F488919
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1044 | 466 | 2088 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300053136|Ga0500559_0115769|Ga0500559_0115769_295_1137 |
| Length | 280 |
| Sequence | VDAGFRIRSGSTEDQSFTGSILIMTTAPAPFHDLKQKWREGRPTFGAIATIPSIQTVRIMAQSLDWIIVDCEHGPIDLNTAHGMIMATSGTPCTPLVRIAANEPWLAKAPMDIGAMGINFPMVNSAADAAKAVSSLRYPPTGERLWGPFHAPFRWNTGMPDYMARADDSMICMVTIEHIDAVENIDTIMATPGIDIAVIGVGDLATSIGKRGQPGDPEVQALVARAEAGIRKSGVPLGGAALNAEMGNAMIDRGYVLLALGFDWSLFQRGIMAGFEGIKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 2 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 120 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 121 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 122 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 123 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 124 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 125 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 128 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 196 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 197 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 207 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 210 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 211 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 212 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 214 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 218 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 219 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 220 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 221 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 222 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 228 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 232 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 243 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 245 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 246 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 247 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 248 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 249 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 250 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 251 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 252 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 253 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 254 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 256 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 257 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 258 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 259 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 260 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 261 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 262 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 263 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 264 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 265 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 266 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 267 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 268 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 349 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 350 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 351 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 352 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 353 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 356 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 357 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 358 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 359 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 360 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 361 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 362 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 363 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 364 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 365 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 366 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 367 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 368 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 369 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 370 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 371 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 372 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 386 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 387 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 388 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 390 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 391 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 392 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 397 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 403 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 404 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 405 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 406 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 407 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 408 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 409 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 410 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 411 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 412 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 413 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 414 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 415 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 416 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 417 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 418 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 419 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 420 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 421 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 422 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 423 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 424 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 425 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 426 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 427 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 428 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 429 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 430 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 431 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 432 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 433 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 434 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 435 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 436 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 437 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 438 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 439 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 440 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 441 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 442 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 443 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 444 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 445 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 446 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 447 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 448 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 449 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 450 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 451 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 452 | 2791355199 | |||
| 453 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 454 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 455 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 456 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 457 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 458 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 459 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 460 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 461 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 462 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 463 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 464 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 465 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 466 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.99 |
| Metatranscriptomes | 0.19 |
| Isolates | 1.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.9 |
| Nodule | 2.39 |
| Rhizoplane | 7.66 |
| Rhizosphere | 65.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500559_0115769 | 3300053136 | Bacteria | 1244 |
| 2 | JGI24745J21846_1004743 | 3300002073 | Bacteria | 1463 |
| 3 | JGI25406J46586_10019112 | 3300003203 | Bacteria | 2800 |
| 4 | JGI25153J46596_10000366 | 3300003215 | Bacteria | 31011 |
| 5 | JGI25153J46596_10003459 | 3300003215 | Bacteria | 8844 |
| 6 | JGI25153J46596_10004454 | 3300003215 | Bacteria | 7551 |
| 7 | JGI25160J50197_1000729 | 3300003354 | Bacteria | 17998 |
| 8 | JGI25160J50197_1005746 | 3300003354 | Bacteria | 5118 |
| 9 | JGI25404J52841_10001176 | 3300003659 | Bacteria | 4465 |
| 10 | JGI25404J52841_10005591 | 3300003659 | Bacteria | 2597 |
| 11 | JGI25404J52841_10011264 | 3300003659 | Bacteria | 1927 |
| 12 | JGI25404J52841_10020849 | 3300003659 | Bacteria | 1419 |
| 13 | JGI25404J52841_10035503 | 3300003659 | Bacteria | 1062 |
| 14 | Ga0055542_1012548 | 3300003762 | Bacteria | 1462 |
| 15 | Ga0055543_1008363 | 3300004625 | Bacteria | 2295 |
| 16 | Ga0065165_1000278 | 3300005262 | Bacteria | 87353 |
| 17 | Ga0065165_1011041 | 3300005262 | Bacteria | 3821 |
| 18 | Ga0065165_1013968 | 3300005262 | Bacteria | 3147 |
| 19 | Ga0065715_10183263 | 3300005293 | Bacteria | 1462 |
| 20 | Ga0070658_10075965 | 3300005327 | Bacteria | 2756 |
| 21 | Ga0070676_10071609 | 3300005328 | Bacteria | 2082 |
| 22 | Ga0070683_100163357 | 3300005329 | Bacteria | 2113 |
| 23 | Ga0070690_100092911 | 3300005330 | Bacteria | 1990 |
| 24 | Ga0070670_100281259 | 3300005331 | Bacteria | 1453 |
| 25 | Ga0068869_100047994 | 3300005334 | Bacteria | 3085 |
| 26 | Ga0068869_100055295 | 3300005334 | Bacteria | 2892 |
| 27 | Ga0068869_100104819 | 3300005334 | Bacteria | 2144 |
| 28 | Ga0070666_10388134 | 3300005335 | Bacteria | 1003 |
| 29 | Ga0070680_100010206 | 3300005336 | Bacteria | 7240 |
| 30 | Ga0070682_100183420 | 3300005337 | Bacteria | 1464 |
| 31 | Ga0070682_100212131 | 3300005337 | Bacteria | 1373 |
| 32 | Ga0068868_100015888 | 3300005338 | Bacteria | 5578 |
| 33 | Ga0068868_100045227 | 3300005338 | Bacteria | 3444 |
| 34 | Ga0070660_100024156 | 3300005339 | Bacteria | 4508 |
| 35 | Ga0070660_100185563 | 3300005339 | Bacteria | 1684 |
| 36 | Ga0070689_100123418 | 3300005340 | Bacteria | 2070 |
| 37 | Ga0070691_10129254 | 3300005341 | Bacteria | 1278 |
| 38 | Ga0070661_100079872 | 3300005344 | Bacteria | 2414 |
| 39 | Ga0070661_100252637 | 3300005344 | Bacteria | 1361 |
| 40 | Ga0070668_100012569 | 3300005347 | Bacteria | 6303 |
| 41 | Ga0070668_100044471 | 3300005347 | Bacteria | 3406 |
| 42 | Ga0070668_100176725 | 3300005347 | Bacteria | 1741 |
| 43 | Ga0070668_100364711 | 3300005347 | Bacteria | 1226 |
| 44 | Ga0070669_100019904 | 3300005353 | Bacteria | 4794 |
| 45 | Ga0070669_100402251 | 3300005353 | Bacteria | 1120 |
| 46 | Ga0070671_100083173 | 3300005355 | Bacteria | 2676 |
| 47 | Ga0070674_100067707 | 3300005356 | Bacteria | 2512 |
| 48 | Ga0070673_100125690 | 3300005364 | Bacteria | 2145 |
| 49 | Ga0070688_100141898 | 3300005365 | Bacteria | 1633 |
| 50 | Ga0070688_100286883 | 3300005365 | Bacteria | 1185 |
| 51 | Ga0070667_100086637 | 3300005367 | Bacteria | 2688 |
| 52 | Ga0070667_100183279 | 3300005367 | Bacteria | 1852 |
| 53 | Ga0070709_10000321 | 3300005434 | Bacteria | 30544 |
| 54 | Ga0070709_10031836 | 3300005434 | Bacteria | 3176 |
| 55 | Ga0070709_10040970 | 3300005434 | Bacteria | 2850 |
| 56 | Ga0070714_100186448 | 3300005435 | Bacteria | 1890 |
| 57 | Ga0070714_100189894 | 3300005435 | Bacteria | 1874 |
| 58 | Ga0070713_100034852 | 3300005436 | Bacteria | 4048 |
| 59 | Ga0070713_100072247 | 3300005436 | Bacteria | 2917 |
| 60 | Ga0070710_10000643 | 3300005437 | Bacteria | 16645 |
| 61 | Ga0070710_10017631 | 3300005437 | Bacteria | 3658 |
| 62 | Ga0070710_10120491 | 3300005437 | Bacteria | 1588 |
| 63 | Ga0070711_100023304 | 3300005439 | Bacteria | 4024 |
| 64 | Ga0070711_100067274 | 3300005439 | Bacteria | 2513 |
| 65 | Ga0070700_100075552 | 3300005441 | Bacteria | 2161 |
| 66 | Ga0070694_100175875 | 3300005444 | Bacteria | 1580 |
| 67 | Ga0070663_100021332 | 3300005455 | Bacteria | 4307 |
| 68 | Ga0070663_100051045 | 3300005455 | Bacteria | 2944 |
| 69 | Ga0070663_100051598 | 3300005455 | Bacteria | 2931 |
| 70 | Ga0070663_100173815 | 3300005455 | Bacteria | 1667 |
| 71 | Ga0070663_100270029 | 3300005455 | Bacteria | 1352 |
| 72 | Ga0070663_100373540 | 3300005455 | Bacteria | 1159 |
| 73 | Ga0070678_100019116 | 3300005456 | Bacteria | 4457 |
| 74 | Ga0070678_100068453 | 3300005456 | Bacteria | 2646 |
| 75 | Ga0070678_100075032 | 3300005456 | Bacteria | 2543 |
| 76 | Ga0070678_100102928 | 3300005456 | Bacteria | 2217 |
| 77 | Ga0070662_100115690 | 3300005457 | Bacteria | 2049 |
| 78 | Ga0070662_100117741 | 3300005457 | Bacteria | 2032 |
| 79 | Ga0070662_100121975 | 3300005457 | Bacteria | 1999 |
| 80 | Ga0070662_100173828 | 3300005457 | Bacteria | 1693 |
| 81 | Ga0070681_10061815 | 3300005458 | Bacteria | 3719 |
| 82 | Ga0070681_10111762 | 3300005458 | Bacteria | 2671 |
| 83 | Ga0070681_10174929 | 3300005458 | Bacteria | 2068 |
| 84 | Ga0070681_10265397 | 3300005458 | Bacteria | 1628 |
| 85 | Ga0068867_100108604 | 3300005459 | Bacteria | 2128 |
| 86 | Ga0068867_100110645 | 3300005459 | Bacteria | 2110 |
| 87 | Ga0068867_100463638 | 3300005459 | Bacteria | 1082 |
| 88 | Ga0070685_10160931 | 3300005466 | Bacteria | 1431 |
| 89 | Ga0070698_100232538 | 3300005471 | Bacteria | 1777 |
| 90 | Ga0070679_100018864 | 3300005530 | Bacteria | 6698 |
| 91 | Ga0070679_100042441 | 3300005530 | Bacteria | 4529 |
| 92 | Ga0070679_100321402 | 3300005530 | Bacteria | 1497 |
| 93 | Ga0070679_100326100 | 3300005530 | Bacteria | 1484 |
| 94 | Ga0070684_100015968 | 3300005535 | Bacteria | 6131 |
| 95 | Ga0070684_100017476 | 3300005535 | Bacteria | 5889 |
| 96 | Ga0070684_100095065 | 3300005535 | Bacteria | 2655 |
| 97 | Ga0070697_100013902 | 3300005536 | Bacteria | 6318 |
| 98 | Ga0068853_100011732 | 3300005539 | Bacteria | 7120 |
| 99 | Ga0068853_100136803 | 3300005539 | Bacteria | 2197 |
| 100 | Ga0068853_100151890 | 3300005539 | Bacteria | 2085 |
| 101 | Ga0070686_100202531 | 3300005544 | Bacteria | 1424 |
| 102 | Ga0070686_100266519 | 3300005544 | Bacteria | 1258 |
| 103 | Ga0070693_100017871 | 3300005547 | Bacteria | 3696 |
| 104 | Ga0070665_100008531 | 3300005548 | Bacteria | 10368 |
| 105 | Ga0070665_100024503 | 3300005548 | Bacteria | 6078 |
| 106 | Ga0070665_100094785 | 3300005548 | Bacteria | 2989 |
| 107 | Ga0070665_100106328 | 3300005548 | Bacteria | 2808 |
| 108 | Ga0070665_100215170 | 3300005548 | Bacteria | 1922 |
| 109 | Ga0070665_100259378 | 3300005548 | Bacteria | 1739 |
| 110 | Ga0070665_100474580 | 3300005548 | Bacteria | 1261 |
| 111 | Ga0070665_100693089 | 3300005548 | Bacteria | 1032 |
| 112 | Ga0068855_100060159 | 3300005563 | Bacteria | 4443 |
| 113 | Ga0068855_100071075 | 3300005563 | Bacteria | 4047 |
| 114 | Ga0068855_100123883 | 3300005563 | Bacteria | 2956 |
| 115 | Ga0068855_100185338 | 3300005563 | Bacteria | 2351 |
| 116 | Ga0070664_100033202 | 3300005564 | Bacteria | 4320 |
| 117 | Ga0070664_100480797 | 3300005564 | Bacteria | 1143 |
| 118 | Ga0068857_100044204 | 3300005577 | Bacteria | 3950 |
| 119 | Ga0068857_100265276 | 3300005577 | Bacteria | 1577 |
| 120 | Ga0068854_100092238 | 3300005578 | Bacteria | 2256 |
| 121 | Ga0068856_100594570 | 3300005614 | Bacteria | 1128 |
| 122 | Ga0070702_100338152 | 3300005615 | Bacteria | 1055 |
| 123 | Ga0068852_100049132 | 3300005616 | Bacteria | 3607 |
| 124 | Ga0068852_100059330 | 3300005616 | Bacteria | 3318 |
| 125 | Ga0068852_100270940 | 3300005616 | Bacteria | 1634 |
| 126 | Ga0068859_100075880 | 3300005617 | Bacteria | 3402 |
| 127 | Ga0068859_100383615 | 3300005617 | Bacteria | 1501 |
| 128 | Ga0068864_100100435 | 3300005618 | Bacteria | 2565 |
| 129 | Ga0068864_100356219 | 3300005618 | Bacteria | 1382 |
| 130 | Ga0068866_10019214 | 3300005718 | Bacteria | 3105 |
| 131 | Ga0068866_10026450 | 3300005718 | Bacteria | 2740 |
| 132 | Ga0068866_10075346 | 3300005718 | Bacteria | 1796 |
| 133 | Ga0068861_100044893 | 3300005719 | Bacteria | 3325 |
| 134 | Ga0068861_100071020 | 3300005719 | Bacteria | 2698 |
| 135 | Ga0068861_100448540 | 3300005719 | Bacteria | 1155 |
| 136 | Ga0068851_10042077 | 3300005834 | Bacteria | 2299 |
| 137 | Ga0068863_100361737 | 3300005841 | Bacteria | 1415 |
| 138 | Ga0068858_100130635 | 3300005842 | Bacteria | 2355 |
| 139 | Ga0068858_100504165 | 3300005842 | Bacteria | 1169 |
| 140 | Ga0068860_100028576 | 3300005843 | Bacteria | 5369 |
| 141 | Ga0068860_100113935 | 3300005843 | Bacteria | 2586 |
| 142 | Ga0068860_100272704 | 3300005843 | Bacteria | 1651 |
| 143 | Ga0068860_100451934 | 3300005843 | Bacteria | 1278 |
| 144 | Ga0068862_100044232 | 3300005844 | Bacteria | 3797 |
| 145 | Ga0068862_100111239 | 3300005844 | Bacteria | 2404 |
| 146 | Ga0068862_100153409 | 3300005844 | Bacteria | 2051 |
| 147 | Ga0068862_100154996 | 3300005844 | Bacteria | 2041 |
| 148 | Ga0068862_100294050 | 3300005844 | Bacteria | 1492 |
| 149 | Ga0068862_100564389 | 3300005844 | Bacteria | 1088 |
| 150 | Ga0081455_10002423 | 3300005937 | Bacteria | 22248 |
| 151 | Ga0081455_10014321 | 3300005937 | Bacteria | 7781 |
| 152 | Ga0081455_10027456 | 3300005937 | Bacteria | 5217 |
| 153 | Ga0081455_10141150 | 3300005937 | Bacteria | 1871 |
| 154 | Ga0081538_10043188 | 3300005981 | Bacteria | 2834 |
| 155 | Ga0081540_1002773 | 3300005983 | Bacteria | 14213 |
| 156 | Ga0081540_1003578 | 3300005983 | Bacteria | 12209 |
| 157 | Ga0081540_1006176 | 3300005983 | Bacteria | 8783 |
| 158 | Ga0081540_1011101 | 3300005983 | Bacteria | 6047 |
| 159 | Ga0081540_1018496 | 3300005983 | Bacteria | 4272 |
| 160 | Ga0081540_1019810 | 3300005983 | Bacteria | 4072 |
| 161 | Ga0081540_1023306 | 3300005983 | Bacteria | 3623 |
| 162 | Ga0081540_1030875 | 3300005983 | Bacteria | 2959 |
| 163 | Ga0081540_1037049 | 3300005983 | Bacteria | 2590 |
| 164 | Ga0081540_1050246 | 3300005983 | Bacteria | 2073 |
| 165 | Ga0081540_1118772 | 3300005983 | Bacteria | 1102 |
| 166 | Ga0081539_10000747 | 3300005985 | Bacteria | 64612 |
| 167 | Ga0081539_10071601 | 3300005985 | Bacteria | 1856 |
| 168 | Ga0070717_10080272 | 3300006028 | Bacteria | 2737 |
| 169 | Ga0070717_10266497 | 3300006028 | Bacteria | 1516 |
| 170 | Ga0075365_10027907 | 3300006038 | Bacteria | 3595 |
| 171 | Ga0075365_10048361 | 3300006038 | Bacteria | 2799 |
| 172 | Ga0075365_10055734 | 3300006038 | Bacteria | 2625 |
| 173 | Ga0075365_10058056 | 3300006038 | Bacteria | 2575 |
| 174 | Ga0075365_10073033 | 3300006038 | Bacteria | 2311 |
| 175 | Ga0075368_10005485 | 3300006042 | Bacteria | 4364 |
| 176 | Ga0075368_10037556 | 3300006042 | Bacteria | 1894 |
| 177 | Ga0075368_10087362 | 3300006042 | Bacteria | 1273 |
| 178 | Ga0075363_100015314 | 3300006048 | Bacteria | 3768 |
| 179 | Ga0075364_10008417 | 3300006051 | Bacteria | 6165 |
| 180 | Ga0075364_10027628 | 3300006051 | Bacteria | 3626 |
| 181 | Ga0075364_10033448 | 3300006051 | Bacteria | 3311 |
| 182 | Ga0075364_10074324 | 3300006051 | Bacteria | 2241 |
| 183 | Ga0070716_100003039 | 3300006173 | Bacteria | 7830 |
| 184 | Ga0070716_100063710 | 3300006173 | Bacteria | 2141 |
| 185 | Ga0070716_100092284 | 3300006173 | Bacteria | 1835 |
| 186 | Ga0070712_100001170 | 3300006175 | Bacteria | 15895 |
| 187 | Ga0070712_100044408 | 3300006175 | Bacteria | 3064 |
| 188 | Ga0070712_100050251 | 3300006175 | Bacteria | 2900 |
| 189 | Ga0070712_100058594 | 3300006175 | Bacteria | 2709 |
| 190 | Ga0075362_10033896 | 3300006177 | Bacteria | 2223 |
| 191 | Ga0075362_10102798 | 3300006177 | Bacteria | 1338 |
| 192 | Ga0075367_10030820 | 3300006178 | Bacteria | 3077 |
| 193 | Ga0075367_10093254 | 3300006178 | Bacteria | 1834 |
| 194 | Ga0075367_10228330 | 3300006178 | Bacteria | 1166 |
| 195 | Ga0075369_10086957 | 3300006186 | Bacteria | 1392 |
| 196 | Ga0075369_10147230 | 3300006186 | Bacteria | 1075 |
| 197 | Ga0075366_10029871 | 3300006195 | Bacteria | 3202 |
| 198 | Ga0075366_10031820 | 3300006195 | Bacteria | 3105 |
| 199 | Ga0075366_10077094 | 3300006195 | Bacteria | 1989 |
| 200 | Ga0097621_100058724 | 3300006237 | Bacteria | 3148 |
| 201 | Ga0097621_100495607 | 3300006237 | Bacteria | 1106 |
| 202 | Ga0075370_10015749 | 3300006353 | Bacteria | 4055 |
| 203 | Ga0075370_10041235 | 3300006353 | Bacteria | 2605 |
| 204 | Ga0075370_10084193 | 3300006353 | Bacteria | 1830 |
| 205 | Ga0075370_10191964 | 3300006353 | Bacteria | 1204 |
| 206 | Ga0075370_10208920 | 3300006353 | Bacteria | 1152 |
| 207 | Ga0068871_100034617 | 3300006358 | Bacteria | 4009 |
| 208 | Ga0068871_100087688 | 3300006358 | Bacteria | 2588 |
| 209 | Ga0068871_100525786 | 3300006358 | Bacteria | 1069 |
| 210 | Ga0075428_100077239 | 3300006844 | Bacteria | 3635 |
| 211 | Ga0075434_100286281 | 3300006871 | Bacteria | 1668 |
| 212 | Ga0075434_100377517 | 3300006871 | Bacteria | 1438 |
| 213 | Ga0068865_100045334 | 3300006881 | Bacteria | 3014 |
| 214 | Ga0097620_100075881 | 3300006931 | Bacteria | 3402 |
| 215 | Ga0097620_100383566 | 3300006931 | Bacteria | 1501 |
| 216 | Ga0099822_1011696 | 3300006943 | Bacteria | 10656 |
| 217 | Ga0099795_10158387 | 3300007788 | Bacteria | 932 |
| 218 | Ga0105240_10015488 | 3300009093 | Bacteria | 10365 |
| 219 | Ga0105240_10027333 | 3300009093 | Bacteria | 7470 |
| 220 | Ga0105240_10365826 | 3300009093 | Bacteria | 1632 |
| 221 | Ga0105240_10486506 | 3300009093 | Bacteria | 1375 |
| 222 | Ga0111539_10153919 | 3300009094 | Bacteria | 2691 |
| 223 | Ga0105245_10038988 | 3300009098 | Bacteria | 4228 |
| 224 | Ga0105245_10194108 | 3300009098 | Bacteria | 1947 |
| 225 | Ga0105245_10458883 | 3300009098 | Bacteria | 1284 |
| 226 | Ga0105247_10037260 | 3300009101 | Bacteria | 2967 |
| 227 | Ga0114129_10189934 | 3300009147 | Bacteria | 2790 |
| 228 | Ga0105243_10016903 | 3300009148 | Bacteria | 5516 |
| 229 | Ga0105243_10213855 | 3300009148 | Bacteria | 1699 |
| 230 | Ga0105241_10065293 | 3300009174 | Bacteria | 2812 |
| 231 | Ga0105242_10044906 | 3300009176 | Bacteria | 3579 |
| 232 | Ga0105242_10115794 | 3300009176 | Bacteria | 2292 |
| 233 | Ga0105242_10295013 | 3300009176 | Bacteria | 1478 |
| 234 | Ga0105242_10419850 | 3300009176 | Bacteria | 1253 |
| 235 | Ga0105237_10052107 | 3300009545 | Bacteria | 4109 |
| 236 | Ga0105237_10075722 | 3300009545 | Bacteria | 3356 |
| 237 | Ga0105237_10209042 | 3300009545 | Bacteria | 1952 |
| 238 | Ga0105238_10059171 | 3300009551 | Bacteria | 3839 |
| 239 | Ga0105238_10340890 | 3300009551 | Bacteria | 1487 |
| 240 | Ga0105249_10048330 | 3300009553 | Bacteria | 3879 |
| 241 | Ga0105249_10369068 | 3300009553 | Bacteria | 1458 |
| 242 | Ga0105239_10003918 | 3300010375 | Bacteria | 18036 |
| 243 | Ga0105239_10032269 | 3300010375 | Bacteria | 5756 |
| 244 | Ga0105239_10099980 | 3300010375 | Bacteria | 3207 |
| 245 | Ga0105239_10105757 | 3300010375 | Bacteria | 3117 |
| 246 | Ga0105239_10112481 | 3300010375 | Bacteria | 3019 |
| 247 | Ga0105239_10143450 | 3300010375 | Bacteria | 2662 |
| 248 | Ga0105239_10157493 | 3300010375 | Bacteria | 2537 |
| 249 | Ga0105246_10022596 | 3300011119 | Bacteria | 4059 |
| 250 | Ga0105246_10057218 | 3300011119 | Bacteria | 2697 |
| 251 | Ga0105246_10091339 | 3300011119 | Bacteria | 2195 |
| 252 | Ga0157371_10422817 | 3300013102 | Bacteria | 977 |
| 253 | Ga0157370_10050985 | 3300013104 | Bacteria | 3954 |
| 254 | Ga0157369_10011431 | 3300013105 | Bacteria | 10082 |
| 255 | Ga0157369_10020578 | 3300013105 | Bacteria | 7376 |
| 256 | Ga0157369_10052559 | 3300013105 | Bacteria | 4408 |
| 257 | Ga0157369_10210940 | 3300013105 | Bacteria | 2035 |
| 258 | Ga0157374_10192800 | 3300013296 | Bacteria | 1993 |
| 259 | Ga0163162_10065624 | 3300013306 | Bacteria | 3677 |
| 260 | Ga0163162_10108248 | 3300013306 | Bacteria | 2875 |
| 261 | Ga0157372_10103537 | 3300013307 | Bacteria | 3253 |
| 262 | Ga0157372_10105267 | 3300013307 | Bacteria | 3227 |
| 263 | Ga0157375_10015934 | 3300013308 | Bacteria | 6741 |
| 264 | Ga0157375_10047153 | 3300013308 | Bacteria | 4206 |
| 265 | Ga0157375_10231730 | 3300013308 | Bacteria | 2006 |
| 266 | Ga0157375_10253106 | 3300013308 | Bacteria | 1922 |
| 267 | Ga0163163_10017116 | 3300014325 | Bacteria | 6752 |
| 268 | Ga0163163_10118731 | 3300014325 | Bacteria | 2677 |
| 269 | Ga0163163_10298116 | 3300014325 | Unclassified | 1664 |
| 270 | Ga0157377_10118989 | 3300014745 | Bacteria | 1598 |
| 271 | Ga0157377_10175732 | 3300014745 | Bacteria | 1343 |
| 272 | Ga0157379_10023569 | 3300014968 | Bacteria | 5462 |
| 273 | Ga0157376_10120561 | 3300014969 | Bacteria | 2324 |
| 274 | Ga0157376_10287582 | 3300014969 | Bacteria | 1551 |
| 275 | Ga0157376_10615556 | 3300014969 | Bacteria | 1082 |
| 276 | Ga0163161_10056327 | 3300017792 | Bacteria | 2855 |
| 277 | Ga0163161_10123971 | 3300017792 | Bacteria | 1944 |
| 278 | Ga0163161_10127337 | 3300017792 | Bacteria | 1919 |
| 279 | Ga0206354_11003357 | 3300020081 | Bacteria | 1718 |
| 280 | Ga0214544_1000020 | 3300021320 | Bacteria | 178560 |
| 281 | Ga0214542_1000024 | 3300021321 | Bacteria | 191218 |
| 282 | Ga0214545_1000011 | 3300021324 | Bacteria | 190550 |
| 283 | Ga0214545_1030682 | 3300021324 | Bacteria | 2257 |
| 284 | Ga0214543_1000033 | 3300021327 | Bacteria | 190419 |
| 285 | Ga0214543_1030560 | 3300021327 | Bacteria | 2257 |
| 286 | Ga0213873_10017072 | 3300021358 | Bacteria | 1650 |
| 287 | Ga0213872_10020912 | 3300021361 | Bacteria | 3015 |
| 288 | Ga0213874_10008958 | 3300021377 | Bacteria | 2459 |
| 289 | Ga0213876_10000969 | 3300021384 | Bacteria | 18866 |
| 290 | Ga0213876_10067836 | 3300021384 | Bacteria | 1884 |
| 291 | Ga0213871_10001134 | 3300021441 | Bacteria | 4248 |
| 292 | Ga0209563_101494 | 3300025230 | Bacteria | 6143 |
| 293 | Ga0209677_102419 | 3300025253 | Bacteria | 7054 |
| 294 | Ga0209677_106143 | 3300025253 | Bacteria | 2925 |
| 295 | Ga0209148_1000344 | 3300025254 | Bacteria | 61011 |
| 296 | Ga0209233_1008105 | 3300025261 | Bacteria | 3280 |
| 297 | Ga0209455_1001281 | 3300025272 | Bacteria | 11747 |
| 298 | Ga0209564_1002208 | 3300025295 | Bacteria | 16231 |
| 299 | Ga0209564_1016543 | 3300025295 | Bacteria | 2926 |
| 300 | Ga0209564_1018309 | 3300025295 | Bacteria | 2677 |
| 301 | Ga0209758_1000407 | 3300025297 | Bacteria | 73945 |
| 302 | Ga0209758_1000900 | 3300025297 | Bacteria | 40401 |
| 303 | Ga0209758_1000952 | 3300025297 | Bacteria | 39040 |
| 304 | Ga0209758_1001988 | 3300025297 | Bacteria | 22050 |
| 305 | Ga0209758_1002062 | 3300025297 | Bacteria | 21474 |
| 306 | Ga0209758_1011752 | 3300025297 | Bacteria | 5019 |
| 307 | Ga0209758_1017825 | 3300025297 | Bacteria | 3511 |
| 308 | Ga0209256_1011331 | 3300025299 | Bacteria | 3580 |
| 309 | Ga0207426_1000466 | 3300025302 | Bacteria | 62533 |
| 310 | Ga0207426_1000865 | 3300025302 | Bacteria | 31635 |
| 311 | Ga0207426_1003194 | 3300025302 | Bacteria | 9234 |
| 312 | Ga0207426_1012503 | 3300025302 | Bacteria | 3184 |
| 313 | Ga0207426_1019417 | 3300025302 | Bacteria | 2376 |
| 314 | Ga0209257_1001445 | 3300025304 | Bacteria | 28079 |
| 315 | Ga0207692_10001554 | 3300025898 | Bacteria | 8637 |
| 316 | Ga0207692_10184881 | 3300025898 | Bacteria | 1216 |
| 317 | Ga0207692_10190424 | 3300025898 | Bacteria | 1200 |
| 318 | Ga0207642_10021279 | 3300025899 | Bacteria | 2551 |
| 319 | Ga0207642_10037369 | 3300025899 | Bacteria | 2092 |
| 320 | Ga0207642_10054435 | 3300025899 | Bacteria | 1825 |
| 321 | Ga0207710_10022007 | 3300025900 | Bacteria | 2734 |
| 322 | Ga0207710_10098550 | 3300025900 | Bacteria | 1376 |
| 323 | Ga0207710_10189914 | 3300025900 | Bacteria | 1011 |
| 324 | Ga0207688_10031130 | 3300025901 | Bacteria | 2944 |
| 325 | Ga0207688_10298393 | 3300025901 | Bacteria | 985 |
| 326 | Ga0207647_10037625 | 3300025904 | Bacteria | 3067 |
| 327 | Ga0207699_10000550 | 3300025906 | Bacteria | 18494 |
| 328 | Ga0207699_10026311 | 3300025906 | Bacteria | 3205 |
| 329 | Ga0207645_10081511 | 3300025907 | Bacteria | 2074 |
| 330 | Ga0207654_10031567 | 3300025911 | Bacteria | 2919 |
| 331 | Ga0207707_10000466 | 3300025912 | Bacteria | 41992 |
| 332 | Ga0207707_10001222 | 3300025912 | Bacteria | 24136 |
| 333 | Ga0207707_10037513 | 3300025912 | Bacteria | 4235 |
| 334 | Ga0207707_10096318 | 3300025912 | Bacteria | 2586 |
| 335 | Ga0207707_10186582 | 3300025912 | Bacteria | 1810 |
| 336 | Ga0207695_10000029 | 3300025913 | Bacteria | 548364 |
| 337 | Ga0207695_10057285 | 3300025913 | Bacteria | 4049 |
| 338 | Ga0207695_10318943 | 3300025913 | Bacteria | 1444 |
| 339 | Ga0207695_10493222 | 3300025913 | Bacteria | 1107 |
| 340 | Ga0207671_10026230 | 3300025914 | Bacteria | 4369 |
| 341 | Ga0207671_10035977 | 3300025914 | Bacteria | 3672 |
| 342 | Ga0207671_10091491 | 3300025914 | Bacteria | 2292 |
| 343 | Ga0207671_10193027 | 3300025914 | Bacteria | 1588 |
| 344 | Ga0207693_10002659 | 3300025915 | Bacteria | 15525 |
| 345 | Ga0207693_10034621 | 3300025915 | Bacteria | 3983 |
| 346 | Ga0207693_10047433 | 3300025915 | Bacteria | 3375 |
| 347 | Ga0207693_10075916 | 3300025915 | Bacteria | 2632 |
| 348 | Ga0207693_10101701 | 3300025915 | Bacteria | 2254 |
| 349 | Ga0207663_10008869 | 3300025916 | Bacteria | 5288 |
| 350 | Ga0207663_10303734 | 3300025916 | Bacteria | 1193 |
| 351 | Ga0207660_10004908 | 3300025917 | Bacteria | 8710 |
| 352 | Ga0207657_10004634 | 3300025919 | Bacteria | 14526 |
| 353 | Ga0207657_10056992 | 3300025919 | Bacteria | 3370 |
| 354 | Ga0207649_10361467 | 3300025920 | Bacteria | 1077 |
| 355 | Ga0207652_10002138 | 3300025921 | Bacteria | 16939 |
| 356 | Ga0207652_10011255 | 3300025921 | Bacteria | 7208 |
| 357 | Ga0207652_10024322 | 3300025921 | Bacteria | 5024 |
| 358 | Ga0207681_10088275 | 3300025923 | Bacteria | 2208 |
| 359 | Ga0207681_10088634 | 3300025923 | Bacteria | 2204 |
| 360 | Ga0207681_10203927 | 3300025923 | Bacteria | 1520 |
| 361 | Ga0207694_10129317 | 3300025924 | Bacteria | 2023 |
| 362 | Ga0207694_10160215 | 3300025924 | Bacteria | 1817 |
| 363 | Ga0207650_10298792 | 3300025925 | Bacteria | 1314 |
| 364 | Ga0207659_10069356 | 3300025926 | Bacteria | 2567 |
| 365 | Ga0207687_10335989 | 3300025927 | Bacteria | 1227 |
| 366 | Ga0207700_10013381 | 3300025928 | Bacteria | 5336 |
| 367 | Ga0207700_10013938 | 3300025928 | Bacteria | 5252 |
| 368 | Ga0207700_10024525 | 3300025928 | Bacteria | 4175 |
| 369 | Ga0207700_10200662 | 3300025928 | Bacteria | 1681 |
| 370 | Ga0207664_10024687 | 3300025929 | Bacteria | 4519 |
| 371 | Ga0207664_10076606 | 3300025929 | Bacteria | 2708 |
| 372 | Ga0207664_10209111 | 3300025929 | Bacteria | 1687 |
| 373 | Ga0207664_10241565 | 3300025929 | Bacteria | 1573 |
| 374 | Ga0207644_10032126 | 3300025931 | Bacteria | 3660 |
| 375 | Ga0207644_10187048 | 3300025931 | Bacteria | 1627 |
| 376 | Ga0207690_10065536 | 3300025932 | Bacteria | 2484 |
| 377 | Ga0207690_10098731 | 3300025932 | Bacteria | 2081 |
| 378 | Ga0207690_10114570 | 3300025932 | Bacteria | 1947 |
| 379 | Ga0207706_10083950 | 3300025933 | Bacteria | 2800 |
| 380 | Ga0207706_10095838 | 3300025933 | Bacteria | 2609 |
| 381 | Ga0207706_10097118 | 3300025933 | Bacteria | 2591 |
| 382 | Ga0207706_10173181 | 3300025933 | Bacteria | 1896 |
| 383 | Ga0207686_10039113 | 3300025934 | Bacteria | 2876 |
| 384 | Ga0207686_10071513 | 3300025934 | Bacteria | 2233 |
| 385 | Ga0207686_10187205 | 3300025934 | Bacteria | 1473 |
| 386 | Ga0207709_10112831 | 3300025935 | Bacteria | 1821 |
| 387 | Ga0207670_10173074 | 3300025936 | Bacteria | 1620 |
| 388 | Ga0207669_10421677 | 3300025937 | Bacteria | 1050 |
| 389 | Ga0207704_10039581 | 3300025938 | Bacteria | 2747 |
| 390 | Ga0207665_10007182 | 3300025939 | Bacteria | 7370 |
| 391 | Ga0207665_10032684 | 3300025939 | Bacteria | 3445 |
| 392 | Ga0207665_10167316 | 3300025939 | Bacteria | 1585 |
| 393 | Ga0207691_10092265 | 3300025940 | Bacteria | 2712 |
| 394 | Ga0207711_10108226 | 3300025941 | Bacteria | 2469 |
| 395 | Ga0207711_10184304 | 3300025941 | Bacteria | 1900 |
| 396 | Ga0207711_10219462 | 3300025941 | Bacteria | 1738 |
| 397 | Ga0207689_10060253 | 3300025942 | Bacteria | 3121 |
| 398 | Ga0207689_10064343 | 3300025942 | Bacteria | 3018 |
| 399 | Ga0207661_10000499 | 3300025944 | Bacteria | 25254 |
| 400 | Ga0207661_10015755 | 3300025944 | Bacteria | 5568 |
| 401 | Ga0207667_10012774 | 3300025949 | Bacteria | 9646 |
| 402 | Ga0207667_10180188 | 3300025949 | Bacteria | 2170 |
| 403 | Ga0207667_10338680 | 3300025949 | Bacteria | 1535 |
| 404 | Ga0207667_10449313 | 3300025949 | Bacteria | 1310 |
| 405 | Ga0207667_10895369 | 3300025949 | Bacteria | 879 |
| 406 | Ga0207651_10080927 | 3300025960 | Bacteria | 2340 |
| 407 | Ga0207712_10158443 | 3300025961 | Bacteria | 1756 |
| 408 | Ga0207668_10009427 | 3300025972 | Bacteria | 5852 |
| 409 | Ga0207668_10022935 | 3300025972 | Bacteria | 4002 |
| 410 | Ga0207668_10026363 | 3300025972 | Bacteria | 3773 |
| 411 | Ga0207668_10154981 | 3300025972 | Bacteria | 1778 |
| 412 | Ga0207640_10068680 | 3300025981 | Bacteria | 2376 |
| 413 | Ga0207640_10142365 | 3300025981 | Bacteria | 1750 |
| 414 | Ga0207658_10072837 | 3300025986 | Bacteria | 2606 |
| 415 | Ga0207658_10452004 | 3300025986 | Bacteria | 1137 |
| 416 | Ga0207677_10008684 | 3300026023 | Bacteria | 5688 |
| 417 | Ga0207677_10022654 | 3300026023 | Bacteria | 3865 |
| 418 | Ga0207677_10088035 | 3300026023 | Bacteria | 2250 |
| 419 | Ga0207703_10320567 | 3300026035 | Bacteria | 1419 |
| 420 | Ga0207639_10009801 | 3300026041 | Bacteria | 6620 |
| 421 | Ga0207639_10062834 | 3300026041 | Bacteria | 2873 |
| 422 | Ga0207639_10105759 | 3300026041 | Bacteria | 2284 |
| 423 | Ga0207639_10233030 | 3300026041 | Bacteria | 1597 |
| 424 | Ga0207678_10024050 | 3300026067 | Bacteria | 5323 |
| 425 | Ga0207678_10029342 | 3300026067 | Bacteria | 4801 |
| 426 | Ga0207678_10040741 | 3300026067 | Bacteria | 4027 |
| 427 | Ga0207678_10056118 | 3300026067 | Bacteria | 3392 |
| 428 | Ga0207678_10059827 | 3300026067 | Bacteria | 3278 |
| 429 | Ga0207678_10073505 | 3300026067 | Bacteria | 2930 |
| 430 | Ga0207708_10062207 | 3300026075 | Bacteria | 2851 |
| 431 | Ga0207702_10138490 | 3300026078 | Bacteria | 2199 |
| 432 | Ga0207702_10380955 | 3300026078 | Bacteria | 1356 |
| 433 | Ga0207641_10135681 | 3300026088 | Bacteria | 2215 |
| 434 | Ga0207641_10146719 | 3300026088 | Bacteria | 2134 |
| 435 | Ga0207641_10249515 | 3300026088 | Bacteria | 1657 |
| 436 | Ga0207648_10029160 | 3300026089 | Bacteria | 4894 |
| 437 | Ga0207648_10075028 | 3300026089 | Bacteria | 2948 |
| 438 | Ga0207648_10485215 | 3300026089 | Bacteria | 1129 |
| 439 | Ga0207676_10046804 | 3300026095 | Bacteria | 3349 |
| 440 | Ga0207676_10293180 | 3300026095 | Bacteria | 1482 |
| 441 | Ga0207674_10117026 | 3300026116 | Bacteria | 2636 |
| 442 | Ga0207674_10118244 | 3300026116 | Bacteria | 2620 |
| 443 | Ga0207675_100018245 | 3300026118 | Bacteria | 6542 |
| 444 | Ga0207675_100147700 | 3300026118 | Bacteria | 2236 |
| 445 | Ga0207675_100164894 | 3300026118 | Bacteria | 2115 |
| 446 | Ga0207675_100372987 | 3300026118 | Bacteria | 1402 |
| 447 | Ga0207683_10011914 | 3300026121 | Bacteria | 7420 |
| 448 | Ga0207683_10054649 | 3300026121 | Bacteria | 3501 |
| 449 | Ga0207683_10082425 | 3300026121 | Bacteria | 2857 |
| 450 | Ga0207683_10132129 | 3300026121 | Bacteria | 2246 |
| 451 | Ga0207683_10263993 | 3300026121 | Bacteria | 1572 |
| 452 | Ga0207698_10013308 | 3300026142 | Bacteria | 5424 |
| 453 | Ga0207698_10015126 | 3300026142 | Bacteria | 5158 |
| 454 | Ga0207698_11055064 | 3300026142 | Bacteria | 824 |
| 455 | Ga0209389_1000025 | 3300027296 | Bacteria | 149588 |
| 456 | Ga0209589_1000018 | 3300027357 | Bacteria | 192614 |
| 457 | Ga0209589_1000066 | 3300027357 | Bacteria | 100795 |
| 458 | Ga0209489_100026 | 3300027361 | Bacteria | 192614 |
| 459 | Ga0209489_100030 | 3300027361 | Bacteria | 185999 |
| 460 | Ga0209700_100035 | 3300027363 | Bacteria | 192614 |
| 461 | Ga0209588_1010269 | 3300027671 | Bacteria | 2812 |
| 462 | Ga0268266_10001465 | 3300028379 | Bacteria | 28078 |
| 463 | Ga0268266_10003531 | 3300028379 | Bacteria | 15523 |
| 464 | Ga0268266_10016020 | 3300028379 | Bacteria | 6410 |
| 465 | Ga0268266_10088145 | 3300028379 | Bacteria | 2716 |
| 466 | Ga0268266_10095655 | 3300028379 | Bacteria | 2609 |
| 467 | Ga0268266_10099013 | 3300028379 | Bacteria | 2566 |
| 468 | Ga0268266_10107456 | 3300028379 | Bacteria | 2468 |
| 469 | Ga0268266_10115378 | 3300028379 | Bacteria | 2384 |
| 470 | Ga0268266_10371584 | 3300028379 | Bacteria | 1347 |
| 471 | Ga0268266_10468669 | 3300028379 | Bacteria | 1199 |
| 472 | Ga0268266_10607966 | 3300028379 | Bacteria | 1050 |
| 473 | Ga0268264_10000035 | 3300028381 | Bacteria | 398196 |
| 474 | Ga0265319_1028990 | 3300028563 | Bacteria | 1947 |
| 475 | Ga0265334_10002345 | 3300028573 | Bacteria | 8909 |
| 476 | Ga0265318_10032922 | 3300028577 | Bacteria | 2003 |
| 477 | Ga0265322_10070288 | 3300028654 | Bacteria | 993 |
| 478 | Ga0265336_10005760 | 3300028666 | Bacteria | 4536 |
| 479 | Ga0307515_10054331 | 3300028794 | Bacteria | 5883 |
| 480 | Ga0265338_10000065 | 3300028800 | Bacteria | 188966 |
| 481 | Ga0265330_10073333 | 3300031235 | Bacteria | 1480 |
| 482 | Ga0265330_10073974 | 3300031235 | Bacteria | 1472 |
| 483 | Ga0265340_10036665 | 3300031247 | Bacteria | 2429 |
| 484 | Ga0307513_10466462 | 3300031456 | Bacteria | 985 |
| 485 | Ga0307509_10029857 | 3300031507 | Bacteria | 6041 |
| 486 | Ga0265313_10037155 | 3300031595 | Bacteria | 2438 |
| 487 | Ga0307508_10000090 | 3300031616 | Bacteria | 106893 |
| 488 | Ga0307508_10065785 | 3300031616 | Bacteria | 3193 |
| 489 | Ga0265342_10059059 | 3300031712 | Bacteria | 2266 |
| 490 | Ga0307516_10058192 | 3300031730 | Bacteria | 3763 |
| 491 | Ga0307516_10107825 | 3300031730 | Bacteria | 2593 |
| 492 | Ga0307405_10100094 | 3300031731 | Bacteria | 1942 |
| 493 | Ga0307410_10439284 | 3300031852 | Bacteria | 1062 |
| 494 | Ga0307406_10059976 | 3300031901 | Bacteria | 2452 |
| 495 | Ga0307406_10168321 | 3300031901 | Bacteria | 1583 |
| 496 | Ga0307406_10313123 | 3300031901 | Bacteria | 1211 |
| 497 | Ga0307510_10004617 | 3300033180 | Bacteria | 16241 |
| 498 | Ga0307510_10020616 | 3300033180 | Bacteria | 7699 |
| 499 | Ga0307510_10049660 | 3300033180 | Bacteria | 4459 |
| 500 | Ga0316215_1002836 | 3300033544 | Bacteria | 1645 |
| 501 | Ga0373930_0004457 | 3300034816 | Bacteria | 2280 |
| 502 | Ga0373959_0032990 | 3300034820 | Bacteria | 1055 |
| 503 | Ga0373934_0012795 | 3300035086 | Bacteria | 3169 |
| 504 | Ga0373951_0021428 | 3300035091 | Bacteria | 1485 |
| 505 | Ga0373923_0008238 | 3300035111 | Bacteria | 3707 |
| 506 | Ga0373923_0116093 | 3300035111 | Bacteria | 1192 |
| 507 | Ga0373936_0006507 | 3300035113 | Bacteria | 4403 |
| 508 | Ga0373936_0026971 | 3300035113 | Bacteria | 2252 |
| 509 | Ga0373939_0054122 | 3300035114 | Bacteria | 1256 |
| 510 | Ga0373945_0031927 | 3300035116 | Bacteria | 1863 |
| 511 | Ga0373953_0003083 | 3300035117 | Bacteria | 5124 |
| 512 | Ga0373953_0069216 | 3300035117 | Bacteria | 1454 |
| 513 | Ga0373956_0000726 | 3300035119 | Bacteria | 13568 |
| 514 | Ga0373957_0004882 | 3300035120 | Bacteria | 4115 |
| 515 | Ga0373957_0128536 | 3300035120 | Bacteria | 1030 |
| 516 | Ga0373943_0004812 | 3300035170 | Bacteria | 6099 |
| 517 | Ga0373943_0139550 | 3300035170 | Bacteria | 1305 |
| 518 | Ga0373946_0008147 | 3300035171 | Bacteria | 3846 |
| 519 | Ga0373946_0010035 | 3300035171 | Bacteria | 3502 |
| 520 | Ga0373946_0079458 | 3300035171 | Bacteria | 1433 |
| 521 | Ga0373955_0003241 | 3300035172 | Bacteria | 7127 |
| 522 | Ga0373955_0020612 | 3300035172 | Bacteria | 3317 |
| 523 | Ga0373955_0287655 | 3300035172 | Bacteria | 989 |
| 524 | Ga0373924_0021158 | 3300035410 | Bacteria | 2536 |
| 525 | Ga0373924_0031946 | 3300035410 | Bacteria | 2119 |
| 526 | Ga0373931_0001506 | 3300035691 | Bacteria | 10029 |
| 527 | Ga0373935_0095620 | 3300035692 | Bacteria | 1951 |
| 528 | Ga0373935_0216431 | 3300035692 | Bacteria | 1329 |
| 529 | Ga0373927_0001005 | 3300035695 | Bacteria | 21497 |
| 530 | Ga0373927_0005832 | 3300035695 | Bacteria | 8449 |
| 531 | Ga0373927_0113569 | 3300035695 | Bacteria | 1765 |
| 532 | Ga0373927_0143691 | 3300035695 | Bacteria | 1561 |
| 533 | Ga0373927_0167717 | 3300035695 | Bacteria | 1439 |
| 534 | Ga0373927_0173891 | 3300035695 | Bacteria | 1412 |
| 535 | Ga0373933_0009400 | 3300035724 | Bacteria | 5339 |
| 536 | Ga0373933_0020192 | 3300035724 | Bacteria | 3775 |
| 537 | Ga0373933_0452595 | 3300035724 | Bacteria | 840 |
| 538 | Ga0373947_0003823 | 3300035725 | Bacteria | 8867 |
| 539 | Ga0373947_0005667 | 3300035725 | Bacteria | 7285 |
| 540 | Ga0373947_0116907 | 3300035725 | Bacteria | 1691 |
| 541 | Ga0373937_0002920 | 3300036401 | Bacteria | 14286 |
| 542 | Ga0373937_0195852 | 3300036401 | Bacteria | 1899 |
| 543 | Ga0372808_010437 | 3300036459 | Bacteria | 1307 |
| 544 | Ga0373925_0006131 | 3300037068 | Bacteria | 8880 |
| 545 | Ga0373925_0079952 | 3300037068 | Bacteria | 2484 |
| 546 | Ga0373925_0108079 | 3300037068 | Bacteria | 2146 |
| 547 | Ga0373925_0157269 | 3300037068 | Bacteria | 1788 |
| 548 | Ga0373925_0687217 | 3300037068 | Bacteria | 844 |
| 549 | Ga0395900_0081560 | 3300037418 | Bacteria | 3323 |
| 550 | Ga0395898_0073328 | 3300037466 | Bacteria | 3307 |
| 551 | Ga0395898_0179729 | 3300037466 | Bacteria | 2022 |
| 552 | Ga0395905_0015966 | 3300037471 | Bacteria | 7137 |
| 553 | Ga0395905_0099550 | 3300037471 | Bacteria | 2730 |
| 554 | Ga0436364_1466266 | 3300037853 | Bacteria | 1304 |
| 555 | Ga0395901_0039843 | 3300038443 | Bacteria | 4863 |
| 556 | Ga0395901_0179868 | 3300038443 | Bacteria | 2218 |
| 557 | Ga0436365_0244764 | 3300039437 | Bacteria | 1516 |
| 558 | Ga0436365_0255894 | 3300039437 | Bacteria | 31807 |
| 559 | Ga0436365_0870867 | 3300039437 | Bacteria | 2556 |
| 560 | Ga0436365_1891143 | 3300039437 | Bacteria | 871 |
| 561 | Ga0436360_0377935 | 3300039438 | Bacteria | 912 |
| 562 | Ga0436360_1119017 | 3300039438 | Bacteria | 1895 |
| 563 | Ga0436360_1272541 | 3300039438 | Bacteria | 5502 |
| 564 | Ga0436361_0295266 | 3300039447 | Bacteria | 1079 |
| 565 | Ga0436361_0442731 | 3300039447 | Bacteria | 3924 |
| 566 | Ga0436363_0323974 | 3300039450 | Bacteria | 2268 |
| 567 | Ga0436363_0607645 | 3300039450 | Bacteria | 899 |
| 568 | Ga0436363_1259875 | 3300039450 | Bacteria | 3215 |
| 569 | Ga0436363_1577576 | 3300039450 | Bacteria | 2027 |
| 570 | Ga0436362_0240249 | 3300039453 | Bacteria | 1871 |
| 571 | Ga0451798_0628637 | 3300041458 | Bacteria | 967 |
| 572 | Ga0451833_0240175 | 3300041491 | Bacteria | 1644 |
| 573 | Ga0451847_0360949 | 3300041503 | Bacteria | 1381 |
| 574 | Ga0439459_0014524 | 3300042438 | Bacteria | 1432 |
| 575 | Ga0466972_0000261 | 3300044658 | Bacteria | 34759 |
| 576 | Ga0466972_0050816 | 3300044658 | Bacteria | 2000 |
| 577 | Ga0466965_0049773 | 3300044683 | Bacteria | 2077 |
| 578 | Ga0466966_0175167 | 3300044684 | Bacteria | 1303 |
| 579 | Ga0466961_0270759 | 3300044693 | Bacteria | 1040 |
| 580 | Ga0466963_0216899 | 3300044694 | Bacteria | 1339 |
| 581 | Ga0466968_0114682 | 3300044735 | Bacteria | 1214 |
| 582 | Ga0466970_0087256 | 3300044765 | Bacteria | 1692 |
| 583 | Ga0466957_0066260 | 3300044842 | Bacteria | 2226 |
| 584 | Ga0466960_0133158 | 3300044901 | Bacteria | 1314 |
| 585 | Ga0466959_0128863 | 3300045049 | Bacteria | 1794 |
| 586 | Ga0495617_032196 | 3300046452 | Bacteria | 1760 |
| 587 | Ga0495592_0001015 | 3300046454 | Bacteria | 19460 |
| 588 | Ga0495592_0003697 | 3300046454 | Bacteria | 11028 |
| 589 | Ga0495592_0070438 | 3300046454 | Bacteria | 2547 |
| 590 | Ga0495592_0090334 | 3300046454 | Bacteria | 2198 |
| 591 | Ga0495603_0004652 | 3300046455 | Bacteria | 8202 |
| 592 | Ga0495603_0010944 | 3300046455 | Bacteria | 5503 |
| 593 | Ga0495603_0014448 | 3300046455 | Bacteria | 4775 |
| 594 | Ga0495603_0077462 | 3300046455 | Bacteria | 1950 |
| 595 | Ga0495629_0003238 | 3300046459 | Bacteria | 12332 |
| 596 | Ga0495629_0011592 | 3300046459 | Bacteria | 6400 |
| 597 | Ga0495629_0081525 | 3300046459 | Bacteria | 2258 |
| 598 | Ga0495629_0255363 | 3300046459 | Bacteria | 1205 |
| 599 | Ga0495638_0009098 | 3300046460 | Bacteria | 6993 |
| 600 | Ga0495638_0064537 | 3300046460 | Bacteria | 2255 |
| 601 | Ga0495638_0078499 | 3300046460 | Bacteria | 2008 |
| 602 | Ga0495638_0200454 | 3300046460 | Bacteria | 1127 |
| 603 | Ga0495641_0009631 | 3300046461 | Bacteria | 5717 |
| 604 | Ga0495651_0013141 | 3300046462 | Bacteria | 6401 |
| 605 | Ga0495651_0015940 | 3300046462 | Bacteria | 5820 |
| 606 | Ga0495651_0033664 | 3300046462 | Bacteria | 3996 |
| 607 | Ga0495651_0178957 | 3300046462 | Bacteria | 1502 |
| 608 | Ga0495653_0000934 | 3300046463 | Bacteria | 22498 |
| 609 | Ga0495653_0119690 | 3300046463 | Bacteria | 1879 |
| 610 | Ga0495653_0356206 | 3300046463 | Bacteria | 940 |
| 611 | Ga0495580_0000612 | 3300046472 | Bacteria | 30191 |
| 612 | Ga0495580_0010282 | 3300046472 | Bacteria | 7298 |
| 613 | Ga0495580_0119377 | 3300046472 | Bacteria | 1831 |
| 614 | Ga0495582_0000831 | 3300046473 | Bacteria | 17092 |
| 615 | Ga0495582_0019067 | 3300046473 | Bacteria | 3754 |
| 616 | Ga0495582_0070749 | 3300046473 | Bacteria | 1930 |
| 617 | Ga0495605_0160241 | 3300046474 | Bacteria | 999 |
| 618 | Ga0495605_0171646 | 3300046474 | Bacteria | 958 |
| 619 | Ga0495639_0000627 | 3300046475 | Bacteria | 16367 |
| 620 | Ga0495639_0040188 | 3300046475 | Bacteria | 2104 |
| 621 | Ga0495639_0048465 | 3300046475 | Bacteria | 1926 |
| 622 | Ga0495662_0000686 | 3300046476 | Bacteria | 16015 |
| 623 | Ga0495662_0119151 | 3300046476 | Bacteria | 1295 |
| 624 | Ga0495664_0009563 | 3300046477 | Bacteria | 5425 |
| 625 | Ga0495664_0096442 | 3300046477 | Bacteria | 1780 |
| 626 | Ga0495664_0127983 | 3300046477 | Bacteria | 1537 |
| 627 | Ga0495664_0367883 | 3300046477 | Bacteria | 865 |
| 628 | Ga0495584_0064018 | 3300046491 | Bacteria | 1849 |
| 629 | Ga0495585_0086988 | 3300046492 | Bacteria | 1687 |
| 630 | Ga0495594_0007696 | 3300046499 | Bacteria | 5543 |
| 631 | Ga0495596_0041380 | 3300046500 | Bacteria | 1817 |
| 632 | Ga0495607_0063530 | 3300046501 | Bacteria | 2088 |
| 633 | Ga0495607_0138068 | 3300046501 | Bacteria | 1261 |
| 634 | Ga0495583_0087672 | 3300046506 | Bacteria | 1344 |
| 635 | Ga0495583_0134317 | 3300046506 | Bacteria | 1034 |
| 636 | Ga0495606_0035698 | 3300046507 | Bacteria | 3395 |
| 637 | Ga0495606_0075938 | 3300046507 | Bacteria | 2101 |
| 638 | Ga0495606_0090759 | 3300046507 | Bacteria | 1880 |
| 639 | Ga0495608_0002093 | 3300046511 | Bacteria | 14381 |
| 640 | Ga0495608_0077941 | 3300046511 | Bacteria | 2157 |
| 641 | Ga0495618_0065862 | 3300046514 | Bacteria | 2302 |
| 642 | Ga0495618_0239659 | 3300046514 | Bacteria | 1140 |
| 643 | Ga0495628_0020462 | 3300046516 | Bacteria | 5456 |
| 644 | Ga0495628_0046153 | 3300046516 | Bacteria | 3461 |
| 645 | Ga0495630_0002217 | 3300046517 | Bacteria | 13536 |
| 646 | Ga0495643_0030321 | 3300046522 | Bacteria | 3021 |
| 647 | Ga0495648_0013331 | 3300046524 | Bacteria | 6084 |
| 648 | Ga0495648_0016179 | 3300046524 | Bacteria | 5383 |
| 649 | Ga0495666_0113226 | 3300046526 | Bacteria | 1274 |
| 650 | Ga0495666_0158074 | 3300046526 | Bacteria | 1052 |
| 651 | Ga0495642_0162479 | 3300046528 | Bacteria | 969 |
| 652 | Ga0495652_0002209 | 3300046529 | Bacteria | 20424 |
| 653 | Ga0495652_0159468 | 3300046529 | Bacteria | 1753 |
| 654 | Ga0495652_0203001 | 3300046529 | Bacteria | 1503 |
| 655 | Ga0495665_0000866 | 3300046531 | Bacteria | 15828 |
| 656 | Ga0495640_0003099 | 3300046533 | Bacteria | 13412 |
| 657 | Ga0495640_0020259 | 3300046533 | Bacteria | 4898 |
| 658 | Ga0495640_0026887 | 3300046533 | Bacteria | 4153 |
| 659 | Ga0495640_0260171 | 3300046533 | Bacteria | 1084 |
| 660 | Ga0495587_0015200 | 3300046536 | Bacteria | 4810 |
| 661 | Ga0495609_0157492 | 3300046538 | Bacteria | 964 |
| 662 | Ga0495597_0168045 | 3300046542 | Bacteria | 892 |
| 663 | Ga0495645_0012499 | 3300046543 | Bacteria | 5983 |
| 664 | Ga0495645_0013311 | 3300046543 | Bacteria | 5815 |
| 665 | Ga0495622_0022179 | 3300046557 | Bacteria | 2958 |
| 666 | Ga0495622_0027395 | 3300046557 | Bacteria | 2660 |
| 667 | Ga0495622_0040897 | 3300046557 | Bacteria | 2156 |
| 668 | Ga0495633_0016209 | 3300046558 | Bacteria | 3850 |
| 669 | Ga0495633_0054611 | 3300046558 | Bacteria | 1879 |
| 670 | Ga0495667_0009515 | 3300046559 | Bacteria | 6585 |
| 671 | Ga0495667_0031439 | 3300046559 | Bacteria | 3564 |
| 672 | Ga0495668_0025884 | 3300046616 | Bacteria | 3332 |
| 673 | Ga0495634_0002722 | 3300046642 | Bacteria | 14545 |
| 674 | Ga0495634_0083525 | 3300046642 | Bacteria | 2084 |
| 675 | Ga0495625_0070900 | 3300046660 | Bacteria | 2446 |
| 676 | Ga0495635_0000540 | 3300046663 | Bacteria | 24055 |
| 677 | Ga0495635_0007303 | 3300046663 | Bacteria | 7716 |
| 678 | Ga0495635_0010103 | 3300046663 | Bacteria | 6600 |
| 679 | Ga0495635_0013453 | 3300046663 | Bacteria | 5725 |
| 680 | Ga0495635_0177916 | 3300046663 | Bacteria | 1446 |
| 681 | Ga0495661_0044100 | 3300046665 | Bacteria | 2736 |
| 682 | Ga0495661_0132550 | 3300046665 | Bacteria | 1364 |
| 683 | Ga0495661_0200219 | 3300046665 | Bacteria | 1046 |
| 684 | Ga0495588_0050990 | 3300046674 | Bacteria | 2130 |
| 685 | Ga0495588_0095442 | 3300046674 | Bacteria | 1559 |
| 686 | Ga0495588_0098362 | 3300046674 | Bacteria | 1536 |
| 687 | Ga0495657_0001615 | 3300046675 | Bacteria | 19351 |
| 688 | Ga0495657_0003319 | 3300046675 | Bacteria | 13189 |
| 689 | Ga0495657_0014067 | 3300046675 | Bacteria | 5878 |
| 690 | Ga0495657_0306693 | 3300046675 | Bacteria | 946 |
| 691 | Ga0495599_0007666 | 3300046678 | Bacteria | 6555 |
| 692 | Ga0495599_0060654 | 3300046678 | Bacteria | 2365 |
| 693 | Ga0495599_0071308 | 3300046678 | Bacteria | 2169 |
| 694 | Ga0495623_0012652 | 3300046679 | Bacteria | 5461 |
| 695 | Ga0495623_0042546 | 3300046679 | Bacteria | 2893 |
| 696 | Ga0495623_0069774 | 3300046679 | Bacteria | 2190 |
| 697 | Ga0495646_0010030 | 3300046680 | Bacteria | 6021 |
| 698 | Ga0495646_0025769 | 3300046680 | Bacteria | 3697 |
| 699 | Ga0495646_0038036 | 3300046680 | Bacteria | 2973 |
| 700 | Ga0495646_0088196 | 3300046680 | Bacteria | 1797 |
| 701 | Ga0495646_0282907 | 3300046680 | Bacteria | 881 |
| 702 | Ga0495647_0006540 | 3300046681 | Bacteria | 3865 |
| 703 | Ga0495658_0000295 | 3300046683 | Bacteria | 28329 |
| 704 | Ga0495658_0066331 | 3300046683 | Bacteria | 2085 |
| 705 | Ga0495658_0146135 | 3300046683 | Bacteria | 1449 |
| 706 | Ga0495658_0147849 | 3300046683 | Bacteria | 1441 |
| 707 | Ga0495613_0004147 | 3300046689 | Bacteria | 10847 |
| 708 | Ga0495613_0031591 | 3300046689 | Bacteria | 3934 |
| 709 | Ga0495613_0069052 | 3300046689 | Bacteria | 2577 |
| 710 | Ga0495613_0069070 | 3300046689 | Bacteria | 2577 |
| 711 | Ga0495613_0105420 | 3300046689 | Bacteria | 2035 |
| 712 | Ga0495613_0143346 | 3300046689 | Bacteria | 1706 |
| 713 | Ga0495624_0000079 | 3300046690 | Bacteria | 63196 |
| 714 | Ga0495624_0151375 | 3300046690 | Bacteria | 1419 |
| 715 | Ga0495670_0020636 | 3300046691 | Bacteria | 3249 |
| 716 | Ga0495670_0057400 | 3300046691 | Bacteria | 1954 |
| 717 | Ga0495649_0030534 | 3300046694 | Bacteria | 2976 |
| 718 | Ga0495649_0069232 | 3300046694 | Bacteria | 1893 |
| 719 | Ga0495589_0152954 | 3300046794 | Bacteria | 1101 |
| 720 | Ga0495600_0004052 | 3300046809 | Bacteria | 8710 |
| 721 | Ga0495600_0007254 | 3300046809 | Bacteria | 6770 |
| 722 | Ga0495600_0052689 | 3300046809 | Bacteria | 2657 |
| 723 | Ga0495581_0000260 | 3300047315 | Bacteria | 25339 |
| 724 | Ga0495581_0117764 | 3300047315 | Bacteria | 1545 |
| 725 | Ga0495604_0021019 | 3300047317 | Bacteria | 5207 |
| 726 | Ga0495604_0027245 | 3300047317 | Bacteria | 4546 |
| 727 | Ga0495636_0104488 | 3300047318 | Bacteria | 1241 |
| 728 | Ga0495674_0009590 | 3300047319 | Bacteria | 9195 |
| 729 | Ga0495674_0032464 | 3300047319 | Bacteria | 4734 |
| 730 | Ga0495674_0064849 | 3300047319 | Bacteria | 3174 |
| 731 | Ga0495672_0079809 | 3300047320 | Bacteria | 1827 |
| 732 | Ga0495672_0156642 | 3300047320 | Bacteria | 1176 |
| 733 | Ga0495676_0094225 | 3300047321 | Bacteria | 2231 |
| 734 | Ga0495676_0144076 | 3300047321 | Bacteria | 1704 |
| 735 | Ga0495680_0012504 | 3300047322 | Bacteria | 7465 |
| 736 | Ga0495680_0026735 | 3300047322 | Bacteria | 4751 |
| 737 | Ga0495683_0064755 | 3300047323 | Bacteria | 1805 |
| 738 | Ga0495687_026560 | 3300047443 | Bacteria | 2723 |
| 739 | Ga0495675_0001958 | 3300047444 | Bacteria | 12284 |
| 740 | Ga0495675_0051348 | 3300047444 | Bacteria | 2619 |
| 741 | Ga0495677_0029096 | 3300047445 | Bacteria | 2008 |
| 742 | Ga0495685_106021 | 3300047447 | Bacteria | 927 |
| 743 | Ga0495673_0041199 | 3300047469 | Bacteria | 2081 |
| 744 | Ga0495681_0031275 | 3300047470 | Bacteria | 2697 |
| 745 | Ga0495681_0043594 | 3300047470 | Bacteria | 2162 |
| 746 | Ga0495684_0001865 | 3300047471 | Bacteria | 16864 |
| 747 | Ga0495684_0010601 | 3300047471 | Bacteria | 7124 |
| 748 | Ga0495684_0074943 | 3300047471 | Bacteria | 2571 |
| 749 | Ga0495684_0120786 | 3300047471 | Bacteria | 1974 |
| 750 | Ga0495686_0065228 | 3300047472 | Bacteria | 2252 |
| 751 | Ga0495593_0001632 | 3300047673 | Bacteria | 13278 |
| 752 | Ga0495593_0042278 | 3300047673 | Bacteria | 2446 |
| 753 | Ga0495593_0279050 | 3300047673 | Bacteria | 836 |
| 754 | Ga0495602_0008574 | 3300048088 | Bacteria | 10676 |
| 755 | Ga0495602_0009374 | 3300048088 | Bacteria | 10184 |
| 756 | Ga0495614_0006328 | 3300048089 | Bacteria | 5320 |
| 757 | Ga0495626_0124338 | 3300048091 | Bacteria | 1106 |
| 758 | Ga0496100_0009348 | 3300048903 | Bacteria | 5508 |
| 759 | Ga0496100_0015363 | 3300048903 | Bacteria | 4470 |
| 760 | Ga0496100_0174741 | 3300048903 | Bacteria | 1550 |
| 761 | Ga0496101_0045479 | 3300048904 | Bacteria | 3144 |
| 762 | Ga0496101_0100207 | 3300048904 | Bacteria | 2167 |
| 763 | Ga0496101_0128252 | 3300048904 | Bacteria | 1924 |
| 764 | Ga0496101_0148183 | 3300048904 | Bacteria | 1793 |
| 765 | Ga0496101_0184157 | 3300048904 | Bacteria | 1609 |
| 766 | Ga0496101_0641512 | 3300048904 | Bacteria | 839 |
| 767 | Ga0496102_0000518 | 3300048905 | Bacteria | 42014 |
| 768 | Ga0496102_0018395 | 3300048905 | Bacteria | 6140 |
| 769 | Ga0496102_0040527 | 3300048905 | Bacteria | 4213 |
| 770 | Ga0496102_0051795 | 3300048905 | Bacteria | 3739 |
| 771 | Ga0496102_0088496 | 3300048905 | Bacteria | 2863 |
| 772 | Ga0496102_0143112 | 3300048905 | Bacteria | 2243 |
| 773 | Ga0496102_0211252 | 3300048905 | Bacteria | 1829 |
| 774 | Ga0496103_0032295 | 3300048906 | Bacteria | 3194 |
| 775 | Ga0496104_0007085 | 3300048907 | Bacteria | 9887 |
| 776 | Ga0496104_0019267 | 3300048907 | Bacteria | 6240 |
| 777 | Ga0496104_0113960 | 3300048907 | Bacteria | 2593 |
| 778 | Ga0496104_0144401 | 3300048907 | Bacteria | 2285 |
| 779 | Ga0496104_0154376 | 3300048907 | Bacteria | 2203 |
| 780 | Ga0496104_0369454 | 3300048907 | Bacteria | 1347 |
| 781 | Ga0496104_0457144 | 3300048907 | Bacteria | 1188 |
| 782 | Ga0496105_0004162 | 3300048908 | Bacteria | 10857 |
| 783 | Ga0496105_0004256 | 3300048908 | Bacteria | 10766 |
| 784 | Ga0496105_0058155 | 3300048908 | Bacteria | 3191 |
| 785 | Ga0496105_0471040 | 3300048908 | Bacteria | 989 |
| 786 | Ga0496106_0000116 | 3300048909 | Bacteria | 61237 |
| 787 | Ga0496106_0015576 | 3300048909 | Bacteria | 5623 |
| 788 | Ga0496106_0034762 | 3300048909 | Bacteria | 3766 |
| 789 | Ga0496106_0052613 | 3300048909 | Bacteria | 3073 |
| 790 | Ga0496106_0059004 | 3300048909 | Bacteria | 2906 |
| 791 | Ga0496106_0159417 | 3300048909 | Bacteria | 1784 |
| 792 | Ga0496106_0345858 | 3300048909 | Bacteria | 1194 |
| 793 | Ga0496106_0381075 | 3300048909 | Bacteria | 1133 |
| 794 | Ga0496107_0001003 | 3300048910 | Bacteria | 16852 |
| 795 | Ga0496107_0042167 | 3300048910 | Bacteria | 3277 |
| 796 | Ga0496107_0127221 | 3300048910 | Bacteria | 1880 |
| 797 | Ga0496107_0200124 | 3300048910 | Bacteria | 1485 |
| 798 | Ga0496107_0427037 | 3300048910 | Bacteria | 985 |
| 799 | Ga0496108_0000523 | 3300048911 | Bacteria | 30064 |
| 800 | Ga0496108_0005230 | 3300048911 | Bacteria | 10477 |
| 801 | Ga0496108_0315518 | 3300048911 | Bacteria | 1362 |
| 802 | Ga0496108_0375076 | 3300048911 | Bacteria | 1242 |
| 803 | Ga0496109_0001407 | 3300048912 | Bacteria | 19953 |
| 804 | Ga0496109_0005646 | 3300048912 | Bacteria | 10464 |
| 805 | Ga0496109_0014037 | 3300048912 | Bacteria | 6963 |
| 806 | Ga0496109_0040291 | 3300048912 | Bacteria | 4231 |
| 807 | Ga0496109_0060989 | 3300048912 | Bacteria | 3447 |
| 808 | Ga0496110_0096837 | 3300048913 | Bacteria | 2644 |
| 809 | Ga0496110_0131033 | 3300048913 | Bacteria | 2264 |
| 810 | Ga0496110_0159171 | 3300048913 | Bacteria | 2046 |
| 811 | Ga0496110_0236942 | 3300048913 | Bacteria | 1660 |
| 812 | Ga0496111_0059018 | 3300048914 | Bacteria | 2779 |
| 813 | Ga0496111_0092499 | 3300048914 | Bacteria | 2217 |
| 814 | Ga0496111_0192727 | 3300048914 | Bacteria | 1515 |
| 815 | Ga0496112_0005822 | 3300048915 | Bacteria | 10731 |
| 816 | Ga0496112_0089521 | 3300048915 | Bacteria | 3046 |
| 817 | Ga0496112_0098378 | 3300048915 | Bacteria | 2895 |
| 818 | Ga0496112_0259580 | 3300048915 | Bacteria | 1687 |
| 819 | Ga0496112_0266573 | 3300048915 | Bacteria | 1661 |
| 820 | Ga0496112_0278435 | 3300048915 | Bacteria | 1620 |
| 821 | Ga0496112_0292241 | 3300048915 | Bacteria | 1575 |
| 822 | Ga0496112_0480936 | 3300048915 | Bacteria | 1178 |
| 823 | Ga0496113_0007261 | 3300048916 | Bacteria | 7107 |
| 824 | Ga0496113_0040246 | 3300048916 | Bacteria | 3443 |
| 825 | Ga0496113_0076535 | 3300048916 | Bacteria | 2556 |
| 826 | Ga0496113_0155383 | 3300048916 | Bacteria | 1806 |
| 827 | Ga0496114_0023481 | 3300048917 | Bacteria | 5033 |
| 828 | Ga0496114_0105206 | 3300048917 | Bacteria | 2414 |
| 829 | Ga0496114_0759064 | 3300048917 | Bacteria | 847 |
| 830 | Ga0496115_0001962 | 3300048918 | Bacteria | 14682 |
| 831 | Ga0496115_0007907 | 3300048918 | Bacteria | 7845 |
| 832 | Ga0496115_0029187 | 3300048918 | Bacteria | 4330 |
| 833 | Ga0496115_0133812 | 3300048918 | Bacteria | 2044 |
| 834 | Ga0496115_0174257 | 3300048918 | Bacteria | 1779 |
| 835 | Ga0496115_0321695 | 3300048918 | Bacteria | 1265 |
| 836 | Ga0496116_0003309 | 3300048919 | Bacteria | 16026 |
| 837 | Ga0496116_0219738 | 3300048919 | Bacteria | 975 |
| 838 | Ga0496117_0039261 | 3300048920 | Bacteria | 3496 |
| 839 | Ga0496117_0048231 | 3300048920 | Bacteria | 3045 |
| 840 | Ga0496117_0092934 | 3300048920 | Bacteria | 1936 |
| 841 | Ga0496117_0113604 | 3300048920 | Bacteria | 1681 |
| 842 | Ga0496118_0057858 | 3300048921 | Bacteria | 2902 |
| 843 | Ga0496118_0061411 | 3300048921 | Bacteria | 2783 |
| 844 | Ga0496118_0062861 | 3300048921 | Bacteria | 2736 |
| 845 | Ga0496118_0065275 | 3300048921 | Bacteria | 2664 |
| 846 | Ga0496118_0084467 | 3300048921 | Bacteria | 2215 |
| 847 | Ga0496118_0145442 | 3300048921 | Bacteria | 1494 |
| 848 | Ga0496119_0149452 | 3300048922 | Bacteria | 1253 |
| 849 | Ga0496119_0194687 | 3300048922 | Bacteria | 1054 |
| 850 | Ga0496120_0151801 | 3300048923 | Bacteria | 1163 |
| 851 | Ga0496121_0007140 | 3300048924 | Bacteria | 13552 |
| 852 | Ga0496121_0012978 | 3300048924 | Bacteria | 9004 |
| 853 | Ga0496121_0046097 | 3300048924 | Bacteria | 3735 |
| 854 | Ga0496121_0052638 | 3300048924 | Bacteria | 3416 |
| 855 | Ga0496121_0059500 | 3300048924 | Bacteria | 3149 |
| 856 | Ga0496121_0069804 | 3300048924 | Bacteria | 2833 |
| 857 | Ga0496121_0101392 | 3300048924 | Bacteria | 2220 |
| 858 | Ga0496121_0110728 | 3300048924 | Bacteria | 2095 |
| 859 | Ga0496121_0163465 | 3300048924 | Bacteria | 1625 |
| 860 | Ga0496121_0233548 | 3300048924 | Bacteria | 1286 |
| 861 | Ga0496122_0006885 | 3300048925 | Bacteria | 12857 |
| 862 | Ga0496122_0028275 | 3300048925 | Bacteria | 4764 |
| 863 | Ga0496122_0187982 | 3300048925 | Bacteria | 1223 |
| 864 | Ga0496123_0008430 | 3300048926 | Bacteria | 9472 |
| 865 | Ga0496124_0027923 | 3300048927 | Bacteria | 5054 |
| 866 | Ga0496124_0200939 | 3300048927 | Bacteria | 1516 |
| 867 | Ga0496124_0219331 | 3300048927 | Bacteria | 1432 |
| 868 | Ga0496124_0226570 | 3300048927 | Bacteria | 1401 |
| 869 | Ga0496124_0233211 | 3300048927 | Bacteria | 1374 |
| 870 | Ga0496125_0000063 | 3300048928 | Bacteria | 250260 |
| 871 | Ga0496125_0001163 | 3300048928 | Bacteria | 39846 |
| 872 | Ga0496125_0009338 | 3300048928 | Bacteria | 10107 |
| 873 | Ga0496125_0039283 | 3300048928 | Bacteria | 4078 |
| 874 | Ga0496125_0044237 | 3300048928 | Bacteria | 3768 |
| 875 | Ga0496125_0044370 | 3300048928 | Bacteria | 3761 |
| 876 | Ga0496125_0082097 | 3300048928 | Bacteria | 2459 |
| 877 | Ga0496125_0098417 | 3300048928 | Bacteria | 2164 |
| 878 | Ga0496125_0139997 | 3300048928 | Bacteria | 1684 |
| 879 | Ga0496126_0005437 | 3300048929 | Bacteria | 14524 |
| 880 | Ga0496126_0010695 | 3300048929 | Bacteria | 9587 |
| 881 | Ga0496126_0040655 | 3300048929 | Bacteria | 4310 |
| 882 | Ga0496126_0063768 | 3300048929 | Bacteria | 3302 |
| 883 | Ga0496126_0085671 | 3300048929 | Bacteria | 2777 |
| 884 | Ga0496126_0088140 | 3300048929 | Bacteria | 2734 |
| 885 | Ga0496126_0146154 | 3300048929 | Bacteria | 2030 |
| 886 | Ga0496126_0175455 | 3300048929 | Bacteria | 1823 |
| 887 | Ga0496126_0199497 | 3300048929 | Bacteria | 1690 |
| 888 | Ga0496126_0229115 | 3300048929 | Bacteria | 1557 |
| 889 | Ga0496126_0233140 | 3300048929 | Bacteria | 1541 |
| 890 | Ga0496126_0315486 | 3300048929 | Bacteria | 1286 |
| 891 | Ga0495682_0032256 | 3300049460 | Bacteria | 1935 |
| 892 | Ga0495682_0098803 | 3300049460 | Bacteria | 1047 |
| 893 | Ga0501031_0462377 | 3300049568 | Bacteria | 819 |
| 894 | Ga0501037_0325957 | 3300049573 | Bacteria | 1063 |
| 895 | Ga0501041_0056887 | 3300049577 | Bacteria | 2391 |
| 896 | Ga0501042_0237073 | 3300049578 | Bacteria | 1316 |
| 897 | Ga0501046_0159998 | 3300049580 | Bacteria | 1694 |
| 898 | Ga0501047_0166415 | 3300049581 | Bacteria | 2075 |
| 899 | Ga0501048_0515841 | 3300049582 | Bacteria | 857 |
| 900 | Ga0501070_0101299 | 3300049586 | Bacteria | 2382 |
| 901 | Ga0501073_0208108 | 3300049589 | Bacteria | 1352 |
| 902 | Ga0501074_0054035 | 3300049590 | Bacteria | 2897 |
| 903 | Ga0501080_0175445 | 3300049742 | Bacteria | 1975 |
| 904 | Ga0501044_0060418 | 3300049823 | Bacteria | 3881 |
| 905 | nmdc:mga03683_22924_c1 | 3300050489 | Bacteria | 2425 |
| 906 | nmdc:mga03683_34046_c1 | 3300050489 | Bacteria | 2060 |
| 907 | nmdc:mga03n38_10056_c1 | 3300050490 | Bacteria | 3465 |
| 908 | nmdc:mga03n38_6302_c1 | 3300050490 | Bacteria | 4111 |
| 909 | nmdc:mga03n38_64269_c1 | 3300050490 | Bacteria | 1679 |
| 910 | nmdc:mga00v17_55445_c1 | 3300050491 | Bacteria | 2421 |
| 911 | nmdc:mga00v17_57508_c1 | 3300050491 | Bacteria | 2379 |
| 912 | nmdc:mga0yw44_11492_c1 | 3300050492 | Bacteria | 4575 |
| 913 | nmdc:mga0yw44_158641_c1 | 3300050492 | Bacteria | 1480 |
| 914 | nmdc:mga0yw44_16842_c1 | 3300050492 | Bacteria | 3959 |
| 915 | nmdc:mga0yw44_41020_c1 | 3300050492 | Bacteria | 2753 |
| 916 | nmdc:mga0yw44_53041_c1 | 3300050492 | Bacteria | 2461 |
| 917 | nmdc:mga0yw44_60081_c1 | 3300050492 | Bacteria | 2328 |
| 918 | nmdc:mga0k408_184721_c1 | 3300050493 | Bacteria | 1243 |
| 919 | nmdc:mga06z11_166914_c1 | 3300050494 | Bacteria | 1262 |
| 920 | nmdc:mga06z11_192205_c1 | 3300050494 | Bacteria | 1182 |
| 921 | nmdc:mga06z11_229613_c1 | 3300050494 | Bacteria | 1087 |
| 922 | nmdc:mga06z11_235824_c1 | 3300050494 | Bacteria | 1073 |
| 923 | nmdc:mga06z11_244461_c1 | 3300050494 | Bacteria | 1055 |
| 924 | nmdc:mga06z11_31830_c1 | 3300050494 | Bacteria | 2567 |
| 925 | nmdc:mga06z11_75663_c1 | 3300050494 | Bacteria | 1471 |
| 926 | nmdc:mga06z11_76619_c1 | 3300050494 | Bacteria | 1784 |
| 927 | nmdc:mga07m45_138730_c1 | 3300050496 | Bacteria | 1408 |
| 928 | nmdc:mga07m45_148882_c1 | 3300050496 | Bacteria | 1357 |
| 929 | nmdc:mga07m45_15298_c1 | 3300050496 | Bacteria | 4096 |
| 930 | nmdc:mga07m45_38376_c1 | 3300050496 | Bacteria | 2673 |
| 931 | nmdc:mga05p37_73611_c1 | 3300050507 | Bacteria | 4204 |
| 932 | nmdc:mga08y16_323386_c1 | 3300050511 | Bacteria | 1587 |
| 933 | nmdc:mga0rr50_254246_c1 | 3300050513 | Bacteria | 1460 |
| 934 | nmdc:mga0a205_509902_c1 | 3300050515 | Bacteria | 1059 |
| 935 | nmdc:mga0sz30_43856_c1 | 3300050516 | Bacteria | 1883 |
| 936 | nmdc:mga0sz30_94400_c1 | 3300050516 | Bacteria | 1304 |
| 937 | Ga0495601_0116769 | 3300053077 | Bacteria | 1731 |
| 938 | Ga0495601_0146288 | 3300053077 | Bacteria | 1542 |
| 939 | Ga0495601_0344906 | 3300053077 | Bacteria | 969 |
| 940 | Ga0495601_0349670 | 3300053077 | Bacteria | 961 |
| 941 | Ga0495612_0057110 | 3300053078 | Bacteria | 1611 |
| 942 | Ga0495655_0007442 | 3300053083 | Bacteria | 2037 |
| 943 | Ga0495655_0055616 | 3300053083 | Bacteria | 1063 |
| 944 | Ga0495595_0051140 | 3300053084 | Bacteria | 1914 |
| 945 | Ga0495619_0024640 | 3300053085 | Bacteria | 3860 |
| 946 | Ga0495619_0146567 | 3300053085 | Bacteria | 1628 |
| 947 | Ga0495619_0235827 | 3300053085 | Bacteria | 1268 |
| 948 | Ga0500643_000019 | 3300053087 | Bacteria | 294301 |
| 949 | Ga0500646_0032516 | 3300053090 | Bacteria | 1440 |
| 950 | Ga0500647_0030004 | 3300053091 | Bacteria | 2581 |
| 951 | Ga0500647_0208506 | 3300053091 | Bacteria | 882 |
| 952 | Ga0500651_0009449 | 3300053093 | Bacteria | 5796 |
| 953 | Ga0500566_0000064 | 3300053094 | Bacteria | 50908 |
| 954 | Ga0500566_0020051 | 3300053094 | Bacteria | 3925 |
| 955 | Ga0500566_0073570 | 3300053094 | Bacteria | 1915 |
| 956 | Ga0500566_0092758 | 3300053094 | Bacteria | 1667 |
| 957 | Ga0500640_004979 | 3300053095 | Bacteria | 4892 |
| 958 | Ga0500640_028015 | 3300053095 | Bacteria | 2459 |
| 959 | Ga0500641_0016215 | 3300053096 | Bacteria | 2772 |
| 960 | Ga0500641_0038291 | 3300053096 | Bacteria | 1926 |
| 961 | Ga0500650_0000414 | 3300053098 | Bacteria | 10570 |
| 962 | Ga0500554_006673 | 3300053102 | Bacteria | 2606 |
| 963 | Ga0500554_015475 | 3300053102 | Bacteria | 1994 |
| 964 | Ga0500555_001693 | 3300053103 | Bacteria | 6635 |
| 965 | Ga0500556_0000024 | 3300053104 | Bacteria | 167556 |
| 966 | Ga0500557_000039 | 3300053105 | Bacteria | 66862 |
| 967 | Ga0500562_013356 | 3300053108 | Bacteria | 2096 |
| 968 | Ga0500562_019094 | 3300053108 | Bacteria | 1771 |
| 969 | Ga0500569_006619 | 3300053109 | Bacteria | 2552 |
| 970 | Ga0500572_000026 | 3300053111 | Bacteria | 45518 |
| 971 | Ga0500572_000344 | 3300053111 | Bacteria | 16637 |
| 972 | Ga0500592_002695 | 3300053116 | Bacteria | 2857 |
| 973 | Ga0500594_0026277 | 3300053118 | Bacteria | 1499 |
| 974 | Ga0500595_002251 | 3300053119 | Bacteria | 9777 |
| 975 | Ga0500595_002953 | 3300053119 | Bacteria | 8096 |
| 976 | Ga0500595_013331 | 3300053119 | Bacteria | 3151 |
| 977 | Ga0500595_019259 | 3300053119 | Bacteria | 2480 |
| 978 | Ga0500607_079888 | 3300053121 | Bacteria | 1669 |
| 979 | Ga0500614_001497 | 3300053123 | Bacteria | 5564 |
| 980 | Ga0500618_005822 | 3300053125 | Bacteria | 3701 |
| 981 | Ga0500642_0000273 | 3300053130 | Bacteria | 19371 |
| 982 | Ga0500642_0001501 | 3300053130 | Bacteria | 6725 |
| 983 | Ga0500642_0022680 | 3300053130 | Bacteria | 2510 |
| 984 | Ga0500652_001229 | 3300053131 | Bacteria | 8140 |
| 985 | Ga0500658_0027983 | 3300053134 | Bacteria | 2184 |
| 986 | Ga0500658_0193358 | 3300053134 | Bacteria | 929 |
| 987 | Ga0500559_0000652 | 3300053136 | Bacteria | 23359 |
| 988 | Ga0500559_0001707 | 3300053136 | Bacteria | 12065 |
| 989 | Ga0500559_0003076 | 3300053136 | Bacteria | 8326 |
| 990 | Ga0500559_0007580 | 3300053136 | Bacteria | 4796 |
| 991 | Ga0500568_0011538 | 3300053139 | Bacteria | 4091 |
| 992 | Ga0500577_0033268 | 3300053142 | Bacteria | 1821 |
| 993 | Ga0500586_000905 | 3300053145 | Bacteria | 6095 |
| 994 | Ga0500603_001132 | 3300053150 | Bacteria | 6234 |
| 995 | Ga0500603_015252 | 3300053150 | Bacteria | 1807 |
| 996 | Ga0500604_0013466 | 3300053151 | Bacteria | 2216 |
| 997 | Ga0500616_0013535 | 3300053153 | Bacteria | 4731 |
| 998 | Ga0500619_004900 | 3300053154 | Bacteria | 2927 |
| 999 | Ga0500620_022019 | 3300053155 | Bacteria | 1913 |
| 1000 | Ga0500622_0001676 | 3300053156 | Bacteria | 17264 |
| 1001 | Ga0500630_000572 | 3300053159 | Bacteria | 16714 |
| 1002 | Ga0500634_0025477 | 3300053161 | Bacteria | 3220 |
| 1003 | Ga0500638_002262 | 3300053162 | Bacteria | 6596 |
| 1004 | Ga0500638_025631 | 3300053162 | Bacteria | 2820 |
| 1005 | Ga0500638_149893 | 3300053162 | Bacteria | 1038 |
| 1006 | Ga0500638_165198 | 3300053162 | Bacteria | 970 |
| 1007 | Ga0500639_000353 | 3300053163 | Bacteria | 22721 |
| 1008 | Ga0500639_046810 | 3300053163 | Bacteria | 2260 |
| 1009 | Ga0500639_092474 | 3300053163 | Bacteria | 1503 |
| 1010 | Ga0500639_191023 | 3300053163 | Bacteria | 892 |
| 1011 | Ga0500636_0000194 | 3300053177 | Bacteria | 32748 |
| 1012 | Ga0500636_0098888 | 3300053177 | Bacteria | 1661 |
| 1013 | Ga0500636_0169760 | 3300053177 | Bacteria | 1181 |
| 1014 | Ga0500637_0000356 | 3300053178 | Bacteria | 17344 |
| 1015 | Ga0500637_0027232 | 3300053178 | Bacteria | 3154 |
| 1016 | Ga0500637_0031722 | 3300053178 | Bacteria | 2944 |
| 1017 | Ga0500637_0059689 | 3300053178 | Bacteria | 2184 |
| 1018 | Ga0500625_012209 | 3300053729 | Bacteria | 3923 |
| 1019 | Ga0500596_004938 | 3300053735 | Bacteria | 2397 |
| 1020 | Ga0500599_000542 | 3300053736 | Bacteria | 3970 |
| 1021 | Ga0500601_000750 | 3300053737 | Bacteria | 4196 |
| 1022 | Ga0500601_002435 | 3300053737 | Bacteria | 1999 |
| 1023 | Ga0500661_010359 | 3300055283 | Bacteria | 1699 |
| 1024 | Ga0466962_0183347 | 3300061719 | Bacteria | 1021 |
| 1025 | 2509153765 | 2508501128 | Bacteria | 8613869 |
| 1026 | 2513696981 | 2513237101 | Bacteria | 7952346 |
| 1027 | 2513892027 | 2513237141 | Bacteria | 8496279 |
| 1028 | 2603861027 | 2602042107 | Bacteria | 6226103 |
| 1029 | 2723846424 | 2721755755 | Bacteria | 8322773 |
| 1030 | 2793076917 | |||
| 1031 | 2857528848 | 2857524615 | Bacteria | 6615449 |
| 1032 | 2874610608 | 2874604998 | Bacteria | 7834745 |
| 1033 | 2876816244 | 2876808645 | Bacteria | 8824342 |
| 1034 | 2879118670 | 2879110137 | Bacteria | 8907982 |
| 1035 | 2889039063 | 2889033259 | Bacteria | 9099371 |
| 1036 | 2893069046 | 2893066018 | Bacteria | 6158120 |
| 1037 | 2903750456 | 2903748898 | Bacteria | 9972761 |
| 1038 | 2919079270 | 2919073203 | Bacteria | 6531949 |
| 1039 | 2922362235 | 2922361189 | Bacteria | 7436256 |
| 1040 | 2922388010 | 2922386360 | Bacteria | 7017218 |
| 1041 | 8006964810 | 8006964411 | Bacteria | 8966052 |
| 1042 | 8006991793 | 8006984368 | Bacteria | 9651211 |
| 1043 | 8006995546 | 8006994254 | Bacteria | 8309700 |
| 1044 | 8016590789 | 8016583857 | Bacteria | 10421953 |
| 1045 | Ga0500559_0115769 | |||
| 1046 | JGI24745J21846_1004743 | |||
| 1047 | JGI25406J46586_10019112 | |||
| 1048 | JGI25153J46596_10000366 | |||
| 1049 | JGI25153J46596_10003459 | |||
| 1050 | JGI25153J46596_10004454 | |||
| 1051 | JGI25160J50197_1000729 | |||
| 1052 | JGI25160J50197_1005746 | |||
| 1053 | JGI25404J52841_10001176 | |||
| 1054 | JGI25404J52841_10005591 | |||
| 1055 | JGI25404J52841_10011264 | |||
| 1056 | JGI25404J52841_10020849 | |||
| 1057 | JGI25404J52841_10035503 | |||
| 1058 | Ga0055542_1012548 | |||
| 1059 | Ga0055543_1008363 | |||
| 1060 | Ga0065165_1000278 | |||
| 1061 | Ga0065165_1011041 | |||
| 1062 | Ga0065165_1013968 | |||
| 1063 | Ga0065715_10183263 | |||
| 1064 | Ga0070658_10075965 | |||
| 1065 | Ga0070676_10071609 | |||
| 1066 | Ga0070683_100163357 | |||
| 1067 | Ga0070690_100092911 | |||
| 1068 | Ga0070670_100281259 | |||
| 1069 | Ga0068869_100047994 | |||
| 1070 | Ga0068869_100055295 | |||
| 1071 | Ga0068869_100104819 | |||
| 1072 | Ga0070666_10388134 | |||
| 1073 | Ga0070680_100010206 | |||
| 1074 | Ga0070682_100183420 | |||
| 1075 | Ga0070682_100212131 | |||
| 1076 | Ga0068868_100015888 | |||
| 1077 | Ga0068868_100045227 | |||
| 1078 | Ga0070660_100024156 | |||
| 1079 | Ga0070660_100185563 | |||
| 1080 | Ga0070689_100123418 | |||
| 1081 | Ga0070691_10129254 | |||
| 1082 | Ga0070661_100079872 | |||
| 1083 | Ga0070661_100252637 | |||
| 1084 | Ga0070668_100012569 | |||
| 1085 | Ga0070668_100044471 | |||
| 1086 | Ga0070668_100176725 | |||
| 1087 | Ga0070668_100364711 | |||
| 1088 | Ga0070669_100019904 | |||
| 1089 | Ga0070669_100402251 | |||
| 1090 | Ga0070671_100083173 | |||
| 1091 | Ga0070674_100067707 | |||
| 1092 | Ga0070673_100125690 | |||
| 1093 | Ga0070688_100141898 | |||
| 1094 | Ga0070688_100286883 | |||
| 1095 | Ga0070667_100086637 | |||
| 1096 | Ga0070667_100183279 | |||
| 1097 | Ga0070709_10000321 | |||
| 1098 | Ga0070709_10031836 | |||
| 1099 | Ga0070709_10040970 | |||
| 1100 | Ga0070714_100186448 | |||
| 1101 | Ga0070714_100189894 | |||
| 1102 | Ga0070713_100034852 | |||
| 1103 | Ga0070713_100072247 | |||
| 1104 | Ga0070710_10000643 | |||
| 1105 | Ga0070710_10017631 | |||
| 1106 | Ga0070710_10120491 | |||
| 1107 | Ga0070711_100023304 | |||
| 1108 | Ga0070711_100067274 | |||
| 1109 | Ga0070700_100075552 | |||
| 1110 | Ga0070694_100175875 | |||
| 1111 | Ga0070663_100021332 | |||
| 1112 | Ga0070663_100051045 | |||
| 1113 | Ga0070663_100051598 | |||
| 1114 | Ga0070663_100173815 | |||
| 1115 | Ga0070663_100270029 | |||
| 1116 | Ga0070663_100373540 | |||
| 1117 | Ga0070678_100019116 | |||
| 1118 | Ga0070678_100068453 | |||
| 1119 | Ga0070678_100075032 | |||
| 1120 | Ga0070678_100102928 | |||
| 1121 | Ga0070662_100115690 | |||
| 1122 | Ga0070662_100117741 | |||
| 1123 | Ga0070662_100121975 | |||
| 1124 | Ga0070662_100173828 | |||
| 1125 | Ga0070681_10061815 | |||
| 1126 | Ga0070681_10111762 | |||
| 1127 | Ga0070681_10174929 | |||
| 1128 | Ga0070681_10265397 | |||
| 1129 | Ga0068867_100108604 | |||
| 1130 | Ga0068867_100110645 | |||
| 1131 | Ga0068867_100463638 | |||
| 1132 | Ga0070685_10160931 | |||
| 1133 | Ga0070698_100232538 | |||
| 1134 | Ga0070679_100018864 | |||
| 1135 | Ga0070679_100042441 | |||
| 1136 | Ga0070679_100321402 | |||
| 1137 | Ga0070679_100326100 | |||
| 1138 | Ga0070684_100015968 | |||
| 1139 | Ga0070684_100017476 | |||
| 1140 | Ga0070684_100095065 | |||
| 1141 | Ga0070697_100013902 | |||
| 1142 | Ga0068853_100011732 | |||
| 1143 | Ga0068853_100136803 | |||
| 1144 | Ga0068853_100151890 | |||
| 1145 | Ga0070686_100202531 | |||
| 1146 | Ga0070686_100266519 | |||
| 1147 | Ga0070693_100017871 | |||
| 1148 | Ga0070665_100008531 | |||
| 1149 | Ga0070665_100024503 | |||
| 1150 | Ga0070665_100094785 | |||
| 1151 | Ga0070665_100106328 | |||
| 1152 | Ga0070665_100215170 | |||
| 1153 | Ga0070665_100259378 | |||
| 1154 | Ga0070665_100474580 | |||
| 1155 | Ga0070665_100693089 | |||
| 1156 | Ga0068855_100060159 | |||
| 1157 | Ga0068855_100071075 | |||
| 1158 | Ga0068855_100123883 | |||
| 1159 | Ga0068855_100185338 | |||
| 1160 | Ga0070664_100033202 | |||
| 1161 | Ga0070664_100480797 | |||
| 1162 | Ga0068857_100044204 | |||
| 1163 | Ga0068857_100265276 | |||
| 1164 | Ga0068854_100092238 | |||
| 1165 | Ga0068856_100594570 | |||
| 1166 | Ga0070702_100338152 | |||
| 1167 | Ga0068852_100049132 | |||
| 1168 | Ga0068852_100059330 | |||
| 1169 | Ga0068852_100270940 | |||
| 1170 | Ga0068859_100075880 | |||
| 1171 | Ga0068859_100383615 | |||
| 1172 | Ga0068864_100100435 | |||
| 1173 | Ga0068864_100356219 | |||
| 1174 | Ga0068866_10019214 | |||
| 1175 | Ga0068866_10026450 | |||
| 1176 | Ga0068866_10075346 | |||
| 1177 | Ga0068861_100044893 | |||
| 1178 | Ga0068861_100071020 | |||
| 1179 | Ga0068861_100448540 | |||
| 1180 | Ga0068851_10042077 | |||
| 1181 | Ga0068863_100361737 | |||
| 1182 | Ga0068858_100130635 | |||
| 1183 | Ga0068858_100504165 | |||
| 1184 | Ga0068860_100028576 | |||
| 1185 | Ga0068860_100113935 | |||
| 1186 | Ga0068860_100272704 | |||
| 1187 | Ga0068860_100451934 | |||
| 1188 | Ga0068862_100044232 | |||
| 1189 | Ga0068862_100111239 | |||
| 1190 | Ga0068862_100153409 | |||
| 1191 | Ga0068862_100154996 | |||
| 1192 | Ga0068862_100294050 | |||
| 1193 | Ga0068862_100564389 | |||
| 1194 | Ga0081455_10002423 | |||
| 1195 | Ga0081455_10014321 | |||
| 1196 | Ga0081455_10027456 | |||
| 1197 | Ga0081455_10141150 | |||
| 1198 | Ga0081538_10043188 | |||
| 1199 | Ga0081540_1002773 | |||
| 1200 | Ga0081540_1003578 | |||
| 1201 | Ga0081540_1006176 | |||
| 1202 | Ga0081540_1011101 | |||
| 1203 | Ga0081540_1018496 | |||
| 1204 | Ga0081540_1019810 | |||
| 1205 | Ga0081540_1023306 | |||
| 1206 | Ga0081540_1030875 | |||
| 1207 | Ga0081540_1037049 | |||
| 1208 | Ga0081540_1050246 | |||
| 1209 | Ga0081540_1118772 | |||
| 1210 | Ga0081539_10000747 | |||
| 1211 | Ga0081539_10071601 | |||
| 1212 | Ga0070717_10080272 | |||
| 1213 | Ga0070717_10266497 | |||
| 1214 | Ga0075365_10027907 | |||
| 1215 | Ga0075365_10048361 | |||
| 1216 | Ga0075365_10055734 | |||
| 1217 | Ga0075365_10058056 | |||
| 1218 | Ga0075365_10073033 | |||
| 1219 | Ga0075368_10005485 | |||
| 1220 | Ga0075368_10037556 | |||
| 1221 | Ga0075368_10087362 | |||
| 1222 | Ga0075363_100015314 | |||
| 1223 | Ga0075364_10008417 | |||
| 1224 | Ga0075364_10027628 | |||
| 1225 | Ga0075364_10033448 | |||
| 1226 | Ga0075364_10074324 | |||
| 1227 | Ga0070716_100003039 | |||
| 1228 | Ga0070716_100063710 | |||
| 1229 | Ga0070716_100092284 | |||
| 1230 | Ga0070712_100001170 | |||
| 1231 | Ga0070712_100044408 | |||
| 1232 | Ga0070712_100050251 | |||
| 1233 | Ga0070712_100058594 | |||
| 1234 | Ga0075362_10033896 | |||
| 1235 | Ga0075362_10102798 | |||
| 1236 | Ga0075367_10030820 | |||
| 1237 | Ga0075367_10093254 | |||
| 1238 | Ga0075367_10228330 | |||
| 1239 | Ga0075369_10086957 | |||
| 1240 | Ga0075369_10147230 | |||
| 1241 | Ga0075366_10029871 | |||
| 1242 | Ga0075366_10031820 | |||
| 1243 | Ga0075366_10077094 | |||
| 1244 | Ga0097621_100058724 | |||
| 1245 | Ga0097621_100495607 | |||
| 1246 | Ga0075370_10015749 | |||
| 1247 | Ga0075370_10041235 | |||
| 1248 | Ga0075370_10084193 | |||
| 1249 | Ga0075370_10191964 | |||
| 1250 | Ga0075370_10208920 | |||
| 1251 | Ga0068871_100034617 | |||
| 1252 | Ga0068871_100087688 | |||
| 1253 | Ga0068871_100525786 | |||
| 1254 | Ga0075428_100077239 | |||
| 1255 | Ga0075434_100286281 | |||
| 1256 | Ga0075434_100377517 | |||
| 1257 | Ga0068865_100045334 | |||
| 1258 | Ga0097620_100075881 | |||
| 1259 | Ga0097620_100383566 | |||
| 1260 | Ga0099822_1011696 | |||
| 1261 | Ga0099795_10158387 | |||
| 1262 | Ga0105240_10015488 | |||
| 1263 | Ga0105240_10027333 | |||
| 1264 | Ga0105240_10365826 | |||
| 1265 | Ga0105240_10486506 | |||
| 1266 | Ga0111539_10153919 | |||
| 1267 | Ga0105245_10038988 | |||
| 1268 | Ga0105245_10194108 | |||
| 1269 | Ga0105245_10458883 | |||
| 1270 | Ga0105247_10037260 | |||
| 1271 | Ga0114129_10189934 | |||
| 1272 | Ga0105243_10016903 | |||
| 1273 | Ga0105243_10213855 | |||
| 1274 | Ga0105241_10065293 | |||
| 1275 | Ga0105242_10044906 | |||
| 1276 | Ga0105242_10115794 | |||
| 1277 | Ga0105242_10295013 | |||
| 1278 | Ga0105242_10419850 | |||
| 1279 | Ga0105237_10052107 | |||
| 1280 | Ga0105237_10075722 | |||
| 1281 | Ga0105237_10209042 | |||
| 1282 | Ga0105238_10059171 | |||
| 1283 | Ga0105238_10340890 | |||
| 1284 | Ga0105249_10048330 | |||
| 1285 | Ga0105249_10369068 | |||
| 1286 | Ga0105239_10003918 | |||
| 1287 | Ga0105239_10032269 | |||
| 1288 | Ga0105239_10099980 | |||
| 1289 | Ga0105239_10105757 | |||
| 1290 | Ga0105239_10112481 | |||
| 1291 | Ga0105239_10143450 | |||
| 1292 | Ga0105239_10157493 | |||
| 1293 | Ga0105246_10022596 | |||
| 1294 | Ga0105246_10057218 | |||
| 1295 | Ga0105246_10091339 | |||
| 1296 | Ga0157371_10422817 | |||
| 1297 | Ga0157370_10050985 | |||
| 1298 | Ga0157369_10011431 | |||
| 1299 | Ga0157369_10020578 | |||
| 1300 | Ga0157369_10052559 | |||
| 1301 | Ga0157369_10210940 | |||
| 1302 | Ga0157374_10192800 | |||
| 1303 | Ga0163162_10065624 | |||
| 1304 | Ga0163162_10108248 | |||
| 1305 | Ga0157372_10103537 | |||
| 1306 | Ga0157372_10105267 | |||
| 1307 | Ga0157375_10015934 | |||
| 1308 | Ga0157375_10047153 | |||
| 1309 | Ga0157375_10231730 | |||
| 1310 | Ga0157375_10253106 | |||
| 1311 | Ga0163163_10017116 | |||
| 1312 | Ga0163163_10118731 | |||
| 1313 | Ga0163163_10298116 | |||
| 1314 | Ga0157377_10118989 | |||
| 1315 | Ga0157377_10175732 | |||
| 1316 | Ga0157379_10023569 | |||
| 1317 | Ga0157376_10120561 | |||
| 1318 | Ga0157376_10287582 | |||
| 1319 | Ga0157376_10615556 | |||
| 1320 | Ga0163161_10056327 | |||
| 1321 | Ga0163161_10123971 | |||
| 1322 | Ga0163161_10127337 | |||
| 1323 | Ga0206354_11003357 | |||
| 1324 | Ga0214544_1000020 | |||
| 1325 | Ga0214542_1000024 | |||
| 1326 | Ga0214545_1000011 | |||
| 1327 | Ga0214545_1030682 | |||
| 1328 | Ga0214543_1000033 | |||
| 1329 | Ga0214543_1030560 | |||
| 1330 | Ga0213873_10017072 | |||
| 1331 | Ga0213872_10020912 | |||
| 1332 | Ga0213874_10008958 | |||
| 1333 | Ga0213876_10000969 | |||
| 1334 | Ga0213876_10067836 | |||
| 1335 | Ga0213871_10001134 | |||
| 1336 | Ga0209563_101494 | |||
| 1337 | Ga0209677_102419 | |||
| 1338 | Ga0209677_106143 | |||
| 1339 | Ga0209148_1000344 | |||
| 1340 | Ga0209233_1008105 | |||
| 1341 | Ga0209455_1001281 | |||
| 1342 | Ga0209564_1002208 | |||
| 1343 | Ga0209564_1016543 | |||
| 1344 | Ga0209564_1018309 | |||
| 1345 | Ga0209758_1000407 | |||
| 1346 | Ga0209758_1000900 | |||
| 1347 | Ga0209758_1000952 | |||
| 1348 | Ga0209758_1001988 | |||
| 1349 | Ga0209758_1002062 | |||
| 1350 | Ga0209758_1011752 | |||
| 1351 | Ga0209758_1017825 | |||
| 1352 | Ga0209256_1011331 | |||
| 1353 | Ga0207426_1000466 | |||
| 1354 | Ga0207426_1000865 | |||
| 1355 | Ga0207426_1003194 | |||
| 1356 | Ga0207426_1012503 | |||
| 1357 | Ga0207426_1019417 | |||
| 1358 | Ga0209257_1001445 | |||
| 1359 | Ga0207692_10001554 | |||
| 1360 | Ga0207692_10184881 | |||
| 1361 | Ga0207692_10190424 | |||
| 1362 | Ga0207642_10021279 | |||
| 1363 | Ga0207642_10037369 | |||
| 1364 | Ga0207642_10054435 | |||
| 1365 | Ga0207710_10022007 | |||
| 1366 | Ga0207710_10098550 | |||
| 1367 | Ga0207710_10189914 | |||
| 1368 | Ga0207688_10031130 | |||
| 1369 | Ga0207688_10298393 | |||
| 1370 | Ga0207647_10037625 | |||
| 1371 | Ga0207699_10000550 | |||
| 1372 | Ga0207699_10026311 | |||
| 1373 | Ga0207645_10081511 | |||
| 1374 | Ga0207654_10031567 | |||
| 1375 | Ga0207707_10000466 | |||
| 1376 | Ga0207707_10001222 | |||
| 1377 | Ga0207707_10037513 | |||
| 1378 | Ga0207707_10096318 | |||
| 1379 | Ga0207707_10186582 | |||
| 1380 | Ga0207695_10000029 | |||
| 1381 | Ga0207695_10057285 | |||
| 1382 | Ga0207695_10318943 | |||
| 1383 | Ga0207695_10493222 | |||
| 1384 | Ga0207671_10026230 | |||
| 1385 | Ga0207671_10035977 | |||
| 1386 | Ga0207671_10091491 | |||
| 1387 | Ga0207671_10193027 | |||
| 1388 | Ga0207693_10002659 | |||
| 1389 | Ga0207693_10034621 | |||
| 1390 | Ga0207693_10047433 | |||
| 1391 | Ga0207693_10075916 | |||
| 1392 | Ga0207693_10101701 | |||
| 1393 | Ga0207663_10008869 | |||
| 1394 | Ga0207663_10303734 | |||
| 1395 | Ga0207660_10004908 | |||
| 1396 | Ga0207657_10004634 | |||
| 1397 | Ga0207657_10056992 | |||
| 1398 | Ga0207649_10361467 | |||
| 1399 | Ga0207652_10002138 | |||
| 1400 | Ga0207652_10011255 | |||
| 1401 | Ga0207652_10024322 | |||
| 1402 | Ga0207681_10088275 | |||
| 1403 | Ga0207681_10088634 | |||
| 1404 | Ga0207681_10203927 | |||
| 1405 | Ga0207694_10129317 | |||
| 1406 | Ga0207694_10160215 | |||
| 1407 | Ga0207650_10298792 | |||
| 1408 | Ga0207659_10069356 | |||
| 1409 | Ga0207687_10335989 | |||
| 1410 | Ga0207700_10013381 | |||
| 1411 | Ga0207700_10013938 | |||
| 1412 | Ga0207700_10024525 | |||
| 1413 | Ga0207700_10200662 | |||
| 1414 | Ga0207664_10024687 | |||
| 1415 | Ga0207664_10076606 | |||
| 1416 | Ga0207664_10209111 | |||
| 1417 | Ga0207664_10241565 | |||
| 1418 | Ga0207644_10032126 | |||
| 1419 | Ga0207644_10187048 | |||
| 1420 | Ga0207690_10065536 | |||
| 1421 | Ga0207690_10098731 | |||
| 1422 | Ga0207690_10114570 | |||
| 1423 | Ga0207706_10083950 | |||
| 1424 | Ga0207706_10095838 | |||
| 1425 | Ga0207706_10097118 | |||
| 1426 | Ga0207706_10173181 | |||
| 1427 | Ga0207686_10039113 | |||
| 1428 | Ga0207686_10071513 | |||
| 1429 | Ga0207686_10187205 | |||
| 1430 | Ga0207709_10112831 | |||
| 1431 | Ga0207670_10173074 | |||
| 1432 | Ga0207669_10421677 | |||
| 1433 | Ga0207704_10039581 | |||
| 1434 | Ga0207665_10007182 | |||
| 1435 | Ga0207665_10032684 | |||
| 1436 | Ga0207665_10167316 | |||
| 1437 | Ga0207691_10092265 | |||
| 1438 | Ga0207711_10108226 | |||
| 1439 | Ga0207711_10184304 | |||
| 1440 | Ga0207711_10219462 | |||
| 1441 | Ga0207689_10060253 | |||
| 1442 | Ga0207689_10064343 | |||
| 1443 | Ga0207661_10000499 | |||
| 1444 | Ga0207661_10015755 | |||
| 1445 | Ga0207667_10012774 | |||
| 1446 | Ga0207667_10180188 | |||
| 1447 | Ga0207667_10338680 | |||
| 1448 | Ga0207667_10449313 | |||
| 1449 | Ga0207667_10895369 | |||
| 1450 | Ga0207651_10080927 | |||
| 1451 | Ga0207712_10158443 | |||
| 1452 | Ga0207668_10009427 | |||
| 1453 | Ga0207668_10022935 | |||
| 1454 | Ga0207668_10026363 | |||
| 1455 | Ga0207668_10154981 | |||
| 1456 | Ga0207640_10068680 | |||
| 1457 | Ga0207640_10142365 | |||
| 1458 | Ga0207658_10072837 | |||
| 1459 | Ga0207658_10452004 | |||
| 1460 | Ga0207677_10008684 | |||
| 1461 | Ga0207677_10022654 | |||
| 1462 | Ga0207677_10088035 | |||
| 1463 | Ga0207703_10320567 | |||
| 1464 | Ga0207639_10009801 | |||
| 1465 | Ga0207639_10062834 | |||
| 1466 | Ga0207639_10105759 | |||
| 1467 | Ga0207639_10233030 | |||
| 1468 | Ga0207678_10024050 | |||
| 1469 | Ga0207678_10029342 | |||
| 1470 | Ga0207678_10040741 | |||
| 1471 | Ga0207678_10056118 | |||
| 1472 | Ga0207678_10059827 | |||
| 1473 | Ga0207678_10073505 | |||
| 1474 | Ga0207708_10062207 | |||
| 1475 | Ga0207702_10138490 | |||
| 1476 | Ga0207702_10380955 | |||
| 1477 | Ga0207641_10135681 | |||
| 1478 | Ga0207641_10146719 | |||
| 1479 | Ga0207641_10249515 | |||
| 1480 | Ga0207648_10029160 | |||
| 1481 | Ga0207648_10075028 | |||
| 1482 | Ga0207648_10485215 | |||
| 1483 | Ga0207676_10046804 | |||
| 1484 | Ga0207676_10293180 | |||
| 1485 | Ga0207674_10117026 | |||
| 1486 | Ga0207674_10118244 | |||
| 1487 | Ga0207675_100018245 | |||
| 1488 | Ga0207675_100147700 | |||
| 1489 | Ga0207675_100164894 | |||
| 1490 | Ga0207675_100372987 | |||
| 1491 | Ga0207683_10011914 | |||
| 1492 | Ga0207683_10054649 | |||
| 1493 | Ga0207683_10082425 | |||
| 1494 | Ga0207683_10132129 | |||
| 1495 | Ga0207683_10263993 | |||
| 1496 | Ga0207698_10013308 | |||
| 1497 | Ga0207698_10015126 | |||
| 1498 | Ga0207698_11055064 | |||
| 1499 | Ga0209389_1000025 | |||
| 1500 | Ga0209589_1000018 | |||
| 1501 | Ga0209589_1000066 | |||
| 1502 | Ga0209489_100026 | |||
| 1503 | Ga0209489_100030 | |||
| 1504 | Ga0209700_100035 | |||
| 1505 | Ga0209588_1010269 | |||
| 1506 | Ga0268266_10001465 | |||
| 1507 | Ga0268266_10003531 | |||
| 1508 | Ga0268266_10016020 | |||
| 1509 | Ga0268266_10088145 | |||
| 1510 | Ga0268266_10095655 | |||
| 1511 | Ga0268266_10099013 | |||
| 1512 | Ga0268266_10107456 | |||
| 1513 | Ga0268266_10115378 | |||
| 1514 | Ga0268266_10371584 | |||
| 1515 | Ga0268266_10468669 | |||
| 1516 | Ga0268266_10607966 | |||
| 1517 | Ga0268264_10000035 | |||
| 1518 | Ga0265319_1028990 | |||
| 1519 | Ga0265334_10002345 | |||
| 1520 | Ga0265318_10032922 | |||
| 1521 | Ga0265322_10070288 | |||
| 1522 | Ga0265336_10005760 | |||
| 1523 | Ga0307515_10054331 | |||
| 1524 | Ga0265338_10000065 | |||
| 1525 | Ga0265330_10073333 | |||
| 1526 | Ga0265330_10073974 | |||
| 1527 | Ga0265340_10036665 | |||
| 1528 | Ga0307513_10466462 | |||
| 1529 | Ga0307509_10029857 | |||
| 1530 | Ga0265313_10037155 | |||
| 1531 | Ga0307508_10000090 | |||
| 1532 | Ga0307508_10065785 | |||
| 1533 | Ga0265342_10059059 | |||
| 1534 | Ga0307516_10058192 | |||
| 1535 | Ga0307516_10107825 | |||
| 1536 | Ga0307405_10100094 | |||
| 1537 | Ga0307410_10439284 | |||
| 1538 | Ga0307406_10059976 | |||
| 1539 | Ga0307406_10168321 | |||
| 1540 | Ga0307406_10313123 | |||
| 1541 | Ga0307510_10004617 | |||
| 1542 | Ga0307510_10020616 | |||
| 1543 | Ga0307510_10049660 | |||
| 1544 | Ga0316215_1002836 | |||
| 1545 | Ga0373930_0004457 | |||
| 1546 | Ga0373959_0032990 | |||
| 1547 | Ga0373934_0012795 | |||
| 1548 | Ga0373951_0021428 | |||
| 1549 | Ga0373923_0008238 | |||
| 1550 | Ga0373923_0116093 | |||
| 1551 | Ga0373936_0006507 | |||
| 1552 | Ga0373936_0026971 | |||
| 1553 | Ga0373939_0054122 | |||
| 1554 | Ga0373945_0031927 | |||
| 1555 | Ga0373953_0003083 | |||
| 1556 | Ga0373953_0069216 | |||
| 1557 | Ga0373956_0000726 | |||
| 1558 | Ga0373957_0004882 | |||
| 1559 | Ga0373957_0128536 | |||
| 1560 | Ga0373943_0004812 | |||
| 1561 | Ga0373943_0139550 | |||
| 1562 | Ga0373946_0008147 | |||
| 1563 | Ga0373946_0010035 | |||
| 1564 | Ga0373946_0079458 | |||
| 1565 | Ga0373955_0003241 | |||
| 1566 | Ga0373955_0020612 | |||
| 1567 | Ga0373955_0287655 | |||
| 1568 | Ga0373924_0021158 | |||
| 1569 | Ga0373924_0031946 | |||
| 1570 | Ga0373931_0001506 | |||
| 1571 | Ga0373935_0095620 | |||
| 1572 | Ga0373935_0216431 | |||
| 1573 | Ga0373927_0001005 | |||
| 1574 | Ga0373927_0005832 | |||
| 1575 | Ga0373927_0113569 | |||
| 1576 | Ga0373927_0143691 | |||
| 1577 | Ga0373927_0167717 | |||
| 1578 | Ga0373927_0173891 | |||
| 1579 | Ga0373933_0009400 | |||
| 1580 | Ga0373933_0020192 | |||
| 1581 | Ga0373933_0452595 | |||
| 1582 | Ga0373947_0003823 | |||
| 1583 | Ga0373947_0005667 | |||
| 1584 | Ga0373947_0116907 | |||
| 1585 | Ga0373937_0002920 | |||
| 1586 | Ga0373937_0195852 | |||
| 1587 | Ga0372808_010437 | |||
| 1588 | Ga0373925_0006131 | |||
| 1589 | Ga0373925_0079952 | |||
| 1590 | Ga0373925_0108079 | |||
| 1591 | Ga0373925_0157269 | |||
| 1592 | Ga0373925_0687217 | |||
| 1593 | Ga0395900_0081560 | |||
| 1594 | Ga0395898_0073328 | |||
| 1595 | Ga0395898_0179729 | |||
| 1596 | Ga0395905_0015966 | |||
| 1597 | Ga0395905_0099550 | |||
| 1598 | Ga0436364_1466266 | |||
| 1599 | Ga0395901_0039843 | |||
| 1600 | Ga0395901_0179868 | |||
| 1601 | Ga0436365_0244764 | |||
| 1602 | Ga0436365_0255894 | |||
| 1603 | Ga0436365_0870867 | |||
| 1604 | Ga0436365_1891143 | |||
| 1605 | Ga0436360_0377935 | |||
| 1606 | Ga0436360_1119017 | |||
| 1607 | Ga0436360_1272541 | |||
| 1608 | Ga0436361_0295266 | |||
| 1609 | Ga0436361_0442731 | |||
| 1610 | Ga0436363_0323974 | |||
| 1611 | Ga0436363_0607645 | |||
| 1612 | Ga0436363_1259875 | |||
| 1613 | Ga0436363_1577576 | |||
| 1614 | Ga0436362_0240249 | |||
| 1615 | Ga0451798_0628637 | |||
| 1616 | Ga0451833_0240175 | |||
| 1617 | Ga0451847_0360949 | |||
| 1618 | Ga0439459_0014524 | |||
| 1619 | Ga0466972_0000261 | |||
| 1620 | Ga0466972_0050816 | |||
| 1621 | Ga0466965_0049773 | |||
| 1622 | Ga0466966_0175167 | |||
| 1623 | Ga0466961_0270759 | |||
| 1624 | Ga0466963_0216899 | |||
| 1625 | Ga0466968_0114682 | |||
| 1626 | Ga0466970_0087256 | |||
| 1627 | Ga0466957_0066260 | |||
| 1628 | Ga0466960_0133158 | |||
| 1629 | Ga0466959_0128863 | |||
| 1630 | Ga0495617_032196 | |||
| 1631 | Ga0495592_0001015 | |||
| 1632 | Ga0495592_0003697 | |||
| 1633 | Ga0495592_0070438 | |||
| 1634 | Ga0495592_0090334 | |||
| 1635 | Ga0495603_0004652 | |||
| 1636 | Ga0495603_0010944 | |||
| 1637 | Ga0495603_0014448 | |||
| 1638 | Ga0495603_0077462 | |||
| 1639 | Ga0495629_0003238 | |||
| 1640 | Ga0495629_0011592 | |||
| 1641 | Ga0495629_0081525 | |||
| 1642 | Ga0495629_0255363 | |||
| 1643 | Ga0495638_0009098 | |||
| 1644 | Ga0495638_0064537 | |||
| 1645 | Ga0495638_0078499 | |||
| 1646 | Ga0495638_0200454 | |||
| 1647 | Ga0495641_0009631 | |||
| 1648 | Ga0495651_0013141 | |||
| 1649 | Ga0495651_0015940 | |||
| 1650 | Ga0495651_0033664 | |||
| 1651 | Ga0495651_0178957 | |||
| 1652 | Ga0495653_0000934 | |||
| 1653 | Ga0495653_0119690 | |||
| 1654 | Ga0495653_0356206 | |||
| 1655 | Ga0495580_0000612 | |||
| 1656 | Ga0495580_0010282 | |||
| 1657 | Ga0495580_0119377 | |||
| 1658 | Ga0495582_0000831 | |||
| 1659 | Ga0495582_0019067 | |||
| 1660 | Ga0495582_0070749 | |||
| 1661 | Ga0495605_0160241 | |||
| 1662 | Ga0495605_0171646 | |||
| 1663 | Ga0495639_0000627 | |||
| 1664 | Ga0495639_0040188 | |||
| 1665 | Ga0495639_0048465 | |||
| 1666 | Ga0495662_0000686 | |||
| 1667 | Ga0495662_0119151 | |||
| 1668 | Ga0495664_0009563 | |||
| 1669 | Ga0495664_0096442 | |||
| 1670 | Ga0495664_0127983 | |||
| 1671 | Ga0495664_0367883 | |||
| 1672 | Ga0495584_0064018 | |||
| 1673 | Ga0495585_0086988 | |||
| 1674 | Ga0495594_0007696 | |||
| 1675 | Ga0495596_0041380 | |||
| 1676 | Ga0495607_0063530 | |||
| 1677 | Ga0495607_0138068 | |||
| 1678 | Ga0495583_0087672 | |||
| 1679 | Ga0495583_0134317 | |||
| 1680 | Ga0495606_0035698 | |||
| 1681 | Ga0495606_0075938 | |||
| 1682 | Ga0495606_0090759 | |||
| 1683 | Ga0495608_0002093 | |||
| 1684 | Ga0495608_0077941 | |||
| 1685 | Ga0495618_0065862 | |||
| 1686 | Ga0495618_0239659 | |||
| 1687 | Ga0495628_0020462 | |||
| 1688 | Ga0495628_0046153 | |||
| 1689 | Ga0495630_0002217 | |||
| 1690 | Ga0495643_0030321 | |||
| 1691 | Ga0495648_0013331 | |||
| 1692 | Ga0495648_0016179 | |||
| 1693 | Ga0495666_0113226 | |||
| 1694 | Ga0495666_0158074 | |||
| 1695 | Ga0495642_0162479 | |||
| 1696 | Ga0495652_0002209 | |||
| 1697 | Ga0495652_0159468 | |||
| 1698 | Ga0495652_0203001 | |||
| 1699 | Ga0495665_0000866 | |||
| 1700 | Ga0495640_0003099 | |||
| 1701 | Ga0495640_0020259 | |||
| 1702 | Ga0495640_0026887 | |||
| 1703 | Ga0495640_0260171 | |||
| 1704 | Ga0495587_0015200 | |||
| 1705 | Ga0495609_0157492 | |||
| 1706 | Ga0495597_0168045 | |||
| 1707 | Ga0495645_0012499 | |||
| 1708 | Ga0495645_0013311 | |||
| 1709 | Ga0495622_0022179 | |||
| 1710 | Ga0495622_0027395 | |||
| 1711 | Ga0495622_0040897 | |||
| 1712 | Ga0495633_0016209 | |||
| 1713 | Ga0495633_0054611 | |||
| 1714 | Ga0495667_0009515 | |||
| 1715 | Ga0495667_0031439 | |||
| 1716 | Ga0495668_0025884 | |||
| 1717 | Ga0495634_0002722 | |||
| 1718 | Ga0495634_0083525 | |||
| 1719 | Ga0495625_0070900 | |||
| 1720 | Ga0495635_0000540 | |||
| 1721 | Ga0495635_0007303 | |||
| 1722 | Ga0495635_0010103 | |||
| 1723 | Ga0495635_0013453 | |||
| 1724 | Ga0495635_0177916 | |||
| 1725 | Ga0495661_0044100 | |||
| 1726 | Ga0495661_0132550 | |||
| 1727 | Ga0495661_0200219 | |||
| 1728 | Ga0495588_0050990 | |||
| 1729 | Ga0495588_0095442 | |||
| 1730 | Ga0495588_0098362 | |||
| 1731 | Ga0495657_0001615 | |||
| 1732 | Ga0495657_0003319 | |||
| 1733 | Ga0495657_0014067 | |||
| 1734 | Ga0495657_0306693 | |||
| 1735 | Ga0495599_0007666 | |||
| 1736 | Ga0495599_0060654 | |||
| 1737 | Ga0495599_0071308 | |||
| 1738 | Ga0495623_0012652 | |||
| 1739 | Ga0495623_0042546 | |||
| 1740 | Ga0495623_0069774 | |||
| 1741 | Ga0495646_0010030 | |||
| 1742 | Ga0495646_0025769 | |||
| 1743 | Ga0495646_0038036 | |||
| 1744 | Ga0495646_0088196 | |||
| 1745 | Ga0495646_0282907 | |||
| 1746 | Ga0495647_0006540 | |||
| 1747 | Ga0495658_0000295 | |||
| 1748 | Ga0495658_0066331 | |||
| 1749 | Ga0495658_0146135 | |||
| 1750 | Ga0495658_0147849 | |||
| 1751 | Ga0495613_0004147 | |||
| 1752 | Ga0495613_0031591 | |||
| 1753 | Ga0495613_0069052 | |||
| 1754 | Ga0495613_0069070 | |||
| 1755 | Ga0495613_0105420 | |||
| 1756 | Ga0495613_0143346 | |||
| 1757 | Ga0495624_0000079 | |||
| 1758 | Ga0495624_0151375 | |||
| 1759 | Ga0495670_0020636 | |||
| 1760 | Ga0495670_0057400 | |||
| 1761 | Ga0495649_0030534 | |||
| 1762 | Ga0495649_0069232 | |||
| 1763 | Ga0495589_0152954 | |||
| 1764 | Ga0495600_0004052 | |||
| 1765 | Ga0495600_0007254 | |||
| 1766 | Ga0495600_0052689 | |||
| 1767 | Ga0495581_0000260 | |||
| 1768 | Ga0495581_0117764 | |||
| 1769 | Ga0495604_0021019 | |||
| 1770 | Ga0495604_0027245 | |||
| 1771 | Ga0495636_0104488 | |||
| 1772 | Ga0495674_0009590 | |||
| 1773 | Ga0495674_0032464 | |||
| 1774 | Ga0495674_0064849 | |||
| 1775 | Ga0495672_0079809 | |||
| 1776 | Ga0495672_0156642 | |||
| 1777 | Ga0495676_0094225 | |||
| 1778 | Ga0495676_0144076 | |||
| 1779 | Ga0495680_0012504 | |||
| 1780 | Ga0495680_0026735 | |||
| 1781 | Ga0495683_0064755 | |||
| 1782 | Ga0495687_026560 | |||
| 1783 | Ga0495675_0001958 | |||
| 1784 | Ga0495675_0051348 | |||
| 1785 | Ga0495677_0029096 | |||
| 1786 | Ga0495685_106021 | |||
| 1787 | Ga0495673_0041199 | |||
| 1788 | Ga0495681_0031275 | |||
| 1789 | Ga0495681_0043594 | |||
| 1790 | Ga0495684_0001865 | |||
| 1791 | Ga0495684_0010601 | |||
| 1792 | Ga0495684_0074943 | |||
| 1793 | Ga0495684_0120786 | |||
| 1794 | Ga0495686_0065228 | |||
| 1795 | Ga0495593_0001632 | |||
| 1796 | Ga0495593_0042278 | |||
| 1797 | Ga0495593_0279050 | |||
| 1798 | Ga0495602_0008574 | |||
| 1799 | Ga0495602_0009374 | |||
| 1800 | Ga0495614_0006328 | |||
| 1801 | Ga0495626_0124338 | |||
| 1802 | Ga0496100_0009348 | |||
| 1803 | Ga0496100_0015363 | |||
| 1804 | Ga0496100_0174741 | |||
| 1805 | Ga0496101_0045479 | |||
| 1806 | Ga0496101_0100207 | |||
| 1807 | Ga0496101_0128252 | |||
| 1808 | Ga0496101_0148183 | |||
| 1809 | Ga0496101_0184157 | |||
| 1810 | Ga0496101_0641512 | |||
| 1811 | Ga0496102_0000518 | |||
| 1812 | Ga0496102_0018395 | |||
| 1813 | Ga0496102_0040527 | |||
| 1814 | Ga0496102_0051795 | |||
| 1815 | Ga0496102_0088496 | |||
| 1816 | Ga0496102_0143112 | |||
| 1817 | Ga0496102_0211252 | |||
| 1818 | Ga0496103_0032295 | |||
| 1819 | Ga0496104_0007085 | |||
| 1820 | Ga0496104_0019267 | |||
| 1821 | Ga0496104_0113960 | |||
| 1822 | Ga0496104_0144401 | |||
| 1823 | Ga0496104_0154376 | |||
| 1824 | Ga0496104_0369454 | |||
| 1825 | Ga0496104_0457144 | |||
| 1826 | Ga0496105_0004162 | |||
| 1827 | Ga0496105_0004256 | |||
| 1828 | Ga0496105_0058155 | |||
| 1829 | Ga0496105_0471040 | |||
| 1830 | Ga0496106_0000116 | |||
| 1831 | Ga0496106_0015576 | |||
| 1832 | Ga0496106_0034762 | |||
| 1833 | Ga0496106_0052613 | |||
| 1834 | Ga0496106_0059004 | |||
| 1835 | Ga0496106_0159417 | |||
| 1836 | Ga0496106_0345858 | |||
| 1837 | Ga0496106_0381075 | |||
| 1838 | Ga0496107_0001003 | |||
| 1839 | Ga0496107_0042167 | |||
| 1840 | Ga0496107_0127221 | |||
| 1841 | Ga0496107_0200124 | |||
| 1842 | Ga0496107_0427037 | |||
| 1843 | Ga0496108_0000523 | |||
| 1844 | Ga0496108_0005230 | |||
| 1845 | Ga0496108_0315518 | |||
| 1846 | Ga0496108_0375076 | |||
| 1847 | Ga0496109_0001407 | |||
| 1848 | Ga0496109_0005646 | |||
| 1849 | Ga0496109_0014037 | |||
| 1850 | Ga0496109_0040291 | |||
| 1851 | Ga0496109_0060989 | |||
| 1852 | Ga0496110_0096837 | |||
| 1853 | Ga0496110_0131033 | |||
| 1854 | Ga0496110_0159171 | |||
| 1855 | Ga0496110_0236942 | |||
| 1856 | Ga0496111_0059018 | |||
| 1857 | Ga0496111_0092499 | |||
| 1858 | Ga0496111_0192727 | |||
| 1859 | Ga0496112_0005822 | |||
| 1860 | Ga0496112_0089521 | |||
| 1861 | Ga0496112_0098378 | |||
| 1862 | Ga0496112_0259580 | |||
| 1863 | Ga0496112_0266573 | |||
| 1864 | Ga0496112_0278435 | |||
| 1865 | Ga0496112_0292241 | |||
| 1866 | Ga0496112_0480936 | |||
| 1867 | Ga0496113_0007261 | |||
| 1868 | Ga0496113_0040246 | |||
| 1869 | Ga0496113_0076535 | |||
| 1870 | Ga0496113_0155383 | |||
| 1871 | Ga0496114_0023481 | |||
| 1872 | Ga0496114_0105206 | |||
| 1873 | Ga0496114_0759064 | |||
| 1874 | Ga0496115_0001962 | |||
| 1875 | Ga0496115_0007907 | |||
| 1876 | Ga0496115_0029187 | |||
| 1877 | Ga0496115_0133812 | |||
| 1878 | Ga0496115_0174257 | |||
| 1879 | Ga0496115_0321695 | |||
| 1880 | Ga0496116_0003309 | |||
| 1881 | Ga0496116_0219738 | |||
| 1882 | Ga0496117_0039261 | |||
| 1883 | Ga0496117_0048231 | |||
| 1884 | Ga0496117_0092934 | |||
| 1885 | Ga0496117_0113604 | |||
| 1886 | Ga0496118_0057858 | |||
| 1887 | Ga0496118_0061411 | |||
| 1888 | Ga0496118_0062861 | |||
| 1889 | Ga0496118_0065275 | |||
| 1890 | Ga0496118_0084467 | |||
| 1891 | Ga0496118_0145442 | |||
| 1892 | Ga0496119_0149452 | |||
| 1893 | Ga0496119_0194687 | |||
| 1894 | Ga0496120_0151801 | |||
| 1895 | Ga0496121_0007140 | |||
| 1896 | Ga0496121_0012978 | |||
| 1897 | Ga0496121_0046097 | |||
| 1898 | Ga0496121_0052638 | |||
| 1899 | Ga0496121_0059500 | |||
| 1900 | Ga0496121_0069804 | |||
| 1901 | Ga0496121_0101392 | |||
| 1902 | Ga0496121_0110728 | |||
| 1903 | Ga0496121_0163465 | |||
| 1904 | Ga0496121_0233548 | |||
| 1905 | Ga0496122_0006885 | |||
| 1906 | Ga0496122_0028275 | |||
| 1907 | Ga0496122_0187982 | |||
| 1908 | Ga0496123_0008430 | |||
| 1909 | Ga0496124_0027923 | |||
| 1910 | Ga0496124_0200939 | |||
| 1911 | Ga0496124_0219331 | |||
| 1912 | Ga0496124_0226570 | |||
| 1913 | Ga0496124_0233211 | |||
| 1914 | Ga0496125_0000063 | |||
| 1915 | Ga0496125_0001163 | |||
| 1916 | Ga0496125_0009338 | |||
| 1917 | Ga0496125_0039283 | |||
| 1918 | Ga0496125_0044237 | |||
| 1919 | Ga0496125_0044370 | |||
| 1920 | Ga0496125_0082097 | |||
| 1921 | Ga0496125_0098417 | |||
| 1922 | Ga0496125_0139997 | |||
| 1923 | Ga0496126_0005437 | |||
| 1924 | Ga0496126_0010695 | |||
| 1925 | Ga0496126_0040655 | |||
| 1926 | Ga0496126_0063768 | |||
| 1927 | Ga0496126_0085671 | |||
| 1928 | Ga0496126_0088140 | |||
| 1929 | Ga0496126_0146154 | |||
| 1930 | Ga0496126_0175455 | |||
| 1931 | Ga0496126_0199497 | |||
| 1932 | Ga0496126_0229115 | |||
| 1933 | Ga0496126_0233140 | |||
| 1934 | Ga0496126_0315486 | |||
| 1935 | Ga0495682_0032256 | |||
| 1936 | Ga0495682_0098803 | |||
| 1937 | Ga0501031_0462377 | |||
| 1938 | Ga0501037_0325957 | |||
| 1939 | Ga0501041_0056887 | |||
| 1940 | Ga0501042_0237073 | |||
| 1941 | Ga0501046_0159998 | |||
| 1942 | Ga0501047_0166415 | |||
| 1943 | Ga0501048_0515841 | |||
| 1944 | Ga0501070_0101299 | |||
| 1945 | Ga0501073_0208108 | |||
| 1946 | Ga0501074_0054035 | |||
| 1947 | Ga0501080_0175445 | |||
| 1948 | Ga0501044_0060418 | |||
| 1949 | nmdc:mga03683_22924_c1 | |||
| 1950 | nmdc:mga03683_34046_c1 | |||
| 1951 | nmdc:mga03n38_10056_c1 | |||
| 1952 | nmdc:mga03n38_6302_c1 | |||
| 1953 | nmdc:mga03n38_64269_c1 | |||
| 1954 | nmdc:mga00v17_55445_c1 | |||
| 1955 | nmdc:mga00v17_57508_c1 | |||
| 1956 | nmdc:mga0yw44_11492_c1 | |||
| 1957 | nmdc:mga0yw44_158641_c1 | |||
| 1958 | nmdc:mga0yw44_16842_c1 | |||
| 1959 | nmdc:mga0yw44_41020_c1 | |||
| 1960 | nmdc:mga0yw44_53041_c1 | |||
| 1961 | nmdc:mga0yw44_60081_c1 | |||
| 1962 | nmdc:mga0k408_184721_c1 | |||
| 1963 | nmdc:mga06z11_166914_c1 | |||
| 1964 | nmdc:mga06z11_192205_c1 | |||
| 1965 | nmdc:mga06z11_229613_c1 | |||
| 1966 | nmdc:mga06z11_235824_c1 | |||
| 1967 | nmdc:mga06z11_244461_c1 | |||
| 1968 | nmdc:mga06z11_31830_c1 | |||
| 1969 | nmdc:mga06z11_75663_c1 | |||
| 1970 | nmdc:mga06z11_76619_c1 | |||
| 1971 | nmdc:mga07m45_138730_c1 | |||
| 1972 | nmdc:mga07m45_148882_c1 | |||
| 1973 | nmdc:mga07m45_15298_c1 | |||
| 1974 | nmdc:mga07m45_38376_c1 | |||
| 1975 | nmdc:mga05p37_73611_c1 | |||
| 1976 | nmdc:mga08y16_323386_c1 | |||
| 1977 | nmdc:mga0rr50_254246_c1 | |||
| 1978 | nmdc:mga0a205_509902_c1 | |||
| 1979 | nmdc:mga0sz30_43856_c1 | |||
| 1980 | nmdc:mga0sz30_94400_c1 | |||
| 1981 | Ga0495601_0116769 | |||
| 1982 | Ga0495601_0146288 | |||
| 1983 | Ga0495601_0344906 | |||
| 1984 | Ga0495601_0349670 | |||
| 1985 | Ga0495612_0057110 | |||
| 1986 | Ga0495655_0007442 | |||
| 1987 | Ga0495655_0055616 | |||
| 1988 | Ga0495595_0051140 | |||
| 1989 | Ga0495619_0024640 | |||
| 1990 | Ga0495619_0146567 | |||
| 1991 | Ga0495619_0235827 | |||
| 1992 | Ga0500643_000019 | |||
| 1993 | Ga0500646_0032516 | |||
| 1994 | Ga0500647_0030004 | |||
| 1995 | Ga0500647_0208506 | |||
| 1996 | Ga0500651_0009449 | |||
| 1997 | Ga0500566_0000064 | |||
| 1998 | Ga0500566_0020051 | |||
| 1999 | Ga0500566_0073570 | |||
| 2000 | Ga0500566_0092758 | |||
| 2001 | Ga0500640_004979 | |||
| 2002 | Ga0500640_028015 | |||
| 2003 | Ga0500641_0016215 | |||
| 2004 | Ga0500641_0038291 | |||
| 2005 | Ga0500650_0000414 | |||
| 2006 | Ga0500554_006673 | |||
| 2007 | Ga0500554_015475 | |||
| 2008 | Ga0500555_001693 | |||
| 2009 | Ga0500556_0000024 | |||
| 2010 | Ga0500557_000039 | |||
| 2011 | Ga0500562_013356 | |||
| 2012 | Ga0500562_019094 | |||
| 2013 | Ga0500569_006619 | |||
| 2014 | Ga0500572_000026 | |||
| 2015 | Ga0500572_000344 | |||
| 2016 | Ga0500592_002695 | |||
| 2017 | Ga0500594_0026277 | |||
| 2018 | Ga0500595_002251 | |||
| 2019 | Ga0500595_002953 | |||
| 2020 | Ga0500595_013331 | |||
| 2021 | Ga0500595_019259 | |||
| 2022 | Ga0500607_079888 | |||
| 2023 | Ga0500614_001497 | |||
| 2024 | Ga0500618_005822 | |||
| 2025 | Ga0500642_0000273 | |||
| 2026 | Ga0500642_0001501 | |||
| 2027 | Ga0500642_0022680 | |||
| 2028 | Ga0500652_001229 | |||
| 2029 | Ga0500658_0027983 | |||
| 2030 | Ga0500658_0193358 | |||
| 2031 | Ga0500559_0000652 | |||
| 2032 | Ga0500559_0001707 | |||
| 2033 | Ga0500559_0003076 | |||
| 2034 | Ga0500559_0007580 | |||
| 2035 | Ga0500568_0011538 | |||
| 2036 | Ga0500577_0033268 | |||
| 2037 | Ga0500586_000905 | |||
| 2038 | Ga0500603_001132 | |||
| 2039 | Ga0500603_015252 | |||
| 2040 | Ga0500604_0013466 | |||
| 2041 | Ga0500616_0013535 | |||
| 2042 | Ga0500619_004900 | |||
| 2043 | Ga0500620_022019 | |||
| 2044 | Ga0500622_0001676 | |||
| 2045 | Ga0500630_000572 | |||
| 2046 | Ga0500634_0025477 | |||
| 2047 | Ga0500638_002262 | |||
| 2048 | Ga0500638_025631 | |||
| 2049 | Ga0500638_149893 | |||
| 2050 | Ga0500638_165198 | |||
| 2051 | Ga0500639_000353 | |||
| 2052 | Ga0500639_046810 | |||
| 2053 | Ga0500639_092474 | |||
| 2054 | Ga0500639_191023 | |||
| 2055 | Ga0500636_0000194 | |||
| 2056 | Ga0500636_0098888 | |||
| 2057 | Ga0500636_0169760 | |||
| 2058 | Ga0500637_0000356 | |||
| 2059 | Ga0500637_0027232 | |||
| 2060 | Ga0500637_0031722 | |||
| 2061 | Ga0500637_0059689 | |||
| 2062 | Ga0500625_012209 | |||
| 2063 | Ga0500596_004938 | |||
| 2064 | Ga0500599_000542 | |||
| 2065 | Ga0500601_000750 | |||
| 2066 | Ga0500601_002435 | |||
| 2067 | Ga0500661_010359 | |||
| 2068 | Ga0466962_0183347 | |||
| 2069 | 2509153765 | |||
| 2070 | 2513696981 | |||
| 2071 | 2513892027 | |||
| 2072 | 2603861027 | |||
| 2073 | 2723846424 | |||
| 2074 | 2793076917 | |||
| 2075 | 2857528848 | |||
| 2076 | 2874610608 | |||
| 2077 | 2876816244 | |||
| 2078 | 2879118670 | |||
| 2079 | 2889039063 | |||
| 2080 | 2893069046 | |||
| 2081 | 2903750456 | |||
| 2082 | 2919079270 | |||
| 2083 | 2922362235 | |||
| 2084 | 2922388010 | |||
| 2085 | 8006964810 | |||
| 2086 | 8006991793 | |||
| 2087 | 8006995546 | |||
| 2088 | 8016590789 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7et9-assembly1.cif.gz_A | crystal structure of abhpai-zn-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii | 0.9076 | 68 | 306 |
| 1dxe-assembly1.cif.gz_A | 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli | 0.9067 | 68 | 306 |
| 4b5w-assembly1.cif.gz_C | crystal structures of divalent metal dependent pyruvate aldolase r70a mutant, hpai, in complex with pyruvate | 0.9057 | 68 | 306 |
| 2v5j-assembly1.cif.gz_B | apo class ii aldolase hpch | 0.9035 | 68 | 306 |
| 7v8t-assembly1.cif.gz_F | crystal structure of class ii pyruvate aldolase from pseudomonas aeruginosa. | 0.9004 | 66 | 306 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1dxfA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9119 | 68 | 305 | 3.20.20.60 |
| af_Q4DGT6_3_267_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9045 | 65 | 306 | 3.20.20.60 |
| 4tv5A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.8964 | 67 | 313 | 3.20.20.60 |
| 6r62A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.8948 | 68 | 306 | 3.20.20.60 |
| af_Q4CQY1_6_194_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.8928 | 71 | 252 | 3.20.20.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N9CWP1-F1-model_v4 | deleted | 0.9406 | 68 | 234 |
|
| AF-A0A2E6ULC4-F1-model_v4 | Aldolase | 0.9391 | 93 | 263 |
GO:0005737
GO:0016832 |
| AF-A0A7X7BD34-F1-model_v4 | 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase | 0.9372 | 68 | 241 |
GO:0005737
GO:0016832 |
| AF-N1S4F7-F1-model_v4 | 2-keto-3-deoxy-L-rhamnonate aldolase | 0.9345 | 79 | 278 |
GO:0005737
GO:0016832 |
| AF-X1V378-F1-model_v4 | HpcH/HpaI aldolase/citrate lyase domain-containing protein | 0.9339 | 68 | 276 |
GO:0005737
GO:0016832 |