F488890

General Info

Members Datasets Scaffolds Average Seq Length
1043 521 902 242

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10001025|Ga0316575_1000102511
Length 265
Sequence VEDLTDAPGTLDAPTTEEECVTDAPRLELLPAVDVADGRAVRLVQGEAGSETSYGDPVAAALEWQAGGAEWIHLVDLDAAFGRGSNADLLADVVSRLDVRVEMSGGIRDDDSLRRALATGCARVNLGTAALEDPEWTARAIAERGDRVAVGLDVRGTTLAARGWTKEGGDLWEVLARLDAAGCARYVVTDVTKDGTLRGPNLDLLRRVCAATDSPVVASGGVSSLDDLAALRALVPDGVEGAIVGKALYAGAFTLPDALDVAGRP

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
4 2558860280 Kutzneria sp. 744 Isolate Unclassified
5 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
6 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
7 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
8 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
9 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
10 2643221613 Oerskovia sp. Root22 Isolate Unclassified
11 2643221647 Streptomyces sp. Root369 Isolate Unclassified
12 2643221670 Streptomyces sp. Root431 Isolate Unclassified
13 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
14 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
15 2643221679 Angustibacter sp. Root456 Isolate Unclassified
16 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
17 2643221692 Nocardia sp. Root136 Isolate Unclassified
18 2643221714 Streptomyces sp. Root264 Isolate Unclassified
19 2643221721 Oerskovia sp. Root918 Isolate Unclassified
20 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
21 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
22 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
23 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
24 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
25 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
26 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
27 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
28 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
29 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
30 2773857759 Microbacterium sp. 1294 Isolate Unclassified
31 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
32 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
33 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
34 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
35 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
36 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
37 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
38 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
39 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
40 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
41 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
42 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
43 2808606448 Streptomyces sp. 193411 Isolate Unclassified
44 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
45 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
46 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
47 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
48 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
49 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
50 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
51 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
52 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
53 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
54 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
55 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
56 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
57 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
58 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
59 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
60 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
61 2862574272 Streptomyces sp. AcE210 Isolate Nodule
62 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
63 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
64 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
65 2867369537 Streptomyces sp. Z26 Isolate Unclassified
66 2867428634 Streptomyces sp. RP5T Isolate Unclassified
67 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
68 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
69 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
70 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
71 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
72 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
73 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
74 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
75 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
76 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
77 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
78 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
79 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
80 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
81 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
82 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
83 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
84 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
85 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
86 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
87 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
88 2920879853 Kocuria salina CV6 Isolate Unclassified
89 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
90 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
91 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
92 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
93 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
94 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
95 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
96 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
97 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
98 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
99 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
100 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
101 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
102 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
103 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
104 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
105 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
106 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
107 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
108 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
109 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
110 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
111 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
112 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
113 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
114 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
115 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
116 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
117 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
118 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
119 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
120 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
121 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
122 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
123 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
124 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
125 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
126 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
127 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
128 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
129 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
130 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
131 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
132 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
133 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
134 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
135 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
136 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
137 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
138 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
139 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
140 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
141 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
142 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
143 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
144 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
145 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
146 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
147 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
148 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
149 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
150 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
151 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
152 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
153 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
154 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
155 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
156 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
157 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
158 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
159 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
160 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
161 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
162 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
163 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
164 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
165 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
166 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
167 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
168 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
169 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
170 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
171 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
172 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
173 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
174 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
175 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
176 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
177 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
178 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
179 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
180 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
181 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
182 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
183 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
184 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
185 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
186 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
187 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
188 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
189 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
190 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
191 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
192 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
193 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
194 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
228 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
229 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
230 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
231 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
232 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
233 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
234 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
235 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
236 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
237 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
238 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
239 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
240 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
241 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
242 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
243 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
244 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
245 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
246 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
247 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
248 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
249 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
250 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
251 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
252 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
253 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
254 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
255 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
256 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
257 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
258 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
259 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
260 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
261 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
262 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
263 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
264 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
265 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
266 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
267 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
268 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
269 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
270 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
271 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
274 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
275 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
276 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
277 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
278 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
279 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
280 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
281 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
282 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
283 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
284 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
285 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
286 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
287 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
288 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
289 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
290 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
291 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
292 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
293 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
294 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
295 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
296 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
297 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
298 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
299 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
300 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
301 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
302 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
303 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
304 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
305 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
306 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
307 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
308 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
309 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
310 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
311 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
312 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
313 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
314 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
315 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
316 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
317 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
318 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
319 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
320 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
321 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
322 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
323 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
324 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
325 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
326 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
327 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
328 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
329 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
330 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
331 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
332 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
333 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
334 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
335 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
336 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
337 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
338 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
339 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
340 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
341 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
342 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
343 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
344 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
345 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
346 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
347 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
348 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
349 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
350 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
351 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
352 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
353 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
354 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
355 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
356 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
357 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
358 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
359 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
360 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
361 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
362 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
363 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
364 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
365 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
366 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
367 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
368 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
369 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
370 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
371 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
372 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
373 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
374 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
375 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
376 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
377 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
378 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
379 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
380 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
381 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
382 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
383 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
384 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
385 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
386 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
387 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
388 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
389 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
390 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
391 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
392 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
393 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
394 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
395 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
396 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
397 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
398 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
399 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
400 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
401 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
402 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
403 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
404 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
405 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
406 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
407 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
408 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
409 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
410 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
411 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
412 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
413 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
414 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
415 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
416 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
417 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
418 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
419 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
420 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
421 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
422 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
423 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
424 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
425 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
426 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
427 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
428 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
429 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
430 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
447 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
448 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
449 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
450 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
451 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
452 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
453 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
454 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
455 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
456 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
457 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
458 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
459 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
460 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
461 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
464 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
465 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
466 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
467 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
468 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
469 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
470 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
471 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
472 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
473 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
474 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
475 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
476 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
477 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
478 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
479 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
480 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
481 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
482 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
483 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
484 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
485 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
486 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
487 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
488 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
489 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
490 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
491 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
492 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
493 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
494 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
495 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
496 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
497 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
498 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
499 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
500 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
501 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
502 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
503 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
504 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
505 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
506 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
507 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
508 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
509 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
510 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
511 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
512 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
513 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
514 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
515 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
516 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
517 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
518 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
519 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
520 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
521 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.43
Metatranscriptomes 1.05
Isolates 13.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.36
Nodule 0.38
Rhizoplane 3.84
Rhizosphere 78.04
Stem 0
Stem Tuber 0.1
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10010664 3300001989 Bacteria 3408
2 JGI24737J22298_10020253 3300001990 Bacteria 2124
3 JGI24738J21930_10012514 3300002075 Bacteria 1853
4 JGI25406J46586_10002838 3300003203 Bacteria 8165
5 Ga0007423J48922_100139 3300003285 Bacteria 33024
6 rootH2_10070449 3300003320 Bacteria 1406
7 rootL2_10011701 3300003322 Bacteria 3694
8 Ga0006562J51391_1157002 3300003578 Bacteria 5800
9 Ga0006562J51391_1157005 3300003578 Bacteria 1680
10 Ga0070658_10001257 3300005327 Bacteria 21711
11 Ga0070658_10008378 3300005327 Bacteria 8311
12 Ga0070658_10015310 3300005327 Bacteria 6138
13 Ga0070658_10199462 3300005327 Bacteria 1688
14 Ga0070658_10602833 3300005327 Bacteria 952
15 Ga0070680_100224733 3300005336 Bacteria 1585
16 Ga0070660_100098521 3300005339 Bacteria 2314
17 Ga0070660_100153009 3300005339 Bacteria 1855
18 Ga0070660_100259018 3300005339 Bacteria 1420
19 Ga0070714_100004428 3300005435 Bacteria 10573
20 Ga0070714_100004987 3300005435 Bacteria 10091
21 Ga0070714_100685964 3300005435 Bacteria 988
22 Ga0070710_10000044 3300005437 Bacteria 58112
23 Ga0070705_100153705 3300005440 Bacteria 1529
24 Ga0070700_100000007 3300005441 Bacteria 198866
25 Ga0070663_100117229 3300005455 Bacteria 2008
26 Ga0070663_100175118 3300005455 Bacteria 1661
27 Ga0070681_10091626 3300005458 Bacteria 2990
28 Ga0070681_10908481 3300005458 Bacteria 799
29 Ga0070679_100007399 3300005530 Bacteria 10261
30 Ga0070684_100067183 3300005535 Bacteria 3148
31 Ga0070684_100379274 3300005535 Bacteria 1302
32 Ga0068853_100022098 3300005539 Bacteria 5309
33 Ga0068853_100097278 3300005539 Bacteria 2598
34 Ga0070686_100126260 3300005544 Bacteria 1763
35 Ga0070665_100021952 3300005548 Bacteria 6420
36 Ga0070665_100213759 3300005548 Bacteria 1929
37 Ga0068855_100013558 3300005563 Bacteria 9831
38 Ga0068855_100099049 3300005563 Bacteria 3358
39 Ga0068855_100250917 3300005563 Bacteria 1974
40 Ga0068856_100101506 3300005614 Bacteria 2870
41 Ga0068856_100118454 3300005614 Bacteria 2649
42 Ga0068856_100154063 3300005614 Bacteria 2308
43 Ga0068856_100341016 3300005614 Bacteria 1517
44 Ga0070702_100000907 3300005615 Bacteria 11562
45 Ga0068852_100030459 3300005616 Bacteria 4442
46 Ga0068870_10202948 3300005840 Bacteria 1203
47 Ga0081455_10000443 3300005937 Bacteria 54547
48 Ga0081455_10054131 3300005937 Bacteria 3423
49 Ga0081540_1004894 3300005983 Bacteria 10089
50 Ga0081539_10000988 3300005985 Bacteria 52904
51 Ga0081539_10004512 3300005985 Bacteria 15299
52 Ga0081539_10008926 3300005985 Bacteria 8547
53 Ga0081539_10133842 3300005985 Bacteria 1214
54 Ga0070717_10312129 3300006028 Bacteria 1400
55 Ga0075368_10008947 3300006042 Bacteria 3590
56 Ga0075364_10003377 3300006051 Bacteria 9065
57 Ga0070712_100267205 3300006175 Bacteria 1373
58 Ga0070712_100397857 3300006175 Bacteria 1137
59 Ga0075367_10001030 3300006178 Bacteria 11486
60 Ga0075370_10064971 3300006353 Bacteria 2081
61 Ga0075433_10025524 3300006852 Bacteria 4996
62 Ga0075429_100326061 3300006880 Bacteria 1344
63 Ga0075436_100132597 3300006914 Bacteria 1747
64 Ga0097620_100051607 3300006931 Bacteria 4134
65 Ga0099826_10055096 3300006948 Bacteria 2636
66 Ga0075435_100002359 3300007076 Bacteria 12518
67 Ga0105250_10012833 3300009092 Bacteria 3452
68 Ga0105240_10002006 3300009093 Bacteria 33571
69 Ga0105240_10504435 3300009093 Bacteria 1345
70 Ga0105245_10474514 3300009098 Bacteria 1263
71 Ga0105245_10574172 3300009098 Bacteria 1152
72 Ga0105247_10001304 3300009101 Bacteria 18324
73 Ga0105243_10012714 3300009148 Bacteria 6358
74 Ga0105243_10097794 3300009148 Bacteria 2430
75 Ga0105243_10592998 3300009148 Bacteria 1066
76 Ga0105241_10009224 3300009174 Bacteria 7256
77 Ga0105242_10055393 3300009176 Bacteria 3244
78 Ga0105237_10032397 3300009545 Bacteria 5291
79 Ga0105237_10612707 3300009545 Bacteria 1095
80 Ga0105238_10013809 3300009551 Bacteria 8164
81 Ga0105238_10047653 3300009551 Bacteria 4320
82 Ga0105238_10060498 3300009551 Bacteria 3792
83 Ga0105238_10095585 3300009551 Bacteria 2958
84 Ga0105238_10367498 3300009551 Bacteria 1429
85 Ga0105249_10577107 3300009553 Bacteria 1177
86 Ga0105249_10685609 3300009553 Bacteria 1084
87 Ga0105239_10073281 3300010375 Bacteria 3765
88 Ga0105246_10227605 3300011119 Bacteria 1466
89 Ga0105246_10232949 3300011119 Bacteria 1451
90 Ga0157371_10004092 3300013102 Bacteria 12890
91 Ga0157370_10004259 3300013104 Bacteria 16514
92 Ga0157370_10038416 3300013104 Bacteria 4630
93 Ga0157369_10016379 3300013105 Bacteria 8340
94 Ga0157369_10118308 3300013105 Bacteria 2812
95 Ga0157369_10155606 3300013105 Bacteria 2414
96 Ga0157369_10199185 3300013105 Bacteria 2102
97 Ga0157374_10450774 3300013296 Bacteria 1288
98 Ga0157378_10291884 3300013297 Bacteria 1575
99 Ga0163162_10292191 3300013306 Bacteria 1761
100 Ga0163162_10436577 3300013306 Bacteria 1441
101 Ga0157372_10000079 3300013307 Bacteria 100687
102 Ga0157372_10132319 3300013307 Bacteria 2871
103 Ga0157372_10148987 3300013307 Bacteria 2699
104 Ga0157372_10912574 3300013307 Bacteria 1019
105 Ga0157375_10596968 3300013308 Bacteria 1263
106 Ga0157380_10973232 3300014326 Bacteria 880
107 Ga0182008_10002930 3300014497 Bacteria 10528
108 Ga0157377_10347686 3300014745 Bacteria 994
109 Ga0157379_10170874 3300014968 Bacteria 1962
110 Ga0182006_1067333 3300015261 Bacteria 1337
111 Ga0182007_10004606 3300015262 Bacteria 6231
112 Ga0183367_1007 3300015688 Bacteria 498079
113 Ga0206354_10024324 3300020081 Bacteria 1189
114 Ga0206353_10114382 3300020082 Bacteria 2447
115 Ga0206353_10447514 3300020082 Bacteria 3060
116 Ga0206353_10600692 3300020082 Bacteria 5401
117 Ga0206353_11478345 3300020082 Bacteria 1345
118 Ga0213873_10000058 3300021358 Bacteria 24370
119 Ga0213875_10000071 3300021388 Bacteria 120220
120 Ga0213875_10001897 3300021388 Bacteria 12937
121 Ga0213875_10081951 3300021388 Bacteria 1505
122 Ga0207692_10000357 3300025898 Bacteria 15729
123 Ga0207710_10023559 3300025900 Bacteria 2646
124 Ga0207688_10368977 3300025901 Bacteria 887
125 Ga0207647_10016380 3300025904 Bacteria 5060
126 Ga0207647_10073596 3300025904 Bacteria 2058
127 Ga0207643_10040861 3300025908 Bacteria 2612
128 Ga0207705_10000001 3300025909 Bacteria 2061880
129 Ga0207705_10193151 3300025909 Bacteria 1540
130 Ga0207705_10209977 3300025909 Bacteria 1477
131 Ga0207654_10132764 3300025911 Bacteria 1578
132 Ga0207707_10060501 3300025912 Bacteria 3295
133 Ga0207695_10001622 3300025913 Bacteria 36477
134 Ga0207695_10604979 3300025913 Bacteria 977
135 Ga0207671_10000976 3300025914 Bacteria 35441
136 Ga0207671_10489531 3300025914 Bacteria 980
137 Ga0207693_10347695 3300025915 Bacteria 1160
138 Ga0207660_10161899 3300025917 Bacteria 1727
139 Ga0207657_10106689 3300025919 Bacteria 2317
140 Ga0207657_10240635 3300025919 Bacteria 1445
141 Ga0207657_10620790 3300025919 Bacteria 843
142 Ga0207652_10173637 3300025921 Bacteria 1935
143 Ga0207652_10206926 3300025921 Bacteria 1766
144 Ga0207694_10000220 3300025924 Bacteria 55978
145 Ga0207694_10054186 3300025924 Bacteria 3111
146 Ga0207659_10547828 3300025926 Bacteria 983
147 Ga0207700_10345017 3300025928 Bacteria 1295
148 Ga0207664_10000091 3300025929 Bacteria 84244
149 Ga0207664_10015771 3300025929 Bacteria 5496
150 Ga0207664_10023671 3300025929 Bacteria 4605
151 Ga0207664_10157794 3300025929 Bacteria 1933
152 Ga0207664_10562169 3300025929 Bacteria 1024
153 Ga0207690_10017351 3300025932 Bacteria 4392
154 Ga0207709_10004841 3300025935 Bacteria 7712
155 Ga0207709_10029752 3300025935 Bacteria 3171
156 Ga0207704_10257852 3300025938 Bacteria 1313
157 Ga0207661_10161058 3300025944 Bacteria 1947
158 Ga0207661_10226208 3300025944 Bacteria 1655
159 Ga0207667_10050485 3300025949 Bacteria 4389
160 Ga0207667_10057590 3300025949 Bacteria 4079
161 Ga0207667_10503441 3300025949 Bacteria 1228
162 Ga0207668_10055981 3300025972 Bacteria 2745
163 Ga0207668_10429322 3300025972 Bacteria 1123
164 Ga0207640_10005073 3300025981 Bacteria 7165
165 Ga0207639_10055224 3300026041 Bacteria 3039
166 Ga0207639_10206353 3300026041 Bacteria 1689
167 Ga0207678_10023532 3300026067 Bacteria 5387
168 Ga0207678_10250594 3300026067 Bacteria 1516
169 Ga0207708_10000006 3300026075 Bacteria 266916
170 Ga0207702_10130418 3300026078 Bacteria 2262
171 Ga0207702_10505883 3300026078 Bacteria 1178
172 Ga0207702_10514038 3300026078 Bacteria 1168
173 Ga0207674_10015577 3300026116 Bacteria 8350
174 Ga0207675_100073159 3300026118 Bacteria 3207
175 Ga0207683_10152206 3300026121 Bacteria 2088
176 Ga0207683_10328499 3300026121 Bacteria 1401
177 Ga0207698_10196474 3300026142 Bacteria 1803
178 Ga0207698_10209726 3300026142 Bacteria 1752
179 Ga0209813_10017241 3300027866 Bacteria 1981
180 Ga0307517_10010039 3300028786 Bacteria 13314
181 Ga0307517_10045407 3300028786 Bacteria 4615
182 Ga0307515_10001023 3300028794 Bacteria 63806
183 Ga0307515_10028171 3300028794 Bacteria 9559
184 Ga0307515_10044259 3300028794 Bacteria 6884
185 Ga0307511_10001719 3300030521 Bacteria 23050
186 Ga0307511_10002015 3300030521 Bacteria 21310
187 Ga0307511_10099457 3300030521 Bacteria 1919
188 Ga0307511_10106659 3300030521 Bacteria 1807
189 Ga0307511_10121505 3300030521 Bacteria 1613
190 Ga0307512_10001219 3300030522 Bacteria 37239
191 Ga0307512_10030796 3300030522 Bacteria 4660
192 Ga0316176_1150059 3300030732 Bacteria 8347
193 Ga0314311_1039871 3300030733 Bacteria 9000
194 Ga0316178_1163203 3300030735 Bacteria 1339
195 Ga0316180_1049974 3300030736 Bacteria 1142
196 Ga0316183_1045511 3300030742 Bacteria 2084
197 Ga0316181_1125033 3300030744 Bacteria 1864
198 Ga0316182_1357079 3300030745 Bacteria 5185
199 Ga0265340_10003524 3300031247 Bacteria 8803
200 Ga0307513_10000483 3300031456 Bacteria 57234
201 Ga0307513_10007993 3300031456 Bacteria 13589
202 Ga0307513_10053872 3300031456 Bacteria 4319
203 Ga0307513_10171194 3300031456 Bacteria 2049
204 Ga0307509_10053988 3300031507 Bacteria 4280
205 Ga0307509_10062666 3300031507 Bacteria 3920
206 Ga0307509_10136899 3300031507 Bacteria 2392
207 Ga0307408_100100359 3300031548 Bacteria 2204
208 Ga0307408_100583191 3300031548 Bacteria 991
209 Ga0307508_10002617 3300031616 Bacteria 18905
210 Ga0307508_10005838 3300031616 Bacteria 11629
211 Ga0307508_10048095 3300031616 Bacteria 3801
212 Ga0307508_10085607 3300031616 Bacteria 2735
213 Ga0307508_10125154 3300031616 Bacteria 2173
214 Ga0307508_10257165 3300031616 Bacteria 1341
215 Ga0307514_10000866 3300031649 Bacteria 48042
216 Ga0307514_10068123 3300031649 Bacteria 2683
217 Ga0307514_10082594 3300031649 Bacteria 2371
218 Ga0316575_10001025 3300031665 Bacteria 8661
219 Ga0316575_10002244 3300031665 Bacteria 6452
220 Ga0316575_10029147 3300031665 Bacteria 2154
221 Ga0316575_10129354 3300031665 Bacteria 1036
222 Ga0316579_10001944 3300031691 Bacteria 7698
223 Ga0316576_10000880 3300031727 Bacteria 15240
224 Ga0316576_10005583 3300031727 Bacteria 7709
225 Ga0316576_10006505 3300031727 Bacteria 7283
226 Ga0316576_10020558 3300031727 Bacteria 4548
227 Ga0316576_10047954 3300031727 Bacteria 3096
228 Ga0316578_10019894 3300031728 Bacteria 3702
229 Ga0316578_10051659 3300031728 Bacteria 2407
230 Ga0316578_10073838 3300031728 Bacteria 2022
231 Ga0316578_10184467 3300031728 Bacteria 1257
232 Ga0307516_10000836 3300031730 Bacteria 42164
233 Ga0307516_10017241 3300031730 Bacteria 7536
234 Ga0307516_10039317 3300031730 Bacteria 4716
235 Ga0307516_10278049 3300031730 Bacteria 1357
236 Ga0307405_10142830 3300031731 Bacteria 1672
237 Ga0316577_10032890 3300031733 Bacteria 2897
238 Ga0316577_10099308 3300031733 Bacteria 1631
239 Ga0307413_10001807 3300031824 Bacteria 8396
240 Ga0307413_10073897 3300031824 Bacteria 2157
241 Ga0307413_10085581 3300031824 Bacteria 2036
242 Ga0307413_10415129 3300031824 Bacteria 1058
243 Ga0307518_10000187 3300031838 Bacteria 47022
244 Ga0307518_10168033 3300031838 Bacteria 1498
245 Ga0307410_10054604 3300031852 Bacteria 2709
246 Ga0307410_10120873 3300031852 Bacteria 1910
247 Ga0307410_10217344 3300031852 Bacteria 1468
248 Ga0307406_10098078 3300031901 Bacteria 1989
249 Ga0307406_10128713 3300031901 Bacteria 1773
250 Ga0307407_10253504 3300031903 Bacteria 1207
251 Ga0307412_10015695 3300031911 Bacteria 4496
252 Ga0307412_10052924 3300031911 Bacteria 2690
253 Ga0307412_10064375 3300031911 Bacteria 2477
254 Ga0307412_10548421 3300031911 Bacteria 971
255 Ga0307409_100003904 3300031995 Bacteria 8249
256 Ga0307409_100038860 3300031995 Bacteria 3525
257 Ga0307409_100222765 3300031995 Bacteria 1704
258 Ga0307409_100425048 3300031995 Bacteria 1275
259 Ga0307409_100598414 3300031995 Bacteria 1089
260 Ga0307409_100649547 3300031995 Bacteria 1049
261 Ga0307416_100012870 3300032002 Bacteria 5660
262 Ga0307416_100102010 3300032002 Bacteria 2500
263 Ga0307416_100370147 3300032002 Bacteria 1459
264 Ga0307416_100427894 3300032002 Bacteria 1370
265 Ga0307414_10585579 3300032004 Bacteria 999
266 Ga0307411_10004675 3300032005 Bacteria 6601
267 Ga0307411_10305639 3300032005 Bacteria 1277
268 Ga0307415_100089055 3300032126 Bacteria 2228
269 Ga0316583_10013089 3300032133 Bacteria 2993
270 Ga0316585_10003252 3300032137 Bacteria 4454
271 Ga0316585_10009189 3300032137 Bacteria 2878
272 Ga0316580_10010121 3300032139 Bacteria 2841
273 Ga0307507_10000019 3300033179 Bacteria 224026
274 Ga0307507_10017958 3300033179 Bacteria 8086
275 Ga0307507_10045870 3300033179 Bacteria 4293
276 Ga0307507_10308330 3300033179 Bacteria 964
277 Ga0307510_10011375 3300033180 Bacteria 10571
278 Ga0307510_10031973 3300033180 Bacteria 5935
279 Ga0307510_10124243 3300033180 Bacteria 2275
280 Ga0307510_10194466 3300033180 Bacteria 1572
281 Ga0373942_0057929 3300035207 Bacteria 1103
282 Ga0316574_0004754 3300035398 Bacteria 7170
283 Ga0316574_0141240 3300035398 Bacteria 1551
284 Ga0316574_0278298 3300035398 Bacteria 1066
285 Ga0316582_0007848 3300036647 Bacteria 5703
286 Ga0316582_0058991 3300036647 Bacteria 2455
287 Ga0316582_0246618 3300036647 Bacteria 1224
288 Ga0316584_0003071 3300036712 Bacteria 10758
289 Ga0316584_0028637 3300036712 Bacteria 4109
290 Ga0316584_0042701 3300036712 Bacteria 3379
291 Ga0316584_0179957 3300036712 Bacteria 1565
292 Ga0373925_0130767 3300037068 Bacteria 1957
293 Ga0395899_0011707 3300037312 Bacteria 6715
294 Ga0395899_0012802 3300037312 Bacteria 6428
295 Ga0395899_0133485 3300037312 Bacteria 1771
296 Ga0395900_0024030 3300037418 Bacteria 6236
297 Ga0395900_0054388 3300037418 Bacteria 4122
298 Ga0395900_0059411 3300037418 Bacteria 3936
299 Ga0395898_0003138 3300037466 Bacteria 18662
300 Ga0395898_0003389 3300037466 Bacteria 17855
301 Ga0395898_0078790 3300037466 Bacteria 3179
302 Ga0395898_0124866 3300037466 Bacteria 2465
303 Ga0395898_0125388 3300037466 Bacteria 2460
304 Ga0395898_0151883 3300037466 Bacteria 2215
305 Ga0395898_0169704 3300037466 Bacteria 2086
306 Ga0395898_0631775 3300037466 Bacteria 1013
307 Ga0395905_0024507 3300037471 Bacteria 5694
308 Ga0395905_0385676 3300037471 Bacteria 1295
309 Ga0316581_0051225 3300037588 Bacteria 1265
310 Ga0436364_0383034 3300037853 Bacteria 52816
311 Ga0436364_0619304 3300037853 Bacteria 133320
312 Ga0436364_1193326 3300037853 Bacteria 6592
313 Ga0395901_0003409 3300038443 Bacteria 16013
314 Ga0395901_0011881 3300038443 Bacteria 8831
315 Ga0395901_0100620 3300038443 Bacteria 3032
316 Ga0395901_0116605 3300038443 Bacteria 2805
317 Ga0395901_0179986 3300038443 Bacteria 2217
318 Ga0395901_0187487 3300038443 Bacteria 2169
319 Ga0395901_0274685 3300038443 Bacteria 1752
320 Ga0395901_0339111 3300038443 Bacteria 1553
321 Ga0400485_07745 3300038735 Bacteria 24721
322 Ga0400488_11659 3300038741 Bacteria 9771
323 Ga0400486_04200 3300038742 Bacteria 58211
324 Ga0436365_1156973 3300039437 Bacteria 1643
325 Ga0439436_0004093 3300041404 Bacteria 4471
326 Ga0439439_0015650 3300041406 Bacteria 1854
327 Ga0451789_0675791 3300041443 Bacteria 1341
328 Ga0451795_0121483 3300041456 Bacteria 2342
329 Ga0451833_1101346 3300041491 Bacteria 4129
330 Ga0451833_1314909 3300041491 Bacteria 766
331 Ga0451835_0497006 3300041492 Bacteria 1507
332 Ga0451837_0076298 3300041494 Bacteria 5466
333 Ga0451841_1174457 3300041498 Bacteria 1103
334 Ga0451843_1293141 3300041509 Bacteria 1959
335 Ga0451853_1635577 3300041512 Bacteria 9224
336 Ga0451853_2882476 3300041512 Bacteria 1359
337 Ga0439442_003740 3300042002 Bacteria 3015
338 Ga0439448_0086255 3300042005 Bacteria 1058
339 Ga0439432_015276 3300042006 Bacteria 2593
340 Ga0439449_0001767 3300042007 Bacteria 8497
341 Ga0439450_019447 3300042008 Bacteria 1439
342 Ga0439455_0053092 3300042012 Bacteria 1062
343 Ga0439457_000358 3300042014 Bacteria 12732
344 Ga0450894_000108 3300042131 Bacteria 14142
345 Ga0450896_000133 3300042133 Bacteria 5646
346 Ga0450898_000249 3300042134 Bacteria 5923
347 Ga0450898_005549 3300042134 Bacteria 1911
348 Ga0439458_0000302 3300042157 Bacteria 12271
349 Ga0450908_003192 3300042184 Bacteria 3187
350 Ga0450901_002785 3300042533 Bacteria 1854
351 Ga0451577_0252036 3300042876 Unclassified 1598
352 Ga0466969_0000312 3300044656 Bacteria 26699
353 Ga0466969_0063271 3300044656 Bacteria 1793
354 Ga0466969_0082283 3300044656 Bacteria 1534
355 Ga0466969_0092650 3300044656 Bacteria 1430
356 Ga0466969_0122548 3300044656 Bacteria 1209
357 Ga0466969_0126177 3300044656 Bacteria 1189
358 Ga0466972_0007209 3300044658 Bacteria 5583
359 Ga0466972_0009202 3300044658 Bacteria 4960
360 Ga0466972_0019146 3300044658 Bacteria 3423
361 Ga0466972_0038057 3300044658 Bacteria 2350
362 Ga0466972_0164233 3300044658 Bacteria 1043
363 Ga0466965_0000544 3300044683 Bacteria 13582
364 Ga0466965_0003850 3300044683 Bacteria 6627
365 Ga0466965_0024888 3300044683 Bacteria 2896
366 Ga0466965_0055567 3300044683 Bacteria 1970
367 Ga0466965_0091716 3300044683 Bacteria 1546
368 Ga0466965_0140284 3300044683 Bacteria 1258
369 Ga0466965_0185174 3300044683 Bacteria 1100
370 Ga0466966_0000681 3300044684 Bacteria 21566
371 Ga0466966_0000853 3300044684 Bacteria 19461
372 Ga0466966_0001836 3300044684 Bacteria 13765
373 Ga0466966_0006747 3300044684 Bacteria 7602
374 Ga0466966_0017580 3300044684 Bacteria 4724
375 Ga0466966_0175444 3300044684 Bacteria 1301
376 Ga0466961_0001762 3300044693 Bacteria 13420
377 Ga0466961_0004550 3300044693 Bacteria 8698
378 Ga0466961_0012188 3300044693 Bacteria 5498
379 Ga0466961_0020506 3300044693 Bacteria 4254
380 Ga0466961_0024952 3300044693 Bacteria 3846
381 Ga0466961_0033050 3300044693 Bacteria 3324
382 Ga0466961_0094173 3300044693 Bacteria 1890
383 Ga0466963_0000206 3300044694 Bacteria 25098
384 Ga0466963_0000614 3300044694 Bacteria 17088
385 Ga0466963_0020362 3300044694 Bacteria 4171
386 Ga0466963_0037006 3300044694 Bacteria 3185
387 Ga0466963_0161976 3300044694 Bacteria 1557
388 Ga0466963_0314793 3300044694 Bacteria 1101
389 Ga0466963_0321552 3300044694 Bacteria 1089
390 Ga0466964_0037040 3300044706 Bacteria 1958
391 Ga0466964_0040300 3300044706 Bacteria 1885
392 Ga0466971_0008218 3300044719 Bacteria 4552
393 Ga0466971_0009107 3300044719 Bacteria 4338
394 Ga0466971_0013856 3300044719 Bacteria 3545
395 Ga0466971_0033927 3300044719 Bacteria 2287
396 Ga0466971_0038368 3300044719 Bacteria 2150
397 Ga0466968_0000913 3300044735 Bacteria 10403
398 Ga0466968_0108827 3300044735 Bacteria 1244
399 Ga0466970_0001751 3300044765 Bacteria 10476
400 Ga0466970_0002247 3300044765 Bacteria 9324
401 Ga0466970_0002697 3300044765 Bacteria 8575
402 Ga0466970_0003067 3300044765 Bacteria 8111
403 Ga0466970_0016567 3300044765 Bacteria 3802
404 Ga0466970_0019046 3300044765 Bacteria 3557
405 Ga0466970_0263882 3300044765 Bacteria 966
406 Ga0466957_0000450 3300044842 Bacteria 20326
407 Ga0466957_0164363 3300044842 Bacteria 1443
408 Ga0466957_0262665 3300044842 Bacteria 1151
409 Ga0466957_0286834 3300044842 Bacteria 1103
410 Ga0466960_0002663 3300044901 Bacteria 6737
411 Ga0466960_0005164 3300044901 Bacteria 5163
412 Ga0466960_0024045 3300044901 Bacteria 2744
413 Ga0466960_0025324 3300044901 Bacteria 2684
414 Ga0466960_0298100 3300044901 Bacteria 908
415 Ga0466959_0000702 3300045049 Bacteria 19592
416 Ga0466959_0003628 3300045049 Bacteria 10181
417 Ga0466959_0004881 3300045049 Bacteria 9078
418 Ga0466959_0014819 3300045049 Bacteria 5675
419 Ga0466959_0201267 3300045049 Bacteria 1386
420 Ga0466958_0000246 3300045836 Bacteria 20885
421 Ga0466958_0004524 3300045836 Bacteria 7349
422 Ga0466958_0019819 3300045836 Bacteria 3917
423 Ga0466958_0030508 3300045836 Bacteria 3203
424 Ga0466958_0052067 3300045836 Bacteria 2480
425 Ga0466958_0265827 3300045836 Bacteria 1098
426 Ga0466958_0322136 3300045836 Bacteria 993
427 Ga0466967_0000259 3300045976 Bacteria 23242
428 Ga0466967_0005297 3300045976 Bacteria 8903
429 Ga0466967_0229605 3300045976 Bacteria 1767
430 Ga0466967_0278286 3300045976 Bacteria 1605
431 Ga0466967_0480116 3300045976 Bacteria 1218
432 Ga0466967_0701272 3300045976 Bacteria 1002
433 Ga0495617_015956 3300046452 Bacteria 2541
434 Ga0495627_023753 3300046453 Bacteria 2005
435 Ga0495627_039221 3300046453 Bacteria 1462
436 Ga0495592_0006146 3300046454 Bacteria 8931
437 Ga0495592_0015690 3300046454 Bacteria 5747
438 Ga0495592_0055209 3300046454 Bacteria 2939
439 Ga0495592_0074713 3300046454 Bacteria 2462
440 Ga0495592_0101946 3300046454 Bacteria 2044
441 Ga0495592_0163579 3300046454 Bacteria 1529
442 Ga0495603_0000118 3300046455 Bacteria 38501
443 Ga0495603_0002495 3300046455 Bacteria 10830
444 Ga0495603_0053210 3300046455 Bacteria 2402
445 Ga0495603_0233520 3300046455 Bacteria 1060
446 Ga0495629_0001225 3300046459 Bacteria 20142
447 Ga0495629_0003945 3300046459 Bacteria 11160
448 Ga0495629_0006546 3300046459 Bacteria 8627
449 Ga0495629_0015712 3300046459 Bacteria 5435
450 Ga0495629_0158648 3300046459 Bacteria 1571
451 Ga0495638_0064804 3300046460 Bacteria 2250
452 Ga0495641_0082886 3300046461 Bacteria 1436
453 Ga0495651_0000211 3300046462 Bacteria 44617
454 Ga0495651_0000324 3300046462 Bacteria 37048
455 Ga0495651_0001024 3300046462 Bacteria 21638
456 Ga0495651_0003371 3300046462 Bacteria 12264
457 Ga0495651_0020877 3300046462 Bacteria 5084
458 Ga0495653_0005610 3300046463 Bacteria 10240
459 Ga0495580_0038672 3300046472 Bacteria 3416
460 Ga0495582_0082387 3300046473 Bacteria 1787
461 Ga0495605_0011696 3300046474 Bacteria 4884
462 Ga0495639_0006635 3300046475 Bacteria 4978
463 Ga0495662_0001508 3300046476 Bacteria 11554
464 Ga0495662_0002106 3300046476 Bacteria 9980
465 Ga0495662_0022833 3300046476 Bacteria 3020
466 Ga0495662_0036208 3300046476 Bacteria 2382
467 Ga0495664_0002194 3300046477 Bacteria 10455
468 Ga0495664_0023458 3300046477 Bacteria 3581
469 Ga0495664_0107191 3300046477 Bacteria 1685
470 Ga0495664_0242584 3300046477 Bacteria 1090
471 Ga0495584_0010442 3300046491 Bacteria 4771
472 Ga0495585_0031988 3300046492 Bacteria 2983
473 Ga0495585_0061848 3300046492 Bacteria 2057
474 Ga0495594_0001176 3300046499 Bacteria 13693
475 Ga0495594_0010207 3300046499 Bacteria 4866
476 Ga0495594_0014082 3300046499 Bacteria 4187
477 Ga0495596_0012530 3300046500 Bacteria 3629
478 Ga0495583_0030333 3300046506 Bacteria 2634
479 Ga0495583_0090564 3300046506 Bacteria 1317
480 Ga0495606_0017255 3300046507 Bacteria 5467
481 Ga0495608_0021342 3300046511 Bacteria 4444
482 Ga0495608_0032629 3300046511 Bacteria 3520
483 Ga0495608_0038537 3300046511 Bacteria 3209
484 Ga0495608_0066984 3300046511 Bacteria 2350
485 Ga0495608_0243723 3300046511 Bacteria 1122
486 Ga0495610_0007469 3300046512 Bacteria 7267
487 Ga0495616_0013521 3300046513 Bacteria 4601
488 Ga0495618_0037100 3300046514 Bacteria 3059
489 Ga0495618_0040123 3300046514 Bacteria 2945
490 Ga0495618_0044642 3300046514 Bacteria 2795
491 Ga0495618_0140578 3300046514 Bacteria 1544
492 Ga0495620_0031617 3300046515 Bacteria 2423
493 Ga0495628_0022766 3300046516 Bacteria 5145
494 Ga0495628_0026002 3300046516 Bacteria 4779
495 Ga0495628_0026462 3300046516 Bacteria 4730
496 Ga0495628_0126088 3300046516 Bacteria 1961
497 Ga0495630_0042372 3300046517 Bacteria 3399
498 Ga0495630_0046801 3300046517 Bacteria 3234
499 Ga0495631_0005465 3300046518 Bacteria 6648
500 Ga0495631_0089949 3300046518 Bacteria 1322
501 Ga0495632_0028913 3300046519 Bacteria 2891
502 Ga0495632_0031247 3300046519 Bacteria 2755
503 Ga0495643_0004048 3300046522 Bacteria 10450
504 Ga0495648_0332640 3300046524 Bacteria 700
505 Ga0495663_0049205 3300046525 Bacteria 1301
506 Ga0495666_0000276 3300046526 Bacteria 22293
507 Ga0495666_0020869 3300046526 Bacteria 3243
508 Ga0495642_0035377 3300046528 Bacteria 2015
509 Ga0495652_0010670 3300046529 Bacteria 8321
510 Ga0495652_0018950 3300046529 Bacteria 6132
511 Ga0495652_0022724 3300046529 Bacteria 5565
512 Ga0495652_0063283 3300046529 Bacteria 3115
513 Ga0495652_0158330 3300046529 Bacteria 1761
514 Ga0495652_0289364 3300046529 Bacteria 1196
515 Ga0495654_0037013 3300046530 Bacteria 2450
516 Ga0495665_0048588 3300046531 Bacteria 2249
517 Ga0495640_0004853 3300046533 Bacteria 10699
518 Ga0495640_0053029 3300046533 Bacteria 2782
519 Ga0495586_0009432 3300046535 Bacteria 5195
520 Ga0495586_0089008 3300046535 Bacteria 1703
521 Ga0495586_0293070 3300046535 Bacteria 932
522 Ga0495587_0008553 3300046536 Bacteria 6575
523 Ga0495587_0014977 3300046536 Bacteria 4849
524 Ga0495609_0003387 3300046538 Bacteria 9163
525 Ga0495597_0062332 3300046542 Bacteria 1622
526 Ga0495645_0008635 3300046543 Bacteria 7114
527 Ga0495645_0033596 3300046543 Bacteria 3742
528 Ga0495645_0054473 3300046543 Bacteria 2906
529 Ga0495645_0191490 3300046543 Bacteria 1393
530 Ga0495622_0002898 3300046557 Bacteria 8188
531 Ga0495622_0004164 3300046557 Bacteria 6747
532 Ga0495622_0051737 3300046557 Bacteria 1905
533 Ga0495633_0023178 3300046558 Bacteria 3076
534 Ga0495667_0134369 3300046559 Bacteria 1595
535 Ga0495656_0139360 3300046615 Bacteria 1162
536 Ga0495668_0104241 3300046616 Bacteria 1551
537 Ga0495634_0004021 3300046642 Bacteria 11663
538 Ga0495634_0021694 3300046642 Bacteria 4534
539 Ga0495634_0025930 3300046642 Bacteria 4094
540 Ga0495611_0006244 3300046648 Bacteria 5085
541 Ga0495611_0007776 3300046648 Bacteria 4553
542 Ga0495625_0007626 3300046660 Bacteria 9388
543 Ga0495625_0083574 3300046660 Bacteria 2219
544 Ga0495635_0001097 3300046663 Bacteria 17971
545 Ga0495635_0003328 3300046663 Bacteria 11115
546 Ga0495635_0009396 3300046663 Bacteria 6836
547 Ga0495635_0016123 3300046663 Bacteria 5217
548 Ga0495661_0157471 3300046665 Bacteria 1222
549 Ga0495588_0010629 3300046674 Bacteria 4288
550 Ga0495588_0058330 3300046674 Bacteria 1995
551 Ga0495588_0121383 3300046674 Bacteria 1377
552 Ga0495588_0171135 3300046674 Bacteria 1148
553 Ga0495657_0002044 3300046675 Bacteria 17193
554 Ga0495657_0007303 3300046675 Bacteria 8550
555 Ga0495657_0018070 3300046675 Bacteria 5109
556 Ga0495657_0068042 3300046675 Bacteria 2335
557 Ga0495599_0051104 3300046678 Bacteria 2590
558 Ga0495599_0175117 3300046678 Bacteria 1323
559 Ga0495623_0011914 3300046679 Bacteria 5635
560 Ga0495623_0027516 3300046679 Bacteria 3658
561 Ga0495623_0072871 3300046679 Bacteria 2135
562 Ga0495623_0200114 3300046679 Bacteria 1149
563 Ga0495623_0250043 3300046679 Bacteria 997
564 Ga0495646_0001636 3300046680 Bacteria 13353
565 Ga0495646_0011796 3300046680 Bacteria 5556
566 Ga0495658_0018195 3300046683 Bacteria 3648
567 Ga0495613_0001306 3300046689 Bacteria 19061
568 Ga0495613_0004176 3300046689 Bacteria 10813
569 Ga0495613_0029375 3300046689 Bacteria 4087
570 Ga0495613_0058110 3300046689 Bacteria 2839
571 Ga0495613_0175787 3300046689 Bacteria 1517
572 Ga0495624_0075230 3300046690 Bacteria 2097
573 Ga0495624_0130302 3300046690 Bacteria 1542
574 Ga0495670_0007279 3300046691 Bacteria 5441
575 Ga0495649_0129369 3300046694 Bacteria 1332
576 Ga0495589_0023370 3300046794 Bacteria 3151
577 Ga0495589_0030384 3300046794 Bacteria 2720
578 Ga0495589_0044773 3300046794 Bacteria 2199
579 Ga0495589_0064498 3300046794 Bacteria 1796
580 Ga0495589_0122686 3300046794 Bacteria 1250
581 Ga0495600_0013546 3300046809 Bacteria 5127
582 Ga0495600_0021836 3300046809 Bacteria 4103
583 Ga0495600_0057223 3300046809 Bacteria 2547
584 Ga0495600_0064496 3300046809 Bacteria 2394
585 Ga0495581_0001702 3300047315 Bacteria 12247
586 Ga0495581_0011305 3300047315 Bacteria 5163
587 Ga0495581_0015062 3300047315 Bacteria 4488
588 Ga0495581_0057044 3300047315 Bacteria 2254
589 Ga0495581_0326859 3300047315 Bacteria 896
590 Ga0495604_0001211 3300047317 Bacteria 21264
591 Ga0495604_0004607 3300047317 Bacteria 10923
592 Ga0495604_0009596 3300047317 Bacteria 7654
593 Ga0495604_0021693 3300047317 Bacteria 5128
594 Ga0495604_0022107 3300047317 Bacteria 5076
595 Ga0495604_0034066 3300047317 Bacteria 4029
596 Ga0495636_0001395 3300047318 Bacteria 9117
597 Ga0495636_0001821 3300047318 Bacteria 8155
598 Ga0495636_0016622 3300047318 Bacteria 2940
599 Ga0495636_0054921 3300047318 Bacteria 1674
600 Ga0495636_0081577 3300047318 Bacteria 1393
601 Ga0495674_0122208 3300047319 Bacteria 2199
602 Ga0495672_0030419 3300047320 Bacteria 3388
603 Ga0495676_0006095 3300047321 Bacteria 11087
604 Ga0495676_0006378 3300047321 Bacteria 10868
605 Ga0495676_0026496 3300047321 Bacteria 4989
606 Ga0495676_0030679 3300047321 Bacteria 4556
607 Ga0495680_0023976 3300047322 Bacteria 5068
608 Ga0495687_001939 3300047443 Bacteria 17732
609 Ga0495687_005383 3300047443 Bacteria 8172
610 Ga0495687_043409 3300047443 Bacteria 1958
611 Ga0495687_043860 3300047443 Bacteria 1946
612 Ga0495675_0014848 3300047444 Bacteria 4925
613 Ga0495675_0016868 3300047444 Bacteria 4620
614 Ga0495675_0036473 3300047444 Bacteria 3135
615 Ga0495675_0101022 3300047444 Bacteria 1805
616 Ga0495685_000366 3300047447 Bacteria 14391
617 Ga0495685_002245 3300047447 Bacteria 6019
618 Ga0495685_005998 3300047447 Bacteria 3971
619 Ga0495685_030359 3300047447 Bacteria 1858
620 Ga0495685_050876 3300047447 Bacteria 1406
621 Ga0495681_0000244 3300047470 Bacteria 45285
622 Ga0495681_0001646 3300047470 Bacteria 16583
623 Ga0495684_0021677 3300047471 Bacteria 4947
624 Ga0495684_0112895 3300047471 Bacteria 2049
625 Ga0495686_0193984 3300047472 Bacteria 1169
626 Ga0495593_0006642 3300047673 Bacteria 6769
627 Ga0495602_0032581 3300048088 Bacteria 4905
628 Ga0495614_0006743 3300048089 Bacteria 5140
629 Ga0495615_0024698 3300048090 Bacteria 1389
630 Ga0496100_0038361 3300048903 Bacteria 3035
631 Ga0496101_0004424 3300048904 Bacteria 8843
632 Ga0496101_0086077 3300048904 Bacteria 2330
633 Ga0496101_0248801 3300048904 Bacteria 1385
634 Ga0496102_0000072 3300048905 Bacteria 150284
635 Ga0496102_0001262 3300048905 Bacteria 22825
636 Ga0496102_0216325 3300048905 Bacteria 1806
637 Ga0496102_0528348 3300048905 Bacteria 1102
638 Ga0496103_0000053 3300048906 Bacteria 148944
639 Ga0496104_0044248 3300048907 Bacteria 4183
640 Ga0496105_0629683 3300048908 Bacteria 830
641 Ga0496106_0138934 3300048909 Bacteria 1910
642 Ga0496106_0201711 3300048909 Bacteria 1583
643 Ga0496106_0284451 3300048909 Bacteria 1325
644 Ga0496107_0144284 3300048910 Bacteria 1760
645 Ga0496107_0148337 3300048910 Bacteria 1734
646 Ga0496107_0400601 3300048910 Bacteria 1020
647 Ga0496108_0070849 3300048911 Bacteria 2942
648 Ga0496108_0321196 3300048911 Bacteria 1350
649 Ga0496109_0001713 3300048912 Bacteria 18287
650 Ga0496109_0046548 3300048912 Bacteria 3940
651 Ga0496109_0076809 3300048912 Bacteria 3072
652 Ga0496109_0753766 3300048912 Bacteria 911
653 Ga0496110_0039360 3300048913 Bacteria 4116
654 Ga0496110_0150624 3300048913 Bacteria 2106
655 Ga0496111_0106454 3300048914 Bacteria 2064
656 Ga0496111_0196835 3300048914 Bacteria 1498
657 Ga0496112_0488311 3300048915 Bacteria 1168
658 Ga0496113_0027136 3300048916 Bacteria 4101
659 Ga0496113_0034505 3300048916 Bacteria 3691
660 Ga0496113_0050697 3300048916 Bacteria 3096
661 Ga0496113_0375015 3300048916 Bacteria 1142
662 Ga0496113_0660335 3300048916 Bacteria 836
663 Ga0496114_0010486 3300048917 Bacteria 7374
664 Ga0496114_0024971 3300048917 Bacteria 4880
665 Ga0496114_0133492 3300048917 Bacteria 2145
666 Ga0496114_0501293 3300048917 Bacteria 1074
667 Ga0496118_0301799 3300048921 Bacteria 879
668 Ga0496119_0000287 3300048922 Bacteria 70711
669 Ga0496119_0001906 3300048922 Bacteria 23895
670 Ga0496119_0018434 3300048922 Bacteria 5196
671 Ga0496119_0068757 3300048922 Bacteria 2084
672 Ga0496119_0092923 3300048922 Bacteria 1710
673 Ga0496120_0016091 3300048923 Bacteria 4900
674 Ga0496120_0026492 3300048923 Bacteria 3579
675 Ga0496120_0037272 3300048923 Bacteria 2887
676 Ga0496120_0118128 3300048923 Bacteria 1375
677 Ga0496122_0000911 3300048925 Bacteria 54375
678 Ga0496122_0001286 3300048925 Bacteria 41681
679 Ga0496122_0109159 3300048925 Bacteria 1822
680 Ga0496123_0001055 3300048926 Bacteria 41698
681 Ga0496123_0074172 3300048926 Bacteria 2107
682 Ga0496124_0002228 3300048927 Bacteria 25820
683 Ga0496124_0029110 3300048927 Bacteria 4928
684 Ga0496125_0000172 3300048928 Bacteria 144915
685 Ga0496125_0001197 3300048928 Bacteria 39065
686 Ga0496125_0136819 3300048928 Bacteria 1712
687 Ga0496126_0000006 3300048929 Bacteria 798804
688 Ga0496126_0143757 3300048929 Bacteria 2051
689 Ga0496126_0316588 3300048929 Bacteria 1284
690 Ga0495678_076863 3300049459 Bacteria 1208
691 Ga0501316_003151 3300049532 Bacteria 1583
692 Ga0501316_007283 3300049532 Bacteria 1198
693 Ga0501323_007545 3300049539 Bacteria 1244
694 Ga0501031_0003586 3300049568 Bacteria 9985
695 Ga0501031_0025632 3300049568 Bacteria 3846
696 Ga0501031_0087453 3300049568 Bacteria 2032
697 Ga0501031_0098726 3300049568 Bacteria 1905
698 Ga0501031_0293392 3300049568 Bacteria 1054
699 Ga0501032_0002783 3300049569 Bacteria 13607
700 Ga0501032_0011504 3300049569 Bacteria 6356
701 Ga0501032_0013299 3300049569 Bacteria 5859
702 Ga0501032_0020894 3300049569 Bacteria 4555
703 Ga0501032_0078719 3300049569 Bacteria 2194
704 Ga0501032_0155137 3300049569 Bacteria 1504
705 Ga0501032_0157763 3300049569 Bacteria 1490
706 Ga0501032_0252925 3300049569 Bacteria 1143
707 Ga0501032_0318222 3300049569 Bacteria 1004
708 Ga0501033_0004222 3300049570 Bacteria 11562
709 Ga0501033_0011161 3300049570 Bacteria 6881
710 Ga0501033_0013104 3300049570 Bacteria 6318
711 Ga0501033_0040134 3300049570 Bacteria 3495
712 Ga0501033_0056095 3300049570 Bacteria 2912
713 Ga0501033_0090325 3300049570 Bacteria 2241
714 Ga0501033_0152941 3300049570 Bacteria 1663
715 Ga0501033_0171598 3300049570 Bacteria 1557
716 Ga0501033_0389348 3300049570 Bacteria 973
717 Ga0501034_0011290 3300049571 Bacteria 9267
718 Ga0501034_0011768 3300049571 Bacteria 9054
719 Ga0501034_0013123 3300049571 Bacteria 8539
720 Ga0501034_0047293 3300049571 Bacteria 4345
721 Ga0501034_0049354 3300049571 Bacteria 4246
722 Ga0501034_0051315 3300049571 Bacteria 4159
723 Ga0501034_0054911 3300049571 Bacteria 4009
724 Ga0501034_0068991 3300049571 Bacteria 3546
725 Ga0501034_0072216 3300049571 Bacteria 3459
726 Ga0501034_0077554 3300049571 Bacteria 3328
727 Ga0501034_0243782 3300049571 Bacteria 1743
728 Ga0501036_0016093 3300049572 Bacteria 6250
729 Ga0501036_0020715 3300049572 Bacteria 5524
730 Ga0501036_0021723 3300049572 Bacteria 5395
731 Ga0501036_0023329 3300049572 Bacteria 5211
732 Ga0501036_0470870 3300049572 Bacteria 1046
733 Ga0501037_0002837 3300049573 Bacteria 12560
734 Ga0501037_0009899 3300049573 Bacteria 6994
735 Ga0501037_0034880 3300049573 Bacteria 3711
736 Ga0501037_0180397 3300049573 Bacteria 1498
737 Ga0501037_0466051 3300049573 Bacteria 860
738 Ga0501038_0000236 3300049574 Bacteria 46834
739 Ga0501038_0000642 3300049574 Bacteria 31067
740 Ga0501038_0002092 3300049574 Bacteria 18498
741 Ga0501038_0008112 3300049574 Bacteria 9665
742 Ga0501038_0016192 3300049574 Bacteria 6762
743 Ga0501038_0018752 3300049574 Bacteria 6246
744 Ga0501038_0018834 3300049574 Bacteria 6231
745 Ga0501038_0020044 3300049574 Bacteria 6019
746 Ga0501038_0034542 3300049574 Bacteria 4445
747 Ga0501038_0140967 3300049574 Bacteria 1972
748 Ga0501039_0021706 3300049575 Bacteria 4926
749 Ga0501039_0067064 3300049575 Bacteria 2787
750 Ga0501039_0086631 3300049575 Bacteria 2439
751 Ga0501039_0125731 3300049575 Bacteria 2011
752 Ga0501039_0370043 3300049575 Bacteria 1126
753 Ga0501039_0498598 3300049575 Bacteria 956
754 Ga0501040_0006289 3300049576 Bacteria 7708
755 Ga0501040_0077505 3300049576 Bacteria 2299
756 Ga0501041_0010790 3300049577 Bacteria 5390
757 Ga0501042_0119923 3300049578 Bacteria 1894
758 Ga0501042_0142261 3300049578 Bacteria 1729
759 Ga0501042_0195315 3300049578 Bacteria 1459
760 Ga0501042_0198535 3300049578 Bacteria 1447
761 Ga0501042_0253527 3300049578 Bacteria 1270
762 Ga0501043_0003942 3300049579 Bacteria 12173
763 Ga0501043_0012723 3300049579 Bacteria 6578
764 Ga0501043_0017479 3300049579 Bacteria 5622
765 Ga0501043_0065199 3300049579 Bacteria 2860
766 Ga0501043_0106646 3300049579 Bacteria 2200
767 Ga0501043_0229700 3300049579 Bacteria 1433
768 Ga0501043_0331670 3300049579 Bacteria 1158
769 Ga0501046_0001520 3300049580 Bacteria 22125
770 Ga0501046_0012735 3300049580 Bacteria 7153
771 Ga0501046_0122653 3300049580 Bacteria 1976
772 Ga0501046_0123166 3300049580 Bacteria 1972
773 Ga0501046_0262140 3300049580 Bacteria 1269
774 Ga0501046_0560730 3300049580 Bacteria 813
775 Ga0501047_0000242 3300049581 Bacteria 64647
776 Ga0501047_0002545 3300049581 Bacteria 17375
777 Ga0501047_0013453 3300049581 Bacteria 7757
778 Ga0501047_0020231 3300049581 Bacteria 6391
779 Ga0501047_0036990 3300049581 Bacteria 4718
780 Ga0501047_0047148 3300049581 Bacteria 4164
781 Ga0501047_0049204 3300049581 Bacteria 4070
782 Ga0501047_0056449 3300049581 Bacteria 3797
783 Ga0501047_0057352 3300049581 Bacteria 3766
784 Ga0501047_0074002 3300049581 Bacteria 3279
785 Ga0501047_0093311 3300049581 Bacteria 2889
786 Ga0501047_0498782 3300049581 Bacteria 1044
787 Ga0501048_0000017 3300049582 Bacteria 72572
788 Ga0501048_0005662 3300049582 Bacteria 9503
789 Ga0501048_0011943 3300049582 Bacteria 6473
790 Ga0501048_0025620 3300049582 Bacteria 4299
791 Ga0501067_0042361 3300049583 Bacteria 2528
792 Ga0501068_0026861 3300049584 Bacteria 3395
793 Ga0501068_0031024 3300049584 Bacteria 3174
794 Ga0501068_0270715 3300049584 Bacteria 1084
795 Ga0501069_0126207 3300049585 Bacteria 1463
796 Ga0501070_0005659 3300049586 Bacteria 10653
797 Ga0501070_0029209 3300049586 Bacteria 4624
798 Ga0501070_0041603 3300049586 Bacteria 3828
799 Ga0501070_0139438 3300049586 Bacteria 2002
800 Ga0501070_0360492 3300049586 Bacteria 1179
801 Ga0501070_0556102 3300049586 Bacteria 918
802 Ga0501071_0008875 3300049587 Bacteria 6665
803 Ga0501072_0003634 3300049588 Bacteria 11605
804 Ga0501072_0216488 3300049588 Bacteria 1526
805 Ga0501072_0469874 3300049588 Bacteria 996
806 Ga0501073_0184770 3300049589 Bacteria 1443
807 Ga0501073_0195845 3300049589 Bacteria 1397
808 Ga0501073_0398361 3300049589 Bacteria 951
809 Ga0501074_0093437 3300049590 Bacteria 2154
810 Ga0501074_0347747 3300049590 Bacteria 1052
811 Ga0501076_0002750 3300049592 Bacteria 12180
812 Ga0501076_0860439 3300049592 Bacteria 748
813 Ga0501077_0009068 3300049593 Bacteria 6176
814 Ga0501079_0011123 3300049741 Bacteria 6863
815 Ga0501079_0264761 3300049741 Bacteria 1344
816 Ga0501080_0029049 3300049742 Bacteria 5147
817 Ga0501080_0283111 3300049742 Bacteria 1507
818 Ga0501081_0153760 3300049743 Bacteria 1654
819 Ga0501083_0009247 3300049744 Bacteria 6957
820 Ga0501083_0019054 3300049744 Bacteria 4778
821 Ga0501035_0008203 3300049822 Bacteria 9734
822 Ga0501035_0013623 3300049822 Bacteria 7502
823 Ga0501035_0016971 3300049822 Bacteria 6709
824 Ga0501035_0017639 3300049822 Bacteria 6585
825 Ga0501035_0021024 3300049822 Bacteria 5999
826 Ga0501035_0047883 3300049822 Bacteria 3835
827 Ga0501035_0071919 3300049822 Bacteria 3061
828 Ga0501035_0092344 3300049822 Bacteria 2663
829 Ga0501035_0126030 3300049822 Bacteria 2235
830 Ga0501035_0321880 3300049822 Bacteria 1299
831 Ga0501044_0001763 3300049823 Bacteria 25278
832 Ga0501044_0005221 3300049823 Bacteria 14453
833 Ga0501044_0005946 3300049823 Bacteria 13510
834 Ga0501044_0006363 3300049823 Bacteria 13055
835 Ga0501044_0006713 3300049823 Bacteria 12684
836 Ga0501044_0009459 3300049823 Bacteria 10613
837 Ga0501044_0013559 3300049823 Bacteria 8808
838 Ga0501044_0013651 3300049823 Bacteria 8778
839 Ga0501044_0016458 3300049823 Bacteria 7937
840 Ga0501044_0057165 3300049823 Bacteria 4003
841 Ga0501044_0541364 3300049823 Bacteria 1062
842 Ga0501045_0056529 3300049824 Bacteria 2870
843 Ga0501045_0072361 3300049824 Bacteria 2538
844 Ga0501045_0088426 3300049824 Bacteria 2288
845 Ga0501045_0190144 3300049824 Bacteria 1530
846 nmdc:mga03n38_33572_c1 3300050490 Bacteria 2184
847 nmdc:mga00v17_2658_c1 3300050491 Bacteria 9161
848 nmdc:mga04h51_14526_c1 3300050495 Bacteria 2252
849 nmdc:mga07m45_30018_c3 3300050496 Bacteria 2052
850 nmdc:mga09592_404987_c1 3300050508 Bacteria 1179
851 nmdc:mga0n895_17970_c1 3300050512 Bacteria 6535
852 nmdc:mga0rr50_15996_c1 3300050513 Bacteria 4969
853 nmdc:mga08x19_117413_c1 3300050514 Bacteria 1780
854 nmdc:mga0a205_192749_c1 3300050515 Bacteria 1930
855 Ga0495601_0003606 3300053077 Bacteria 8907
856 Ga0495612_0019542 3300053078 Bacteria 2713
857 Ga0495612_0035189 3300053078 Bacteria 2029
858 Ga0495619_0034364 3300053085 Bacteria 3296
859 Ga0495619_0052281 3300053085 Bacteria 2700
860 Ga0495619_0143557 3300053085 Bacteria 1645
861 Ga0500644_0043545 3300053088 Bacteria 1502
862 Ga0500651_0233972 3300053093 Bacteria 1074
863 Ga0500566_0017617 3300053094 Bacteria 4197
864 Ga0500640_014535 3300053095 Bacteria 3279
865 Ga0500560_014684 3300053107 Bacteria 2094
866 Ga0500562_046540 3300053108 Bacteria 1157
867 Ga0500569_001652 3300053109 Bacteria 4250
868 Ga0500652_001263 3300053131 Bacteria 8037
869 Ga0500655_031140 3300053133 Bacteria 1028
870 Ga0500559_0000929 3300053136 Bacteria 18495
871 Ga0500559_0019924 3300053136 Bacteria 2835
872 Ga0500561_0000299 3300053137 Bacteria 8535
873 Ga0500573_0000007 3300053140 Bacteria 272970
874 Ga0500573_0021820 3300053140 Bacteria 3674
875 Ga0500573_0075010 3300053140 Bacteria 1926
876 Ga0500577_0067301 3300053142 Bacteria 1396
877 Ga0500588_0029040 3300053146 Bacteria 1574
878 Ga0500600_0009099 3300053149 Bacteria 5990
879 Ga0500600_0093442 3300053149 Bacteria 1601
880 Ga0500616_0009856 3300053153 Bacteria 5758
881 Ga0500616_0019007 3300053153 Bacteria 3879
882 Ga0500624_002698 3300053157 Bacteria 2363
883 Ga0500633_0000386 3300053160 Bacteria 6799
884 Ga0500634_0000473 3300053161 Bacteria 13030
885 Ga0500656_000142 3300053732 Bacteria 4385
886 Ga0500587_000104 3300053739 Bacteria 7496
887 Ga0501084_0040371 3300054114 Bacteria 3903
888 Ga0501084_0111344 3300054114 Bacteria 2301
889 Ga0501084_0144427 3300054114 Bacteria 2004
890 Ga0501084_0329255 3300054114 Bacteria 1290
891 Ga0501082_0001659 3300060353 Bacteria 19597
892 Ga0501082_0006677 3300060353 Bacteria 9982
893 Ga0501082_0030518 3300060353 Bacteria 4645
894 Ga0501082_0151126 3300060353 Bacteria 2017
895 Ga0466962_0000264 3300061719 Bacteria 22152
896 Ga0466962_0002007 3300061719 Bacteria 9618
897 Ga0466962_0003662 3300061719 Bacteria 7330
898 Ga0466962_0024435 3300061719 Bacteria 2902
899 Ga0466962_0101381 3300061719 Bacteria 1382
900 Ga0466962_0133557 3300061719 Bacteria 1200
901 Ga0530510_0009623 3300061734 Bacteria 6779
902 Ga0530510_0263182 3300061734 Bacteria 1286

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046524 Ga0495648_0332640 Ga0495648_0332640_64_687 203
2 3300048904 Ga0496101_0086077 Ga0496101_0086077_703_1515 209
3 3300048905 Ga0496102_0001262 Ga0496102_0001262_1776_2588 209
4 3300048909 Ga0496106_0284451 Ga0496106_0284451_470_1282 209
5 3300048910 Ga0496107_0400601 Ga0496107_0400601_111_923 209
6 3300048917 Ga0496114_0024971 Ga0496114_0024971_2093_2905 209
7 3300021388 Ga0213875_10000071 Ga0213875_1000007155 218
8 3300049578 Ga0501042_0198535 Ga0501042_0198535_178_912 218
9 3300049592 Ga0501076_0860439 Ga0501076_0860439_67_729 220
10 3300009098 Ga0105245_10574172 Ga0105245_105741722 221
11 3300037853 Ga0436364_0619304 Ga0436364_0619304_59025_59759 221
12 3300046674 Ga0495588_0121383 Ga0495588_0121383_700_1365 221
13 3300020082 Ga0206353_10114382 Ga0206353_101143822 222
14 3300025919 Ga0207657_10240635 Ga0207657_102406352 222
15 3300006051 Ga0075364_10003377 Ga0075364_100033772 223
16 3300013102 Ga0157371_10004092 Ga0157371_100040929 229
17 3300044658 Ga0466972_0009202 Ga0466972_0009202_2529_3230 229
18 3300044658 Ga0466972_0038057 Ga0466972_0038057_327_1028 229
19 3300044683 Ga0466965_0000544 Ga0466965_0000544_7444_8145 229
20 3300044683 Ga0466965_0003850 Ga0466965_0003850_5394_6095 229
21 3300044683 Ga0466965_0055567 Ga0466965_0055567_1140_1841 229
22 3300044735 Ga0466968_0108827 Ga0466968_0108827_369_1070 229
23 3300044901 Ga0466960_0002663 Ga0466960_0002663_25_726 229
24 3300049588 Ga0501072_0469874 Ga0501072_0469874_156_857 229
25 3300005440 Ga0070705_100153705 Ga0070705_1001537051 230
26 3300005615 Ga0070702_100000907 Ga0070702_10000090710 230
27 3300009148 Ga0105243_10097794 Ga0105243_100977942 230
28 3300009176 Ga0105242_10055393 Ga0105242_100553935 230
29 3300009551 Ga0105238_10060498 Ga0105238_100604983 230
30 3300009553 Ga0105249_10577107 Ga0105249_105771071 230
31 3300013297 Ga0157378_10291884 Ga0157378_102918841 230
32 3300013306 Ga0163162_10436577 Ga0163162_104365771 230
33 3300014968 Ga0157379_10170874 Ga0157379_101708743 230
34 3300025972 Ga0207668_10055981 Ga0207668_100559813 230
35 3300026121 Ga0207683_10152206 Ga0207683_101522061 230
36 3300044656 Ga0466969_0126177 Ga0466969_0126177_116_847 230
37 3300045976 Ga0466967_0005297 Ga0466967_0005297_7524_8255 231
38 3300046454 Ga0495592_0015690 Ga0495592_0015690_4133_4846 231
39 3300046462 Ga0495651_0001024 Ga0495651_0001024_1035_1748 231
40 3300046463 Ga0495653_0005610 Ga0495653_0005610_7490_8203 231
41 3300046472 Ga0495580_0038672 Ga0495580_0038672_1010_1723 231
42 3300046476 Ga0495662_0001508 Ga0495662_0001508_5047_5760 231
43 3300046477 Ga0495664_0023458 Ga0495664_0023458_2422_3135 231
44 3300046511 Ga0495608_0021342 Ga0495608_0021342_1744_2457 231
45 3300046516 Ga0495628_0022766 Ga0495628_0022766_2219_2932 231
46 3300046517 Ga0495630_0042372 Ga0495630_0042372_2625_3338 231
47 3300046526 Ga0495666_0000276 Ga0495666_0000276_20318_21031 231
48 3300046529 Ga0495652_0022724 Ga0495652_0022724_3070_3783 231
49 3300046531 Ga0495665_0048588 Ga0495665_0048588_513_1226 231
50 3300046535 Ga0495586_0009432 Ga0495586_0009432_1643_2356 231
51 3300046536 Ga0495587_0014977 Ga0495587_0014977_2098_2811 231
52 3300046543 Ga0495645_0008635 Ga0495645_0008635_3934_4647 231
53 3300046642 Ga0495634_0021694 Ga0495634_0021694_1655_2368 231
54 3300046663 Ga0495635_0016123 Ga0495635_0016123_2625_3338 231
55 3300046675 Ga0495657_0007303 Ga0495657_0007303_5229_5942 231
56 3300046678 Ga0495599_0051104 Ga0495599_0051104_843_1556 231
57 3300046679 Ga0495623_0027516 Ga0495623_0027516_1066_1779 231
58 3300046680 Ga0495646_0011796 Ga0495646_0011796_2625_3338 231
59 3300046689 Ga0495613_0029375 Ga0495613_0029375_1162_1875 231
60 3300046809 Ga0495600_0057223 Ga0495600_0057223_1066_1779 231
61 3300047315 Ga0495581_0011305 Ga0495581_0011305_2802_3515 231
62 3300047317 Ga0495604_0001211 Ga0495604_0001211_1776_2489 231
63 3300047444 Ga0495675_0036473 Ga0495675_0036473_1197_1910 231
64 3300053085 Ga0495619_0052281 Ga0495619_0052281_584_1297 231
65 3300005544 Ga0070686_100126260 Ga0070686_1001262602 232
66 iso_pu_bacteria 2643221692 2644518282 232
67 iso_pu_bacteria 2675903058 2676476792 232
68 iso_pu_bacteria 2827628540 2827630118 232
69 iso_pu_bacteria 2767802112 2768646841 234
70 iso_pu_bacteria 2867346516 2867351219 234
71 iso_pu_bacteria 2558860280 2559429917 235
72 iso_pu_bacteria 2643221681 2644457438 235
73 iso_pu_bacteria 2643221961 2645719339 235
74 iso_pu_bacteria 2643221962 2645726255 235
75 iso_pu_bacteria 2795385470 2795783252 235
76 iso_pu_bacteria 2899370129 2899371780 235
77 iso_pu_bacteria 3002998708 3003007089 235
78 iso_pu_bacteria 8053945823 8053947382 235
79 3300014745 Ga0157377_10347686 Ga0157377_103476862 236
80 3300035398 Ga0316574_0141240 Ga0316574_0141240_502_1215 236
81 3300036647 Ga0316582_0058991 Ga0316582_0058991_777_1490 236
82 3300036712 Ga0316584_0028637 Ga0316584_0028637_839_1552 236
83 3300037588 Ga0316581_0051225 Ga0316581_0051225_352_1065 236
84 iso_pu_bacteria 2558860112 2558912085 236
85 iso_pu_bacteria 2585427649 2586059576 236
86 iso_pu_bacteria 2643221613 2644081692 236
87 iso_pu_bacteria 2643221721 2644665265 236
88 iso_pu_bacteria 2643221722 2644671291 236
89 iso_pu_bacteria 2738543011 2739240497 236
90 iso_pu_bacteria 2744054611 2744955040 236
91 iso_pu_bacteria 2791354901 2791913491 236
92 iso_pu_bacteria 2808606375 2808919104 236
93 iso_pu_bacteria 2808606522 2809591660 236
94 iso_pu_bacteria 2835188231 2835189344 236
95 iso_pu_bacteria 2839986021 2839986329 236
96 iso_pu_bacteria 2842888712 2842891855 236
97 iso_pu_bacteria 2862507626 2862513617 236
98 iso_pu_bacteria 2870782633 2870789820 236
99 iso_pu_bacteria 2884994152 2884995154 236
100 iso_pu_bacteria 2887443736 2887447574 236
101 iso_pu_bacteria 2889300758 2889302092 236
102 iso_pu_bacteria 2904765812 2904769286 236
103 iso_pu_bacteria 2904770941 2904772842 236
104 iso_pu_bacteria 2908811453 2908814352 236
105 iso_pu_bacteria 2912715099 2912721707 236
106 iso_pu_bacteria 2919420072 2919422793 236
107 iso_pu_bacteria 2919432681 2919434954 236
108 iso_pu_bacteria 2935890801 2935891429 236
109 iso_pu_bacteria 2939743619 2939748080 236
110 iso_pu_bacteria 2956939328 2956941278 236
111 iso_pu_bacteria 3001119090 3001120294 236
112 3300005327 Ga0070658_10008378 Ga0070658_100083782 237
113 3300005435 Ga0070714_100685964 Ga0070714_1006859641 237
114 3300005614 Ga0068856_100101506 Ga0068856_1001015062 237
115 3300005614 Ga0068856_100154063 Ga0068856_1001540635 237
116 3300005985 Ga0081539_10004512 Ga0081539_100045123 237
117 3300006175 Ga0070712_100397857 Ga0070712_1003978572 237
118 3300013105 Ga0157369_10118308 Ga0157369_101183082 237
119 3300013307 Ga0157372_10912574 Ga0157372_109125741 237
120 3300025909 Ga0207705_10193151 Ga0207705_101931512 237
121 3300025911 Ga0207654_10132764 Ga0207654_101327642 237
122 3300025929 Ga0207664_10562169 Ga0207664_105621692 237
123 3300026078 Ga0207702_10130418 Ga0207702_101304183 237
124 3300026142 Ga0207698_10196474 Ga0207698_101964742 237
125 3300035207 Ga0373942_0057929 Ga0373942_0057929_100_822 237
126 3300037312 Ga0395899_0012802 Ga0395899_0012802_290_1024 237
127 3300044683 Ga0466965_0140284 Ga0466965_0140284_471_1202 237
128 3300044694 Ga0466963_0321552 Ga0466963_0321552_274_1005 237
129 3300045836 Ga0466958_0322136 Ga0466958_0322136_225_959 237
130 3300045976 Ga0466967_0278286 Ga0466967_0278286_299_1030 237
131 3300045976 Ga0466967_0701272 Ga0466967_0701272_145_858 237
132 3300048912 Ga0496109_0001713 Ga0496109_0001713_16249_16962 237
133 3300048912 Ga0496109_0753766 Ga0496109_0753766_142_873 237
134 3300048913 Ga0496110_0150624 Ga0496110_0150624_1309_2034 237
135 3300048916 Ga0496113_0375015 Ga0496113_0375015_193_918 237
136 3300048922 Ga0496119_0000287 Ga0496119_0000287_68133_68846 237
137 3300048923 Ga0496120_0016091 Ga0496120_0016091_1581_2294 237
138 3300049822 Ga0501035_0321880 Ga0501035_0321880_142_855 237
139 iso_pu_bacteria 2547132111 2547409663 237
140 iso_pu_bacteria 2554235005 2554259044 237
141 iso_pu_bacteria 2582581313 2585306730 237
142 iso_pu_bacteria 2582581314 2585314159 237
143 iso_pu_bacteria 2643221647 2644271049 237
144 iso_pu_bacteria 2643221678 2644435716 237
145 iso_pu_bacteria 2643221679 2644446373 237
146 iso_pu_bacteria 2643221714 2644629458 237
147 iso_pu_bacteria 2731639228 2731905581 237
148 iso_pu_bacteria 2773857759 2774383400 237
149 iso_pu_bacteria 2784132109 2784472452 237
150 iso_pu_bacteria 2784132148 2784587310 237
151 iso_pu_bacteria 2784746763 2785345016 237
152 iso_pu_bacteria 2799112218 2799186091 237
153 iso_pu_bacteria 2802429296 2804844327 237
154 iso_pu_bacteria 2808606359 2808840525 237
155 iso_pu_bacteria 2808606448 2809230883 237
156 iso_pu_bacteria 2808606982 2811847535 237
157 iso_pu_bacteria 2811994917 2812481782 237
158 iso_pu_bacteria 2818991472 2819743331 237
159 iso_pu_bacteria 2848551377 2848553060 237
160 iso_pu_bacteria 2857729791 2857733570 237
161 iso_pu_bacteria 2857737099 2857738625 237
162 iso_pu_bacteria 2862290372 2862296601 237
163 iso_pu_bacteria 2862382967 2862385430 237
164 iso_pu_bacteria 2863404153 2863406278 237
165 iso_pu_bacteria 2867428634 2867430736 237
166 iso_pu_bacteria 2873151551 2873157090 237
167 iso_pu_bacteria 2895660088 2895662776 237
168 iso_pu_bacteria 2905926851 2905930257 237
169 iso_pu_bacteria 2912723979 2912725553 237
170 iso_pu_bacteria 2919446982 2919450786 237
171 iso_pu_bacteria 2919468124 2919473029 237
172 iso_pu_bacteria 2920879853 2920883714 237
173 iso_pu_bacteria 2935390628 2935396217 237
174 iso_pu_bacteria 2939660829 2939663744 237
175 iso_pu_bacteria 2946003308 2946004044 237
176 iso_pu_bacteria 2946072368 2946074521 237
177 iso_pu_bacteria 2947224130 2947231124 237
178 iso_pu_bacteria 2954002825 2954004433 237
179 iso_pu_bacteria 2954380949 2954387881 237
180 iso_pu_bacteria 2954691527 2954698694 237
181 iso_pu_bacteria 2954701450 2954703529 237
182 iso_pu_bacteria 2954711539 2954717666 237
183 iso_pu_bacteria 2954721474 2954727632 237
184 iso_pu_bacteria 2954731030 2954734170 237
185 iso_pu_bacteria 2954740390 2954746526 237
186 iso_pu_bacteria 2954749733 2954753054 237
187 iso_pu_bacteria 2954759201 2954765642 237
188 iso_pu_bacteria 2964326757 2964327070 237
189 iso_pu_bacteria 2977251589 2977253589 237
190 iso_pu_bacteria 2990059506 2990064308 237
191 iso_pu_bacteria 3006321560 3006322375 237
192 iso_pu_bacteria 3006493962 3006495476 237
193 iso_pu_bacteria 8004021418 8004022914 237
194 iso_pu_bacteria 8004025490 8004026133 237
195 iso_pu_bacteria 8008558824 8008562030 237
196 iso_pu_bacteria 8008574985 8008580149 237
197 iso_pu_bacteria 8025413630 8025417010 237
198 iso_pu_bacteria 8025478263 8025479909 237
199 iso_pu_bacteria 8046352972 8046356061 237
200 iso_pu_bacteria 8048406513 8048410053 237
201 iso_pu_bacteria 8056447290 8056450122 237
202 iso_pu_bacteria 8056829672 8056831157 237
203 3300005441 Ga0070700_100000007 Ga0070700_100000007131 238
204 3300006880 Ga0075429_100326061 Ga0075429_1003260613 238
205 3300009545 Ga0105237_10612707 Ga0105237_106127072 238
206 3300025914 Ga0207671_10489531 Ga0207671_104895312 238
207 3300026075 Ga0207708_10000006 Ga0207708_1000000647 238
208 3300030742 Ga0316183_1045511 Ga0316183_10455113 238
209 3300030744 Ga0316181_1125033 Ga0316181_11250333 238
210 3300030745 Ga0316182_1357079 Ga0316182_13570795 238
211 3300031665 Ga0316575_10029147 Ga0316575_100291473 238
212 3300031727 Ga0316576_10000880 Ga0316576_100008809 238
213 3300031727 Ga0316576_10020558 Ga0316576_100205586 238
214 3300031728 Ga0316578_10051659 Ga0316578_100516593 238
215 3300031733 Ga0316577_10032890 Ga0316577_100328903 238
216 3300032133 Ga0316583_10013089 Ga0316583_100130894 238
217 3300032137 Ga0316585_10009189 Ga0316585_100091894 238
218 3300032139 Ga0316580_10010121 Ga0316580_100101212 238
219 3300038443 Ga0395901_0003409 Ga0395901_0003409_9462_10187 238
220 3300045976 Ga0466967_0480116 Ga0466967_0480116_257_994 238
221 3300048911 Ga0496108_0321196 Ga0496108_0321196_362_1099 238
222 3300048917 Ga0496114_0501293 Ga0496114_0501293_50_814 238
223 3300048929 Ga0496126_0316588 Ga0496126_0316588_306_1031 238
224 3300049575 Ga0501039_0125731 Ga0501039_0125731_1084_1815 238
225 3300049578 Ga0501042_0253527 Ga0501042_0253527_424_1155 238
226 3300050508 nmdc:mga09592_404987_c1 nmdc:mga09592_404987_c1_250_978 238
227 iso_pu_bacteria 2582581312 2585302063 238
228 iso_pu_bacteria 2643221670 2644387453 238
229 iso_pu_bacteria 2784746768 2785367861 238
230 iso_pu_bacteria 2786546132 2786668915 238
231 iso_pu_bacteria 2857479173 2857479258 238
232 iso_pu_bacteria 2862178590 2862183017 238
233 iso_pu_bacteria 2862574272 2862583010 238
234 iso_pu_bacteria 2868088558 2868089157 238
235 iso_pu_bacteria 2918501144 2918503125 238
236 iso_pu_bacteria 2954673503 2954675196 238
237 iso_pu_bacteria 2954682443 2954688939 238
238 3300003285 Ga0007423J48922_100139 Ga0007423J48922_10013929 239
239 3300005327 Ga0070658_10001257 Ga0070658_1000125718 239
240 3300005327 Ga0070658_10015310 Ga0070658_100153103 239
241 3300005327 Ga0070658_10199462 Ga0070658_101994622 239
242 3300005327 Ga0070658_10602833 Ga0070658_106028331 239
243 3300005336 Ga0070680_100224733 Ga0070680_1002247333 239
244 3300005339 Ga0070660_100098521 Ga0070660_1000985211 239
245 3300005339 Ga0070660_100153009 Ga0070660_1001530091 239
246 3300005435 Ga0070714_100004987 Ga0070714_1000049877 239
247 3300005437 Ga0070710_10000044 Ga0070710_1000004444 239
248 3300005455 Ga0070663_100117229 Ga0070663_1001172292 239
249 3300005458 Ga0070681_10091626 Ga0070681_100916265 239
250 3300005458 Ga0070681_10908481 Ga0070681_109084811 239
251 3300005530 Ga0070679_100007399 Ga0070679_1000073997 239
252 3300005539 Ga0068853_100022098 Ga0068853_1000220983 239
253 3300005563 Ga0068855_100099049 Ga0068855_1000990493 239
254 3300005840 Ga0068870_10202948 Ga0068870_102029481 239
255 3300005937 Ga0081455_10000443 Ga0081455_1000044358 239
256 3300005983 Ga0081540_1004894 Ga0081540_10048943 239
257 3300005985 Ga0081539_10008926 Ga0081539_100089264 239
258 3300005985 Ga0081539_10133842 Ga0081539_101338422 239
259 3300006931 Ga0097620_100051607 Ga0097620_1000516076 239
260 3300009093 Ga0105240_10504435 Ga0105240_105044351 239
261 3300009098 Ga0105245_10474514 Ga0105245_104745142 239
262 3300009101 Ga0105247_10001304 Ga0105247_1000130413 239
263 3300009551 Ga0105238_10047653 Ga0105238_100476536 239
264 3300009551 Ga0105238_10367498 Ga0105238_103674982 239
265 3300009553 Ga0105249_10685609 Ga0105249_106856092 239
266 3300011119 Ga0105246_10227605 Ga0105246_102276052 239
267 3300013104 Ga0157370_10004259 Ga0157370_1000425918 239
268 3300013104 Ga0157370_10038416 Ga0157370_100384167 239
269 3300013105 Ga0157369_10016379 Ga0157369_100163795 239
270 3300013105 Ga0157369_10199185 Ga0157369_101991852 239
271 3300013306 Ga0163162_10292191 Ga0163162_102921912 239
272 3300013307 Ga0157372_10000079 Ga0157372_1000007912 239
273 3300014326 Ga0157380_10973232 Ga0157380_109732321 239
274 3300020081 Ga0206354_10024324 Ga0206354_100243242 239
275 3300020082 Ga0206353_10447514 Ga0206353_104475144 239
276 3300020082 Ga0206353_10600692 Ga0206353_106006922 239
277 3300021358 Ga0213873_10000058 Ga0213873_100000582 239
278 3300021388 Ga0213875_10081951 Ga0213875_100819512 239
279 3300025898 Ga0207692_10000357 Ga0207692_1000035714 239
280 3300025900 Ga0207710_10023559 Ga0207710_100235593 239
281 3300025901 Ga0207688_10368977 Ga0207688_103689771 239
282 3300025908 Ga0207643_10040861 Ga0207643_100408614 239
283 3300025909 Ga0207705_10000001 Ga0207705_100000012027 239
284 3300025909 Ga0207705_10209977 Ga0207705_102099771 239
285 3300025912 Ga0207707_10060501 Ga0207707_100605015 239
286 3300025913 Ga0207695_10604979 Ga0207695_106049792 239
287 3300025917 Ga0207660_10161899 Ga0207660_101618993 239
288 3300025919 Ga0207657_10106689 Ga0207657_101066894 239
289 3300025921 Ga0207652_10173637 Ga0207652_101736372 239
290 3300025921 Ga0207652_10206926 Ga0207652_102069263 239
291 3300025924 Ga0207694_10054186 Ga0207694_100541864 239
292 3300025928 Ga0207700_10345017 Ga0207700_103450172 239
293 3300025929 Ga0207664_10000091 Ga0207664_1000009115 239
294 3300025929 Ga0207664_10023671 Ga0207664_100236714 239
295 3300025932 Ga0207690_10017351 Ga0207690_100173515 239
296 3300025935 Ga0207709_10029752 Ga0207709_100297522 239
297 3300025938 Ga0207704_10257852 Ga0207704_102578522 239
298 3300025949 Ga0207667_10057590 Ga0207667_100575902 239
299 3300025972 Ga0207668_10429322 Ga0207668_104293222 239
300 3300026041 Ga0207639_10055224 Ga0207639_100552243 239
301 3300026067 Ga0207678_10023532 Ga0207678_100235324 239
302 3300026078 Ga0207702_10505883 Ga0207702_105058832 239
303 3300026078 Ga0207702_10514038 Ga0207702_105140382 239
304 3300026116 Ga0207674_10015577 Ga0207674_100155775 239
305 3300026118 Ga0207675_100073159 Ga0207675_1000731593 239
306 3300026121 Ga0207683_10328499 Ga0207683_103284992 239
307 3300030521 Ga0307511_10001719 Ga0307511_1000171925 239
308 3300030732 Ga0316176_1150059 Ga0316176_115005911 239
309 3300030733 Ga0314311_1039871 Ga0314311_10398712 239
310 3300030735 Ga0316178_1163203 Ga0316178_11632032 239
311 3300030736 Ga0316180_1049974 Ga0316180_10499742 239
312 3300031247 Ga0265340_10003524 Ga0265340_100035247 239
313 3300031456 Ga0307513_10000483 Ga0307513_100004834 239
314 3300031507 Ga0307509_10053988 Ga0307509_100539882 239
315 3300031548 Ga0307408_100100359 Ga0307408_1001003591 239
316 3300031548 Ga0307408_100583191 Ga0307408_1005831911 239
317 3300031665 Ga0316575_10001025 Ga0316575_1000102511 239
318 3300031665 Ga0316575_10002244 Ga0316575_100022448 239
319 3300031665 Ga0316575_10129354 Ga0316575_101293542 239
320 3300031691 Ga0316579_10001944 Ga0316579_100019447 239
321 3300031727 Ga0316576_10005583 Ga0316576_100055838 239
322 3300031727 Ga0316576_10047954 Ga0316576_100479542 239
323 3300031728 Ga0316578_10019894 Ga0316578_100198945 239
324 3300031728 Ga0316578_10184467 Ga0316578_101844672 239
325 3300031731 Ga0307405_10142830 Ga0307405_101428302 239
326 3300031733 Ga0316577_10099308 Ga0316577_100993081 239
327 3300031852 Ga0307410_10054604 Ga0307410_100546045 239
328 3300031852 Ga0307410_10120873 Ga0307410_101208732 239
329 3300031852 Ga0307410_10217344 Ga0307410_102173441 239
330 3300031901 Ga0307406_10128713 Ga0307406_101287132 239
331 3300031903 Ga0307407_10253504 Ga0307407_102535043 239
332 3300031911 Ga0307412_10015695 Ga0307412_100156955 239
333 3300031911 Ga0307412_10052924 Ga0307412_100529244 239
334 3300031911 Ga0307412_10548421 Ga0307412_105484212 239
335 3300031995 Ga0307409_100003904 Ga0307409_1000039048 239
336 3300031995 Ga0307409_100038860 Ga0307409_1000388602 239
337 3300031995 Ga0307409_100598414 Ga0307409_1005984141 239
338 3300031995 Ga0307409_100649547 Ga0307409_1006495472 239
339 3300032002 Ga0307416_100012870 Ga0307416_1000128705 239
340 3300032002 Ga0307416_100370147 Ga0307416_1003701472 239
341 3300032002 Ga0307416_100427894 Ga0307416_1004278941 239
342 3300032137 Ga0316585_10003252 Ga0316585_100032522 239
343 3300035398 Ga0316574_0004754 Ga0316574_0004754_2901_3650 239
344 3300036647 Ga0316582_0007848 Ga0316582_0007848_84_833 239
345 3300036647 Ga0316582_0246618 Ga0316582_0246618_319_1053 239
346 3300036712 Ga0316584_0003071 Ga0316584_0003071_6648_7397 239
347 3300036712 Ga0316584_0179957 Ga0316584_0179957_723_1457 239
348 3300037068 Ga0373925_0130767 Ga0373925_0130767_333_1064 239
349 3300037312 Ga0395899_0011707 Ga0395899_0011707_1953_2693 239
350 3300037312 Ga0395899_0133485 Ga0395899_0133485_940_1680 239
351 3300037418 Ga0395900_0054388 Ga0395900_0054388_2269_3009 239
352 3300037418 Ga0395900_0059411 Ga0395900_0059411_2563_3303 239
353 3300037466 Ga0395898_0003138 Ga0395898_0003138_16195_16935 239
354 3300037466 Ga0395898_0151883 Ga0395898_0151883_956_1696 239
355 3300037471 Ga0395905_0024507 Ga0395905_0024507_133_873 239
356 3300037853 Ga0436364_1193326 Ga0436364_1193326_5028_5765 239
357 3300038443 Ga0395901_0011881 Ga0395901_0011881_7677_8417 239
358 3300038443 Ga0395901_0100620 Ga0395901_0100620_280_1017 239
359 3300038443 Ga0395901_0116605 Ga0395901_0116605_2023_2763 239
360 3300039437 Ga0436365_1156973 Ga0436365_1156973_497_1228 239
361 3300041443 Ga0451789_0675791 Ga0451789_0675791_508_1263 239
362 3300041456 Ga0451795_0121483 Ga0451795_0121483_116_886 239
363 3300041498 Ga0451841_1174457 Ga0451841_1174457_163_933 239
364 3300041509 Ga0451843_1293141 Ga0451843_1293141_1031_1801 239
365 3300044656 Ga0466969_0063271 Ga0466969_0063271_249_980 239
366 3300044656 Ga0466969_0082283 Ga0466969_0082283_141_872 239
367 3300044683 Ga0466965_0091716 Ga0466965_0091716_516_1265 239
368 3300044684 Ga0466966_0000853 Ga0466966_0000853_11712_12443 239
369 3300044693 Ga0466961_0024952 Ga0466961_0024952_882_1613 239
370 3300044693 Ga0466961_0094173 Ga0466961_0094173_500_1243 239
371 3300044694 Ga0466963_0020362 Ga0466963_0020362_2417_3148 239
372 3300044694 Ga0466963_0314793 Ga0466963_0314793_369_1088 239
373 3300044719 Ga0466971_0013856 Ga0466971_0013856_1883_2602 239
374 3300044719 Ga0466971_0033927 Ga0466971_0033927_258_989 239
375 3300044735 Ga0466968_0000913 Ga0466968_0000913_828_1559 239
376 3300044765 Ga0466970_0002247 Ga0466970_0002247_7775_8506 239
377 3300044765 Ga0466970_0002697 Ga0466970_0002697_481_1212 239
378 3300044765 Ga0466970_0016567 Ga0466970_0016567_1609_2328 239
379 3300044842 Ga0466957_0262665 Ga0466957_0262665_243_989 239
380 3300044842 Ga0466957_0286834 Ga0466957_0286834_173_904 239
381 3300044901 Ga0466960_0005164 Ga0466960_0005164_3125_3859 239
382 3300044901 Ga0466960_0024045 Ga0466960_0024045_551_1285 239
383 3300044901 Ga0466960_0298100 Ga0466960_0298100_117_848 239
384 3300045049 Ga0466959_0003628 Ga0466959_0003628_702_1433 239
385 3300045836 Ga0466958_0004524 Ga0466958_0004524_6083_6802 239
386 3300045836 Ga0466958_0030508 Ga0466958_0030508_1464_2195 239
387 3300045976 Ga0466967_0229605 Ga0466967_0229605_959_1678 239
388 3300046460 Ga0495638_0064804 Ga0495638_0064804_1167_1913 239
389 3300047320 Ga0495672_0030419 Ga0495672_0030419_2208_2927 239
390 3300048903 Ga0496100_0038361 Ga0496100_0038361_1112_1858 239
391 3300048904 Ga0496101_0004424 Ga0496101_0004424_2094_2840 239
392 3300048905 Ga0496102_0000072 Ga0496102_0000072_66026_66757 239
393 3300048905 Ga0496102_0528348 Ga0496102_0528348_70_816 239
394 3300048906 Ga0496103_0000053 Ga0496103_0000053_146094_146825 239
395 3300048907 Ga0496104_0044248 Ga0496104_0044248_2260_3006 239
396 3300048909 Ga0496106_0138934 Ga0496106_0138934_279_1016 239
397 3300048910 Ga0496107_0148337 Ga0496107_0148337_812_1558 239
398 3300048912 Ga0496109_0076809 Ga0496109_0076809_2004_2750 239
399 3300048913 Ga0496110_0039360 Ga0496110_0039360_3279_4025 239
400 3300048914 Ga0496111_0106454 Ga0496111_0106454_565_1311 239
401 3300048916 Ga0496113_0027136 Ga0496113_0027136_2096_2818 239
402 3300048916 Ga0496113_0034505 Ga0496113_0034505_196_942 239
403 3300048916 Ga0496113_0050697 Ga0496113_0050697_2024_2770 239
404 3300048917 Ga0496114_0010486 Ga0496114_0010486_1810_2544 239
405 3300048917 Ga0496114_0133492 Ga0496114_0133492_1194_1931 239
406 3300048921 Ga0496118_0301799 Ga0496118_0301799_60_806 239
407 3300048922 Ga0496119_0001906 Ga0496119_0001906_18935_19681 239
408 3300048922 Ga0496119_0018434 Ga0496119_0018434_2247_2993 239
409 3300048922 Ga0496119_0068757 Ga0496119_0068757_884_1615 239
410 3300048922 Ga0496119_0092923 Ga0496119_0092923_703_1455 239
411 3300048923 Ga0496120_0026492 Ga0496120_0026492_2698_3444 239
412 3300048923 Ga0496120_0037272 Ga0496120_0037272_1926_2657 239
413 3300048923 Ga0496120_0118128 Ga0496120_0118128_533_1279 239
414 3300048925 Ga0496122_0000911 Ga0496122_0000911_5425_6177 239
415 3300048925 Ga0496122_0001286 Ga0496122_0001286_7747_8487 239
416 3300048925 Ga0496122_0109159 Ga0496122_0109159_114_836 239
417 3300048926 Ga0496123_0001055 Ga0496123_0001055_33195_33935 239
418 3300048926 Ga0496123_0074172 Ga0496123_0074172_380_1105 239
419 3300048927 Ga0496124_0002228 Ga0496124_0002228_7700_8440 239
420 3300048927 Ga0496124_0029110 Ga0496124_0029110_2567_3292 239
421 3300048928 Ga0496125_0000172 Ga0496125_0000172_102059_102811 239
422 3300048928 Ga0496125_0001197 Ga0496125_0001197_6561_7301 239
423 3300048929 Ga0496126_0000006 Ga0496126_0000006_783530_784273 239
424 3300049532 Ga0501316_003151 Ga0501316_003151_416_1159 239
425 3300049569 Ga0501032_0011504 Ga0501032_0011504_4787_5515 239
426 3300049569 Ga0501032_0020894 Ga0501032_0020894_719_1459 239
427 3300049570 Ga0501033_0040134 Ga0501033_0040134_919_1659 239
428 3300049571 Ga0501034_0011290 Ga0501034_0011290_5866_6606 239
429 3300049571 Ga0501034_0013123 Ga0501034_0013123_2312_3040 239
430 3300049571 Ga0501034_0051315 Ga0501034_0051315_3193_3930 239
431 3300049571 Ga0501034_0068991 Ga0501034_0068991_2101_2838 239
432 3300049571 Ga0501034_0077554 Ga0501034_0077554_255_1001 239
433 3300049572 Ga0501036_0020715 Ga0501036_0020715_795_1535 239
434 3300049572 Ga0501036_0470870 Ga0501036_0470870_258_1004 239
435 3300049573 Ga0501037_0009899 Ga0501037_0009899_5270_6016 239
436 3300049573 Ga0501037_0034880 Ga0501037_0034880_1157_1885 239
437 3300049574 Ga0501038_0000236 Ga0501038_0000236_13252_13992 239
438 3300049574 Ga0501038_0002092 Ga0501038_0002092_8308_9054 239
439 3300049574 Ga0501038_0008112 Ga0501038_0008112_1141_1869 239
440 3300049575 Ga0501039_0498598 Ga0501039_0498598_96_821 239
441 3300049578 Ga0501042_0119923 Ga0501042_0119923_286_1026 239
442 3300049579 Ga0501043_0017479 Ga0501043_0017479_2942_3670 239
443 3300049579 Ga0501043_0065199 Ga0501043_0065199_992_1732 239
444 3300049580 Ga0501046_0001520 Ga0501046_0001520_5471_6211 239
445 3300049580 Ga0501046_0122653 Ga0501046_0122653_960_1688 239
446 3300049580 Ga0501046_0560730 Ga0501046_0560730_46_774 239
447 3300049581 Ga0501047_0013453 Ga0501047_0013453_4088_4816 239
448 3300049581 Ga0501047_0036990 Ga0501047_0036990_1678_2418 239
449 3300049581 Ga0501047_0047148 Ga0501047_0047148_2576_3322 239
450 3300049581 Ga0501047_0498782 Ga0501047_0498782_80_811 239
451 3300049582 Ga0501048_0000017 Ga0501048_0000017_63591_64319 239
452 3300049582 Ga0501048_0025620 Ga0501048_0025620_1207_1947 239
453 3300049586 Ga0501070_0029209 Ga0501070_0029209_133_861 239
454 3300049586 Ga0501070_0041603 Ga0501070_0041603_2361_3101 239
455 3300049589 Ga0501073_0184770 Ga0501073_0184770_431_1159 239
456 3300049590 Ga0501074_0093437 Ga0501074_0093437_207_947 239
457 3300049741 Ga0501079_0264761 Ga0501079_0264761_568_1296 239
458 3300049744 Ga0501083_0019054 Ga0501083_0019054_820_1560 239
459 3300049822 Ga0501035_0013623 Ga0501035_0013623_4480_5220 239
460 3300049822 Ga0501035_0021024 Ga0501035_0021024_1570_2316 239
461 3300049823 Ga0501044_0005946 Ga0501044_0005946_3424_4152 239
462 3300049823 Ga0501044_0006713 Ga0501044_0006713_2899_3630 239
463 3300049823 Ga0501044_0009459 Ga0501044_0009459_5261_6007 239
464 3300049823 Ga0501044_0013559 Ga0501044_0013559_3687_4427 239
465 3300049823 Ga0501044_0541364 Ga0501044_0541364_112_834 239
466 3300050491 nmdc:mga00v17_2658_c1 nmdc:mga00v17_2658_c1_8077_8802 239
467 3300053136 Ga0500559_0000929 Ga0500559_0000929_2743_3489 239
468 3300053136 Ga0500559_0019924 Ga0500559_0019924_1595_2332 239
469 3300053140 Ga0500573_0000007 Ga0500573_0000007_244921_245670 239
470 3300053140 Ga0500573_0021820 Ga0500573_0021820_2016_2765 239
471 3300053153 Ga0500616_0019007 Ga0500616_0019007_2882_3652 239
472 3300054114 Ga0501084_0111344 Ga0501084_0111344_1233_1973 239
473 3300060353 Ga0501082_0001659 Ga0501082_0001659_11988_12725 239
474 3300060353 Ga0501082_0006677 Ga0501082_0006677_8578_9318 239
475 3300061719 Ga0466962_0101381 Ga0466962_0101381_575_1306 239
476 3300061719 Ga0466962_0133557 Ga0466962_0133557_365_1084 239
477 iso_pu_bacteria 2728369276 2729906155 239
478 iso_pu_bacteria 2791355406 2793984585 239
479 iso_pu_bacteria 2997600082 2997606661 239
480 iso_pu_bacteria 8047893842 8047899683 239
481 iso_pu_bacteria 8048127548 8048137498 239
482 iso_pu_bacteria 8048356638 8048359247 239
483 iso_pu_bacteria 8048369669 8048376632 239
484 iso_pu_bacteria 8048379754 8048385685 239
485 3300003203 JGI25406J46586_10002838 JGI25406J46586_1000283811 240
486 3300005339 Ga0070660_100259018 Ga0070660_1002590182 240
487 3300005455 Ga0070663_100175118 Ga0070663_1001751182 240
488 3300005535 Ga0070684_100067183 Ga0070684_1000671833 240
489 3300005535 Ga0070684_100379274 Ga0070684_1003792742 240
490 3300005539 Ga0068853_100097278 Ga0068853_1000972782 240
491 3300005548 Ga0070665_100021952 Ga0070665_1000219526 240
492 3300005563 Ga0068855_100013558 Ga0068855_1000135588 240
493 3300005616 Ga0068852_100030459 Ga0068852_1000304592 240
494 3300005985 Ga0081539_10000988 Ga0081539_1000098823 240
495 3300006175 Ga0070712_100267205 Ga0070712_1002672052 240
496 3300006852 Ga0075433_10025524 Ga0075433_100255244 240
497 3300006914 Ga0075436_100132597 Ga0075436_1001325972 240
498 3300007076 Ga0075435_100002359 Ga0075435_1000023595 240
499 3300009093 Ga0105240_10002006 Ga0105240_100020067 240
500 3300009148 Ga0105243_10012714 Ga0105243_100127148 240
501 3300009148 Ga0105243_10592998 Ga0105243_105929982 240
502 3300009174 Ga0105241_10009224 Ga0105241_100092247 240
503 3300009545 Ga0105237_10032397 Ga0105237_100323974 240
504 3300009551 Ga0105238_10013809 Ga0105238_100138098 240
505 3300009551 Ga0105238_10095585 Ga0105238_100955853 240
506 3300010375 Ga0105239_10073281 Ga0105239_100732812 240
507 3300013105 Ga0157369_10155606 Ga0157369_101556064 240
508 3300013296 Ga0157374_10450774 Ga0157374_104507742 240
509 3300013307 Ga0157372_10132319 Ga0157372_101323193 240
510 3300015688 Ga0183367_1007 Ga0183367_1007349 240
511 3300021388 Ga0213875_10001897 Ga0213875_100018977 240
512 3300025904 Ga0207647_10016380 Ga0207647_100163805 240
513 3300025913 Ga0207695_10001622 Ga0207695_100016226 240
514 3300025914 Ga0207671_10000976 Ga0207671_1000097618 240
515 3300025919 Ga0207657_10620790 Ga0207657_106207901 240
516 3300025924 Ga0207694_10000220 Ga0207694_100002203 240
517 3300025926 Ga0207659_10547828 Ga0207659_105478282 240
518 3300025935 Ga0207709_10004841 Ga0207709_100048417 240
519 3300025944 Ga0207661_10226208 Ga0207661_102262082 240
520 3300025949 Ga0207667_10050485 Ga0207667_100504855 240
521 3300025981 Ga0207640_10005073 Ga0207640_100050736 240
522 3300026041 Ga0207639_10206353 Ga0207639_102063532 240
523 3300026067 Ga0207678_10250594 Ga0207678_102505942 240
524 3300026142 Ga0207698_10209726 Ga0207698_102097262 240
525 3300028794 Ga0307515_10044259 Ga0307515_100442595 240
526 3300031456 Ga0307513_10171194 Ga0307513_101711941 240
527 3300031727 Ga0316576_10006505 Ga0316576_100065056 240
528 3300031728 Ga0316578_10073838 Ga0316578_100738382 240
529 3300031824 Ga0307413_10001807 Ga0307413_1000180711 240
530 3300031824 Ga0307413_10073897 Ga0307413_100738973 240
531 3300031838 Ga0307518_10000187 Ga0307518_1000018750 240
532 3300031901 Ga0307406_10098078 Ga0307406_100980782 240
533 3300031995 Ga0307409_100222765 Ga0307409_1002227652 240
534 3300032004 Ga0307414_10585579 Ga0307414_105855791 240
535 3300032005 Ga0307411_10004675 Ga0307411_100046758 240
536 3300032126 Ga0307415_100089055 Ga0307415_1000890553 240
537 3300035398 Ga0316574_0278298 Ga0316574_0278298_57_797 240
538 3300036712 Ga0316584_0042701 Ga0316584_0042701_396_1136 240
539 3300037466 Ga0395898_0003389 Ga0395898_0003389_1300_2031 240
540 3300037466 Ga0395898_0169704 Ga0395898_0169704_1236_2030 240
541 3300037466 Ga0395898_0631775 Ga0395898_0631775_172_948 240
542 3300037853 Ga0436364_0383034 Ga0436364_0383034_7514_8254 240
543 3300038443 Ga0395901_0179986 Ga0395901_0179986_671_1447 240
544 3300038443 Ga0395901_0274685 Ga0395901_0274685_58_789 240
545 3300038443 Ga0395901_0339111 Ga0395901_0339111_110_886 240
546 3300038735 Ga0400485_07745 Ga0400485_07745_702_1436 240
547 3300038741 Ga0400488_11659 Ga0400488_11659_6463_7200 240
548 3300038742 Ga0400486_04200 Ga0400486_04200_34794_35528 240
549 3300041491 Ga0451833_1101346 Ga0451833_1101346_3363_4103 240
550 3300041512 Ga0451853_1635577 Ga0451853_1635577_3281_4003 240
551 3300041512 Ga0451853_2882476 Ga0451853_2882476_169_903 240
552 3300042002 Ga0439442_003740 Ga0439442_003740_1873_2595 240
553 3300042006 Ga0439432_015276 Ga0439432_015276_450_1172 240
554 3300042131 Ga0450894_000108 Ga0450894_000108_8194_8919 240
555 3300042133 Ga0450896_000133 Ga0450896_000133_2682_3407 240
556 3300042134 Ga0450898_000249 Ga0450898_000249_1227_1952 240
557 3300042184 Ga0450908_003192 Ga0450908_003192_1358_2083 240
558 3300042876 Ga0451577_0252036 Ga0451577_0252036_148_879 240
559 3300044656 Ga0466969_0092650 Ga0466969_0092650_249_971 240
560 3300044656 Ga0466969_0122548 Ga0466969_0122548_362_1108 240
561 3300044658 Ga0466972_0019146 Ga0466972_0019146_96_818 240
562 3300044683 Ga0466965_0185174 Ga0466965_0185174_267_1022 240
563 3300044684 Ga0466966_0000681 Ga0466966_0000681_19949_20671 240
564 3300044684 Ga0466966_0175444 Ga0466966_0175444_251_997 240
565 3300044693 Ga0466961_0004550 Ga0466961_0004550_4580_5326 240
566 3300044693 Ga0466961_0020506 Ga0466961_0020506_230_952 240
567 3300044719 Ga0466971_0038368 Ga0466971_0038368_1120_1875 240
568 3300044765 Ga0466970_0003067 Ga0466970_0003067_4680_5435 240
569 3300045049 Ga0466959_0014819 Ga0466959_0014819_4192_4938 240
570 3300045049 Ga0466959_0201267 Ga0466959_0201267_290_1012 240
571 3300046454 Ga0495592_0074713 Ga0495592_0074713_1307_2038 240
572 3300046455 Ga0495603_0000118 Ga0495603_0000118_35804_36532 240
573 3300046459 Ga0495629_0001225 Ga0495629_0001225_1542_2270 240
574 3300046459 Ga0495629_0003945 Ga0495629_0003945_8462_9190 240
575 3300046462 Ga0495651_0000324 Ga0495651_0000324_28030_28761 240
576 3300046499 Ga0495594_0001176 Ga0495594_0001176_11589_12317 240
577 3300046506 Ga0495583_0090564 Ga0495583_0090564_529_1251 240
578 3300046511 Ga0495608_0038537 Ga0495608_0038537_2198_2926 240
579 3300046516 Ga0495628_0126088 Ga0495628_0126088_380_1111 240
580 3300046518 Ga0495631_0089949 Ga0495631_0089949_539_1270 240
581 3300046525 Ga0495663_0049205 Ga0495663_0049205_14_745 240
582 3300046529 Ga0495652_0010670 Ga0495652_0010670_3120_3851 240
583 3300046529 Ga0495652_0158330 Ga0495652_0158330_483_1214 240
584 3300046557 Ga0495622_0004164 Ga0495622_0004164_5593_6321 240
585 3300046557 Ga0495622_0051737 Ga0495622_0051737_718_1449 240
586 3300046648 Ga0495611_0007776 Ga0495611_0007776_3351_4079 240
587 3300046674 Ga0495588_0171135 Ga0495588_0171135_92_820 240
588 3300046679 Ga0495623_0200114 Ga0495623_0200114_162_893 240
589 3300046689 Ga0495613_0004176 Ga0495613_0004176_8421_9149 240
590 3300046794 Ga0495589_0064498 Ga0495589_0064498_718_1446 240
591 3300046794 Ga0495589_0122686 Ga0495589_0122686_485_1207 240
592 3300046809 Ga0495600_0064496 Ga0495600_0064496_847_1578 240
593 3300047318 Ga0495636_0001821 Ga0495636_0001821_72_794 240
594 3300047318 Ga0495636_0054921 Ga0495636_0054921_432_1160 240
595 3300047321 Ga0495676_0006095 Ga0495676_0006095_8595_9323 240
596 3300047321 Ga0495676_0030679 Ga0495676_0030679_2287_3015 240
597 3300047443 Ga0495687_005383 Ga0495687_005383_7373_8095 240
598 3300047444 Ga0495675_0014848 Ga0495675_0014848_2915_3643 240
599 3300047447 Ga0495685_050876 Ga0495685_050876_115_846 240
600 3300048089 Ga0495614_0006743 Ga0495614_0006743_1326_2054 240
601 3300048090 Ga0495615_0024698 Ga0495615_0024698_550_1281 240
602 3300048904 Ga0496101_0248801 Ga0496101_0248801_413_1159 240
603 3300048909 Ga0496106_0201711 Ga0496106_0201711_321_1049 240
604 3300048911 Ga0496108_0070849 Ga0496108_0070849_1392_2135 240
605 3300049569 Ga0501032_0157763 Ga0501032_0157763_475_1200 240
606 3300049570 Ga0501033_0389348 Ga0501033_0389348_23_748 240
607 3300049580 Ga0501046_0123166 Ga0501046_0123166_1131_1856 240
608 3300049823 Ga0501044_0001763 Ga0501044_0001763_12182_12907 240
609 3300050512 nmdc:mga0n895_17970_c1 nmdc:mga0n895_17970_c1_4990_5712 240
610 3300050513 nmdc:mga0rr50_15996_c1 nmdc:mga0rr50_15996_c1_3470_4192 240
611 3300050514 nmdc:mga08x19_117413_c1 nmdc:mga08x19_117413_c1_535_1257 240
612 3300050515 nmdc:mga0a205_192749_c1 nmdc:mga0a205_192749_c1_223_945 240
613 3300053077 Ga0495601_0003606 Ga0495601_0003606_3319_4050 240
614 3300053108 Ga0500562_046540 Ga0500562_046540_95_841 240
615 3300053133 Ga0500655_031140 Ga0500655_031140_275_1015 240
616 3300061719 Ga0466962_0002007 Ga0466962_0002007_3249_3995 240
617 iso_pu_bacteria 2643221587 2643945223 240
618 iso_pu_bacteria 2643221677 2644432122 240
619 iso_pu_bacteria 2738541308 2738886846 240
620 iso_pu_bacteria 2995463766 2995464588 240
621 iso_pu_bacteria 3006425503 3006426685 240
622 iso_pu_bacteria 8023623736 8023627572 240
623 iso_pu_bacteria 8033684223 8033684702 240
624 iso_pu_bacteria 8056667051 8056667883 240
625 3300001989 JGI24739J22299_10010664 JGI24739J22299_100106643 241
626 3300001990 JGI24737J22298_10020253 JGI24737J22298_100202533 241
627 3300002075 JGI24738J21930_10012514 JGI24738J21930_100125143 241
628 3300003320 rootH2_10070449 rootH2_100704492 241
629 3300003322 rootL2_10011701 rootL2_100117015 241
630 3300003578 Ga0006562J51391_1157002 Ga0006562J51391_11570026 241
631 3300003578 Ga0006562J51391_1157005 Ga0006562J51391_11570052 241
632 3300005435 Ga0070714_100004428 Ga0070714_1000044289 241
633 3300005548 Ga0070665_100213759 Ga0070665_1002137592 241
634 3300005563 Ga0068855_100250917 Ga0068855_1002509173 241
635 3300005614 Ga0068856_100118454 Ga0068856_1001184543 241
636 3300005614 Ga0068856_100341016 Ga0068856_1003410162 241
637 3300005937 Ga0081455_10054131 Ga0081455_100541315 241
638 3300006028 Ga0070717_10312129 Ga0070717_103121291 241
639 3300006042 Ga0075368_10008947 Ga0075368_100089474 241
640 3300006178 Ga0075367_10001030 Ga0075367_100010309 241
641 3300006353 Ga0075370_10064971 Ga0075370_100649714 241
642 3300006948 Ga0099826_10055096 Ga0099826_100550964 241
643 3300009092 Ga0105250_10012833 Ga0105250_100128335 241
644 3300011119 Ga0105246_10232949 Ga0105246_102329493 241
645 3300013307 Ga0157372_10148987 Ga0157372_101489872 241
646 3300013308 Ga0157375_10596968 Ga0157375_105969681 241
647 3300014497 Ga0182008_10002930 Ga0182008_100029305 241
648 3300015261 Ga0182006_1067333 Ga0182006_10673332 241
649 3300015262 Ga0182007_10004606 Ga0182007_100046067 241
650 3300020082 Ga0206353_11478345 Ga0206353_114783452 241
651 3300025904 Ga0207647_10073596 Ga0207647_100735962 241
652 3300025915 Ga0207693_10347695 Ga0207693_103476952 241
653 3300025929 Ga0207664_10015771 Ga0207664_100157712 241
654 3300025929 Ga0207664_10157794 Ga0207664_101577941 241
655 3300025944 Ga0207661_10161058 Ga0207661_101610582 241
656 3300025949 Ga0207667_10503441 Ga0207667_105034412 241
657 3300027866 Ga0209813_10017241 Ga0209813_100172413 241
658 3300028786 Ga0307517_10010039 Ga0307517_1001003910 241
659 3300028786 Ga0307517_10045407 Ga0307517_100454075 241
660 3300028794 Ga0307515_10001023 Ga0307515_1000102316 241
661 3300028794 Ga0307515_10028171 Ga0307515_100281717 241
662 3300030521 Ga0307511_10002015 Ga0307511_1000201512 241
663 3300030521 Ga0307511_10099457 Ga0307511_100994573 241
664 3300030521 Ga0307511_10106659 Ga0307511_101066592 241
665 3300030521 Ga0307511_10121505 Ga0307511_101215052 241
666 3300030522 Ga0307512_10001219 Ga0307512_1000121929 241
667 3300030522 Ga0307512_10030796 Ga0307512_100307964 241
668 3300031456 Ga0307513_10007993 Ga0307513_100079934 241
669 3300031456 Ga0307513_10053872 Ga0307513_100538726 241
670 3300031507 Ga0307509_10062666 Ga0307509_100626664 241
671 3300031507 Ga0307509_10136899 Ga0307509_101368993 241
672 3300031616 Ga0307508_10002617 Ga0307508_100026171 241
673 3300031616 Ga0307508_10005838 Ga0307508_100058388 241
674 3300031616 Ga0307508_10048095 Ga0307508_100480953 241
675 3300031616 Ga0307508_10085607 Ga0307508_100856074 241
676 3300031616 Ga0307508_10125154 Ga0307508_101251543 241
677 3300031616 Ga0307508_10257165 Ga0307508_102571651 241
678 3300031649 Ga0307514_10000866 Ga0307514_100008665 241
679 3300031649 Ga0307514_10068123 Ga0307514_100681232 241
680 3300031649 Ga0307514_10082594 Ga0307514_100825941 241
681 3300031730 Ga0307516_10000836 Ga0307516_1000083622 241
682 3300031730 Ga0307516_10017241 Ga0307516_100172416 241
683 3300031730 Ga0307516_10039317 Ga0307516_100393172 241
684 3300031730 Ga0307516_10278049 Ga0307516_102780493 241
685 3300031824 Ga0307413_10085581 Ga0307413_100855813 241
686 3300031824 Ga0307413_10415129 Ga0307413_104151292 241
687 3300031838 Ga0307518_10168033 Ga0307518_101680332 241
688 3300031911 Ga0307412_10064375 Ga0307412_100643753 241
689 3300031995 Ga0307409_100425048 Ga0307409_1004250482 241
690 3300032002 Ga0307416_100102010 Ga0307416_1001020102 241
691 3300032005 Ga0307411_10305639 Ga0307411_103056391 241
692 3300033179 Ga0307507_10000019 Ga0307507_1000001993 241
693 3300033179 Ga0307507_10017958 Ga0307507_100179588 241
694 3300033179 Ga0307507_10045870 Ga0307507_100458702 241
695 3300033179 Ga0307507_10308330 Ga0307507_103083302 241
696 3300033180 Ga0307510_10011375 Ga0307510_100113753 241
697 3300033180 Ga0307510_10031973 Ga0307510_100319738 241
698 3300033180 Ga0307510_10124243 Ga0307510_101242434 241
699 3300033180 Ga0307510_10194466 Ga0307510_101944662 241
700 3300037418 Ga0395900_0024030 Ga0395900_0024030_5007_5732 241
701 3300037466 Ga0395898_0078790 Ga0395898_0078790_2238_2972 241
702 3300037466 Ga0395898_0124866 Ga0395898_0124866_1245_1970 241
703 3300037466 Ga0395898_0125388 Ga0395898_0125388_493_1218 241
704 3300037471 Ga0395905_0385676 Ga0395905_0385676_129_854 241
705 3300038443 Ga0395901_0187487 Ga0395901_0187487_1061_1786 241
706 3300041404 Ga0439436_0004093 Ga0439436_0004093_1612_2337 241
707 3300041406 Ga0439439_0015650 Ga0439439_0015650_187_912 241
708 3300041491 Ga0451833_1314909 Ga0451833_1314909_31_756 241
709 3300041492 Ga0451835_0497006 Ga0451835_0497006_248_973 241
710 3300041494 Ga0451837_0076298 Ga0451837_0076298_4141_4866 241
711 3300042005 Ga0439448_0086255 Ga0439448_0086255_237_962 241
712 3300042007 Ga0439449_0001767 Ga0439449_0001767_72_797 241
713 3300042008 Ga0439450_019447 Ga0439450_019447_547_1272 241
714 3300042012 Ga0439455_0053092 Ga0439455_0053092_118_846 241
715 3300042014 Ga0439457_000358 Ga0439457_000358_8214_8939 241
716 3300042134 Ga0450898_005549 Ga0450898_005549_929_1654 241
717 3300042157 Ga0439458_0000302 Ga0439458_0000302_3024_3752 241
718 3300042533 Ga0450901_002785 Ga0450901_002785_682_1410 241
719 3300044656 Ga0466969_0000312 Ga0466969_0000312_2584_3324 241
720 3300044658 Ga0466972_0007209 Ga0466972_0007209_4426_5154 241
721 3300044658 Ga0466972_0164233 Ga0466972_0164233_88_813 241
722 3300044683 Ga0466965_0024888 Ga0466965_0024888_649_1377 241
723 3300044684 Ga0466966_0001836 Ga0466966_0001836_10178_10906 241
724 3300044684 Ga0466966_0006747 Ga0466966_0006747_6407_7153 241
725 3300044684 Ga0466966_0017580 Ga0466966_0017580_966_1709 241
726 3300044693 Ga0466961_0001762 Ga0466961_0001762_10093_10833 241
727 3300044693 Ga0466961_0012188 Ga0466961_0012188_1652_2398 241
728 3300044693 Ga0466961_0033050 Ga0466961_0033050_1204_1932 241
729 3300044694 Ga0466963_0000206 Ga0466963_0000206_13992_14720 241
730 3300044694 Ga0466963_0000614 Ga0466963_0000614_10885_11610 241
731 3300044694 Ga0466963_0037006 Ga0466963_0037006_1478_2203 241
732 3300044694 Ga0466963_0161976 Ga0466963_0161976_31_765 241
733 3300044706 Ga0466964_0037040 Ga0466964_0037040_226_951 241
734 3300044706 Ga0466964_0040300 Ga0466964_0040300_554_1282 241
735 3300044719 Ga0466971_0008218 Ga0466971_0008218_2205_2948 241
736 3300044719 Ga0466971_0009107 Ga0466971_0009107_1521_2249 241
737 3300044765 Ga0466970_0001751 Ga0466970_0001751_5001_5729 241
738 3300044765 Ga0466970_0019046 Ga0466970_0019046_788_1531 241
739 3300044765 Ga0466970_0263882 Ga0466970_0263882_204_950 241
740 3300044842 Ga0466957_0000450 Ga0466957_0000450_12926_13654 241
741 3300044842 Ga0466957_0164363 Ga0466957_0164363_514_1239 241
742 3300044901 Ga0466960_0025324 Ga0466960_0025324_1294_2019 241
743 3300045049 Ga0466959_0000702 Ga0466959_0000702_13864_14592 241
744 3300045049 Ga0466959_0004881 Ga0466959_0004881_1915_2661 241
745 3300045836 Ga0466958_0000246 Ga0466958_0000246_4873_5601 241
746 3300045836 Ga0466958_0019819 Ga0466958_0019819_2708_3448 241
747 3300045836 Ga0466958_0052067 Ga0466958_0052067_1066_1809 241
748 3300045836 Ga0466958_0265827 Ga0466958_0265827_333_1067 241
749 3300045976 Ga0466967_0000259 Ga0466967_0000259_8664_9392 241
750 3300046452 Ga0495617_015956 Ga0495617_015956_1593_2318 241
751 3300046453 Ga0495627_023753 Ga0495627_023753_113_838 241
752 3300046453 Ga0495627_039221 Ga0495627_039221_378_1112 241
753 3300046454 Ga0495592_0006146 Ga0495592_0006146_195_920 241
754 3300046454 Ga0495592_0055209 Ga0495592_0055209_947_1675 241
755 3300046454 Ga0495592_0101946 Ga0495592_0101946_419_1144 241
756 3300046454 Ga0495592_0163579 Ga0495592_0163579_345_1082 241
757 3300046455 Ga0495603_0002495 Ga0495603_0002495_81_806 241
758 3300046455 Ga0495603_0053210 Ga0495603_0053210_1651_2376 241
759 3300046455 Ga0495603_0233520 Ga0495603_0233520_95_823 241
760 3300046459 Ga0495629_0006546 Ga0495629_0006546_6946_7671 241
761 3300046459 Ga0495629_0015712 Ga0495629_0015712_2816_3541 241
762 3300046459 Ga0495629_0158648 Ga0495629_0158648_791_1522 241
763 3300046461 Ga0495641_0082886 Ga0495641_0082886_635_1360 241
764 3300046462 Ga0495651_0000211 Ga0495651_0000211_33146_33883 241
765 3300046462 Ga0495651_0003371 Ga0495651_0003371_2456_3184 241
766 3300046462 Ga0495651_0020877 Ga0495651_0020877_3953_4678 241
767 3300046473 Ga0495582_0082387 Ga0495582_0082387_995_1720 241
768 3300046474 Ga0495605_0011696 Ga0495605_0011696_591_1316 241
769 3300046475 Ga0495639_0006635 Ga0495639_0006635_3548_4273 241
770 3300046476 Ga0495662_0002106 Ga0495662_0002106_1269_1997 241
771 3300046476 Ga0495662_0022833 Ga0495662_0022833_521_1246 241
772 3300046476 Ga0495662_0036208 Ga0495662_0036208_920_1645 241
773 3300046477 Ga0495664_0002194 Ga0495664_0002194_2552_3280 241
774 3300046477 Ga0495664_0107191 Ga0495664_0107191_203_928 241
775 3300046477 Ga0495664_0242584 Ga0495664_0242584_186_923 241
776 3300046491 Ga0495584_0010442 Ga0495584_0010442_455_1180 241
777 3300046492 Ga0495585_0031988 Ga0495585_0031988_523_1248 241
778 3300046492 Ga0495585_0061848 Ga0495585_0061848_952_1677 241
779 3300046499 Ga0495594_0010207 Ga0495594_0010207_1285_2010 241
780 3300046499 Ga0495594_0014082 Ga0495594_0014082_250_978 241
781 3300046500 Ga0495596_0012530 Ga0495596_0012530_1840_2565 241
782 3300046506 Ga0495583_0030333 Ga0495583_0030333_1796_2521 241
783 3300046507 Ga0495606_0017255 Ga0495606_0017255_330_1055 241
784 3300046511 Ga0495608_0032629 Ga0495608_0032629_2322_3047 241
785 3300046511 Ga0495608_0066984 Ga0495608_0066984_1067_1795 241
786 3300046511 Ga0495608_0243723 Ga0495608_0243723_368_1105 241
787 3300046512 Ga0495610_0007469 Ga0495610_0007469_994_1719 241
788 3300046513 Ga0495616_0013521 Ga0495616_0013521_1548_2273 241
789 3300046514 Ga0495618_0037100 Ga0495618_0037100_162_887 241
790 3300046514 Ga0495618_0040123 Ga0495618_0040123_1082_1810 241
791 3300046514 Ga0495618_0044642 Ga0495618_0044642_1327_2064 241
792 3300046514 Ga0495618_0140578 Ga0495618_0140578_686_1411 241
793 3300046515 Ga0495620_0031617 Ga0495620_0031617_1376_2101 241
794 3300046516 Ga0495628_0026002 Ga0495628_0026002_2946_3683 241
795 3300046516 Ga0495628_0026462 Ga0495628_0026462_2132_2857 241
796 3300046517 Ga0495630_0046801 Ga0495630_0046801_1175_1903 241
797 3300046518 Ga0495631_0005465 Ga0495631_0005465_4770_5495 241
798 3300046519 Ga0495632_0028913 Ga0495632_0028913_1654_2379 241
799 3300046519 Ga0495632_0031247 Ga0495632_0031247_665_1396 241
800 3300046522 Ga0495643_0004048 Ga0495643_0004048_7084_7815 241
801 3300046526 Ga0495666_0020869 Ga0495666_0020869_2438_3163 241
802 3300046528 Ga0495642_0035377 Ga0495642_0035377_305_1030 241
803 3300046529 Ga0495652_0018950 Ga0495652_0018950_1434_2159 241
804 3300046529 Ga0495652_0063283 Ga0495652_0063283_2199_2924 241
805 3300046529 Ga0495652_0289364 Ga0495652_0289364_74_802 241
806 3300046530 Ga0495654_0037013 Ga0495654_0037013_447_1172 241
807 3300046533 Ga0495640_0004853 Ga0495640_0004853_3422_4147 241
808 3300046533 Ga0495640_0053029 Ga0495640_0053029_458_1183 241
809 3300046535 Ga0495586_0089008 Ga0495586_0089008_838_1575 241
810 3300046535 Ga0495586_0293070 Ga0495586_0293070_71_796 241
811 3300046536 Ga0495587_0008553 Ga0495587_0008553_4680_5408 241
812 3300046538 Ga0495609_0003387 Ga0495609_0003387_5993_6718 241
813 3300046542 Ga0495597_0062332 Ga0495597_0062332_72_797 241
814 3300046543 Ga0495645_0033596 Ga0495645_0033596_50_787 241
815 3300046543 Ga0495645_0054473 Ga0495645_0054473_959_1687 241
816 3300046543 Ga0495645_0191490 Ga0495645_0191490_367_1092 241
817 3300046557 Ga0495622_0002898 Ga0495622_0002898_1299_2024 241
818 3300046558 Ga0495633_0023178 Ga0495633_0023178_2068_2793 241
819 3300046559 Ga0495667_0134369 Ga0495667_0134369_321_1046 241
820 3300046615 Ga0495656_0139360 Ga0495656_0139360_289_1014 241
821 3300046616 Ga0495668_0104241 Ga0495668_0104241_135_860 241
822 3300046642 Ga0495634_0004021 Ga0495634_0004021_6119_6847 241
823 3300046642 Ga0495634_0025930 Ga0495634_0025930_1167_1892 241
824 3300046648 Ga0495611_0006244 Ga0495611_0006244_1027_1752 241
825 3300046660 Ga0495625_0007626 Ga0495625_0007626_1270_1998 241
826 3300046660 Ga0495625_0083574 Ga0495625_0083574_995_1720 241
827 3300046663 Ga0495635_0001097 Ga0495635_0001097_7382_8110 241
828 3300046663 Ga0495635_0003328 Ga0495635_0003328_9094_9831 241
829 3300046663 Ga0495635_0009396 Ga0495635_0009396_1846_2571 241
830 3300046665 Ga0495661_0157471 Ga0495661_0157471_114_845 241
831 3300046674 Ga0495588_0010629 Ga0495588_0010629_2849_3577 241
832 3300046674 Ga0495588_0058330 Ga0495588_0058330_1037_1762 241
833 3300046675 Ga0495657_0002044 Ga0495657_0002044_6372_7100 241
834 3300046675 Ga0495657_0018070 Ga0495657_0018070_564_1289 241
835 3300046675 Ga0495657_0068042 Ga0495657_0068042_910_1635 241
836 3300046678 Ga0495599_0175117 Ga0495599_0175117_191_916 241
837 3300046679 Ga0495623_0011914 Ga0495623_0011914_2754_3491 241
838 3300046679 Ga0495623_0072871 Ga0495623_0072871_546_1271 241
839 3300046679 Ga0495623_0250043 Ga0495623_0250043_144_869 241
840 3300046680 Ga0495646_0001636 Ga0495646_0001636_7671_8399 241
841 3300046683 Ga0495658_0018195 Ga0495658_0018195_1606_2334 241
842 3300046689 Ga0495613_0001306 Ga0495613_0001306_124_852 241
843 3300046689 Ga0495613_0058110 Ga0495613_0058110_27_752 241
844 3300046689 Ga0495613_0175787 Ga0495613_0175787_574_1299 241
845 3300046690 Ga0495624_0075230 Ga0495624_0075230_635_1360 241
846 3300046690 Ga0495624_0130302 Ga0495624_0130302_622_1353 241
847 3300046691 Ga0495670_0007279 Ga0495670_0007279_1370_2101 241
848 3300046694 Ga0495649_0129369 Ga0495649_0129369_66_791 241
849 3300046794 Ga0495589_0023370 Ga0495589_0023370_500_1231 241
850 3300046794 Ga0495589_0030384 Ga0495589_0030384_1005_1733 241
851 3300046794 Ga0495589_0044773 Ga0495589_0044773_423_1148 241
852 3300046809 Ga0495600_0013546 Ga0495600_0013546_2920_3645 241
853 3300046809 Ga0495600_0021836 Ga0495600_0021836_2424_3152 241
854 3300047315 Ga0495581_0001702 Ga0495581_0001702_6865_7593 241
855 3300047315 Ga0495581_0015062 Ga0495581_0015062_357_1082 241
856 3300047315 Ga0495581_0057044 Ga0495581_0057044_1450_2175 241
857 3300047315 Ga0495581_0326859 Ga0495581_0326859_43_768 241
858 3300047317 Ga0495604_0004607 Ga0495604_0004607_6768_7493 241
859 3300047317 Ga0495604_0009596 Ga0495604_0009596_2110_2838 241
860 3300047317 Ga0495604_0021693 Ga0495604_0021693_2143_2868 241
861 3300047317 Ga0495604_0022107 Ga0495604_0022107_3400_4125 241
862 3300047317 Ga0495604_0034066 Ga0495604_0034066_2025_2750 241
863 3300047318 Ga0495636_0001395 Ga0495636_0001395_5023_5748 241
864 3300047318 Ga0495636_0016622 Ga0495636_0016622_357_1082 241
865 3300047318 Ga0495636_0081577 Ga0495636_0081577_589_1314 241
866 3300047319 Ga0495674_0122208 Ga0495674_0122208_1163_1891 241
867 3300047321 Ga0495676_0006378 Ga0495676_0006378_1567_2292 241
868 3300047321 Ga0495676_0026496 Ga0495676_0026496_2475_3203 241
869 3300047322 Ga0495680_0023976 Ga0495680_0023976_484_1209 241
870 3300047443 Ga0495687_001939 Ga0495687_001939_8167_8892 241
871 3300047443 Ga0495687_043409 Ga0495687_043409_182_907 241
872 3300047443 Ga0495687_043860 Ga0495687_043860_1174_1899 241
873 3300047444 Ga0495675_0016868 Ga0495675_0016868_125_850 241
874 3300047444 Ga0495675_0101022 Ga0495675_0101022_1029_1754 241
875 3300047447 Ga0495685_000366 Ga0495685_000366_13388_14119 241
876 3300047447 Ga0495685_002245 Ga0495685_002245_2638_3363 241
877 3300047447 Ga0495685_005998 Ga0495685_005998_2720_3448 241
878 3300047447 Ga0495685_030359 Ga0495685_030359_289_1014 241
879 3300047470 Ga0495681_0000244 Ga0495681_0000244_29122_29853 241
880 3300047470 Ga0495681_0001646 Ga0495681_0001646_1224_1952 241
881 3300047471 Ga0495684_0021677 Ga0495684_0021677_3647_4372 241
882 3300047471 Ga0495684_0112895 Ga0495684_0112895_208_936 241
883 3300047472 Ga0495686_0193984 Ga0495686_0193984_203_931 241
884 3300047673 Ga0495593_0006642 Ga0495593_0006642_4962_5690 241
885 3300048088 Ga0495602_0032581 Ga0495602_0032581_851_1579 241
886 3300048905 Ga0496102_0216325 Ga0496102_0216325_25_750 241
887 3300048908 Ga0496105_0629683 Ga0496105_0629683_57_782 241
888 3300048910 Ga0496107_0144284 Ga0496107_0144284_242_967 241
889 3300048912 Ga0496109_0046548 Ga0496109_0046548_1000_1725 241
890 3300048914 Ga0496111_0196835 Ga0496111_0196835_717_1442 241
891 3300048915 Ga0496112_0488311 Ga0496112_0488311_333_1058 241
892 3300048916 Ga0496113_0660335 Ga0496113_0660335_90_815 241
893 3300048928 Ga0496125_0136819 Ga0496125_0136819_373_1098 241
894 3300048929 Ga0496126_0143757 Ga0496126_0143757_847_1584 241
895 3300049459 Ga0495678_076863 Ga0495678_076863_154_879 241
896 3300049532 Ga0501316_007283 Ga0501316_007283_212_946 241
897 3300049539 Ga0501323_007545 Ga0501323_007545_501_1226 241
898 3300049568 Ga0501031_0003586 Ga0501031_0003586_6112_6849 241
899 3300049568 Ga0501031_0025632 Ga0501031_0025632_2375_3100 241
900 3300049568 Ga0501031_0087453 Ga0501031_0087453_664_1389 241
901 3300049568 Ga0501031_0098726 Ga0501031_0098726_169_894 241
902 3300049568 Ga0501031_0293392 Ga0501031_0293392_56_784 241
903 3300049569 Ga0501032_0002783 Ga0501032_0002783_2852_3589 241
904 3300049569 Ga0501032_0013299 Ga0501032_0013299_5083_5808 241
905 3300049569 Ga0501032_0078719 Ga0501032_0078719_1138_1869 241
906 3300049569 Ga0501032_0155137 Ga0501032_0155137_709_1434 241
907 3300049569 Ga0501032_0252925 Ga0501032_0252925_29_754 241
908 3300049569 Ga0501032_0318222 Ga0501032_0318222_18_743 241
909 3300049570 Ga0501033_0004222 Ga0501033_0004222_2528_3253 241
910 3300049570 Ga0501033_0011161 Ga0501033_0011161_4276_5007 241
911 3300049570 Ga0501033_0013104 Ga0501033_0013104_3245_3970 241
912 3300049570 Ga0501033_0056095 Ga0501033_0056095_1053_1778 241
913 3300049570 Ga0501033_0090325 Ga0501033_0090325_1082_1810 241
914 3300049570 Ga0501033_0152941 Ga0501033_0152941_120_848 241
915 3300049570 Ga0501033_0171598 Ga0501033_0171598_789_1517 241
916 3300049571 Ga0501034_0011768 Ga0501034_0011768_5002_5739 241
917 3300049571 Ga0501034_0047293 Ga0501034_0047293_3020_3745 241
918 3300049571 Ga0501034_0049354 Ga0501034_0049354_2373_3098 241
919 3300049571 Ga0501034_0054911 Ga0501034_0054911_1438_2169 241
920 3300049571 Ga0501034_0072216 Ga0501034_0072216_1421_2146 241
921 3300049571 Ga0501034_0243782 Ga0501034_0243782_12_737 241
922 3300049572 Ga0501036_0016093 Ga0501036_0016093_5031_5756 241
923 3300049572 Ga0501036_0021723 Ga0501036_0021723_1395_2126 241
924 3300049572 Ga0501036_0023329 Ga0501036_0023329_2755_3483 241
925 3300049573 Ga0501037_0002837 Ga0501037_0002837_6862_7599 241
926 3300049573 Ga0501037_0180397 Ga0501037_0180397_277_1002 241
927 3300049573 Ga0501037_0466051 Ga0501037_0466051_29_754 241
928 3300049574 Ga0501038_0000642 Ga0501038_0000642_12648_13373 241
929 3300049574 Ga0501038_0016192 Ga0501038_0016192_1918_2643 241
930 3300049574 Ga0501038_0018752 Ga0501038_0018752_2717_3448 241
931 3300049574 Ga0501038_0018834 Ga0501038_0018834_322_1059 241
932 3300049574 Ga0501038_0020044 Ga0501038_0020044_3450_4175 241
933 3300049574 Ga0501038_0034542 Ga0501038_0034542_3096_3821 241
934 3300049574 Ga0501038_0140967 Ga0501038_0140967_1087_1815 241
935 3300049575 Ga0501039_0021706 Ga0501039_0021706_2519_3250 241
936 3300049575 Ga0501039_0067064 Ga0501039_0067064_1141_1866 241
937 3300049575 Ga0501039_0086631 Ga0501039_0086631_1687_2415 241
938 3300049575 Ga0501039_0370043 Ga0501039_0370043_371_1096 241
939 3300049576 Ga0501040_0006289 Ga0501040_0006289_1357_2094 241
940 3300049576 Ga0501040_0077505 Ga0501040_0077505_1245_1973 241
941 3300049577 Ga0501041_0010790 Ga0501041_0010790_1387_2124 241
942 3300049578 Ga0501042_0142261 Ga0501042_0142261_548_1285 241
943 3300049578 Ga0501042_0195315 Ga0501042_0195315_166_894 241
944 3300049579 Ga0501043_0003942 Ga0501043_0003942_1499_2227 241
945 3300049579 Ga0501043_0012723 Ga0501043_0012723_3883_4608 241
946 3300049579 Ga0501043_0106646 Ga0501043_0106646_986_1711 241
947 3300049579 Ga0501043_0229700 Ga0501043_0229700_333_1058 241
948 3300049579 Ga0501043_0331670 Ga0501043_0331670_295_1026 241
949 3300049580 Ga0501046_0012735 Ga0501046_0012735_1998_2723 241
950 3300049580 Ga0501046_0262140 Ga0501046_0262140_420_1157 241
951 3300049581 Ga0501047_0000242 Ga0501047_0000242_53451_54176 241
952 3300049581 Ga0501047_0002545 Ga0501047_0002545_9777_10514 241
953 3300049581 Ga0501047_0020231 Ga0501047_0020231_1650_2375 241
954 3300049581 Ga0501047_0049204 Ga0501047_0049204_2164_2889 241
955 3300049581 Ga0501047_0056449 Ga0501047_0056449_3020_3745 241
956 3300049581 Ga0501047_0057352 Ga0501047_0057352_407_1132 241
957 3300049581 Ga0501047_0074002 Ga0501047_0074002_288_1019 241
958 3300049581 Ga0501047_0093311 Ga0501047_0093311_429_1154 241
959 3300049582 Ga0501048_0005662 Ga0501048_0005662_5682_6419 241
960 3300049582 Ga0501048_0011943 Ga0501048_0011943_444_1169 241
961 3300049583 Ga0501067_0042361 Ga0501067_0042361_1329_2066 241
962 3300049584 Ga0501068_0026861 Ga0501068_0026861_417_1154 241
963 3300049584 Ga0501068_0031024 Ga0501068_0031024_625_1353 241
964 3300049584 Ga0501068_0270715 Ga0501068_0270715_288_1019 241
965 3300049585 Ga0501069_0126207 Ga0501069_0126207_180_908 241
966 3300049586 Ga0501070_0005659 Ga0501070_0005659_1181_1909 241
967 3300049586 Ga0501070_0139438 Ga0501070_0139438_1085_1810 241
968 3300049586 Ga0501070_0360492 Ga0501070_0360492_399_1124 241
969 3300049586 Ga0501070_0556102 Ga0501070_0556102_140_868 241
970 3300049587 Ga0501071_0008875 Ga0501071_0008875_5735_6472 241
971 3300049588 Ga0501072_0003634 Ga0501072_0003634_3555_4292 241
972 3300049588 Ga0501072_0216488 Ga0501072_0216488_753_1481 241
973 3300049589 Ga0501073_0195845 Ga0501073_0195845_113_850 241
974 3300049589 Ga0501073_0398361 Ga0501073_0398361_153_878 241
975 3300049590 Ga0501074_0347747 Ga0501074_0347747_11_739 241
976 3300049592 Ga0501076_0002750 Ga0501076_0002750_5967_6704 241
977 3300049593 Ga0501077_0009068 Ga0501077_0009068_4848_5585 241
978 3300049741 Ga0501079_0011123 Ga0501079_0011123_965_1693 241
979 3300049742 Ga0501080_0029049 Ga0501080_0029049_3740_4465 241
980 3300049742 Ga0501080_0283111 Ga0501080_0283111_315_1043 241
981 3300049743 Ga0501081_0153760 Ga0501081_0153760_338_1066 241
982 3300049744 Ga0501083_0009247 Ga0501083_0009247_5799_6536 241
983 3300049822 Ga0501035_0008203 Ga0501035_0008203_5791_6528 241
984 3300049822 Ga0501035_0016971 Ga0501035_0016971_4017_4742 241
985 3300049822 Ga0501035_0017639 Ga0501035_0017639_5290_6015 241
986 3300049822 Ga0501035_0047883 Ga0501035_0047883_2657_3382 241
987 3300049822 Ga0501035_0071919 Ga0501035_0071919_1411_2142 241
988 3300049822 Ga0501035_0092344 Ga0501035_0092344_816_1544 241
989 3300049822 Ga0501035_0126030 Ga0501035_0126030_484_1209 241
990 3300049823 Ga0501044_0005221 Ga0501044_0005221_9974_10699 241
991 3300049823 Ga0501044_0006363 Ga0501044_0006363_4563_5288 241
992 3300049823 Ga0501044_0013651 Ga0501044_0013651_6862_7599 241
993 3300049823 Ga0501044_0016458 Ga0501044_0016458_6710_7435 241
994 3300049823 Ga0501044_0057165 Ga0501044_0057165_2825_3550 241
995 3300049824 Ga0501045_0056529 Ga0501045_0056529_1089_1814 241
996 3300049824 Ga0501045_0072361 Ga0501045_0072361_1312_2049 241
997 3300049824 Ga0501045_0088426 Ga0501045_0088426_709_1437 241
998 3300049824 Ga0501045_0190144 Ga0501045_0190144_679_1410 241
999 3300050490 nmdc:mga03n38_33572_c1 nmdc:mga03n38_33572_c1_984_1712 241
1000 3300050495 nmdc:mga04h51_14526_c1 nmdc:mga04h51_14526_c1_642_1367 241
1001 3300050496 nmdc:mga07m45_30018_c3 nmdc:mga07m45_30018_c3_1262_1990 241
1002 3300053078 Ga0495612_0019542 Ga0495612_0019542_328_1056 241
1003 3300053078 Ga0495612_0035189 Ga0495612_0035189_1259_1996 241
1004 3300053085 Ga0495619_0034364 Ga0495619_0034364_1391_2119 241
1005 3300053085 Ga0495619_0143557 Ga0495619_0143557_19_756 241
1006 3300053088 Ga0500644_0043545 Ga0500644_0043545_692_1420 241
1007 3300053093 Ga0500651_0233972 Ga0500651_0233972_89_820 241
1008 3300053094 Ga0500566_0017617 Ga0500566_0017617_540_1271 241
1009 3300053095 Ga0500640_014535 Ga0500640_014535_1205_1933 241
1010 3300053107 Ga0500560_014684 Ga0500560_014684_395_1126 241
1011 3300053109 Ga0500569_001652 Ga0500569_001652_725_1456 241
1012 3300053131 Ga0500652_001263 Ga0500652_001263_2751_3482 241
1013 3300053137 Ga0500561_0000299 Ga0500561_0000299_6964_7695 241
1014 3300053140 Ga0500573_0075010 Ga0500573_0075010_16_744 241
1015 3300053142 Ga0500577_0067301 Ga0500577_0067301_65_796 241
1016 3300053146 Ga0500588_0029040 Ga0500588_0029040_488_1219 241
1017 3300053149 Ga0500600_0009099 Ga0500600_0009099_1841_2572 241
1018 3300053149 Ga0500600_0093442 Ga0500600_0093442_213_938 241
1019 3300053153 Ga0500616_0009856 Ga0500616_0009856_2508_3239 241
1020 3300053157 Ga0500624_002698 Ga0500624_002698_671_1399 241
1021 3300053160 Ga0500633_0000386 Ga0500633_0000386_3360_4091 241
1022 3300053161 Ga0500634_0000473 Ga0500634_0000473_5139_5870 241
1023 3300053732 Ga0500656_000142 Ga0500656_000142_1245_1976 241
1024 3300053739 Ga0500587_000104 Ga0500587_000104_301_1032 241
1025 3300054114 Ga0501084_0040371 Ga0501084_0040371_1044_1781 241
1026 3300054114 Ga0501084_0144427 Ga0501084_0144427_724_1452 241
1027 3300054114 Ga0501084_0329255 Ga0501084_0329255_254_979 241
1028 3300060353 Ga0501082_0030518 Ga0501082_0030518_3554_4291 241
1029 3300060353 Ga0501082_0151126 Ga0501082_0151126_719_1447 241
1030 3300061719 Ga0466962_0000264 Ga0466962_0000264_8372_9100 241
1031 3300061719 Ga0466962_0003662 Ga0466962_0003662_4488_5231 241
1032 3300061719 Ga0466962_0024435 Ga0466962_0024435_1196_1936 241
1033 3300061734 Ga0530510_0009623 Ga0530510_0009623_5839_6576 241
1034 3300061734 Ga0530510_0263182 Ga0530510_0263182_271_999 241
1035 iso_pu_bacteria 2862281513 2862288759 241
1036 iso_pu_bacteria 2862705112 2862707759 241
1037 iso_pu_bacteria 2867369537 2867370564 241
1038 iso_pu_bacteria 2877676314 2877682699 241
1039 iso_pu_bacteria 2912757875 2912759442 241
1040 iso_pu_bacteria 2990044586 2990049353 241
1041 iso_pu_bacteria 3006486233 3006488000 241
1042 iso_pu_bacteria 8025524527 8025528842 241
1043 iso_pu_bacteria 8025530807 8025535444 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

28

254

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u28-assembly1.cif.gz_A crystal structure of apo phosphoribosyl isomerase a from streptomyces sviceus atcc 29083 0.9964 2 241
4w9t-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.9958 3 241
4u28-assembly1.cif.gz_A crystal structure of apo phosphoribosyl isomerase a from streptomyces sviceus atcc 29083 0.9922 2 241
4x2r-assembly1.cif.gz_A crystal structure of pria from actinomyces urogenitalis 0.9888 2 241
4tx9-assembly1.cif.gz_A crystal structure of hisap from streptomyces sviceus with degraded profar 0.9877 1 241
ID Description Score Start End Superfamily
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9889 2 241 3.20.20.70
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9606 2 241 3.20.20.70
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9453 6 240 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9421 4 241 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9383 4 241 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6J7TZ86-F1-model_v4 Unannotated protein 0.9992 128 239 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A6I2XYG1-F1-model_v4 Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) 0.999 115 239 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737
AF-A0A132MPP7-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9989 22 239 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737
AF-A0A6G3XFK6-F1-model_v4 Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) 0.998 1 122 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737
AF-A0A6N9YAZ4-F1-model_v4 deleted 0.9969 74 239

Feature Viewer

pLDDT pTM Quality
93.74 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map