 Bacteria 3124
905 Ga0496118_0071969 3300048921 Bacteria 2486
906 Ga0496118_0180623 3300048921 Bacteria 1275
907 Ga0496121_0000077 3300048924 Bacteria 235293
908 Ga0496121_0030446 3300048924 Bacteria 4956
909 Ga0496121_0048141 3300048924 Bacteria 3630
910 Ga0496121_0081538 3300048924 Bacteria 2560
911 Ga0496121_0089776 3300048924 Bacteria 2404
912 Ga0496121_0098951 3300048924 Bacteria 2255
913 Ga0496121_0173892 3300048924 Bacteria 1561
914 Ga0496122_0035498 3300048925 Bacteria 4054
915 Ga0496124_0002375 3300048927 Bacteria 24818
916 Ga0496124_0121758 3300048927 Bacteria 2084
917 Ga0496125_0048124 3300048928 Bacteria 3559
918 Ga0496125_0062411 3300048928 Bacteria 2980
919 Ga0496125_0154636 3300048928 Bacteria 1569
920 Ga0496126_0006024 3300048929 Bacteria 13609
921 Ga0496126_0018133 3300048929 Bacteria 6986
922 Ga0496126_0026244 3300048929 Bacteria 5588
923 Ga0496126_0034951 3300048929 Bacteria 4713
924 Ga0496126_0051994 3300048929 Bacteria 3727
925 Ga0496126_0155440 3300048929 Bacteria 1958
926 Ga0496126_0180962 3300048929 Bacteria 1791
927 Ga0496126_0203176 3300048929 Bacteria 1672
928 Ga0496126_0408124 3300048929 Bacteria 1100
929 Ga0501031_0038357 3300049568 Bacteria 3126
930 Ga0501031_0139413 3300049568 Bacteria 1585
931 Ga0501031_0192239 3300049568 Bacteria 1333
932 Ga0501032_0093040 3300049569 Bacteria 1999
933 Ga0501033_0030031 3300049570 Bacteria 4084
934 Ga0501034_0032996 3300049571 Bacteria 5257
935 Ga0501037_0014466 3300049573 Bacteria 5807
936 Ga0501037_0049800 3300049573 Bacteria 3067
937 Ga0501038_0012458 3300049574 Bacteria 7772
938 Ga0501039_0008471 3300049575 Bacteria 7840
939 Ga0501039_0078299 3300049575 Bacteria 2571
940 Ga0501040_0006582 3300049576 Bacteria 7539
941 Ga0501040_0077037 3300049576 Bacteria 2307
942 Ga0501042_0014951 3300049578 Bacteria 5306
943 Ga0501043_0067091 3300049579 Bacteria 2817
944 Ga0501047_0092278 3300049581 Bacteria 2906
945 Ga0501048_0010834 3300049582 Bacteria 6796
946 Ga0501067_0003500 3300049583 Bacteria 8633
947 Ga0501067_0014400 3300049583 Bacteria 4379
948 Ga0501067_0048239 3300049583 Bacteria 2362
949 Ga0501068_0005171 3300049584 Bacteria 7117
950 Ga0501068_0127201 3300049584 Bacteria 1592
951 Ga0501069_0032536 3300049585 Bacteria 2871
952 Ga0501069_0044001 3300049585 Bacteria 2472
953 Ga0501070_0021264 3300049586 Bacteria 5445
954 Ga0501070_0021894 3300049586 Bacteria 5356
955 Ga0501071_0268885 3300049587 Bacteria 1288
956 Ga0501072_0030261 3300049588 Bacteria 4234
957 Ga0501073_0000701 3300049589 Bacteria 23621
958 Ga0501073_0014223 3300049589 Bacteria 5779
959 Ga0501074_0088728 3300049590 Bacteria 2215
960 Ga0501075_0075879 3300049591 Bacteria 2542
961 Ga0501077_0075666 3300049593 Unclassified 2132
962 Ga0501079_0022790 3300049741 Bacteria 4807
963 Ga0501079_0070801 3300049741 Bacteria 2693
964 Ga0501079_0374500 3300049741 Bacteria 1116
965 Ga0501080_0149095 3300049742 Bacteria 2162
966 Ga0501083_0031342 3300049744 Bacteria 3649
967 Ga0501083_0061060 3300049744 Unclassified 2517
968 Ga0501044_0103701 3300049823 Bacteria 2858
969 Ga0501045_0002697 3300049824 Bacteria 12118
970 nmdc:mga03n38_6006_c1 3300050490 Bacteria 4186
971 nmdc:mga06z11_121961_c1 3300050494 Bacteria 1455
972 nmdc:mga06z11_13965_c1 3300050494 Bacteria 3542
973 nmdc:mga06z11_15652_c1 3300050494 Bacteria 3391
974 nmdc:mga07m45_62937_c1 3300050496 Bacteria 2104
975 nmdc:mga05p37_124219_c1 3300050507 Bacteria 3170
976 nmdc:mga05p37_272266_c1 3300050507 Bacteria 2022
977 nmdc:mga08y16_214543_c1 3300050511 Bacteria 1993
978 nmdc:mga08y16_2489_c1 3300050511 Bacteria 18925
979 nmdc:mga08y16_3164_c1 3300050511 Bacteria 17060
980 nmdc:mga08y16_56024_c1 3300050511 Unclassified 4120
981 nmdc:mga08y16_8401_c1 3300050511 Bacteria 10806
982 nmdc:mga0n895_275928_c1 3300050512 Bacteria 1705
983 nmdc:mga0n895_381_c1 3300050512 Bacteria 30014
984 nmdc:mga0a205_2432_c1 3300050515 Bacteria 16422
985 nmdc:mga0a205_472178_c1 3300050515 Unclassified 1113
986 nmdc:mga0a205_49895_c1 3300050515 Bacteria 4041
987 nmdc:mga0sz30_20613_c2 3300050516 Bacteria 1507
988 Ga0495601_0005443 3300053077 Bacteria 7417
989 Ga0495601_0007975 3300053077 Bacteria 6235
990 Ga0495601_0340549 3300053077 Bacteria 975
991 Ga0495612_0013688 3300053078 Bacteria 3267
992 Ga0495612_0013901 3300053078 Bacteria 3243
993 Ga0500635_0004635 3300053080 Bacteria 3549
994 Ga0500635_0010920 3300053080 Bacteria 2567
995 Ga0500635_0022158 3300053080 Bacteria 1966
996 Ga0495595_0001767 3300053084 Bacteria 8441
997 Ga0495595_0003811 3300053084 Bacteria 6003
998 Ga0495595_0006384 3300053084 Bacteria 4806
999 Ga0495619_0000308 3300053085 Bacteria 34461
1000 Ga0495619_0016450 3300053085 Bacteria 4682
1001 Ga0495619_0043597 3300053085 Bacteria 2941
1002 Ga0495619_0175450 3300053085 Bacteria 1482
1003 Ga0500646_0010209 3300053090 Bacteria 2408
1004 Ga0500566_0069485 3300053094 Bacteria 1979
1005 Ga0500641_0002055 3300053096 Bacteria 7147
1006 Ga0500650_0079712 3300053098 Bacteria 1531
1007 Ga0500554_000935 3300053102 Bacteria 5693
1008 Ga0500556_0026238 3300053104 Bacteria 1934
1009 Ga0500572_000056 3300053111 Bacteria 34105
1010 Ga0500595_043425 3300053119 Bacteria 1431
1011 Ga0500655_006959 3300053133 Bacteria 2033
1012 Ga0500658_0044292 3300053134 Bacteria 1795
1013 Ga0500559_0000423 3300053136 Bacteria 30084
1014 Ga0500588_0029484 3300053146 Bacteria 1565
1015 Ga0500603_032165 3300053150 Bacteria 1359
1016 Ga0500634_0066796 3300053161 Bacteria 1893
1017 Ga0500639_009475 3300053163 Bacteria 5091
1018 Ga0500637_0054269 3300053178 Bacteria 2287
1019 Ga0500637_0096258 3300053178 Bacteria 1715
1020 Ga0500637_0136517 3300053178 Bacteria 1420
1021 Ga0500645_009336 3300053730 Bacteria 3297
1022 Ga0500596_000256 3300053735 Bacteria 9337
1023 Ga0500596_000710 3300053735 Bacteria 6513
1024 Ga0501084_0034204 3300054114 Bacteria 4249
1025 Ga0501082_0054566 3300060353 Bacteria 3444
1026 Ga0501082_0176206 3300060353 Bacteria 1859
1027 Ga0501082_0299150 3300060353 Unclassified 1401
1028 Ga0466962_0160947 3300061719 Bacteria 1091
1029 Ga0530510_0032958 3300061734 Bacteria 3728

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0482350 Ga0496104_0482350_17_844 252
2 3300009545 Ga0105237_10098472 Ga0105237_100984723 267
3 3300013100 Ga0157373_10138365 Ga0157373_101383651 267
4 3300026067 Ga0207678_10033426 Ga0207678_100334268 267
5 3300026118 Ga0207675_100015329 Ga0207675_1000153292 267
6 3300035692 Ga0373935_0086918 Ga0373935_0086918_436_1308 267
7 3300035695 Ga0373927_0152087 Ga0373927_0152087_284_1156 267
8 3300046491 Ga0495584_0152203 Ga0495584_0152203_152_1024 267
9 3300046525 Ga0495663_0013129 Ga0495663_0013129_1430_2302 267
10 3300046616 Ga0495668_0229152 Ga0495668_0229152_20_892 267
11 3300047320 Ga0495672_0063988 Ga0495672_0063988_13_885 267
12 3300048903 Ga0496100_0337258 Ga0496100_0337258_42_914 267
13 3300048917 Ga0496114_0248749 Ga0496114_0248749_620_1492 267
14 3300050516 nmdc:mga0sz30_20613_c2 nmdc:mga0sz30_20613_c2_31_903 267
15 3300046533 Ga0495640_0254266 Ga0495640_0254266_191_1033 276
16 3300047315 Ga0495581_0008649 Ga0495581_0008649_4977_5834 276
17 3300048929 Ga0496126_0155440 Ga0496126_0155440_977_1819 276
18 3300049741 Ga0501079_0374500 Ga0501079_0374500_255_1100 276
19 3300053077 Ga0495601_0340549 Ga0495601_0340549_64_921 276
20 3300046538 Ga0495609_0094471 Ga0495609_0094471_79_981 277
21 3300047323 Ga0495683_0144769 Ga0495683_0144769_188_1090 277
22 3300049583 Ga0501067_0014400 Ga0501067_0014400_2876_3763 279
23 3300046533 Ga0495640_0098440 Ga0495640_0098440_897_1814 282
24 3300049741 Ga0501079_0070801 Ga0501079_0070801_1598_2473 282
25 3300050507 nmdc:mga05p37_124219_c1 nmdc:mga05p37_124219_c1_1889_2743 282
26 3300035117 Ga0373953_0097070 Ga0373953_0097070_24_950 285
27 3300035117 Ga0373953_0108640 Ga0373953_0108640_50_976 285
28 3300035724 Ga0373933_0220365 Ga0373933_0220365_347_1207 285
29 3300046675 Ga0495657_0136886 Ga0495657_0136886_606_1466 285
30 3300037466 Ga0395898_0441057 Ga0395898_0441057_250_1218 286
31 3300046453 Ga0495627_068260 Ga0495627_068260_25_921 287
32 3300046615 Ga0495656_0168225 Ga0495656_0168225_111_1043 287
33 3300046810 Ga0495660_0145671 Ga0495660_0145671_56_988 287
34 3300048927 Ga0496124_0121758 Ga0496124_0121758_794_1726 287
35 3300035119 Ga0373956_0046690 Ga0373956_0046690_995_1861 288
36 3300046514 Ga0495618_0269276 Ga0495618_0269276_53_919 288
37 3300046663 Ga0495635_0092474 Ga0495635_0092474_31_897 288
38 3300046694 Ga0495649_0108048 Ga0495649_0108048_19_954 288
39 3300046794 Ga0495589_0075273 Ga0495589_0075273_690_1625 288
40 3300061719 Ga0466962_0160947 Ga0466962_0160947_27_944 289
41 3300028573 Ga0265334_10036455 Ga0265334_100364552 296
42 3300028666 Ga0265336_10005233 Ga0265336_100052332 296
43 3300028800 Ga0265338_10000328 Ga0265338_1000032852 296
44 3300048909 Ga0496106_0394675 Ga0496106_0394675_135_1097 297
45 3300053178 Ga0500637_0096258 Ga0500637_0096258_66_1028 297
46 3300046463 Ga0495653_0051973 Ga0495653_0051973_2152_3117 298
47 3300005367 Ga0070667_100381390 Ga0070667_1003813901 299
48 3300005545 Ga0070695_100111657 Ga0070695_1001116572 299
49 3300046476 Ga0495662_0134505 Ga0495662_0134505_260_1198 300
50 3300053078 Ga0495612_0013901 Ga0495612_0013901_629_1600 311
51 3300005434 Ga0070709_10001920 Ga0070709_100019204 314
52 3300005437 Ga0070710_10000834 Ga0070710_1000083412 314
53 3300005439 Ga0070711_100000773 Ga0070711_10000077312 314
54 3300005467 Ga0070706_100033904 Ga0070706_1000339046 314
55 3300005471 Ga0070698_100020555 Ga0070698_1000205555 314
56 3300006028 Ga0070717_10004617 Ga0070717_100046173 314
57 3300006163 Ga0070715_10000830 Ga0070715_100008302 314
58 3300006173 Ga0070716_100023686 Ga0070716_1000236862 314
59 3300025898 Ga0207692_10000538 Ga0207692_1000053810 314
60 3300025906 Ga0207699_10001601 Ga0207699_100016014 314
61 3300025910 Ga0207684_10019778 Ga0207684_100197783 314
62 3300025915 Ga0207693_10000633 Ga0207693_1000063317 314
63 3300025916 Ga0207663_10010136 Ga0207663_100101363 314
64 3300025939 Ga0207665_10003827 Ga0207665_100038273 314
65 3300048929 Ga0496126_0026244 Ga0496126_0026244_1769_2818 316
66 3300039450 Ga0436363_0021603 Ga0436363_0021603_348_1301 317
67 3300044842 Ga0466957_0062115 Ga0466957_0062115_1183_2211 318
68 3300049583 Ga0501067_0003500 Ga0501067_0003500_4521_5504 319
69 3300049589 Ga0501073_0000701 Ga0501073_0000701_18905_19888 319
70 3300049568 Ga0501031_0139413 Ga0501031_0139413_208_1191 320
71 3300049568 Ga0501031_0192239 Ga0501031_0192239_36_1025 320
72 3300049584 Ga0501068_0127201 Ga0501068_0127201_417_1406 320
73 3300049586 Ga0501070_0021894 Ga0501070_0021894_521_1504 320
74 3300049588 Ga0501072_0030261 Ga0501072_0030261_1528_2517 320
75 3300049590 Ga0501074_0088728 Ga0501074_0088728_906_1895 320
76 3300049591 Ga0501075_0075879 Ga0501075_0075879_428_1417 320
77 3300049741 Ga0501079_0022790 Ga0501079_0022790_3544_4533 320
78 3300060353 Ga0501082_0176206 Ga0501082_0176206_380_1369 320
79 3300061734 Ga0530510_0032958 Ga0530510_0032958_1849_2838 320
80 3300005518 Ga0070699_100000003 Ga0070699_100000003137 321
81 3300006871 Ga0075434_100056527 Ga0075434_1000565272 321
82 3300035170 Ga0373943_0019645 Ga0373943_0019645_677_1672 321
83 3300035171 Ga0373946_0017711 Ga0373946_0017711_122_1117 321
84 3300035725 Ga0373947_0106761 Ga0373947_0106761_348_1343 321
85 3300036401 Ga0373937_0089832 Ga0373937_0089832_1204_2199 321
86 3300037068 Ga0373925_0004100 Ga0373925_0004100_6552_7547 321
87 3300044673 Ga0453683_0012196 Ga0453683_0012196_3064_4059 321
88 3300046459 Ga0495629_0000011 Ga0495629_0000011_49982_50977 321
89 3300046475 Ga0495639_0000303 Ga0495639_0000303_9740_10735 321
90 3300046526 Ga0495666_0001631 Ga0495666_0001631_7139_8134 321
91 3300046533 Ga0495640_0050502 Ga0495640_0050502_384_1379 321
92 3300046535 Ga0495586_0000755 Ga0495586_0000755_6601_7596 321
93 3300046557 Ga0495622_0004249 Ga0495622_0004249_2052_3047 321
94 3300046663 Ga0495635_0006470 Ga0495635_0006470_637_1632 321
95 3300046689 Ga0495613_0128414 Ga0495613_0128414_242_1237 321
96 3300046690 Ga0495624_0078806 Ga0495624_0078806_372_1367 321
97 3300046809 Ga0495600_0197010 Ga0495600_0197010_251_1246 321
98 3300047321 Ga0495676_0016365 Ga0495676_0016365_3954_4949 321
99 3300047322 Ga0495680_0001934 Ga0495680_0001934_7094_8089 321
100 3300047471 Ga0495684_0145506 Ga0495684_0145506_62_1057 321
101 3300050515 nmdc:mga0a205_49895_c1 nmdc:mga0a205_49895_c1_145_1140 321
102 3300053085 Ga0495619_0175450 Ga0495619_0175450_198_1193 321
103 3300005543 Ga0070672_100026481 Ga0070672_1000264814 322
104 3300025912 Ga0207707_10377474 Ga0207707_103774741 322
105 3300025940 Ga0207691_10044524 Ga0207691_100445242 322
106 3300025944 Ga0207661_10088670 Ga0207661_100886702 322
107 3300035170 Ga0373943_0004339 Ga0373943_0004339_4326_5321 322
108 3300048909 Ga0496106_0072449 Ga0496106_0072449_406_1410 322
109 3300049568 Ga0501031_0038357 Ga0501031_0038357_528_1571 322
110 3300049569 Ga0501032_0093040 Ga0501032_0093040_766_1809 322
111 3300049570 Ga0501033_0030031 Ga0501033_0030031_930_1973 322
112 3300049571 Ga0501034_0032996 Ga0501034_0032996_1467_2510 322
113 3300049573 Ga0501037_0014466 Ga0501037_0014466_3999_5042 322
114 3300049573 Ga0501037_0049800 Ga0501037_0049800_643_1686 322
115 3300049574 Ga0501038_0012458 Ga0501038_0012458_5079_6122 322
116 3300049575 Ga0501039_0008471 Ga0501039_0008471_4535_5578 322
117 3300049575 Ga0501039_0078299 Ga0501039_0078299_395_1438 322
118 3300049576 Ga0501040_0006582 Ga0501040_0006582_6149_7192 322
119 3300049578 Ga0501042_0014951 Ga0501042_0014951_620_1663 322
120 3300049579 Ga0501043_0067091 Ga0501043_0067091_934_1977 322
121 3300049581 Ga0501047_0092278 Ga0501047_0092278_594_1637 322
122 3300049582 Ga0501048_0010834 Ga0501048_0010834_723_1766 322
123 3300049584 Ga0501068_0005171 Ga0501068_0005171_3311_4354 322
124 3300049585 Ga0501069_0044001 Ga0501069_0044001_313_1356 322
125 3300049586 Ga0501070_0021264 Ga0501070_0021264_3701_4744 322
126 3300049587 Ga0501071_0268885 Ga0501071_0268885_69_1112 322
127 3300049589 Ga0501073_0014223 Ga0501073_0014223_4354_5397 322
128 3300049742 Ga0501080_0149095 Ga0501080_0149095_191_1234 322
129 3300049744 Ga0501083_0031342 Ga0501083_0031342_2212_3255 322
130 3300049823 Ga0501044_0103701 Ga0501044_0103701_766_1809 322
131 3300049824 Ga0501045_0002697 Ga0501045_0002697_3198_4241 322
132 3300050511 nmdc:mga08y16_8401_c1 nmdc:mga08y16_8401_c1_4917_5906 322
133 3300054114 Ga0501084_0034204 Ga0501084_0034204_2431_3474 322
134 3300060353 Ga0501082_0054566 Ga0501082_0054566_935_1978 322
135 iso_pu_bacteria 2513237098 2513673985 322
136 iso_pu_bacteria 2513237101 2513696000 322
137 iso_pu_bacteria 2524023210 2524470026 322
138 iso_pu_bacteria 2721755755 2723846234 322
139 iso_pu_bacteria 2791355199 2793080550 322
140 iso_pu_bacteria 2874604998 2874610805 322
141 iso_pu_bacteria 2879110137 2879118885 322
142 iso_pu_bacteria 2885383462 2885386359 322
143 iso_pu_bacteria 2889033259 2889039323 322
144 iso_pu_bacteria 2903768456 2903771403 322
145 iso_pu_bacteria 2922361189 2922362035 322
146 iso_pu_bacteria 2922386360 2922389810 322
147 iso_pu_bacteria 8006964411 8006964608 322
148 iso_pu_bacteria 8006984368 8006991236 322
149 iso_pu_bacteria 8006994254 8006999975 322
150 iso_pu_bacteria 8056673599 8056680387 322
151 iso_pu_bacteria 8056681323 8056683137 322
152 3300007788 Ga0099795_10007212 Ga0099795_100072122 323
153 3300009094 Ga0111539_10037099 Ga0111539_100370991 323
154 3300049744 Ga0501083_0061060 Ga0501083_0061060_511_1566 323
155 3300053111 Ga0500572_000056 Ga0500572_000056_15147_16166 323
156 3300053136 Ga0500559_0000423 Ga0500559_0000423_13692_14711 323
157 3300053163 Ga0500639_009475 Ga0500639_009475_3211_4230 323
158 3300053735 Ga0500596_000710 Ga0500596_000710_1218_2237 323
159 3300009147 Ga0114129_10067676 Ga0114129_100676764 324
160 3300039447 Ga0436361_0192460 Ga0436361_0192460_1395_2459 324
161 3300003320 rootH2_10164564 rootH2_101645642 325
162 3300003911 JGI25405J52794_10001360 JGI25405J52794_100013604 325
163 3300003911 JGI25405J52794_10002356 JGI25405J52794_100023563 325
164 3300005329 Ga0070683_100327347 Ga0070683_1003273472 325
165 3300005339 Ga0070660_100027221 Ga0070660_1000272213 325
166 3300005366 Ga0070659_100064239 Ga0070659_1000642393 325
167 3300005563 Ga0068855_100001637 Ga0068855_10000163720 325
168 3300005563 Ga0068855_100163498 Ga0068855_1001634982 325
169 3300005616 Ga0068852_100015387 Ga0068852_1000153873 325
170 3300005617 Ga0068859_100076274 Ga0068859_1000762743 325
171 3300005842 Ga0068858_100152128 Ga0068858_1001521282 325
172 3300005843 Ga0068860_100000149 Ga0068860_10000014994 325
173 3300005937 Ga0081455_10004887 Ga0081455_100048875 325
174 3300005937 Ga0081455_10058657 Ga0081455_100586572 325
175 3300006177 Ga0075362_10018572 Ga0075362_100185723 325
176 3300006931 Ga0097620_100076272 Ga0097620_1000762723 325
177 3300009101 Ga0105247_10041969 Ga0105247_100419692 325
178 3300009551 Ga0105238_10047126 Ga0105238_100471262 325
179 3300010375 Ga0105239_10050199 Ga0105239_100501995 325
180 3300010375 Ga0105239_10055969 Ga0105239_100559695 325
181 3300013297 Ga0157378_10337345 Ga0157378_103373452 325
182 3300014497 Ga0182008_10044170 Ga0182008_100441703 325
183 3300025900 Ga0207710_10023206 Ga0207710_100232062 325
184 3300025919 Ga0207657_10059870 Ga0207657_100598703 325
185 3300025924 Ga0207694_10124010 Ga0207694_101240102 325
186 3300025949 Ga0207667_10011749 Ga0207667_100117494 325
187 3300025949 Ga0207667_10121867 Ga0207667_101218672 325
188 3300026035 Ga0207703_10219227 Ga0207703_102192271 325
189 3300026035 Ga0207703_10222606 Ga0207703_102226062 325
190 3300028381 Ga0268264_10000084 Ga0268264_10000084128 325
191 3300030521 Ga0307511_10091324 Ga0307511_100913243 325
192 3300031507 Ga0307509_10022959 Ga0307509_100229593 325
193 3300031507 Ga0307509_10033098 Ga0307509_100330987 325
194 3300031616 Ga0307508_10000105 Ga0307508_1000010525 325
195 3300031730 Ga0307516_10006693 Ga0307516_1000669314 325
196 3300031730 Ga0307516_10029708 Ga0307516_100297085 325
197 3300033179 Ga0307507_10041585 Ga0307507_100415854 325
198 3300035089 Ga0373944_0002242 Ga0373944_0002242_1398_2402 325
199 3300035111 Ga0373923_0001200 Ga0373923_0001200_2527_3531 325
200 3300035113 Ga0373936_0002403 Ga0373936_0002403_3481_4485 325
201 3300035116 Ga0373945_0013151 Ga0373945_0013151_869_1873 325
202 3300035117 Ga0373953_0013697 Ga0373953_0013697_672_1676 325
203 3300035118 Ga0373954_0034619 Ga0373954_0034619_260_1264 325
204 3300035119 Ga0373956_0044890 Ga0373956_0044890_373_1377 325
205 3300035170 Ga0373943_0005625 Ga0373943_0005625_3923_4927 325
206 3300035171 Ga0373946_0014033 Ga0373946_0014033_1084_2088 325
207 3300035172 Ga0373955_0066110 Ga0373955_0066110_690_1694 325
208 3300035692 Ga0373935_0007646 Ga0373935_0007646_5111_6115 325
209 3300035692 Ga0373935_0032361 Ga0373935_0032361_343_1332 325
210 3300035695 Ga0373927_0008010 Ga0373927_0008010_4076_5065 325
211 3300035724 Ga0373933_0034036 Ga0373933_0034036_1416_2420 325
212 3300035725 Ga0373947_0038205 Ga0373947_0038205_846_1850 325
213 3300035725 Ga0373947_0272258 Ga0373947_0272258_96_1085 325
214 3300037068 Ga0373925_0046571 Ga0373925_0046571_878_1867 325
215 3300037068 Ga0373925_0074250 Ga0373925_0074250_1545_2549 325
216 3300046454 Ga0495592_0049016 Ga0495592_0049016_1178_2182 325
217 3300046455 Ga0495603_0042395 Ga0495603_0042395_851_1855 325
218 3300046459 Ga0495629_0062559 Ga0495629_0062559_1541_2545 325
219 3300046461 Ga0495641_0016919 Ga0495641_0016919_1561_2565 325
220 3300046462 Ga0495651_0017917 Ga0495651_0017917_2312_3316 325
221 3300046472 Ga0495580_0019072 Ga0495580_0019072_3342_4346 325
222 3300046473 Ga0495582_0010994 Ga0495582_0010994_790_1794 325
223 3300046473 Ga0495582_0253854 Ga0495582_0253854_19_996 325
224 3300046475 Ga0495639_0052876 Ga0495639_0052876_54_1058 325
225 3300046476 Ga0495662_0015027 Ga0495662_0015027_1105_2109 325
226 3300046477 Ga0495664_0002459 Ga0495664_0002459_5572_6576 325
227 3300046491 Ga0495584_0021432 Ga0495584_0021432_1641_2645 325
228 3300046492 Ga0495585_0004147 Ga0495585_0004147_644_1648 325
229 3300046499 Ga0495594_0026882 Ga0495594_0026882_362_1366 325
230 3300046501 Ga0495607_0022202 Ga0495607_0022202_2393_3397 325
231 3300046511 Ga0495608_0061334 Ga0495608_0061334_275_1279 325
232 3300046517 Ga0495630_0045453 Ga0495630_0045453_1523_2527 325
233 3300046523 Ga0495644_0002015 Ga0495644_0002015_5932_6936 325
234 3300046526 Ga0495666_0017973 Ga0495666_0017973_1652_2656 325
235 3300046529 Ga0495652_0096797 Ga0495652_0096797_1037_2041 325
236 3300046536 Ga0495587_0075499 Ga0495587_0075499_402_1406 325
237 3300046537 Ga0495598_0019419 Ga0495598_0019419_274_1278 325
238 3300046557 Ga0495622_0059416 Ga0495622_0059416_279_1268 325
239 3300046559 Ga0495667_0035233 Ga0495667_0035233_1651_2655 325
240 3300046615 Ga0495656_0000562 Ga0495656_0000562_5733_6737 325
241 3300046648 Ga0495611_0004220 Ga0495611_0004220_749_1753 325
242 3300046663 Ga0495635_0009263 Ga0495635_0009263_1115_2119 325
243 3300046665 Ga0495661_0054221 Ga0495661_0054221_42_1046 325
244 3300046674 Ga0495588_0004581 Ga0495588_0004581_1867_2871 325
245 3300046678 Ga0495599_0092688 Ga0495599_0092688_700_1689 325
246 3300046680 Ga0495646_0009027 Ga0495646_0009027_4180_5184 325
247 3300046681 Ga0495647_0007118 Ga0495647_0007118_45_1049 325
248 3300046683 Ga0495658_0057813 Ga0495658_0057813_851_1855 325
249 3300046689 Ga0495613_0011762 Ga0495613_0011762_690_1694 325
250 3300046691 Ga0495670_0006473 Ga0495670_0006473_3595_4599 325
251 3300047317 Ga0495604_0045948 Ga0495604_0045948_1614_2618 325
252 3300047319 Ga0495674_0118586 Ga0495674_0118586_559_1563 325
253 3300047321 Ga0495676_0029827 Ga0495676_0029827_1120_2124 325
254 3300047322 Ga0495680_0029773 Ga0495680_0029773_3409_4413 325
255 3300047444 Ga0495675_0142250 Ga0495675_0142250_193_1197 325
256 3300047446 Ga0495679_011605 Ga0495679_011605_475_1479 325
257 3300047471 Ga0495684_0041413 Ga0495684_0041413_959_1963 325
258 3300048089 Ga0495614_0071916 Ga0495614_0071916_44_1048 325
259 3300048909 Ga0496106_0005687 Ga0496106_0005687_4031_5020 325
260 3300048920 Ga0496117_0035051 Ga0496117_0035051_614_1603 325
261 3300048921 Ga0496118_0002112 Ga0496118_0002112_3383_4372 325
262 3300048924 Ga0496121_0000077 Ga0496121_0000077_206106_207095 325
263 3300048924 Ga0496121_0173892 Ga0496121_0173892_149_1138 325
264 3300048927 Ga0496124_0002375 Ga0496124_0002375_18487_19476 325
265 3300048928 Ga0496125_0062411 Ga0496125_0062411_1375_2364 325
266 3300048929 Ga0496126_0006024 Ga0496126_0006024_8486_9475 325
267 3300053078 Ga0495612_0013688 Ga0495612_0013688_1571_2575 325
268 3300053080 Ga0500635_0004635 Ga0500635_0004635_1967_2956 325
269 3300053084 Ga0495595_0001767 Ga0495595_0001767_6948_7952 325
270 3300053094 Ga0500566_0069485 Ga0500566_0069485_445_1434 325
271 3300053119 Ga0500595_043425 Ga0500595_043425_218_1207 325
272 3300053150 Ga0500603_032165 Ga0500603_032165_130_1119 325
273 3300053178 Ga0500637_0136517 Ga0500637_0136517_276_1265 325
274 3300053735 Ga0500596_000256 Ga0500596_000256_3747_4736 325
275 3300000532 CNAas_1002143 CNAas_10021431 326
276 3300003215 JGI25153J46596_10003096 JGI25153J46596_100030967 326
277 3300005327 Ga0070658_10174508 Ga0070658_101745082 326
278 3300005334 Ga0068869_100019911 Ga0068869_1000199112 326
279 3300005334 Ga0068869_100021975 Ga0068869_1000219753 326
280 3300005338 Ga0068868_100049205 Ga0068868_1000492052 326
281 3300005339 Ga0070660_100319570 Ga0070660_1003195701 326
282 3300005347 Ga0070668_100056874 Ga0070668_1000568743 326
283 3300005347 Ga0070668_100088836 Ga0070668_1000888362 326
284 3300005354 Ga0070675_100387630 Ga0070675_1003876301 326
285 3300005355 Ga0070671_100100481 Ga0070671_1001004812 326
286 3300005364 Ga0070673_100243554 Ga0070673_1002435541 326
287 3300005434 Ga0070709_10000625 Ga0070709_100006256 326
288 3300005435 Ga0070714_100008485 Ga0070714_1000084856 326
289 3300005436 Ga0070713_100008487 Ga0070713_1000084875 326
290 3300005436 Ga0070713_100216547 Ga0070713_1002165472 326
291 3300005437 Ga0070710_10006043 Ga0070710_100060435 326
292 3300005438 Ga0070701_10149198 Ga0070701_101491981 326
293 3300005439 Ga0070711_100002593 Ga0070711_1000025932 326
294 3300005444 Ga0070694_100042284 Ga0070694_1000422842 326
295 3300005444 Ga0070694_100151364 Ga0070694_1001513642 326
296 3300005455 Ga0070663_100016592 Ga0070663_1000165925 326
297 3300005455 Ga0070663_100042996 Ga0070663_1000429965 326
298 3300005457 Ga0070662_100024884 Ga0070662_1000248844 326
299 3300005457 Ga0070662_100202938 Ga0070662_1002029382 326
300 3300005457 Ga0070662_100219442 Ga0070662_1002194422 326
301 3300005459 Ga0068867_100203912 Ga0068867_1002039122 326
302 3300005539 Ga0068853_100053503 Ga0068853_1000535034 326
303 3300005543 Ga0070672_100030913 Ga0070672_1000309134 326
304 3300005544 Ga0070686_100186981 Ga0070686_1001869812 326
305 3300005544 Ga0070686_100229675 Ga0070686_1002296751 326
306 3300005546 Ga0070696_100017316 Ga0070696_1000173164 326
307 3300005548 Ga0070665_100007892 Ga0070665_1000078926 326
308 3300005548 Ga0070665_100096914 Ga0070665_1000969144 326
309 3300005563 Ga0068855_100208345 Ga0068855_1002083452 326
310 3300005563 Ga0068855_100305002 Ga0068855_1003050022 326
311 3300005564 Ga0070664_100290171 Ga0070664_1002901712 326
312 3300005577 Ga0068857_100027809 Ga0068857_1000278094 326
313 3300005578 Ga0068854_100044425 Ga0068854_1000444252 326
314 3300005578 Ga0068854_100145194 Ga0068854_1001451942 326
315 3300005614 Ga0068856_100421857 Ga0068856_1004218572 326
316 3300005615 Ga0070702_100027299 Ga0070702_1000272992 326
317 3300005616 Ga0068852_100267487 Ga0068852_1002674872 326
318 3300005617 Ga0068859_100135028 Ga0068859_1001350282 326
319 3300005618 Ga0068864_100016060 Ga0068864_1000160608 326
320 3300005719 Ga0068861_100022570 Ga0068861_1000225702 326
321 3300005719 Ga0068861_100065282 Ga0068861_1000652822 326
322 3300005719 Ga0068861_100094617 Ga0068861_1000946173 326
323 3300005719 Ga0068861_100122970 Ga0068861_1001229702 326
324 3300005834 Ga0068851_10002336 Ga0068851_100023363 326
325 3300005841 Ga0068863_100324847 Ga0068863_1003248472 326
326 3300005842 Ga0068858_100076154 Ga0068858_1000761542 326
327 3300005843 Ga0068860_100030464 Ga0068860_1000304645 326
328 3300005844 Ga0068862_100016002 Ga0068862_1000160024 326
329 3300005844 Ga0068862_100039915 Ga0068862_1000399153 326
330 3300005937 Ga0081455_10001818 Ga0081455_100018184 326
331 3300005937 Ga0081455_10006854 Ga0081455_100068548 326
332 3300005937 Ga0081455_10020372 Ga0081455_100203725 326
333 3300005981 Ga0081538_10038173 Ga0081538_100381733 326
334 3300005983 Ga0081540_1002358 Ga0081540_100235810 326
335 3300005983 Ga0081540_1002564 Ga0081540_10025646 326
336 3300005983 Ga0081540_1007041 Ga0081540_10070418 326
337 3300005983 Ga0081540_1019943 Ga0081540_10199434 326
338 3300005983 Ga0081540_1023695 Ga0081540_10236953 326
339 3300005983 Ga0081540_1050507 Ga0081540_10505072 326
340 3300005985 Ga0081539_10034119 Ga0081539_100341193 326
341 3300006042 Ga0075368_10011454 Ga0075368_100114543 326
342 3300006042 Ga0075368_10011795 Ga0075368_100117952 326
343 3300006048 Ga0075363_100030366 Ga0075363_1000303663 326
344 3300006051 Ga0075364_10044632 Ga0075364_100446323 326
345 3300006173 Ga0070716_100002010 Ga0070716_1000020103 326
346 3300006173 Ga0070716_100038710 Ga0070716_1000387104 326
347 3300006175 Ga0070712_100060074 Ga0070712_1000600742 326
348 3300006175 Ga0070712_100141188 Ga0070712_1001411882 326
349 3300006178 Ga0075367_10009757 Ga0075367_100097572 326
350 3300006178 Ga0075367_10019907 Ga0075367_100199072 326
351 3300006186 Ga0075369_10025683 Ga0075369_100256832 326
352 3300006237 Ga0097621_100216422 Ga0097621_1002164222 326
353 3300006358 Ga0068871_100123836 Ga0068871_1001238363 326
354 3300006881 Ga0068865_100242097 Ga0068865_1002420971 326
355 3300006931 Ga0097620_100135034 Ga0097620_1001350343 326
356 3300009092 Ga0105250_10014671 Ga0105250_100146712 326
357 3300009093 Ga0105240_10314210 Ga0105240_103142102 326
358 3300009098 Ga0105245_10010020 Ga0105245_100100209 326
359 3300009101 Ga0105247_10115949 Ga0105247_101159491 326
360 3300009174 Ga0105241_10003089 Ga0105241_100030893 326
361 3300009174 Ga0105241_10033060 Ga0105241_100330603 326
362 3300009176 Ga0105242_10079700 Ga0105242_100797002 326
363 3300009177 Ga0105248_10102973 Ga0105248_101029733 326
364 3300009177 Ga0105248_10399841 Ga0105248_103998412 326
365 3300009545 Ga0105237_10068310 Ga0105237_100683103 326
366 3300009551 Ga0105238_10002126 Ga0105238_100021269 326
367 3300009553 Ga0105249_10032554 Ga0105249_100325544 326
368 3300009553 Ga0105249_10077505 Ga0105249_100775053 326
369 3300009553 Ga0105249_10391717 Ga0105249_103917172 326
370 3300010375 Ga0105239_10049131 Ga0105239_100491313 326
371 3300010375 Ga0105239_10111085 Ga0105239_101110852 326
372 3300010375 Ga0105239_10386026 Ga0105239_103860262 326
373 3300010375 Ga0105239_10441185 Ga0105239_104411852 326
374 3300011119 Ga0105246_10005103 Ga0105246_100051032 326
375 3300013296 Ga0157374_10084181 Ga0157374_100841812 326
376 3300013297 Ga0157378_10050788 Ga0157378_100507883 326
377 3300013297 Ga0157378_10214547 Ga0157378_102145471 326
378 3300013297 Ga0157378_10297262 Ga0157378_102972622 326
379 3300013306 Ga0163162_10133725 Ga0163162_101337251 326
380 3300013306 Ga0163162_10239709 Ga0163162_102397092 326
381 3300014325 Ga0163163_10003907 Ga0163163_100039075 326
382 3300014325 Ga0163163_10088226 Ga0163163_100882263 326
383 3300021384 Ga0213876_10003374 Ga0213876_100033747 326
384 3300025253 Ga0209677_101310 Ga0209677_1013105 326
385 3300025254 Ga0209148_1003403 Ga0209148_10034036 326
386 3300025261 Ga0209233_1007754 Ga0209233_10077542 326
387 3300025272 Ga0209455_1005530 Ga0209455_10055302 326
388 3300025297 Ga0209758_1007162 Ga0209758_10071623 326
389 3300025315 Ga0207697_10053399 Ga0207697_100533992 326
390 3300025898 Ga0207692_10001089 Ga0207692_100010895 326
391 3300025898 Ga0207692_10041923 Ga0207692_100419233 326
392 3300025899 Ga0207642_10049816 Ga0207642_100498162 326
393 3300025899 Ga0207642_10151026 Ga0207642_101510261 326
394 3300025901 Ga0207688_10141845 Ga0207688_101418452 326
395 3300025904 Ga0207647_10015942 Ga0207647_100159423 326
396 3300025904 Ga0207647_10048560 Ga0207647_100485603 326
397 3300025905 Ga0207685_10013726 Ga0207685_100137263 326
398 3300025906 Ga0207699_10000984 Ga0207699_100009845 326
399 3300025909 Ga0207705_10148064 Ga0207705_101480642 326
400 3300025911 Ga0207654_10000152 Ga0207654_1000015222 326
401 3300025913 Ga0207695_10003119 Ga0207695_1000311919 326
402 3300025913 Ga0207695_10045656 Ga0207695_100456564 326
403 3300025915 Ga0207693_10008274 Ga0207693_100082748 326
404 3300025915 Ga0207693_10072976 Ga0207693_100729762 326
405 3300025916 Ga0207663_10021758 Ga0207663_100217583 326
406 3300025923 Ga0207681_10077875 Ga0207681_100778752 326
407 3300025924 Ga0207694_10000106 Ga0207694_1000010619 326
408 3300025927 Ga0207687_10022557 Ga0207687_100225572 326
409 3300025928 Ga0207700_10048583 Ga0207700_100485832 326
410 3300025929 Ga0207664_10014626 Ga0207664_100146264 326
411 3300025931 Ga0207644_10055397 Ga0207644_100553972 326
412 3300025933 Ga0207706_10045250 Ga0207706_100452506 326
413 3300025933 Ga0207706_10123181 Ga0207706_101231812 326
414 3300025935 Ga0207709_10010467 Ga0207709_100104672 326
415 3300025937 Ga0207669_10018298 Ga0207669_100182984 326
416 3300025939 Ga0207665_10004109 Ga0207665_100041096 326
417 3300025939 Ga0207665_10022548 Ga0207665_100225483 326
418 3300025940 Ga0207691_10045591 Ga0207691_100455913 326
419 3300025940 Ga0207691_10117883 Ga0207691_101178833 326
420 3300025941 Ga0207711_10148884 Ga0207711_101488843 326
421 3300025942 Ga0207689_10022242 Ga0207689_100222422 326
422 3300025942 Ga0207689_10057913 Ga0207689_100579133 326
423 3300025942 Ga0207689_10192610 Ga0207689_101926102 326
424 3300025942 Ga0207689_10341529 Ga0207689_103415292 326
425 3300025945 Ga0207679_10159170 Ga0207679_101591702 326
426 3300025949 Ga0207667_10095670 Ga0207667_100956703 326
427 3300025949 Ga0207667_10223546 Ga0207667_102235462 326
428 3300025949 Ga0207667_10233633 Ga0207667_102336333 326
429 3300025961 Ga0207712_10038903 Ga0207712_100389033 326
430 3300025972 Ga0207668_10019110 Ga0207668_100191103 326
431 3300025972 Ga0207668_10066608 Ga0207668_100666082 326
432 3300025972 Ga0207668_10235129 Ga0207668_102351292 326
433 3300026023 Ga0207677_10076780 Ga0207677_100767802 326
434 3300026041 Ga0207639_10047187 Ga0207639_100471874 326
435 3300026041 Ga0207639_10088492 Ga0207639_100884923 326
436 3300026075 Ga0207708_10053637 Ga0207708_100536374 326
437 3300026078 Ga0207702_10000004 Ga0207702_1000000419 326
438 3300026078 Ga0207702_10358044 Ga0207702_103580442 326
439 3300026089 Ga0207648_10248151 Ga0207648_102481512 326
440 3300026116 Ga0207674_10038075 Ga0207674_100380754 326
441 3300026116 Ga0207674_10043252 Ga0207674_100432524 326
442 3300026118 Ga0207675_100019492 Ga0207675_1000194923 326
443 3300026118 Ga0207675_100038369 Ga0207675_1000383694 326
444 3300026118 Ga0207675_100094123 Ga0207675_1000941233 326
445 3300026118 Ga0207675_100236859 Ga0207675_1002368592 326
446 3300026142 Ga0207698_10132253 Ga0207698_101322532 326
447 3300026142 Ga0207698_10157066 Ga0207698_101570662 326
448 3300028379 Ga0268266_10001331 Ga0268266_1000133120 326
449 3300028379 Ga0268266_10001870 Ga0268266_1000187011 326
450 3300028379 Ga0268266_10094578 Ga0268266_100945784 326
451 3300028380 Ga0268265_10016028 Ga0268265_100160285 326
452 3300028380 Ga0268265_10052521 Ga0268265_100525213 326
453 3300028380 Ga0268265_10300383 Ga0268265_103003832 326
454 3300028381 Ga0268264_10055833 Ga0268264_100558333 326
455 3300028381 Ga0268264_10120126 Ga0268264_101201262 326
456 3300028794 Ga0307515_10260329 Ga0307515_102603291 326
457 3300031456 Ga0307513_10208314 Ga0307513_102083142 326
458 3300031730 Ga0307516_10117785 Ga0307516_101177853 326
459 3300032002 Ga0307416_100169867 Ga0307416_1001698672 326
460 3300033180 Ga0307510_10021386 Ga0307510_100213865 326
461 3300035691 Ga0373931_0046094 Ga0373931_0046094_779_1759 326
462 3300035725 Ga0373947_0109252 Ga0373947_0109252_94_1143 326
463 3300037068 Ga0373925_0078861 Ga0373925_0078861_574_1638 326
464 3300037471 Ga0395905_0170975 Ga0395905_0170975_490_1539 326
465 3300037471 Ga0395905_0332748 Ga0395905_0332748_283_1332 326
466 3300039437 Ga0436365_0245719 Ga0436365_0245719_12787_13815 326
467 3300039453 Ga0436362_0125439 Ga0436362_0125439_4516_5544 326
468 3300041443 Ga0451789_0437480 Ga0451789_0437480_234_1283 326
469 3300041460 Ga0451802_0821672 Ga0451802_0821672_278_1327 326
470 3300041460 Ga0451802_1192777 Ga0451802_1192777_302_1375 326
471 3300046452 Ga0495617_009150 Ga0495617_009150_2102_3151 326
472 3300046455 Ga0495603_0007129 Ga0495603_0007129_971_2020 326
473 3300046460 Ga0495638_0019825 Ga0495638_0019825_1470_2519 326
474 3300046462 Ga0495651_0232807 Ga0495651_0232807_65_1114 326
475 3300046473 Ga0495582_0054597 Ga0495582_0054597_815_1864 326
476 3300046474 Ga0495605_0044201 Ga0495605_0044201_1084_2133 326
477 3300046474 Ga0495605_0089094 Ga0495605_0089094_336_1385 326
478 3300046474 Ga0495605_0095109 Ga0495605_0095109_329_1342 326
479 3300046475 Ga0495639_0026553 Ga0495639_0026553_983_2032 326
480 3300046491 Ga0495584_0027251 Ga0495584_0027251_415_1464 326
481 3300046492 Ga0495585_0057680 Ga0495585_0057680_959_2008 326
482 3300046492 Ga0495585_0159766 Ga0495585_0159766_47_1096 326
483 3300046499 Ga0495594_0020339 Ga0495594_0020339_2065_3114 326
484 3300046506 Ga0495583_0038379 Ga0495583_0038379_873_1922 326
485 3300046506 Ga0495583_0107340 Ga0495583_0107340_46_1059 326
486 3300046512 Ga0495610_0047845 Ga0495610_0047845_128_1177 326
487 3300046513 Ga0495616_0016601 Ga0495616_0016601_414_1463 326
488 3300046513 Ga0495616_0061922 Ga0495616_0061922_393_1442 326
489 3300046518 Ga0495631_0033478 Ga0495631_0033478_68_1117 326
490 3300046519 Ga0495632_0051846 Ga0495632_0051846_517_1566 326
491 3300046522 Ga0495643_0081441 Ga0495643_0081441_566_1615 326
492 3300046524 Ga0495648_0053962 Ga0495648_0053962_1222_2271 326
493 3300046524 Ga0495648_0091052 Ga0495648_0091052_632_1681 326
494 3300046529 Ga0495652_0078831 Ga0495652_0078831_902_1894 326
495 3300046537 Ga0495598_0006129 Ga0495598_0006129_585_1634 326
496 3300046543 Ga0495645_0004167 Ga0495645_0004167_1180_2172 326
497 3300046558 Ga0495633_0080437 Ga0495633_0080437_392_1441 326
498 3300046616 Ga0495668_0023571 Ga0495668_0023571_942_1991 326
499 3300046616 Ga0495668_0085540 Ga0495668_0085540_169_1218 326
500 3300046642 Ga0495634_0150493 Ga0495634_0150493_204_1196 326
501 3300046648 Ga0495611_0070779 Ga0495611_0070779_389_1438 326
502 3300046648 Ga0495611_0077025 Ga0495611_0077025_434_1483 326
503 3300046660 Ga0495625_0042249 Ga0495625_0042249_199_1248 326
504 3300046660 Ga0495625_0114974 Ga0495625_0114974_80_1129 326
505 3300046660 Ga0495625_0172313 Ga0495625_0172313_239_1288 326
506 3300046664 Ga0495659_0029506 Ga0495659_0029506_362_1411 326
507 3300046681 Ga0495647_0076376 Ga0495647_0076376_157_1173 326
508 3300046684 Ga0495669_0024503 Ga0495669_0024503_794_1843 326
509 3300046691 Ga0495670_0032727 Ga0495670_0032727_1174_2223 326
510 3300046691 Ga0495670_0100940 Ga0495670_0100940_31_1080 326
511 3300046692 Ga0495671_0036879 Ga0495671_0036879_697_1746 326
512 3300046692 Ga0495671_0108984 Ga0495671_0108984_186_1235 326
513 3300046794 Ga0495589_0071633 Ga0495589_0071633_303_1352 326
514 3300046810 Ga0495660_0084157 Ga0495660_0084157_132_1181 326
515 3300047321 Ga0495676_0062408 Ga0495676_0062408_429_1478 326
516 3300047470 Ga0495681_0075638 Ga0495681_0075638_92_1105 326
517 3300048903 Ga0496100_0060876 Ga0496100_0060876_134_1114 326
518 3300048905 Ga0496102_0016911 Ga0496102_0016911_4711_5691 326
519 3300048905 Ga0496102_0032117 Ga0496102_0032117_285_1334 326
520 3300048905 Ga0496102_0054713 Ga0496102_0054713_73_1122 326
521 3300048905 Ga0496102_0290402 Ga0496102_0290402_43_1092 326
522 3300048905 Ga0496102_0336808 Ga0496102_0336808_168_1217 326
523 3300048907 Ga0496104_0002526 Ga0496104_0002526_1859_2839 326
524 3300048907 Ga0496104_0330946 Ga0496104_0330946_369_1418 326
525 3300048908 Ga0496105_0044036 Ga0496105_0044036_1147_2127 326
526 3300048908 Ga0496105_0233258 Ga0496105_0233258_92_1141 326
527 3300048909 Ga0496106_0188979 Ga0496106_0188979_559_1608 326
528 3300048911 Ga0496108_0011418 Ga0496108_0011418_596_1576 326
529 3300048911 Ga0496108_0043555 Ga0496108_0043555_405_1454 326
530 3300048912 Ga0496109_0020680 Ga0496109_0020680_137_1117 326
531 3300048912 Ga0496109_0099281 Ga0496109_0099281_1307_2356 326
532 3300048912 Ga0496109_0143391 Ga0496109_0143391_926_1975 326
533 3300048915 Ga0496112_0007966 Ga0496112_0007966_6115_7095 326
534 3300048915 Ga0496112_0013236 Ga0496112_0013236_934_1983 326
535 3300048916 Ga0496113_0041677 Ga0496113_0041677_268_1248 326
536 3300048918 Ga0496115_0102550 Ga0496115_0102550_1181_2230 326
537 3300048919 Ga0496116_0151268 Ga0496116_0151268_79_1128 326
538 3300048921 Ga0496118_0052143 Ga0496118_0052143_1832_2860 326
539 3300048921 Ga0496118_0071969 Ga0496118_0071969_650_1678 326
540 3300048921 Ga0496118_0180623 Ga0496118_0180623_213_1262 326
541 3300048924 Ga0496121_0030446 Ga0496121_0030446_889_1917 326
542 3300048924 Ga0496121_0048141 Ga0496121_0048141_751_1779 326
543 3300048924 Ga0496121_0081538 Ga0496121_0081538_635_1663 326
544 3300048924 Ga0496121_0089776 Ga0496121_0089776_1045_2094 326
545 3300048924 Ga0496121_0098951 Ga0496121_0098951_950_1999 326
546 3300048925 Ga0496122_0035498 Ga0496122_0035498_1143_2192 326
547 3300048928 Ga0496125_0048124 Ga0496125_0048124_924_1973 326
548 3300048928 Ga0496125_0154636 Ga0496125_0154636_436_1464 326
549 3300048929 Ga0496126_0180962 Ga0496126_0180962_710_1759 326
550 3300048929 Ga0496126_0203176 Ga0496126_0203176_214_1197 326
551 3300048929 Ga0496126_0408124 Ga0496126_0408124_19_1047 326
552 3300049576 Ga0501040_0077037 Ga0501040_0077037_973_2022 326
553 3300049583 Ga0501067_0048239 Ga0501067_0048239_818_1867 326
554 3300049585 Ga0501069_0032536 Ga0501069_0032536_23_1072 326
555 3300050490 nmdc:mga03n38_6006_c1 nmdc:mga03n38_6006_c1_1850_2899 326
556 3300050494 nmdc:mga06z11_13965_c1 nmdc:mga06z11_13965_c1_2265_3314 326
557 3300050494 nmdc:mga06z11_15652_c1 nmdc:mga06z11_15652_c1_1935_2984 326
558 3300050496 nmdc:mga07m45_62937_c1 nmdc:mga07m45_62937_c1_782_1831 326
559 3300050507 nmdc:mga05p37_272266_c1 nmdc:mga05p37_272266_c1_577_1626 326
560 3300050511 nmdc:mga08y16_214543_c1 nmdc:mga08y16_214543_c1_925_1974 326
561 3300050512 nmdc:mga0n895_275928_c1 nmdc:mga0n895_275928_c1_418_1467 326
562 3300053090 Ga0500646_0010209 Ga0500646_0010209_79_1128 326
563 3300053096 Ga0500641_0002055 Ga0500641_0002055_2027_3076 326
564 3300053098 Ga0500650_0079712 Ga0500650_0079712_388_1437 326
565 3300053104 Ga0500556_0026238 Ga0500556_0026238_251_1300 326
566 3300053133 Ga0500655_006959 Ga0500655_006959_527_1576 326
567 3300053134 Ga0500658_0044292 Ga0500658_0044292_239_1288 326
568 3300053146 Ga0500588_0029484 Ga0500588_0029484_444_1493 326
569 3300053161 Ga0500634_0066796 Ga0500634_0066796_556_1605 326
570 3300053730 Ga0500645_009336 Ga0500645_009336_1890_2939 326
571 2209111006 2214544922 2213593449 327
572 3300000041 ARcpr5oldR_c000056 ARcpr5oldR_00005617 327
573 3300000042 ARSoilYngRDRAFT_c00038 ARSoilYngRDRAFT_0003817 327
574 3300000043 ARcpr5yngRDRAFT_c000037 ARcpr5yngRDRAFT_00003716 327
575 3300000044 ARSoilOldRDRAFT_c000060 ARSoilOldRDRAFT_00006015 327
576 3300000045 ARCol0oldRDRAFT_c00065 ARCol0oldRDRAFT_0006511 327
577 3300000652 ARCol0yngRDRAFT_1000262 ARCol0yngRDRAFT_10002628 327
578 3300001904 JGI24736J21556_1008999 JGI24736J21556_10089992 327
579 3300001976 JGI24752J21851_1004571 JGI24752J21851_10045712 327
580 3300001977 JGI24746J21847_1000770 JGI24746J21847_10007707 327
581 3300001978 JGI24747J21853_1001345 JGI24747J21853_10013452 327
582 3300001989 JGI24739J22299_10001705 JGI24739J22299_100017055 327
583 3300001990 JGI24737J22298_10000400 JGI24737J22298_1000040014 327
584 3300001990 JGI24737J22298_10002365 JGI24737J22298_100023654 327
585 3300001991 JGI24743J22301_10008225 JGI24743J22301_100082252 327
586 3300002070 JGI24750J21931_1000217 JGI24750J21931_100021712 327
587 3300002073 JGI24745J21846_1000133 JGI24745J21846_10001336 327
588 3300002074 JGI24748J21848_1002725 JGI24748J21848_10027252 327
589 3300002075 JGI24738J21930_10000277 JGI24738J21930_1000027713 327
590 3300002077 JGI24744J21845_10000893 JGI24744J21845_100008936 327
591 3300002126 JGI24035J26624_1000096 JGI24035J26624_10000968 327
592 3300002244 JGI24742J22300_10000345 JGI24742J22300_100003453 327
593 3300002459 JGI24751J29686_10004930 JGI24751J29686_100049303 327
594 3300005289 Ga0065704_10077082 Ga0065704_100770824 327
595 3300005290 Ga0065712_10006696 Ga0065712_100066963 327
596 3300005290 Ga0065712_10071749 Ga0065712_100717497 327
597 3300005290 Ga0065712_10098936 Ga0065712_100989363 327
598 3300005293 Ga0065715_10001161 Ga0065715_1000116111 327
599 3300005293 Ga0065715_10131782 Ga0065715_101317822 327
600 3300005327 Ga0070658_10210823 Ga0070658_102108232 327
601 3300005328 Ga0070676_10000813 Ga0070676_1000081316 327
602 3300005329 Ga0070683_100000240 Ga0070683_10000024016 327
603 3300005329 Ga0070683_100066349 Ga0070683_1000663492 327
604 3300005330 Ga0070690_100000428 Ga0070690_10000042823 327
605 3300005330 Ga0070690_100028240 Ga0070690_1000282403 327
606 3300005330 Ga0070690_100077522 Ga0070690_1000775222 327
607 3300005331 Ga0070670_100048534 Ga0070670_1000485341 327
608 3300005333 Ga0070677_10000294 Ga0070677_100002948 327
609 3300005334 Ga0068869_100000189 Ga0068869_10000018935 327
610 3300005335 Ga0070666_10017675 Ga0070666_100176753 327
611 3300005335 Ga0070666_10269350 Ga0070666_102693501 327
612 3300005336 Ga0070680_100025642 Ga0070680_1000256426 327
613 3300005336 Ga0070680_100046905 Ga0070680_1000469053 327
614 3300005336 Ga0070680_100064986 Ga0070680_1000649863 327
615 3300005337 Ga0070682_100000202 Ga0070682_10000020224 327
616 3300005337 Ga0070682_100175815 Ga0070682_1001758152 327
617 3300005338 Ga0068868_100000614 Ga0068868_10000061414 327
618 3300005339 Ga0070660_100000223 Ga0070660_10000022316 327
619 3300005339 Ga0070660_100011233 Ga0070660_1000112332 327
620 3300005339 Ga0070660_100131688 Ga0070660_1001316882 327
621 3300005340 Ga0070689_100000187 Ga0070689_10000018716 327
622 3300005341 Ga0070691_10003410 Ga0070691_100034108 327
623 3300005341 Ga0070691_10027437 Ga0070691_100274371 327
624 3300005341 Ga0070691_10061506 Ga0070691_100615063 327
625 3300005343 Ga0070687_100000200 Ga0070687_10000020010 327
626 3300005344 Ga0070661_100000298 Ga0070661_10000029827 327
627 3300005345 Ga0070692_10000016 Ga0070692_1000001616 327
628 3300005347 Ga0070668_100051691 Ga0070668_1000516913 327
629 3300005347 Ga0070668_100127841 Ga0070668_1001278412 327
630 3300005353 Ga0070669_100001525 Ga0070669_10000152516 327
631 3300005354 Ga0070675_100000215 Ga0070675_10000021526 327
632 3300005355 Ga0070671_100000402 Ga0070671_10000040217 327
633 3300005356 Ga0070674_100000511 Ga0070674_1000005118 327
634 3300005356 Ga0070674_100049852 Ga0070674_1000498523 327
635 3300005364 Ga0070673_100000035 Ga0070673_10000003543 327
636 3300005365 Ga0070688_100000130 Ga0070688_10000013018 327
637 3300005365 Ga0070688_100000837 Ga0070688_10000083718 327
638 3300005366 Ga0070659_100000583 Ga0070659_10000058329 327
639 3300005366 Ga0070659_100104482 Ga0070659_1001044822 327
640 3300005367 Ga0070667_100000712 Ga0070667_10000071213 327
641 3300005406 Ga0070703_10004424 Ga0070703_100044244 327
642 3300005437 Ga0070710_10071343 Ga0070710_100713432 327
643 3300005438 Ga0070701_10000081 Ga0070701_1000008111 327
644 3300005438 Ga0070701_10005239 Ga0070701_100052396 327
645 3300005440 Ga0070705_100002491 Ga0070705_10000249112 327
646 3300005441 Ga0070700_100027063 Ga0070700_1000270633 327
647 3300005444 Ga0070694_100000129 Ga0070694_10000012927 327
648 3300005444 Ga0070694_100031644 Ga0070694_1000316444 327
649 3300005455 Ga0070663_100041781 Ga0070663_1000417813 327
650 3300005456 Ga0070678_100023973 Ga0070678_1000239736 327
651 3300005457 Ga0070662_100000933 Ga0070662_1000009336 327
652 3300005457 Ga0070662_100037881 Ga0070662_1000378812 327
653 3300005458 Ga0070681_10001286 Ga0070681_100012869 327
654 3300005459 Ga0068867_100000369 Ga0068867_10000036927 327
655 3300005471 Ga0070698_100352531 Ga0070698_1003525312 327
656 3300005518 Ga0070699_100157602 Ga0070699_1001576022 327
657 3300005530 Ga0070679_100000553 Ga0070679_10000055315 327
658 3300005530 Ga0070679_100012149 Ga0070679_1000121495 327
659 3300005530 Ga0070679_100148843 Ga0070679_1001488434 327
660 3300005535 Ga0070684_100000246 Ga0070684_10000024616 327
661 3300005535 Ga0070684_100004778 Ga0070684_1000047784 327
662 3300005535 Ga0070684_100067615 Ga0070684_1000676154 327
663 3300005536 Ga0070697_100050991 Ga0070697_1000509913 327
664 3300005539 Ga0068853_100000243 Ga0068853_10000024350 327
665 3300005543 Ga0070672_100000157 Ga0070672_10000015716 327
666 3300005544 Ga0070686_100000260 Ga0070686_10000026018 327
667 3300005544 Ga0070686_100070937 Ga0070686_1000709373 327
668 3300005545 Ga0070695_100001653 Ga0070695_1000016533 327
669 3300005545 Ga0070695_100024912 Ga0070695_1000249123 327
670 3300005546 Ga0070696_100006359 Ga0070696_10000635911 327
671 3300005546 Ga0070696_100244732 Ga0070696_1002447322 327
672 3300005547 Ga0070693_100005607 Ga0070693_1000056073 327
673 3300005548 Ga0070665_100014837 Ga0070665_1000148378 327
674 3300005549 Ga0070704_100000171 Ga0070704_10000017119 327
675 3300005549 Ga0070704_100005236 Ga0070704_10000523611 327
676 3300005563 Ga0068855_100005012 Ga0068855_10000501215 327
677 3300005564 Ga0070664_100000269 Ga0070664_10000026916 327
678 3300005577 Ga0068857_100000174 Ga0068857_10000017417 327
679 3300005578 Ga0068854_100000211 Ga0068854_10000021128 327
680 3300005614 Ga0068856_100000600 Ga0068856_10000060019 327
681 3300005615 Ga0070702_100000312 Ga0070702_1000003122 327
682 3300005616 Ga0068852_100003615 Ga0068852_10000361515 327
683 3300005616 Ga0068852_100060621 Ga0068852_1000606214 327
684 3300005617 Ga0068859_100000894 Ga0068859_10000089418 327
685 3300005617 Ga0068859_100104579 Ga0068859_1001045794 327
686 3300005618 Ga0068864_100000329 Ga0068864_10000032926 327
687 3300005718 Ga0068866_10000177 Ga0068866_100001776 327
688 3300005719 Ga0068861_100000329 Ga0068861_1000003296 327
689 3300005834 Ga0068851_10020010 Ga0068851_100200103 327
690 3300005834 Ga0068851_10035065 Ga0068851_100350652 327
691 3300005840 Ga0068870_10000056 Ga0068870_1000005618 327
692 3300005841 Ga0068863_100000278 Ga0068863_10000027835 327
693 3300005842 Ga0068858_100001048 Ga0068858_1000010488 327
694 3300005842 Ga0068858_100061574 Ga0068858_1000615744 327
695 3300005843 Ga0068860_100000985 Ga0068860_10000098519 327
696 3300005843 Ga0068860_100092315 Ga0068860_1000923153 327
697 3300005844 Ga0068862_100000593 Ga0068862_10000059329 327
698 3300005937 Ga0081455_10001601 Ga0081455_1000160118 327
699 3300006175 Ga0070712_100166059 Ga0070712_1001660592 327
700 3300006178 Ga0075367_10062759 Ga0075367_100627592 327
701 3300006237 Ga0097621_100000504 Ga0097621_10000050432 327
702 3300006358 Ga0068871_100000815 Ga0068871_10000081519 327
703 3300006852 Ga0075433_10011448 Ga0075433_100114483 327
704 3300006871 Ga0075434_100000244 Ga0075434_10000024429 327
705 3300006881 Ga0068865_100000332 Ga0068865_10000033232 327
706 3300006931 Ga0097620_100000894 Ga0097620_10000089417 327
707 3300006931 Ga0097620_100104582 Ga0097620_1001045822 327
708 3300007265 Ga0099794_10007686 Ga0099794_100076863 327
709 3300007265 Ga0099794_10009781 Ga0099794_100097814 327
710 3300007788 Ga0099795_10005073 Ga0099795_100050733 327
711 3300009011 Ga0105251_10029811 Ga0105251_100298114 327
712 3300009093 Ga0105240_10169358 Ga0105240_101693581 327
713 3300009094 Ga0111539_10001076 Ga0111539_1000107628 327
714 3300009094 Ga0111539_10004346 Ga0111539_100043469 327
715 3300009094 Ga0111539_10018601 Ga0111539_100186014 327
716 3300009098 Ga0105245_10000451 Ga0105245_1000045128 327
717 3300009101 Ga0105247_10001016 Ga0105247_1000101618 327
718 3300009101 Ga0105247_10015146 Ga0105247_100151466 327
719 3300009148 Ga0105243_10002173 Ga0105243_1000217318 327
720 3300009148 Ga0105243_10028538 Ga0105243_100285386 327
721 3300009174 Ga0105241_10001549 Ga0105241_1000154918 327
722 3300009174 Ga0105241_10095469 Ga0105241_100954693 327
723 3300009176 Ga0105242_10000947 Ga0105242_1000094716 327
724 3300009177 Ga0105248_10000837 Ga0105248_1000083728 327
725 3300009177 Ga0105248_10019175 Ga0105248_100191752 327
726 3300009545 Ga0105237_10007227 Ga0105237_1000722710 327
727 3300009545 Ga0105237_10013803 Ga0105237_100138039 327
728 3300009545 Ga0105237_10245793 Ga0105237_102457932 327
729 3300009551 Ga0105238_10008316 Ga0105238_1000831610 327
730 3300009553 Ga0105249_10000976 Ga0105249_1000097611 327
731 3300009553 Ga0105249_10002863 Ga0105249_1000286317 327
732 3300010159 Ga0099796_10024353 Ga0099796_100243532 327
733 3300010159 Ga0099796_10057587 Ga0099796_100575872 327
734 3300010375 Ga0105239_10040227 Ga0105239_100402276 327
735 3300010375 Ga0105239_10049768 Ga0105239_100497686 327
736 3300010375 Ga0105239_10143485 Ga0105239_101434853 327
737 3300011119 Ga0105246_10000100 Ga0105246_1000010028 327
738 3300013102 Ga0157371_10001676 Ga0157371_1000167614 327
739 3300013104 Ga0157370_10035405 Ga0157370_100354054 327
740 3300013296 Ga0157374_10000956 Ga0157374_1000095611 327
741 3300013297 Ga0157378_10001544 Ga0157378_1000154410 327
742 3300013306 Ga0163162_10001003 Ga0163162_100010035 327
743 3300013306 Ga0163162_10027342 Ga0163162_100273422 327
744 3300013307 Ga0157372_10003782 Ga0157372_1000378217 327
745 3300013308 Ga0157375_10000464 Ga0157375_1000046436 327
746 3300014325 Ga0163163_10003318 Ga0163163_100033188 327
747 3300014325 Ga0163163_10010710 Ga0163163_100107103 327
748 3300014326 Ga0157380_10000145 Ga0157380_1000014517 327
749 3300014745 Ga0157377_10000179 Ga0157377_1000017914 327
750 3300014968 Ga0157379_10000067 Ga0157379_1000006727 327
751 3300014968 Ga0157379_10012965 Ga0157379_100129652 327
752 3300014969 Ga0157376_10023037 Ga0157376_100230376 327
753 3300017792 Ga0163161_10001462 Ga0163161_1000146210 327
754 3300025271 Ga0207666_1000002 Ga0207666_100000243 327
755 3300025271 Ga0207666_1000947 Ga0207666_10009474 327
756 3300025315 Ga0207697_10000113 Ga0207697_1000011317 327
757 3300025885 Ga0207653_10001270 Ga0207653_100012709 327
758 3300025893 Ga0207682_10000094 Ga0207682_1000009428 327
759 3300025899 Ga0207642_10014853 Ga0207642_100148533 327
760 3300025900 Ga0207710_10000795 Ga0207710_1000079518 327
761 3300025900 Ga0207710_10022769 Ga0207710_100227694 327
762 3300025901 Ga0207688_10000074 Ga0207688_1000007427 327
763 3300025901 Ga0207688_10019408 Ga0207688_100194083 327
764 3300025903 Ga0207680_10010896 Ga0207680_100108963 327
765 3300025904 Ga0207647_10000218 Ga0207647_1000021829 327
766 3300025904 Ga0207647_10025737 Ga0207647_100257373 327
767 3300025907 Ga0207645_10000247 Ga0207645_1000024737 327
768 3300025908 Ga0207643_10000004 Ga0207643_10000004184 327
769 3300025910 Ga0207684_10228828 Ga0207684_102288282 327
770 3300025912 Ga0207707_10000618 Ga0207707_1000061822 327
771 3300025912 Ga0207707_10008271 Ga0207707_100082716 327
772 3300025913 Ga0207695_10019340 Ga0207695_100193406 327
773 3300025914 Ga0207671_10010899 Ga0207671_100108998 327
774 3300025914 Ga0207671_10014218 Ga0207671_100142185 327
775 3300025917 Ga0207660_10000741 Ga0207660_1000074116 327
776 3300025917 Ga0207660_10006792 Ga0207660_100067923 327
777 3300025918 Ga0207662_10000119 Ga0207662_1000011916 327
778 3300025918 Ga0207662_10002690 Ga0207662_100026907 327
779 3300025919 Ga0207657_10000316 Ga0207657_1000031642 327
780 3300025919 Ga0207657_10133039 Ga0207657_101330393 327
781 3300025920 Ga0207649_10000090 Ga0207649_1000009061 327
782 3300025921 Ga0207652_10000847 Ga0207652_1000084710 327
783 3300025921 Ga0207652_10046491 Ga0207652_100464913 327
784 3300025921 Ga0207652_10154122 Ga0207652_101541224 327
785 3300025921 Ga0207652_10338806 Ga0207652_103388062 327
786 3300025923 Ga0207681_10000370 Ga0207681_1000037012 327
787 3300025923 Ga0207681_10037300 Ga0207681_100373002 327
788 3300025924 Ga0207694_10110720 Ga0207694_101107202 327
789 3300025925 Ga0207650_10017812 Ga0207650_100178122 327
790 3300025926 Ga0207659_10000038 Ga0207659_1000003811 327
791 3300025927 Ga0207687_10000784 Ga0207687_100007846 327
792 3300025931 Ga0207644_10001053 Ga0207644_100010536 327
793 3300025932 Ga0207690_10000239 Ga0207690_1000023922 327
794 3300025933 Ga0207706_10000424 Ga0207706_1000042436 327
795 3300025933 Ga0207706_10078566 Ga0207706_100785663 327
796 3300025934 Ga0207686_10001203 Ga0207686_1000120316 327
797 3300025935 Ga0207709_10000379 Ga0207709_1000037927 327
798 3300025935 Ga0207709_10004757 Ga0207709_100047573 327
799 3300025936 Ga0207670_10000176 Ga0207670_1000017631 327
800 3300025937 Ga0207669_10000165 Ga0207669_1000016512 327
801 3300025938 Ga0207704_10001709 Ga0207704_100017096 327
802 3300025940 Ga0207691_10000358 Ga0207691_1000035828 327
803 3300025941 Ga0207711_10000780 Ga0207711_1000078027 327
804 3300025941 Ga0207711_10043524 Ga0207711_100435242 327
805 3300025942 Ga0207689_10000479 Ga0207689_1000047917 327
806 3300025944 Ga0207661_10000604 Ga0207661_1000060426 327
807 3300025944 Ga0207661_10092221 Ga0207661_100922214 327
808 3300025945 Ga0207679_10000139 Ga0207679_1000013931 327
809 3300025945 Ga0207679_10135058 Ga0207679_101350583 327
810 3300025949 Ga0207667_10003492 Ga0207667_100034926 327
811 3300025949 Ga0207667_10034706 Ga0207667_100347066 327
812 3300025960 Ga0207651_10000072 Ga0207651_1000007225 327
813 3300025961 Ga0207712_10000588 Ga0207712_1000058826 327
814 3300025972 Ga0207668_10000168 Ga0207668_1000016827 327
815 3300025972 Ga0207668_10068636 Ga0207668_100686362 327
816 3300025981 Ga0207640_10000242 Ga0207640_1000024227 327
817 3300025986 Ga0207658_10000667 Ga0207658_1000066716 327
818 3300026023 Ga0207677_10004440 Ga0207677_100044406 327
819 3300026035 Ga0207703_10000463 Ga0207703_1000046327 327
820 3300026041 Ga0207639_10000745 Ga0207639_100007453 327
821 3300026041 Ga0207639_10109237 Ga0207639_101092371 327
822 3300026041 Ga0207639_10308800 Ga0207639_103088002 327
823 3300026067 Ga0207678_10000447 Ga0207678_1000044716 327
824 3300026075 Ga0207708_10000293 Ga0207708_1000029327 327
825 3300026075 Ga0207708_10001642 Ga0207708_1000164221 327
826 3300026078 Ga0207702_10007213 Ga0207702_100072132 327
827 3300026088 Ga0207641_10000724 Ga0207641_1000072422 327
828 3300026089 Ga0207648_10000223 Ga0207648_1000022333 327
829 3300026095 Ga0207676_10000392 Ga0207676_1000039214 327
830 3300026116 Ga0207674_10000955 Ga0207674_1000095517 327
831 3300026116 Ga0207674_10015429 Ga0207674_100154298 327
832 3300026118 Ga0207675_100000364 Ga0207675_10000036425 327
833 3300026118 Ga0207675_100024249 Ga0207675_1000242493 327
834 3300026121 Ga0207683_10000397 Ga0207683_1000039728 327
835 3300026142 Ga0207698_10003705 Ga0207698_1000370511 327
836 3300026142 Ga0207698_10007410 Ga0207698_100074106 327
837 3300027424 Ga0209984_1002742 Ga0209984_10027422 327
838 3300027512 Ga0209179_1001356 Ga0209179_10013562 327
839 3300027671 Ga0209588_1010276 Ga0209588_10102762 327
840 3300027717 Ga0209998_10000535 Ga0209998_100005356 327
841 3300027717 Ga0209998_10012119 Ga0209998_100121193 327
842 3300027717 Ga0209998_10012410 Ga0209998_100124101 327
843 3300027876 Ga0209974_10001185 Ga0209974_100011856 327
844 3300027876 Ga0209974_10039574 Ga0209974_100395742 327
845 3300027907 Ga0207428_10000164 Ga0207428_100001646 327
846 3300027907 Ga0207428_10000439 Ga0207428_1000043916 327
847 3300028379 Ga0268266_10008599 Ga0268266_100085994 327
848 3300028380 Ga0268265_10001307 Ga0268265_100013073 327
849 3300028380 Ga0268265_10016324 Ga0268265_100163243 327
850 3300028381 Ga0268264_10000890 Ga0268264_1000089011 327
851 3300031235 Ga0265330_10007778 Ga0265330_100077782 327
852 3300031247 Ga0265340_10005751 Ga0265340_100057511 327
853 3300031249 Ga0265339_10008893 Ga0265339_100088931 327
854 3300031249 Ga0265339_10039873 Ga0265339_100398732 327
855 3300031712 Ga0265342_10050824 Ga0265342_100508243 327
856 3300034816 Ga0373930_0000249 Ga0373930_0000249_2838_3821 327
857 3300034818 Ga0373950_0000554 Ga0373950_0000554_495_1478 327
858 3300034819 Ga0373958_0000184 Ga0373958_0000184_4108_5091 327
859 3300034819 Ga0373958_0000847 Ga0373958_0000847_1768_2751 327
860 3300034957 Ga0373938_0007981 Ga0373938_0007981_590_1573 327
861 3300035084 Ga0373928_0000961 Ga0373928_0000961_2977_3960 327
862 3300035084 Ga0373928_0014002 Ga0373928_0014002_455_1438 327
863 3300035086 Ga0373934_0013639 Ga0373934_0013639_1454_2506 327
864 3300035088 Ga0373940_0000149 Ga0373940_0000149_5952_6935 327
865 3300035088 Ga0373940_0009491 Ga0373940_0009491_416_1399 327
866 3300035090 Ga0373949_0000476 Ga0373949_0000476_8739_9722 327
867 3300035090 Ga0373949_0006745 Ga0373949_0006745_375_1358 327
868 3300035091 Ga0373951_0000556 Ga0373951_0000556_8821_9804 327
869 3300035092 Ga0373952_0000375 Ga0373952_0000375_2828_3811 327
870 3300035092 Ga0373952_0000491 Ga0373952_0000491_4681_5664 327
871 3300035111 Ga0373923_0004465 Ga0373923_0004465_1931_2983 327
872 3300035112 Ga0373932_0000419 Ga0373932_0000419_2216_3199 327
873 3300035113 Ga0373936_0010433 Ga0373936_0010433_540_1592 327
874 3300035114 Ga0373939_0000671 Ga0373939_0000671_7139_8122 327
875 3300035114 Ga0373939_0001011 Ga0373939_0001011_2397_3380 327
876 3300035115 Ga0373941_0000283 Ga0373941_0000283_6481_7464 327
877 3300035115 Ga0373941_0002421 Ga0373941_0002421_628_1611 327
878 3300035117 Ga0373953_0000986 Ga0373953_0000986_882_1934 327
879 3300035117 Ga0373953_0017919 Ga0373953_0017919_1535_2530 327
880 3300035118 Ga0373954_0000377 Ga0373954_0000377_3824_4876 327
881 3300035119 Ga0373956_0002477 Ga0373956_0002477_3001_4053 327
882 3300035119 Ga0373956_0007446 Ga0373956_0007446_3294_4313 327
883 3300035120 Ga0373957_0000292 Ga0373957_0000292_6649_7701 327
884 3300035121 Ga0373960_0000720 Ga0373960_0000720_5726_6709 327
885 3300035121 Ga0373960_0001077 Ga0373960_0001077_642_1625 327
886 3300035170 Ga0373943_0001653 Ga0373943_0001653_4140_5192 327
887 3300035172 Ga0373955_0000348 Ga0373955_0000348_13115_14167 327
888 3300035172 Ga0373955_0096554 Ga0373955_0096554_152_1204 327
889 3300035172 Ga0373955_0099978 Ga0373955_0099978_31_1050 327
890 3300035207 Ga0373942_0002656 Ga0373942_0002656_804_1787 327
891 3300035241 Ga0373961_0001332 Ga0373961_0001332_6306_7289 327
892 3300035242 Ga0373962_0005337 Ga0373962_0005337_785_1768 327
893 3300035242 Ga0373962_0014338 Ga0373962_0014338_568_1551 327
894 3300035410 Ga0373924_0014135 Ga0373924_0014135_220_1272 327
895 3300035410 Ga0373924_0034063 Ga0373924_0034063_955_2007 327
896 3300035691 Ga0373931_0000089 Ga0373931_0000089_19969_20952 327
897 3300035691 Ga0373931_0003734 Ga0373931_0003734_5599_6582 327
898 3300035692 Ga0373935_0008907 Ga0373935_0008907_369_1421 327
899 3300035692 Ga0373935_0064740 Ga0373935_0064740_505_1500 327
900 3300035695 Ga0373927_0000990 Ga0373927_0000990_3408_4460 327
901 3300035695 Ga0373927_0066789 Ga0373927_0066789_674_1693 327
902 3300035724 Ga0373933_0004936 Ga0373933_0004936_891_1943 327
903 3300035724 Ga0373933_0048919 Ga0373933_0048919_66_1118 327
904 3300035724 Ga0373933_0096607 Ga0373933_0096607_152_1138 327
905 3300035725 Ga0373947_0001990 Ga0373947_0001990_4487_5539 327
906 3300036401 Ga0373937_0006630 Ga0373937_0006630_1585_2637 327
907 3300036401 Ga0373937_0061646 Ga0373937_0061646_1708_2694 327
908 3300036401 Ga0373937_0134577 Ga0373937_0134577_783_1802 327
909 3300036401 Ga0373937_0156945 Ga0373937_0156945_504_1514 327
910 3300037068 Ga0373925_0000863 Ga0373925_0000863_12176_13228 327
911 3300042005 Ga0439448_0033854 Ga0439448_0033854_439_1422 327
912 3300042012 Ga0439455_0005262 Ga0439455_0005262_1454_2437 327
913 3300044656 Ga0466969_0129318 Ga0466969_0129318_133_1158 327
914 3300044684 Ga0466966_0043517 Ga0466966_0043517_843_1931 327
915 3300045051 Ga0451576_0153537 Ga0451576_0153537_784_1767 327
916 3300046454 Ga0495592_0001421 Ga0495592_0001421_6645_7697 327
917 3300046454 Ga0495592_0051951 Ga0495592_0051951_1287_2306 327
918 3300046454 Ga0495592_0058218 Ga0495592_0058218_1215_2210 327
919 3300046454 Ga0495592_0061171 Ga0495592_0061171_971_1954 327
920 3300046455 Ga0495603_0000091 Ga0495603_0000091_24723_25775 327
921 3300046455 Ga0495603_0156822 Ga0495603_0156822_174_1226 327
922 3300046459 Ga0495629_0000583 Ga0495629_0000583_4584_5636 327
923 3300046459 Ga0495629_0002565 Ga0495629_0002565_920_1972 327
924 3300046459 Ga0495629_0029527 Ga0495629_0029527_2029_3048 327
925 3300046461 Ga0495641_0003388 Ga0495641_0003388_5809_6861 327
926 3300046462 Ga0495651_0012272 Ga0495651_0012272_4315_5334 327
927 3300046462 Ga0495651_0057255 Ga0495651_0057255_1018_2070 327
928 3300046463 Ga0495653_0021441 Ga0495653_0021441_3383_4435 327
929 3300046463 Ga0495653_0021760 Ga0495653_0021760_815_1834 327
930 3300046463 Ga0495653_0120600 Ga0495653_0120600_830_1813 327
931 3300046472 Ga0495580_0009686 Ga0495580_0009686_2463_3515 327
932 3300046473 Ga0495582_0000049 Ga0495582_0000049_15112_16164 327
933 3300046475 Ga0495639_0000815 Ga0495639_0000815_10905_11957 327
934 3300046476 Ga0495662_0000387 Ga0495662_0000387_10258_11310 327
935 3300046477 Ga0495664_0009480 Ga0495664_0009480_271_1323 327
936 3300046499 Ga0495594_0000641 Ga0495594_0000641_7188_8240 327
937 3300046511 Ga0495608_0011931 Ga0495608_0011931_4071_5123 327
938 3300046511 Ga0495608_0012258 Ga0495608_0012258_4131_5150 327
939 3300046514 Ga0495618_0017431 Ga0495618_0017431_2605_3624 327
940 3300046516 Ga0495628_0012236 Ga0495628_0012236_1484_2536 327
941 3300046516 Ga0495628_0053918 Ga0495628_0053918_1248_2300 327
942 3300046516 Ga0495628_0155743 Ga0495628_0155743_191_1210 327
943 3300046524 Ga0495648_0000436 Ga0495648_0000436_8726_9712 327
944 3300046529 Ga0495652_0055002 Ga0495652_0055002_815_1834 327
945 3300046529 Ga0495652_0067614 Ga0495652_0067614_798_1850 327
946 3300046531 Ga0495665_0000101 Ga0495665_0000101_2843_3895 327
947 3300046533 Ga0495640_0003445 Ga0495640_0003445_8125_9177 327
948 3300046533 Ga0495640_0016301 Ga0495640_0016301_650_1669 327
949 3300046533 Ga0495640_0048081 Ga0495640_0048081_1492_2475 327
950 3300046536 Ga0495587_0013085 Ga0495587_0013085_812_1831 327
951 3300046536 Ga0495587_0016782 Ga0495587_0016782_920_1972 327
952 3300046543 Ga0495645_0002559 Ga0495645_0002559_920_1972 327
953 3300046557 Ga0495622_0007367 Ga0495622_0007367_2740_3792 327
954 3300046559 Ga0495667_0013983 Ga0495667_0013983_920_1972 327
955 3300046559 Ga0495667_0020621 Ga0495667_0020621_3204_4223 327
956 3300046559 Ga0495667_0066122 Ga0495667_0066122_865_1848 327
957 3300046642 Ga0495634_0000267 Ga0495634_0000267_41923_42975 327
958 3300046663 Ga0495635_0000084 Ga0495635_0000084_52920_53972 327
959 3300046663 Ga0495635_0015264 Ga0495635_0015264_874_1926 327
960 3300046663 Ga0495635_0015655 Ga0495635_0015655_139_1158 327
961 3300046675 Ga0495657_0017064 Ga0495657_0017064_905_1957 327
962 3300046675 Ga0495657_0084392 Ga0495657_0084392_164_1183 327
963 3300046678 Ga0495599_0035912 Ga0495599_0035912_920_1972 327
964 3300046678 Ga0495599_0043703 Ga0495599_0043703_974_1993 327
965 3300046679 Ga0495623_0014573 Ga0495623_0014573_1057_2109 327
966 3300046679 Ga0495623_0200844 Ga0495623_0200844_75_1127 327
967 3300046680 Ga0495646_0006452 Ga0495646_0006452_891_1943 327
968 3300046680 Ga0495646_0023402 Ga0495646_0023402_2032_3051 327
969 3300046680 Ga0495646_0024146 Ga0495646_0024146_2489_3484 327
970 3300046681 Ga0495647_0003483 Ga0495647_0003483_2566_3618 327
971 3300046683 Ga0495658_0000173 Ga0495658_0000173_24959_26011 327
972 3300046689 Ga0495613_0005231 Ga0495613_0005231_865_1917 327
973 3300046689 Ga0495613_0025072 Ga0495613_0025072_930_1982 327
974 3300046690 Ga0495624_0001263 Ga0495624_0001263_17098_18150 327
975 3300046809 Ga0495600_0007694 Ga0495600_0007694_1146_2198 327
976 3300046809 Ga0495600_0040507 Ga0495600_0040507_327_1346 327
977 3300046809 Ga0495600_0074224 Ga0495600_0074224_319_1371 327
978 3300047315 Ga0495581_0000864 Ga0495581_0000864_4633_5685 327
979 3300047315 Ga0495581_0188756 Ga0495581_0188756_40_1059 327
980 3300047317 Ga0495604_0010756 Ga0495604_0010756_897_1949 327
981 3300047317 Ga0495604_0015977 Ga0495604_0015977_4193_5212 327
982 3300047319 Ga0495674_0049391 Ga0495674_0049391_2091_3161 327
983 3300047321 Ga0495676_0004982 Ga0495676_0004982_6209_7261 327
984 3300047321 Ga0495676_0126239 Ga0495676_0126239_659_1678 327
985 3300047322 Ga0495680_0018136 Ga0495680_0018136_4185_5204 327
986 3300047322 Ga0495680_0020444 Ga0495680_0020444_3648_4631 327
987 3300047322 Ga0495680_0054136 Ga0495680_0054136_920_1972 327
988 3300047322 Ga0495680_0186033 Ga0495680_0186033_221_1216 327
989 3300047322 Ga0495680_0227149 Ga0495680_0227149_265_1317 327
990 3300047444 Ga0495675_0000862 Ga0495675_0000862_12113_13165 327
991 3300047444 Ga0495675_0044349 Ga0495675_0044349_608_1627 327
992 3300047444 Ga0495675_0249785 Ga0495675_0249785_17_1000 327
993 3300047471 Ga0495684_0000701 Ga0495684_0000701_13889_14941 327
994 3300047673 Ga0495593_0000016 Ga0495593_0000016_17684_18736 327
995 3300047673 Ga0495593_0026325 Ga0495593_0026325_1146_2198 327
996 3300047673 Ga0495593_0060225 Ga0495593_0060225_145_1164 327
997 3300048088 Ga0495602_0011145 Ga0495602_0011145_3105_4157 327
998 3300048088 Ga0495602_0022469 Ga0495602_0022469_4350_5369 327
999 3300048088 Ga0495602_0152802 Ga0495602_0152802_731_1714 327
1000 3300048903 Ga0496100_0000200 Ga0496100_0000200_19029_20012 327
1001 3300048904 Ga0496101_0000339 Ga0496101_0000339_7584_8567 327
1002 3300048905 Ga0496102_0000729 Ga0496102_0000729_24986_25969 327
1003 3300048906 Ga0496103_0001639 Ga0496103_0001639_7712_8695 327
1004 3300048909 Ga0496106_0000202 Ga0496106_0000202_20867_21850 327
1005 3300048909 Ga0496106_0064478 Ga0496106_0064478_384_1367 327
1006 3300048910 Ga0496107_0000066 Ga0496107_0000066_16360_17343 327
1007 3300048910 Ga0496107_0010112 Ga0496107_0010112_4098_5081 327
1008 3300048911 Ga0496108_0009303 Ga0496108_0009303_2183_3166 327
1009 3300048911 Ga0496108_0015918 Ga0496108_0015918_4121_5104 327
1010 3300048912 Ga0496109_0000595 Ga0496109_0000595_18056_19039 327
1011 3300048912 Ga0496109_0038245 Ga0496109_0038245_2572_3555 327
1012 3300048913 Ga0496110_0064886 Ga0496110_0064886_1237_2220 327
1013 3300048913 Ga0496110_0253987 Ga0496110_0253987_515_1498 327
1014 3300048914 Ga0496111_0016577 Ga0496111_0016577_4067_5050 327
1015 3300048915 Ga0496112_0005122 Ga0496112_0005122_6791_7780 327
1016 3300048915 Ga0496112_0043635 Ga0496112_0043635_54_1037 327
1017 3300048915 Ga0496112_0205776 Ga0496112_0205776_776_1759 327
1018 3300048916 Ga0496113_0008065 Ga0496113_0008065_5352_6335 327
1019 3300048916 Ga0496113_0420805 Ga0496113_0420805_19_1002 327
1020 3300048917 Ga0496114_0023336 Ga0496114_0023336_885_1895 327
1021 3300048918 Ga0496115_0001197 Ga0496115_0001197_4042_5025 327
1022 3300048918 Ga0496115_0022519 Ga0496115_0022519_3397_4407 327
1023 3300048918 Ga0496115_0058265 Ga0496115_0058265_1779_2831 327
1024 3300048929 Ga0496126_0018133 Ga0496126_0018133_3263_4273 327
1025 3300048929 Ga0496126_0034951 Ga0496126_0034951_2381_3391 327
1026 3300048929 Ga0496126_0051994 Ga0496126_0051994_746_1891 327
1027 3300049593 Ga0501077_0075666 Ga0501077_0075666_882_1865 327
1028 3300050494 nmdc:mga06z11_121961_c1 nmdc:mga06z11_121961_c1_54_1037 327
1029 3300050511 nmdc:mga08y16_2489_c1 nmdc:mga08y16_2489_c1_6717_7700 327
1030 3300050511 nmdc:mga08y16_3164_c1 nmdc:mga08y16_3164_c1_7494_8477 327
1031 3300050511 nmdc:mga08y16_56024_c1 nmdc:mga08y16_56024_c1_82_1065 327
1032 3300050512 nmdc:mga0n895_381_c1 nmdc:mga0n895_381_c1_19851_20834 327
1033 3300050515 nmdc:mga0a205_2432_c1 nmdc:mga0a205_2432_c1_14811_15794 327
1034 3300050515 nmdc:mga0a205_472178_c1 nmdc:mga0a205_472178_c1_34_1017 327
1035 3300053077 Ga0495601_0005443 Ga0495601_0005443_3692_4675 327
1036 3300053077 Ga0495601_0007975 Ga0495601_0007975_4376_5395 327
1037 3300053080 Ga0500635_0010920 Ga0500635_0010920_570_1601 327
1038 3300053080 Ga0500635_0022158 Ga0500635_0022158_132_1184 327
1039 3300053084 Ga0495595_0003811 Ga0495595_0003811_3934_4986 327
1040 3300053084 Ga0495595_0006384 Ga0495595_0006384_805_1824 327
1041 3300053085 Ga0495619_0000308 Ga0495619_0000308_32014_32997 327
1042 3300053085 Ga0495619_0016450 Ga0495619_0016450_2777_3796 327
1043 3300053085 Ga0495619_0043597 Ga0495619_0043597_872_1924 327
1044 3300053102 Ga0500554_000935 Ga0500554_000935_317_1369 327
1045 3300053178 Ga0500637_0054269 Ga0500637_0054269_1099_2151 327
1046 3300060353 Ga0501082_0299150 Ga0501082_0299150_198_1181 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

38

250

0.89

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

37

261

0.87

PF07993

NAD_binding_4

Male sterility protein

82

233

0.83

PF05368

NmrA

NmrA-like family

37

148

0.81

PF13460

NAD_binding_10

NAD(P)H-binding

41

189

0.79

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

38

342

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wj7-assembly1.cif.gz_C crystal structure of gox2253 0.8501 1 325
3wj7-assembly1.cif.gz_C crystal structure of gox2253 0.8427 1 325
2x4g-assembly1.cif.gz_A-2 crystal structure of pa4631, a nucleoside-diphosphate-sugar epimerase from pseudomonas aeruginosa 0.8361 2 325
4lk3-assembly1.cif.gz_E crystal structure of human udp-xylose synthase r236a substitution 0.8317 1 323
4m55-assembly1.cif.gz_D crystal structure of human udp-xylose synthase r236h substitution 0.8289 1 323
ID Description Score Start End Superfamily
af_Q94HG6_1_340_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9164 2 324 3.40.50.720
af_Q94HG6_1_340_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.903 2 324 3.40.50.720
af_P96816_2_332_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8671 1 323 3.40.50.720
af_Q23086_2_345_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8589 3 320 3.40.50.720
af_Q54TU9_1_334_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8582 2 325 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A537R5V1-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9682 1 325 GO:0004029
GO:0005737
AF-A0A3M1GBQ3-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9639 2 325 GO:0004029
GO:0005737
AF-A0A537R5V1-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9623 1 325 GO:0004029
GO:0005737
AF-A0A318CJT1-F1-model_v4 NAD-dependent dehydratase 0.9532 4 323 GO:0004029
GO:0005737
AF-A0A4V0HYJ9-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9526 2 323 GO:0004029
GO:0005737

Feature Viewer

pLDDT pTM Quality
91.57 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map