F488890
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1043 | 521 | 902 | 242 |
Family's Representative Sequence
| Representative Sequence | 3300031665|Ga0316575_10001025|Ga0316575_1000102511 |
| Length | 265 |
| Sequence | VEDLTDAPGTLDAPTTEEECVTDAPRLELLPAVDVADGRAVRLVQGEAGSETSYGDPVAAALEWQAGGAEWIHLVDLDAAFGRGSNADLLADVVSRLDVRVEMSGGIRDDDSLRRALATGCARVNLGTAALEDPEWTARAIAERGDRVAVGLDVRGTTLAARGWTKEGGDLWEVLARLDAAGCARYVVTDVTKDGTLRGPNLDLLRRVCAATDSPVVASGGVSSLDDLAALRALVPDGVEGAIVGKALYAGAFTLPDALDVAGRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 2 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 3 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 4 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 5 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 6 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 7 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 8 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 9 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 10 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 11 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 12 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 13 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 14 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 15 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 16 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 17 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 18 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 19 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 20 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 21 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 22 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 23 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 24 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 25 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 26 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 27 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 28 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 29 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 30 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 31 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 32 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 33 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 34 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 35 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 36 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 37 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 38 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 39 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 40 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 41 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 42 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 43 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 44 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 45 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 46 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 47 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 48 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 49 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 50 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 51 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 52 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 53 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 54 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 55 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 56 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 57 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 58 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 59 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 60 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 61 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 62 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 63 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 64 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 65 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 66 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 67 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 68 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 69 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 70 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 71 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 72 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 73 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 74 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 75 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 76 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 77 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 78 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 79 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 80 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 81 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 82 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 83 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 84 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 85 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 86 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 87 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 88 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 89 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 90 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 91 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 92 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 93 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 94 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 95 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 96 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 97 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 98 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 99 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 100 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 101 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 102 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 103 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 104 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 105 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 106 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 107 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 108 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 109 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 110 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 111 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 112 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 113 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 114 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 115 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 116 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 117 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 118 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 119 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 120 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 121 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 122 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 123 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 124 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 125 | 3300003285 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 126 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 127 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 128 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 129 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 131 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 134 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 136 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 138 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 139 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 140 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 141 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 142 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 144 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 145 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 147 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 148 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 149 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 150 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 151 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 153 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 154 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 155 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 156 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 157 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 158 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 159 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 160 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 162 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 163 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 185 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 188 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 189 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 190 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 191 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 192 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 193 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 194 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 229 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 230 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 231 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 232 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 233 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 234 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 235 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 236 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 237 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 238 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 239 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 240 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 241 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 242 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 243 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 244 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 245 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 246 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 247 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 248 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 249 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 250 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 251 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 252 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 253 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 254 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 255 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 256 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 257 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 258 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 259 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 260 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 261 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 262 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 263 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 264 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 265 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 266 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 267 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 268 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 270 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 271 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 272 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 274 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 275 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 276 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 277 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 278 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 279 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 280 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 281 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 282 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 283 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 284 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 285 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 286 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 289 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 290 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 291 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 292 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 293 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 294 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 295 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 296 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 297 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 298 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 299 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 300 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 301 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 302 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 303 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 304 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 305 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 306 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 307 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 308 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 309 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 310 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 311 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 312 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 313 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 314 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 315 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 316 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 317 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 318 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 319 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 320 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 321 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 322 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 323 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 409 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 410 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 411 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 412 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 413 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 414 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 416 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 417 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 418 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 419 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 420 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 421 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 422 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 423 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 424 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 425 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 426 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 427 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 428 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 429 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 465 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 466 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 467 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 468 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 477 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 478 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 479 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 480 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 481 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 482 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 483 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 484 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 485 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 486 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 487 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 488 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 489 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 490 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 491 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 492 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 493 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 494 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 495 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 496 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 497 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 498 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 500 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 501 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 502 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 503 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 504 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 505 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 506 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 507 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 508 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 509 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 510 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 511 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 512 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 513 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 514 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 515 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 516 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 517 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 518 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 519 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 520 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 521 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.43 |
| Metatranscriptomes | 1.05 |
| Isolates | 13.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.36 |
| Nodule | 0.38 |
| Rhizoplane | 3.84 |
| Rhizosphere | 78.04 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 14.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10010664 | 3300001989 | Bacteria | 3408 |
| 2 | JGI24737J22298_10020253 | 3300001990 | Bacteria | 2124 |
| 3 | JGI24738J21930_10012514 | 3300002075 | Bacteria | 1853 |
| 4 | JGI25406J46586_10002838 | 3300003203 | Bacteria | 8165 |
| 5 | Ga0007423J48922_100139 | 3300003285 | Bacteria | 33024 |
| 6 | rootH2_10070449 | 3300003320 | Bacteria | 1406 |
| 7 | rootL2_10011701 | 3300003322 | Bacteria | 3694 |
| 8 | Ga0006562J51391_1157002 | 3300003578 | Bacteria | 5800 |
| 9 | Ga0006562J51391_1157005 | 3300003578 | Bacteria | 1680 |
| 10 | Ga0070658_10001257 | 3300005327 | Bacteria | 21711 |
| 11 | Ga0070658_10008378 | 3300005327 | Bacteria | 8311 |
| 12 | Ga0070658_10015310 | 3300005327 | Bacteria | 6138 |
| 13 | Ga0070658_10199462 | 3300005327 | Bacteria | 1688 |
| 14 | Ga0070658_10602833 | 3300005327 | Bacteria | 952 |
| 15 | Ga0070680_100224733 | 3300005336 | Bacteria | 1585 |
| 16 | Ga0070660_100098521 | 3300005339 | Bacteria | 2314 |
| 17 | Ga0070660_100153009 | 3300005339 | Bacteria | 1855 |
| 18 | Ga0070660_100259018 | 3300005339 | Bacteria | 1420 |
| 19 | Ga0070714_100004428 | 3300005435 | Bacteria | 10573 |
| 20 | Ga0070714_100004987 | 3300005435 | Bacteria | 10091 |
| 21 | Ga0070714_100685964 | 3300005435 | Bacteria | 988 |
| 22 | Ga0070710_10000044 | 3300005437 | Bacteria | 58112 |
| 23 | Ga0070705_100153705 | 3300005440 | Bacteria | 1529 |
| 24 | Ga0070700_100000007 | 3300005441 | Bacteria | 198866 |
| 25 | Ga0070663_100117229 | 3300005455 | Bacteria | 2008 |
| 26 | Ga0070663_100175118 | 3300005455 | Bacteria | 1661 |
| 27 | Ga0070681_10091626 | 3300005458 | Bacteria | 2990 |
| 28 | Ga0070681_10908481 | 3300005458 | Bacteria | 799 |
| 29 | Ga0070679_100007399 | 3300005530 | Bacteria | 10261 |
| 30 | Ga0070684_100067183 | 3300005535 | Bacteria | 3148 |
| 31 | Ga0070684_100379274 | 3300005535 | Bacteria | 1302 |
| 32 | Ga0068853_100022098 | 3300005539 | Bacteria | 5309 |
| 33 | Ga0068853_100097278 | 3300005539 | Bacteria | 2598 |
| 34 | Ga0070686_100126260 | 3300005544 | Bacteria | 1763 |
| 35 | Ga0070665_100021952 | 3300005548 | Bacteria | 6420 |
| 36 | Ga0070665_100213759 | 3300005548 | Bacteria | 1929 |
| 37 | Ga0068855_100013558 | 3300005563 | Bacteria | 9831 |
| 38 | Ga0068855_100099049 | 3300005563 | Bacteria | 3358 |
| 39 | Ga0068855_100250917 | 3300005563 | Bacteria | 1974 |
| 40 | Ga0068856_100101506 | 3300005614 | Bacteria | 2870 |
| 41 | Ga0068856_100118454 | 3300005614 | Bacteria | 2649 |
| 42 | Ga0068856_100154063 | 3300005614 | Bacteria | 2308 |
| 43 | Ga0068856_100341016 | 3300005614 | Bacteria | 1517 |
| 44 | Ga0070702_100000907 | 3300005615 | Bacteria | 11562 |
| 45 | Ga0068852_100030459 | 3300005616 | Bacteria | 4442 |
| 46 | Ga0068870_10202948 | 3300005840 | Bacteria | 1203 |
| 47 | Ga0081455_10000443 | 3300005937 | Bacteria | 54547 |
| 48 | Ga0081455_10054131 | 3300005937 | Bacteria | 3423 |
| 49 | Ga0081540_1004894 | 3300005983 | Bacteria | 10089 |
| 50 | Ga0081539_10000988 | 3300005985 | Bacteria | 52904 |
| 51 | Ga0081539_10004512 | 3300005985 | Bacteria | 15299 |
| 52 | Ga0081539_10008926 | 3300005985 | Bacteria | 8547 |
| 53 | Ga0081539_10133842 | 3300005985 | Bacteria | 1214 |
| 54 | Ga0070717_10312129 | 3300006028 | Bacteria | 1400 |
| 55 | Ga0075368_10008947 | 3300006042 | Bacteria | 3590 |
| 56 | Ga0075364_10003377 | 3300006051 | Bacteria | 9065 |
| 57 | Ga0070712_100267205 | 3300006175 | Bacteria | 1373 |
| 58 | Ga0070712_100397857 | 3300006175 | Bacteria | 1137 |
| 59 | Ga0075367_10001030 | 3300006178 | Bacteria | 11486 |
| 60 | Ga0075370_10064971 | 3300006353 | Bacteria | 2081 |
| 61 | Ga0075433_10025524 | 3300006852 | Bacteria | 4996 |
| 62 | Ga0075429_100326061 | 3300006880 | Bacteria | 1344 |
| 63 | Ga0075436_100132597 | 3300006914 | Bacteria | 1747 |
| 64 | Ga0097620_100051607 | 3300006931 | Bacteria | 4134 |
| 65 | Ga0099826_10055096 | 3300006948 | Bacteria | 2636 |
| 66 | Ga0075435_100002359 | 3300007076 | Bacteria | 12518 |
| 67 | Ga0105250_10012833 | 3300009092 | Bacteria | 3452 |
| 68 | Ga0105240_10002006 | 3300009093 | Bacteria | 33571 |
| 69 | Ga0105240_10504435 | 3300009093 | Bacteria | 1345 |
| 70 | Ga0105245_10474514 | 3300009098 | Bacteria | 1263 |
| 71 | Ga0105245_10574172 | 3300009098 | Bacteria | 1152 |
| 72 | Ga0105247_10001304 | 3300009101 | Bacteria | 18324 |
| 73 | Ga0105243_10012714 | 3300009148 | Bacteria | 6358 |
| 74 | Ga0105243_10097794 | 3300009148 | Bacteria | 2430 |
| 75 | Ga0105243_10592998 | 3300009148 | Bacteria | 1066 |
| 76 | Ga0105241_10009224 | 3300009174 | Bacteria | 7256 |
| 77 | Ga0105242_10055393 | 3300009176 | Bacteria | 3244 |
| 78 | Ga0105237_10032397 | 3300009545 | Bacteria | 5291 |
| 79 | Ga0105237_10612707 | 3300009545 | Bacteria | 1095 |
| 80 | Ga0105238_10013809 | 3300009551 | Bacteria | 8164 |
| 81 | Ga0105238_10047653 | 3300009551 | Bacteria | 4320 |
| 82 | Ga0105238_10060498 | 3300009551 | Bacteria | 3792 |
| 83 | Ga0105238_10095585 | 3300009551 | Bacteria | 2958 |
| 84 | Ga0105238_10367498 | 3300009551 | Bacteria | 1429 |
| 85 | Ga0105249_10577107 | 3300009553 | Bacteria | 1177 |
| 86 | Ga0105249_10685609 | 3300009553 | Bacteria | 1084 |
| 87 | Ga0105239_10073281 | 3300010375 | Bacteria | 3765 |
| 88 | Ga0105246_10227605 | 3300011119 | Bacteria | 1466 |
| 89 | Ga0105246_10232949 | 3300011119 | Bacteria | 1451 |
| 90 | Ga0157371_10004092 | 3300013102 | Bacteria | 12890 |
| 91 | Ga0157370_10004259 | 3300013104 | Bacteria | 16514 |
| 92 | Ga0157370_10038416 | 3300013104 | Bacteria | 4630 |
| 93 | Ga0157369_10016379 | 3300013105 | Bacteria | 8340 |
| 94 | Ga0157369_10118308 | 3300013105 | Bacteria | 2812 |
| 95 | Ga0157369_10155606 | 3300013105 | Bacteria | 2414 |
| 96 | Ga0157369_10199185 | 3300013105 | Bacteria | 2102 |
| 97 | Ga0157374_10450774 | 3300013296 | Bacteria | 1288 |
| 98 | Ga0157378_10291884 | 3300013297 | Bacteria | 1575 |
| 99 | Ga0163162_10292191 | 3300013306 | Bacteria | 1761 |
| 100 | Ga0163162_10436577 | 3300013306 | Bacteria | 1441 |
| 101 | Ga0157372_10000079 | 3300013307 | Bacteria | 100687 |
| 102 | Ga0157372_10132319 | 3300013307 | Bacteria | 2871 |
| 103 | Ga0157372_10148987 | 3300013307 | Bacteria | 2699 |
| 104 | Ga0157372_10912574 | 3300013307 | Bacteria | 1019 |
| 105 | Ga0157375_10596968 | 3300013308 | Bacteria | 1263 |
| 106 | Ga0157380_10973232 | 3300014326 | Bacteria | 880 |
| 107 | Ga0182008_10002930 | 3300014497 | Bacteria | 10528 |
| 108 | Ga0157377_10347686 | 3300014745 | Bacteria | 994 |
| 109 | Ga0157379_10170874 | 3300014968 | Bacteria | 1962 |
| 110 | Ga0182006_1067333 | 3300015261 | Bacteria | 1337 |
| 111 | Ga0182007_10004606 | 3300015262 | Bacteria | 6231 |
| 112 | Ga0183367_1007 | 3300015688 | Bacteria | 498079 |
| 113 | Ga0206354_10024324 | 3300020081 | Bacteria | 1189 |
| 114 | Ga0206353_10114382 | 3300020082 | Bacteria | 2447 |
| 115 | Ga0206353_10447514 | 3300020082 | Bacteria | 3060 |
| 116 | Ga0206353_10600692 | 3300020082 | Bacteria | 5401 |
| 117 | Ga0206353_11478345 | 3300020082 | Bacteria | 1345 |
| 118 | Ga0213873_10000058 | 3300021358 | Bacteria | 24370 |
| 119 | Ga0213875_10000071 | 3300021388 | Bacteria | 120220 |
| 120 | Ga0213875_10001897 | 3300021388 | Bacteria | 12937 |
| 121 | Ga0213875_10081951 | 3300021388 | Bacteria | 1505 |
| 122 | Ga0207692_10000357 | 3300025898 | Bacteria | 15729 |
| 123 | Ga0207710_10023559 | 3300025900 | Bacteria | 2646 |
| 124 | Ga0207688_10368977 | 3300025901 | Bacteria | 887 |
| 125 | Ga0207647_10016380 | 3300025904 | Bacteria | 5060 |
| 126 | Ga0207647_10073596 | 3300025904 | Bacteria | 2058 |
| 127 | Ga0207643_10040861 | 3300025908 | Bacteria | 2612 |
| 128 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 129 | Ga0207705_10193151 | 3300025909 | Bacteria | 1540 |
| 130 | Ga0207705_10209977 | 3300025909 | Bacteria | 1477 |
| 131 | Ga0207654_10132764 | 3300025911 | Bacteria | 1578 |
| 132 | Ga0207707_10060501 | 3300025912 | Bacteria | 3295 |
| 133 | Ga0207695_10001622 | 3300025913 | Bacteria | 36477 |
| 134 | Ga0207695_10604979 | 3300025913 | Bacteria | 977 |
| 135 | Ga0207671_10000976 | 3300025914 | Bacteria | 35441 |
| 136 | Ga0207671_10489531 | 3300025914 | Bacteria | 980 |
| 137 | Ga0207693_10347695 | 3300025915 | Bacteria | 1160 |
| 138 | Ga0207660_10161899 | 3300025917 | Bacteria | 1727 |
| 139 | Ga0207657_10106689 | 3300025919 | Bacteria | 2317 |
| 140 | Ga0207657_10240635 | 3300025919 | Bacteria | 1445 |
| 141 | Ga0207657_10620790 | 3300025919 | Bacteria | 843 |
| 142 | Ga0207652_10173637 | 3300025921 | Bacteria | 1935 |
| 143 | Ga0207652_10206926 | 3300025921 | Bacteria | 1766 |
| 144 | Ga0207694_10000220 | 3300025924 | Bacteria | 55978 |
| 145 | Ga0207694_10054186 | 3300025924 | Bacteria | 3111 |
| 146 | Ga0207659_10547828 | 3300025926 | Bacteria | 983 |
| 147 | Ga0207700_10345017 | 3300025928 | Bacteria | 1295 |
| 148 | Ga0207664_10000091 | 3300025929 | Bacteria | 84244 |
| 149 | Ga0207664_10015771 | 3300025929 | Bacteria | 5496 |
| 150 | Ga0207664_10023671 | 3300025929 | Bacteria | 4605 |
| 151 | Ga0207664_10157794 | 3300025929 | Bacteria | 1933 |
| 152 | Ga0207664_10562169 | 3300025929 | Bacteria | 1024 |
| 153 | Ga0207690_10017351 | 3300025932 | Bacteria | 4392 |
| 154 | Ga0207709_10004841 | 3300025935 | Bacteria | 7712 |
| 155 | Ga0207709_10029752 | 3300025935 | Bacteria | 3171 |
| 156 | Ga0207704_10257852 | 3300025938 | Bacteria | 1313 |
| 157 | Ga0207661_10161058 | 3300025944 | Bacteria | 1947 |
| 158 | Ga0207661_10226208 | 3300025944 | Bacteria | 1655 |
| 159 | Ga0207667_10050485 | 3300025949 | Bacteria | 4389 |
| 160 | Ga0207667_10057590 | 3300025949 | Bacteria | 4079 |
| 161 | Ga0207667_10503441 | 3300025949 | Bacteria | 1228 |
| 162 | Ga0207668_10055981 | 3300025972 | Bacteria | 2745 |
| 163 | Ga0207668_10429322 | 3300025972 | Bacteria | 1123 |
| 164 | Ga0207640_10005073 | 3300025981 | Bacteria | 7165 |
| 165 | Ga0207639_10055224 | 3300026041 | Bacteria | 3039 |
| 166 | Ga0207639_10206353 | 3300026041 | Bacteria | 1689 |
| 167 | Ga0207678_10023532 | 3300026067 | Bacteria | 5387 |
| 168 | Ga0207678_10250594 | 3300026067 | Bacteria | 1516 |
| 169 | Ga0207708_10000006 | 3300026075 | Bacteria | 266916 |
| 170 | Ga0207702_10130418 | 3300026078 | Bacteria | 2262 |
| 171 | Ga0207702_10505883 | 3300026078 | Bacteria | 1178 |
| 172 | Ga0207702_10514038 | 3300026078 | Bacteria | 1168 |
| 173 | Ga0207674_10015577 | 3300026116 | Bacteria | 8350 |
| 174 | Ga0207675_100073159 | 3300026118 | Bacteria | 3207 |
| 175 | Ga0207683_10152206 | 3300026121 | Bacteria | 2088 |
| 176 | Ga0207683_10328499 | 3300026121 | Bacteria | 1401 |
| 177 | Ga0207698_10196474 | 3300026142 | Bacteria | 1803 |
| 178 | Ga0207698_10209726 | 3300026142 | Bacteria | 1752 |
| 179 | Ga0209813_10017241 | 3300027866 | Bacteria | 1981 |
| 180 | Ga0307517_10010039 | 3300028786 | Bacteria | 13314 |
| 181 | Ga0307517_10045407 | 3300028786 | Bacteria | 4615 |
| 182 | Ga0307515_10001023 | 3300028794 | Bacteria | 63806 |
| 183 | Ga0307515_10028171 | 3300028794 | Bacteria | 9559 |
| 184 | Ga0307515_10044259 | 3300028794 | Bacteria | 6884 |
| 185 | Ga0307511_10001719 | 3300030521 | Bacteria | 23050 |
| 186 | Ga0307511_10002015 | 3300030521 | Bacteria | 21310 |
| 187 | Ga0307511_10099457 | 3300030521 | Bacteria | 1919 |
| 188 | Ga0307511_10106659 | 3300030521 | Bacteria | 1807 |
| 189 | Ga0307511_10121505 | 3300030521 | Bacteria | 1613 |
| 190 | Ga0307512_10001219 | 3300030522 | Bacteria | 37239 |
| 191 | Ga0307512_10030796 | 3300030522 | Bacteria | 4660 |
| 192 | Ga0316176_1150059 | 3300030732 | Bacteria | 8347 |
| 193 | Ga0314311_1039871 | 3300030733 | Bacteria | 9000 |
| 194 | Ga0316178_1163203 | 3300030735 | Bacteria | 1339 |
| 195 | Ga0316180_1049974 | 3300030736 | Bacteria | 1142 |
| 196 | Ga0316183_1045511 | 3300030742 | Bacteria | 2084 |
| 197 | Ga0316181_1125033 | 3300030744 | Bacteria | 1864 |
| 198 | Ga0316182_1357079 | 3300030745 | Bacteria | 5185 |
| 199 | Ga0265340_10003524 | 3300031247 | Bacteria | 8803 |
| 200 | Ga0307513_10000483 | 3300031456 | Bacteria | 57234 |
| 201 | Ga0307513_10007993 | 3300031456 | Bacteria | 13589 |
| 202 | Ga0307513_10053872 | 3300031456 | Bacteria | 4319 |
| 203 | Ga0307513_10171194 | 3300031456 | Bacteria | 2049 |
| 204 | Ga0307509_10053988 | 3300031507 | Bacteria | 4280 |
| 205 | Ga0307509_10062666 | 3300031507 | Bacteria | 3920 |
| 206 | Ga0307509_10136899 | 3300031507 | Bacteria | 2392 |
| 207 | Ga0307408_100100359 | 3300031548 | Bacteria | 2204 |
| 208 | Ga0307408_100583191 | 3300031548 | Bacteria | 991 |
| 209 | Ga0307508_10002617 | 3300031616 | Bacteria | 18905 |
| 210 | Ga0307508_10005838 | 3300031616 | Bacteria | 11629 |
| 211 | Ga0307508_10048095 | 3300031616 | Bacteria | 3801 |
| 212 | Ga0307508_10085607 | 3300031616 | Bacteria | 2735 |
| 213 | Ga0307508_10125154 | 3300031616 | Bacteria | 2173 |
| 214 | Ga0307508_10257165 | 3300031616 | Bacteria | 1341 |
| 215 | Ga0307514_10000866 | 3300031649 | Bacteria | 48042 |
| 216 | Ga0307514_10068123 | 3300031649 | Bacteria | 2683 |
| 217 | Ga0307514_10082594 | 3300031649 | Bacteria | 2371 |
| 218 | Ga0316575_10001025 | 3300031665 | Bacteria | 8661 |
| 219 | Ga0316575_10002244 | 3300031665 | Bacteria | 6452 |
| 220 | Ga0316575_10029147 | 3300031665 | Bacteria | 2154 |
| 221 | Ga0316575_10129354 | 3300031665 | Bacteria | 1036 |
| 222 | Ga0316579_10001944 | 3300031691 | Bacteria | 7698 |
| 223 | Ga0316576_10000880 | 3300031727 | Bacteria | 15240 |
| 224 | Ga0316576_10005583 | 3300031727 | Bacteria | 7709 |
| 225 | Ga0316576_10006505 | 3300031727 | Bacteria | 7283 |
| 226 | Ga0316576_10020558 | 3300031727 | Bacteria | 4548 |
| 227 | Ga0316576_10047954 | 3300031727 | Bacteria | 3096 |
| 228 | Ga0316578_10019894 | 3300031728 | Bacteria | 3702 |
| 229 | Ga0316578_10051659 | 3300031728 | Bacteria | 2407 |
| 230 | Ga0316578_10073838 | 3300031728 | Bacteria | 2022 |
| 231 | Ga0316578_10184467 | 3300031728 | Bacteria | 1257 |
| 232 | Ga0307516_10000836 | 3300031730 | Bacteria | 42164 |
| 233 | Ga0307516_10017241 | 3300031730 | Bacteria | 7536 |
| 234 | Ga0307516_10039317 | 3300031730 | Bacteria | 4716 |
| 235 | Ga0307516_10278049 | 3300031730 | Bacteria | 1357 |
| 236 | Ga0307405_10142830 | 3300031731 | Bacteria | 1672 |
| 237 | Ga0316577_10032890 | 3300031733 | Bacteria | 2897 |
| 238 | Ga0316577_10099308 | 3300031733 | Bacteria | 1631 |
| 239 | Ga0307413_10001807 | 3300031824 | Bacteria | 8396 |
| 240 | Ga0307413_10073897 | 3300031824 | Bacteria | 2157 |
| 241 | Ga0307413_10085581 | 3300031824 | Bacteria | 2036 |
| 242 | Ga0307413_10415129 | 3300031824 | Bacteria | 1058 |
| 243 | Ga0307518_10000187 | 3300031838 | Bacteria | 47022 |
| 244 | Ga0307518_10168033 | 3300031838 | Bacteria | 1498 |
| 245 | Ga0307410_10054604 | 3300031852 | Bacteria | 2709 |
| 246 | Ga0307410_10120873 | 3300031852 | Bacteria | 1910 |
| 247 | Ga0307410_10217344 | 3300031852 | Bacteria | 1468 |
| 248 | Ga0307406_10098078 | 3300031901 | Bacteria | 1989 |
| 249 | Ga0307406_10128713 | 3300031901 | Bacteria | 1773 |
| 250 | Ga0307407_10253504 | 3300031903 | Bacteria | 1207 |
| 251 | Ga0307412_10015695 | 3300031911 | Bacteria | 4496 |
| 252 | Ga0307412_10052924 | 3300031911 | Bacteria | 2690 |
| 253 | Ga0307412_10064375 | 3300031911 | Bacteria | 2477 |
| 254 | Ga0307412_10548421 | 3300031911 | Bacteria | 971 |
| 255 | Ga0307409_100003904 | 3300031995 | Bacteria | 8249 |
| 256 | Ga0307409_100038860 | 3300031995 | Bacteria | 3525 |
| 257 | Ga0307409_100222765 | 3300031995 | Bacteria | 1704 |
| 258 | Ga0307409_100425048 | 3300031995 | Bacteria | 1275 |
| 259 | Ga0307409_100598414 | 3300031995 | Bacteria | 1089 |
| 260 | Ga0307409_100649547 | 3300031995 | Bacteria | 1049 |
| 261 | Ga0307416_100012870 | 3300032002 | Bacteria | 5660 |
| 262 | Ga0307416_100102010 | 3300032002 | Bacteria | 2500 |
| 263 | Ga0307416_100370147 | 3300032002 | Bacteria | 1459 |
| 264 | Ga0307416_100427894 | 3300032002 | Bacteria | 1370 |
| 265 | Ga0307414_10585579 | 3300032004 | Bacteria | 999 |
| 266 | Ga0307411_10004675 | 3300032005 | Bacteria | 6601 |
| 267 | Ga0307411_10305639 | 3300032005 | Bacteria | 1277 |
| 268 | Ga0307415_100089055 | 3300032126 | Bacteria | 2228 |
| 269 | Ga0316583_10013089 | 3300032133 | Bacteria | 2993 |
| 270 | Ga0316585_10003252 | 3300032137 | Bacteria | 4454 |
| 271 | Ga0316585_10009189 | 3300032137 | Bacteria | 2878 |
| 272 | Ga0316580_10010121 | 3300032139 | Bacteria | 2841 |
| 273 | Ga0307507_10000019 | 3300033179 | Bacteria | 224026 |
| 274 | Ga0307507_10017958 | 3300033179 | Bacteria | 8086 |
| 275 | Ga0307507_10045870 | 3300033179 | Bacteria | 4293 |
| 276 | Ga0307507_10308330 | 3300033179 | Bacteria | 964 |
| 277 | Ga0307510_10011375 | 3300033180 | Bacteria | 10571 |
| 278 | Ga0307510_10031973 | 3300033180 | Bacteria | 5935 |
| 279 | Ga0307510_10124243 | 3300033180 | Bacteria | 2275 |
| 280 | Ga0307510_10194466 | 3300033180 | Bacteria | 1572 |
| 281 | Ga0373942_0057929 | 3300035207 | Bacteria | 1103 |
| 282 | Ga0316574_0004754 | 3300035398 | Bacteria | 7170 |
| 283 | Ga0316574_0141240 | 3300035398 | Bacteria | 1551 |
| 284 | Ga0316574_0278298 | 3300035398 | Bacteria | 1066 |
| 285 | Ga0316582_0007848 | 3300036647 | Bacteria | 5703 |
| 286 | Ga0316582_0058991 | 3300036647 | Bacteria | 2455 |
| 287 | Ga0316582_0246618 | 3300036647 | Bacteria | 1224 |
| 288 | Ga0316584_0003071 | 3300036712 | Bacteria | 10758 |
| 289 | Ga0316584_0028637 | 3300036712 | Bacteria | 4109 |
| 290 | Ga0316584_0042701 | 3300036712 | Bacteria | 3379 |
| 291 | Ga0316584_0179957 | 3300036712 | Bacteria | 1565 |
| 292 | Ga0373925_0130767 | 3300037068 | Bacteria | 1957 |
| 293 | Ga0395899_0011707 | 3300037312 | Bacteria | 6715 |
| 294 | Ga0395899_0012802 | 3300037312 | Bacteria | 6428 |
| 295 | Ga0395899_0133485 | 3300037312 | Bacteria | 1771 |
| 296 | Ga0395900_0024030 | 3300037418 | Bacteria | 6236 |
| 297 | Ga0395900_0054388 | 3300037418 | Bacteria | 4122 |
| 298 | Ga0395900_0059411 | 3300037418 | Bacteria | 3936 |
| 299 | Ga0395898_0003138 | 3300037466 | Bacteria | 18662 |
| 300 | Ga0395898_0003389 | 3300037466 | Bacteria | 17855 |
| 301 | Ga0395898_0078790 | 3300037466 | Bacteria | 3179 |
| 302 | Ga0395898_0124866 | 3300037466 | Bacteria | 2465 |
| 303 | Ga0395898_0125388 | 3300037466 | Bacteria | 2460 |
| 304 | Ga0395898_0151883 | 3300037466 | Bacteria | 2215 |
| 305 | Ga0395898_0169704 | 3300037466 | Bacteria | 2086 |
| 306 | Ga0395898_0631775 | 3300037466 | Bacteria | 1013 |
| 307 | Ga0395905_0024507 | 3300037471 | Bacteria | 5694 |
| 308 | Ga0395905_0385676 | 3300037471 | Bacteria | 1295 |
| 309 | Ga0316581_0051225 | 3300037588 | Bacteria | 1265 |
| 310 | Ga0436364_0383034 | 3300037853 | Bacteria | 52816 |
| 311 | Ga0436364_0619304 | 3300037853 | Bacteria | 133320 |
| 312 | Ga0436364_1193326 | 3300037853 | Bacteria | 6592 |
| 313 | Ga0395901_0003409 | 3300038443 | Bacteria | 16013 |
| 314 | Ga0395901_0011881 | 3300038443 | Bacteria | 8831 |
| 315 | Ga0395901_0100620 | 3300038443 | Bacteria | 3032 |
| 316 | Ga0395901_0116605 | 3300038443 | Bacteria | 2805 |
| 317 | Ga0395901_0179986 | 3300038443 | Bacteria | 2217 |
| 318 | Ga0395901_0187487 | 3300038443 | Bacteria | 2169 |
| 319 | Ga0395901_0274685 | 3300038443 | Bacteria | 1752 |
| 320 | Ga0395901_0339111 | 3300038443 | Bacteria | 1553 |
| 321 | Ga0400485_07745 | 3300038735 | Bacteria | 24721 |
| 322 | Ga0400488_11659 | 3300038741 | Bacteria | 9771 |
| 323 | Ga0400486_04200 | 3300038742 | Bacteria | 58211 |
| 324 | Ga0436365_1156973 | 3300039437 | Bacteria | 1643 |
| 325 | Ga0439436_0004093 | 3300041404 | Bacteria | 4471 |
| 326 | Ga0439439_0015650 | 3300041406 | Bacteria | 1854 |
| 327 | Ga0451789_0675791 | 3300041443 | Bacteria | 1341 |
| 328 | Ga0451795_0121483 | 3300041456 | Bacteria | 2342 |
| 329 | Ga0451833_1101346 | 3300041491 | Bacteria | 4129 |
| 330 | Ga0451833_1314909 | 3300041491 | Bacteria | 766 |
| 331 | Ga0451835_0497006 | 3300041492 | Bacteria | 1507 |
| 332 | Ga0451837_0076298 | 3300041494 | Bacteria | 5466 |
| 333 | Ga0451841_1174457 | 3300041498 | Bacteria | 1103 |
| 334 | Ga0451843_1293141 | 3300041509 | Bacteria | 1959 |
| 335 | Ga0451853_1635577 | 3300041512 | Bacteria | 9224 |
| 336 | Ga0451853_2882476 | 3300041512 | Bacteria | 1359 |
| 337 | Ga0439442_003740 | 3300042002 | Bacteria | 3015 |
| 338 | Ga0439448_0086255 | 3300042005 | Bacteria | 1058 |
| 339 | Ga0439432_015276 | 3300042006 | Bacteria | 2593 |
| 340 | Ga0439449_0001767 | 3300042007 | Bacteria | 8497 |
| 341 | Ga0439450_019447 | 3300042008 | Bacteria | 1439 |
| 342 | Ga0439455_0053092 | 3300042012 | Bacteria | 1062 |
| 343 | Ga0439457_000358 | 3300042014 | Bacteria | 12732 |
| 344 | Ga0450894_000108 | 3300042131 | Bacteria | 14142 |
| 345 | Ga0450896_000133 | 3300042133 | Bacteria | 5646 |
| 346 | Ga0450898_000249 | 3300042134 | Bacteria | 5923 |
| 347 | Ga0450898_005549 | 3300042134 | Bacteria | 1911 |
| 348 | Ga0439458_0000302 | 3300042157 | Bacteria | 12271 |
| 349 | Ga0450908_003192 | 3300042184 | Bacteria | 3187 |
| 350 | Ga0450901_002785 | 3300042533 | Bacteria | 1854 |
| 351 | Ga0451577_0252036 | 3300042876 | Unclassified | 1598 |
| 352 | Ga0466969_0000312 | 3300044656 | Bacteria | 26699 |
| 353 | Ga0466969_0063271 | 3300044656 | Bacteria | 1793 |
| 354 | Ga0466969_0082283 | 3300044656 | Bacteria | 1534 |
| 355 | Ga0466969_0092650 | 3300044656 | Bacteria | 1430 |
| 356 | Ga0466969_0122548 | 3300044656 | Bacteria | 1209 |
| 357 | Ga0466969_0126177 | 3300044656 | Bacteria | 1189 |
| 358 | Ga0466972_0007209 | 3300044658 | Bacteria | 5583 |
| 359 | Ga0466972_0009202 | 3300044658 | Bacteria | 4960 |
| 360 | Ga0466972_0019146 | 3300044658 | Bacteria | 3423 |
| 361 | Ga0466972_0038057 | 3300044658 | Bacteria | 2350 |
| 362 | Ga0466972_0164233 | 3300044658 | Bacteria | 1043 |
| 363 | Ga0466965_0000544 | 3300044683 | Bacteria | 13582 |
| 364 | Ga0466965_0003850 | 3300044683 | Bacteria | 6627 |
| 365 | Ga0466965_0024888 | 3300044683 | Bacteria | 2896 |
| 366 | Ga0466965_0055567 | 3300044683 | Bacteria | 1970 |
| 367 | Ga0466965_0091716 | 3300044683 | Bacteria | 1546 |
| 368 | Ga0466965_0140284 | 3300044683 | Bacteria | 1258 |
| 369 | Ga0466965_0185174 | 3300044683 | Bacteria | 1100 |
| 370 | Ga0466966_0000681 | 3300044684 | Bacteria | 21566 |
| 371 | Ga0466966_0000853 | 3300044684 | Bacteria | 19461 |
| 372 | Ga0466966_0001836 | 3300044684 | Bacteria | 13765 |
| 373 | Ga0466966_0006747 | 3300044684 | Bacteria | 7602 |
| 374 | Ga0466966_0017580 | 3300044684 | Bacteria | 4724 |
| 375 | Ga0466966_0175444 | 3300044684 | Bacteria | 1301 |
| 376 | Ga0466961_0001762 | 3300044693 | Bacteria | 13420 |
| 377 | Ga0466961_0004550 | 3300044693 | Bacteria | 8698 |
| 378 | Ga0466961_0012188 | 3300044693 | Bacteria | 5498 |
| 379 | Ga0466961_0020506 | 3300044693 | Bacteria | 4254 |
| 380 | Ga0466961_0024952 | 3300044693 | Bacteria | 3846 |
| 381 | Ga0466961_0033050 | 3300044693 | Bacteria | 3324 |
| 382 | Ga0466961_0094173 | 3300044693 | Bacteria | 1890 |
| 383 | Ga0466963_0000206 | 3300044694 | Bacteria | 25098 |
| 384 | Ga0466963_0000614 | 3300044694 | Bacteria | 17088 |
| 385 | Ga0466963_0020362 | 3300044694 | Bacteria | 4171 |
| 386 | Ga0466963_0037006 | 3300044694 | Bacteria | 3185 |
| 387 | Ga0466963_0161976 | 3300044694 | Bacteria | 1557 |
| 388 | Ga0466963_0314793 | 3300044694 | Bacteria | 1101 |
| 389 | Ga0466963_0321552 | 3300044694 | Bacteria | 1089 |
| 390 | Ga0466964_0037040 | 3300044706 | Bacteria | 1958 |
| 391 | Ga0466964_0040300 | 3300044706 | Bacteria | 1885 |
| 392 | Ga0466971_0008218 | 3300044719 | Bacteria | 4552 |
| 393 | Ga0466971_0009107 | 3300044719 | Bacteria | 4338 |
| 394 | Ga0466971_0013856 | 3300044719 | Bacteria | 3545 |
| 395 | Ga0466971_0033927 | 3300044719 | Bacteria | 2287 |
| 396 | Ga0466971_0038368 | 3300044719 | Bacteria | 2150 |
| 397 | Ga0466968_0000913 | 3300044735 | Bacteria | 10403 |
| 398 | Ga0466968_0108827 | 3300044735 | Bacteria | 1244 |
| 399 | Ga0466970_0001751 | 3300044765 | Bacteria | 10476 |
| 400 | Ga0466970_0002247 | 3300044765 | Bacteria | 9324 |
| 401 | Ga0466970_0002697 | 3300044765 | Bacteria | 8575 |
| 402 | Ga0466970_0003067 | 3300044765 | Bacteria | 8111 |
| 403 | Ga0466970_0016567 | 3300044765 | Bacteria | 3802 |
| 404 | Ga0466970_0019046 | 3300044765 | Bacteria | 3557 |
| 405 | Ga0466970_0263882 | 3300044765 | Bacteria | 966 |
| 406 | Ga0466957_0000450 | 3300044842 | Bacteria | 20326 |
| 407 | Ga0466957_0164363 | 3300044842 | Bacteria | 1443 |
| 408 | Ga0466957_0262665 | 3300044842 | Bacteria | 1151 |
| 409 | Ga0466957_0286834 | 3300044842 | Bacteria | 1103 |
| 410 | Ga0466960_0002663 | 3300044901 | Bacteria | 6737 |
| 411 | Ga0466960_0005164 | 3300044901 | Bacteria | 5163 |
| 412 | Ga0466960_0024045 | 3300044901 | Bacteria | 2744 |
| 413 | Ga0466960_0025324 | 3300044901 | Bacteria | 2684 |
| 414 | Ga0466960_0298100 | 3300044901 | Bacteria | 908 |
| 415 | Ga0466959_0000702 | 3300045049 | Bacteria | 19592 |
| 416 | Ga0466959_0003628 | 3300045049 | Bacteria | 10181 |
| 417 | Ga0466959_0004881 | 3300045049 | Bacteria | 9078 |
| 418 | Ga0466959_0014819 | 3300045049 | Bacteria | 5675 |
| 419 | Ga0466959_0201267 | 3300045049 | Bacteria | 1386 |
| 420 | Ga0466958_0000246 | 3300045836 | Bacteria | 20885 |
| 421 | Ga0466958_0004524 | 3300045836 | Bacteria | 7349 |
| 422 | Ga0466958_0019819 | 3300045836 | Bacteria | 3917 |
| 423 | Ga0466958_0030508 | 3300045836 | Bacteria | 3203 |
| 424 | Ga0466958_0052067 | 3300045836 | Bacteria | 2480 |
| 425 | Ga0466958_0265827 | 3300045836 | Bacteria | 1098 |
| 426 | Ga0466958_0322136 | 3300045836 | Bacteria | 993 |
| 427 | Ga0466967_0000259 | 3300045976 | Bacteria | 23242 |
| 428 | Ga0466967_0005297 | 3300045976 | Bacteria | 8903 |
| 429 | Ga0466967_0229605 | 3300045976 | Bacteria | 1767 |
| 430 | Ga0466967_0278286 | 3300045976 | Bacteria | 1605 |
| 431 | Ga0466967_0480116 | 3300045976 | Bacteria | 1218 |
| 432 | Ga0466967_0701272 | 3300045976 | Bacteria | 1002 |
| 433 | Ga0495617_015956 | 3300046452 | Bacteria | 2541 |
| 434 | Ga0495627_023753 | 3300046453 | Bacteria | 2005 |
| 435 | Ga0495627_039221 | 3300046453 | Bacteria | 1462 |
| 436 | Ga0495592_0006146 | 3300046454 | Bacteria | 8931 |
| 437 | Ga0495592_0015690 | 3300046454 | Bacteria | 5747 |
| 438 | Ga0495592_0055209 | 3300046454 | Bacteria | 2939 |
| 439 | Ga0495592_0074713 | 3300046454 | Bacteria | 2462 |
| 440 | Ga0495592_0101946 | 3300046454 | Bacteria | 2044 |
| 441 | Ga0495592_0163579 | 3300046454 | Bacteria | 1529 |
| 442 | Ga0495603_0000118 | 3300046455 | Bacteria | 38501 |
| 443 | Ga0495603_0002495 | 3300046455 | Bacteria | 10830 |
| 444 | Ga0495603_0053210 | 3300046455 | Bacteria | 2402 |
| 445 | Ga0495603_0233520 | 3300046455 | Bacteria | 1060 |
| 446 | Ga0495629_0001225 | 3300046459 | Bacteria | 20142 |
| 447 | Ga0495629_0003945 | 3300046459 | Bacteria | 11160 |
| 448 | Ga0495629_0006546 | 3300046459 | Bacteria | 8627 |
| 449 | Ga0495629_0015712 | 3300046459 | Bacteria | 5435 |
| 450 | Ga0495629_0158648 | 3300046459 | Bacteria | 1571 |
| 451 | Ga0495638_0064804 | 3300046460 | Bacteria | 2250 |
| 452 | Ga0495641_0082886 | 3300046461 | Bacteria | 1436 |
| 453 | Ga0495651_0000211 | 3300046462 | Bacteria | 44617 |
| 454 | Ga0495651_0000324 | 3300046462 | Bacteria | 37048 |
| 455 | Ga0495651_0001024 | 3300046462 | Bacteria | 21638 |
| 456 | Ga0495651_0003371 | 3300046462 | Bacteria | 12264 |
| 457 | Ga0495651_0020877 | 3300046462 | Bacteria | 5084 |
| 458 | Ga0495653_0005610 | 3300046463 | Bacteria | 10240 |
| 459 | Ga0495580_0038672 | 3300046472 | Bacteria | 3416 |
| 460 | Ga0495582_0082387 | 3300046473 | Bacteria | 1787 |
| 461 | Ga0495605_0011696 | 3300046474 | Bacteria | 4884 |
| 462 | Ga0495639_0006635 | 3300046475 | Bacteria | 4978 |
| 463 | Ga0495662_0001508 | 3300046476 | Bacteria | 11554 |
| 464 | Ga0495662_0002106 | 3300046476 | Bacteria | 9980 |
| 465 | Ga0495662_0022833 | 3300046476 | Bacteria | 3020 |
| 466 | Ga0495662_0036208 | 3300046476 | Bacteria | 2382 |
| 467 | Ga0495664_0002194 | 3300046477 | Bacteria | 10455 |
| 468 | Ga0495664_0023458 | 3300046477 | Bacteria | 3581 |
| 469 | Ga0495664_0107191 | 3300046477 | Bacteria | 1685 |
| 470 | Ga0495664_0242584 | 3300046477 | Bacteria | 1090 |
| 471 | Ga0495584_0010442 | 3300046491 | Bacteria | 4771 |
| 472 | Ga0495585_0031988 | 3300046492 | Bacteria | 2983 |
| 473 | Ga0495585_0061848 | 3300046492 | Bacteria | 2057 |
| 474 | Ga0495594_0001176 | 3300046499 | Bacteria | 13693 |
| 475 | Ga0495594_0010207 | 3300046499 | Bacteria | 4866 |
| 476 | Ga0495594_0014082 | 3300046499 | Bacteria | 4187 |
| 477 | Ga0495596_0012530 | 3300046500 | Bacteria | 3629 |
| 478 | Ga0495583_0030333 | 3300046506 | Bacteria | 2634 |
| 479 | Ga0495583_0090564 | 3300046506 | Bacteria | 1317 |
| 480 | Ga0495606_0017255 | 3300046507 | Bacteria | 5467 |
| 481 | Ga0495608_0021342 | 3300046511 | Bacteria | 4444 |
| 482 | Ga0495608_0032629 | 3300046511 | Bacteria | 3520 |
| 483 | Ga0495608_0038537 | 3300046511 | Bacteria | 3209 |
| 484 | Ga0495608_0066984 | 3300046511 | Bacteria | 2350 |
| 485 | Ga0495608_0243723 | 3300046511 | Bacteria | 1122 |
| 486 | Ga0495610_0007469 | 3300046512 | Bacteria | 7267 |
| 487 | Ga0495616_0013521 | 3300046513 | Bacteria | 4601 |
| 488 | Ga0495618_0037100 | 3300046514 | Bacteria | 3059 |
| 489 | Ga0495618_0040123 | 3300046514 | Bacteria | 2945 |
| 490 | Ga0495618_0044642 | 3300046514 | Bacteria | 2795 |
| 491 | Ga0495618_0140578 | 3300046514 | Bacteria | 1544 |
| 492 | Ga0495620_0031617 | 3300046515 | Bacteria | 2423 |
| 493 | Ga0495628_0022766 | 3300046516 | Bacteria | 5145 |
| 494 | Ga0495628_0026002 | 3300046516 | Bacteria | 4779 |
| 495 | Ga0495628_0026462 | 3300046516 | Bacteria | 4730 |
| 496 | Ga0495628_0126088 | 3300046516 | Bacteria | 1961 |
| 497 | Ga0495630_0042372 | 3300046517 | Bacteria | 3399 |
| 498 | Ga0495630_0046801 | 3300046517 | Bacteria | 3234 |
| 499 | Ga0495631_0005465 | 3300046518 | Bacteria | 6648 |
| 500 | Ga0495631_0089949 | 3300046518 | Bacteria | 1322 |
| 501 | Ga0495632_0028913 | 3300046519 | Bacteria | 2891 |
| 502 | Ga0495632_0031247 | 3300046519 | Bacteria | 2755 |
| 503 | Ga0495643_0004048 | 3300046522 | Bacteria | 10450 |
| 504 | Ga0495648_0332640 | 3300046524 | Bacteria | 700 |
| 505 | Ga0495663_0049205 | 3300046525 | Bacteria | 1301 |
| 506 | Ga0495666_0000276 | 3300046526 | Bacteria | 22293 |
| 507 | Ga0495666_0020869 | 3300046526 | Bacteria | 3243 |
| 508 | Ga0495642_0035377 | 3300046528 | Bacteria | 2015 |
| 509 | Ga0495652_0010670 | 3300046529 | Bacteria | 8321 |
| 510 | Ga0495652_0018950 | 3300046529 | Bacteria | 6132 |
| 511 | Ga0495652_0022724 | 3300046529 | Bacteria | 5565 |
| 512 | Ga0495652_0063283 | 3300046529 | Bacteria | 3115 |
| 513 | Ga0495652_0158330 | 3300046529 | Bacteria | 1761 |
| 514 | Ga0495652_0289364 | 3300046529 | Bacteria | 1196 |
| 515 | Ga0495654_0037013 | 3300046530 | Bacteria | 2450 |
| 516 | Ga0495665_0048588 | 3300046531 | Bacteria | 2249 |
| 517 | Ga0495640_0004853 | 3300046533 | Bacteria | 10699 |
| 518 | Ga0495640_0053029 | 3300046533 | Bacteria | 2782 |
| 519 | Ga0495586_0009432 | 3300046535 | Bacteria | 5195 |
| 520 | Ga0495586_0089008 | 3300046535 | Bacteria | 1703 |
| 521 | Ga0495586_0293070 | 3300046535 | Bacteria | 932 |
| 522 | Ga0495587_0008553 | 3300046536 | Bacteria | 6575 |
| 523 | Ga0495587_0014977 | 3300046536 | Bacteria | 4849 |
| 524 | Ga0495609_0003387 | 3300046538 | Bacteria | 9163 |
| 525 | Ga0495597_0062332 | 3300046542 | Bacteria | 1622 |
| 526 | Ga0495645_0008635 | 3300046543 | Bacteria | 7114 |
| 527 | Ga0495645_0033596 | 3300046543 | Bacteria | 3742 |
| 528 | Ga0495645_0054473 | 3300046543 | Bacteria | 2906 |
| 529 | Ga0495645_0191490 | 3300046543 | Bacteria | 1393 |
| 530 | Ga0495622_0002898 | 3300046557 | Bacteria | 8188 |
| 531 | Ga0495622_0004164 | 3300046557 | Bacteria | 6747 |
| 532 | Ga0495622_0051737 | 3300046557 | Bacteria | 1905 |
| 533 | Ga0495633_0023178 | 3300046558 | Bacteria | 3076 |
| 534 | Ga0495667_0134369 | 3300046559 | Bacteria | 1595 |
| 535 | Ga0495656_0139360 | 3300046615 | Bacteria | 1162 |
| 536 | Ga0495668_0104241 | 3300046616 | Bacteria | 1551 |
| 537 | Ga0495634_0004021 | 3300046642 | Bacteria | 11663 |
| 538 | Ga0495634_0021694 | 3300046642 | Bacteria | 4534 |
| 539 | Ga0495634_0025930 | 3300046642 | Bacteria | 4094 |
| 540 | Ga0495611_0006244 | 3300046648 | Bacteria | 5085 |
| 541 | Ga0495611_0007776 | 3300046648 | Bacteria | 4553 |
| 542 | Ga0495625_0007626 | 3300046660 | Bacteria | 9388 |
| 543 | Ga0495625_0083574 | 3300046660 | Bacteria | 2219 |
| 544 | Ga0495635_0001097 | 3300046663 | Bacteria | 17971 |
| 545 | Ga0495635_0003328 | 3300046663 | Bacteria | 11115 |
| 546 | Ga0495635_0009396 | 3300046663 | Bacteria | 6836 |
| 547 | Ga0495635_0016123 | 3300046663 | Bacteria | 5217 |
| 548 | Ga0495661_0157471 | 3300046665 | Bacteria | 1222 |
| 549 | Ga0495588_0010629 | 3300046674 | Bacteria | 4288 |
| 550 | Ga0495588_0058330 | 3300046674 | Bacteria | 1995 |
| 551 | Ga0495588_0121383 | 3300046674 | Bacteria | 1377 |
| 552 | Ga0495588_0171135 | 3300046674 | Bacteria | 1148 |
| 553 | Ga0495657_0002044 | 3300046675 | Bacteria | 17193 |
| 554 | Ga0495657_0007303 | 3300046675 | Bacteria | 8550 |
| 555 | Ga0495657_0018070 | 3300046675 | Bacteria | 5109 |
| 556 | Ga0495657_0068042 | 3300046675 | Bacteria | 2335 |
| 557 | Ga0495599_0051104 | 3300046678 | Bacteria | 2590 |
| 558 | Ga0495599_0175117 | 3300046678 | Bacteria | 1323 |
| 559 | Ga0495623_0011914 | 3300046679 | Bacteria | 5635 |
| 560 | Ga0495623_0027516 | 3300046679 | Bacteria | 3658 |
| 561 | Ga0495623_0072871 | 3300046679 | Bacteria | 2135 |
| 562 | Ga0495623_0200114 | 3300046679 | Bacteria | 1149 |
| 563 | Ga0495623_0250043 | 3300046679 | Bacteria | 997 |
| 564 | Ga0495646_0001636 | 3300046680 | Bacteria | 13353 |
| 565 | Ga0495646_0011796 | 3300046680 | Bacteria | 5556 |
| 566 | Ga0495658_0018195 | 3300046683 | Bacteria | 3648 |
| 567 | Ga0495613_0001306 | 3300046689 | Bacteria | 19061 |
| 568 | Ga0495613_0004176 | 3300046689 | Bacteria | 10813 |
| 569 | Ga0495613_0029375 | 3300046689 | Bacteria | 4087 |
| 570 | Ga0495613_0058110 | 3300046689 | Bacteria | 2839 |
| 571 | Ga0495613_0175787 | 3300046689 | Bacteria | 1517 |
| 572 | Ga0495624_0075230 | 3300046690 | Bacteria | 2097 |
| 573 | Ga0495624_0130302 | 3300046690 | Bacteria | 1542 |
| 574 | Ga0495670_0007279 | 3300046691 | Bacteria | 5441 |
| 575 | Ga0495649_0129369 | 3300046694 | Bacteria | 1332 |
| 576 | Ga0495589_0023370 | 3300046794 | Bacteria | 3151 |
| 577 | Ga0495589_0030384 | 3300046794 | Bacteria | 2720 |
| 578 | Ga0495589_0044773 | 3300046794 | Bacteria | 2199 |
| 579 | Ga0495589_0064498 | 3300046794 | Bacteria | 1796 |
| 580 | Ga0495589_0122686 | 3300046794 | Bacteria | 1250 |
| 581 | Ga0495600_0013546 | 3300046809 | Bacteria | 5127 |
| 582 | Ga0495600_0021836 | 3300046809 | Bacteria | 4103 |
| 583 | Ga0495600_0057223 | 3300046809 | Bacteria | 2547 |
| 584 | Ga0495600_0064496 | 3300046809 | Bacteria | 2394 |
| 585 | Ga0495581_0001702 | 3300047315 | Bacteria | 12247 |
| 586 | Ga0495581_0011305 | 3300047315 | Bacteria | 5163 |
| 587 | Ga0495581_0015062 | 3300047315 | Bacteria | 4488 |
| 588 | Ga0495581_0057044 | 3300047315 | Bacteria | 2254 |
| 589 | Ga0495581_0326859 | 3300047315 | Bacteria | 896 |
| 590 | Ga0495604_0001211 | 3300047317 | Bacteria | 21264 |
| 591 | Ga0495604_0004607 | 3300047317 | Bacteria | 10923 |
| 592 | Ga0495604_0009596 | 3300047317 | Bacteria | 7654 |
| 593 | Ga0495604_0021693 | 3300047317 | Bacteria | 5128 |
| 594 | Ga0495604_0022107 | 3300047317 | Bacteria | 5076 |
| 595 | Ga0495604_0034066 | 3300047317 | Bacteria | 4029 |
| 596 | Ga0495636_0001395 | 3300047318 | Bacteria | 9117 |
| 597 | Ga0495636_0001821 | 3300047318 | Bacteria | 8155 |
| 598 | Ga0495636_0016622 | 3300047318 | Bacteria | 2940 |
| 599 | Ga0495636_0054921 | 3300047318 | Bacteria | 1674 |
| 600 | Ga0495636_0081577 | 3300047318 | Bacteria | 1393 |
| 601 | Ga0495674_0122208 | 3300047319 | Bacteria | 2199 |
| 602 | Ga0495672_0030419 | 3300047320 | Bacteria | 3388 |
| 603 | Ga0495676_0006095 | 3300047321 | Bacteria | 11087 |
| 604 | Ga0495676_0006378 | 3300047321 | Bacteria | 10868 |
| 605 | Ga0495676_0026496 | 3300047321 | Bacteria | 4989 |
| 606 | Ga0495676_0030679 | 3300047321 | Bacteria | 4556 |
| 607 | Ga0495680_0023976 | 3300047322 | Bacteria | 5068 |
| 608 | Ga0495687_001939 | 3300047443 | Bacteria | 17732 |
| 609 | Ga0495687_005383 | 3300047443 | Bacteria | 8172 |
| 610 | Ga0495687_043409 | 3300047443 | Bacteria | 1958 |
| 611 | Ga0495687_043860 | 3300047443 | Bacteria | 1946 |
| 612 | Ga0495675_0014848 | 3300047444 | Bacteria | 4925 |
| 613 | Ga0495675_0016868 | 3300047444 | Bacteria | 4620 |
| 614 | Ga0495675_0036473 | 3300047444 | Bacteria | 3135 |
| 615 | Ga0495675_0101022 | 3300047444 | Bacteria | 1805 |
| 616 | Ga0495685_000366 | 3300047447 | Bacteria | 14391 |
| 617 | Ga0495685_002245 | 3300047447 | Bacteria | 6019 |
| 618 | Ga0495685_005998 | 3300047447 | Bacteria | 3971 |
| 619 | Ga0495685_030359 | 3300047447 | Bacteria | 1858 |
| 620 | Ga0495685_050876 | 3300047447 | Bacteria | 1406 |
| 621 | Ga0495681_0000244 | 3300047470 | Bacteria | 45285 |
| 622 | Ga0495681_0001646 | 3300047470 | Bacteria | 16583 |
| 623 | Ga0495684_0021677 | 3300047471 | Bacteria | 4947 |
| 624 | Ga0495684_0112895 | 3300047471 | Bacteria | 2049 |
| 625 | Ga0495686_0193984 | 3300047472 | Bacteria | 1169 |
| 626 | Ga0495593_0006642 | 3300047673 | Bacteria | 6769 |
| 627 | Ga0495602_0032581 | 3300048088 | Bacteria | 4905 |
| 628 | Ga0495614_0006743 | 3300048089 | Bacteria | 5140 |
| 629 | Ga0495615_0024698 | 3300048090 | Bacteria | 1389 |
| 630 | Ga0496100_0038361 | 3300048903 | Bacteria | 3035 |
| 631 | Ga0496101_0004424 | 3300048904 | Bacteria | 8843 |
| 632 | Ga0496101_0086077 | 3300048904 | Bacteria | 2330 |
| 633 | Ga0496101_0248801 | 3300048904 | Bacteria | 1385 |
| 634 | Ga0496102_0000072 | 3300048905 | Bacteria | 150284 |
| 635 | Ga0496102_0001262 | 3300048905 | Bacteria | 22825 |
| 636 | Ga0496102_0216325 | 3300048905 | Bacteria | 1806 |
| 637 | Ga0496102_0528348 | 3300048905 | Bacteria | 1102 |
| 638 | Ga0496103_0000053 | 3300048906 | Bacteria | 148944 |
| 639 | Ga0496104_0044248 | 3300048907 | Bacteria | 4183 |
| 640 | Ga0496105_0629683 | 3300048908 | Bacteria | 830 |
| 641 | Ga0496106_0138934 | 3300048909 | Bacteria | 1910 |
| 642 | Ga0496106_0201711 | 3300048909 | Bacteria | 1583 |
| 643 | Ga0496106_0284451 | 3300048909 | Bacteria | 1325 |
| 644 | Ga0496107_0144284 | 3300048910 | Bacteria | 1760 |
| 645 | Ga0496107_0148337 | 3300048910 | Bacteria | 1734 |
| 646 | Ga0496107_0400601 | 3300048910 | Bacteria | 1020 |
| 647 | Ga0496108_0070849 | 3300048911 | Bacteria | 2942 |
| 648 | Ga0496108_0321196 | 3300048911 | Bacteria | 1350 |
| 649 | Ga0496109_0001713 | 3300048912 | Bacteria | 18287 |
| 650 | Ga0496109_0046548 | 3300048912 | Bacteria | 3940 |
| 651 | Ga0496109_0076809 | 3300048912 | Bacteria | 3072 |
| 652 | Ga0496109_0753766 | 3300048912 | Bacteria | 911 |
| 653 | Ga0496110_0039360 | 3300048913 | Bacteria | 4116 |
| 654 | Ga0496110_0150624 | 3300048913 | Bacteria | 2106 |
| 655 | Ga0496111_0106454 | 3300048914 | Bacteria | 2064 |
| 656 | Ga0496111_0196835 | 3300048914 | Bacteria | 1498 |
| 657 | Ga0496112_0488311 | 3300048915 | Bacteria | 1168 |
| 658 | Ga0496113_0027136 | 3300048916 | Bacteria | 4101 |
| 659 | Ga0496113_0034505 | 3300048916 | Bacteria | 3691 |
| 660 | Ga0496113_0050697 | 3300048916 | Bacteria | 3096 |
| 661 | Ga0496113_0375015 | 3300048916 | Bacteria | 1142 |
| 662 | Ga0496113_0660335 | 3300048916 | Bacteria | 836 |
| 663 | Ga0496114_0010486 | 3300048917 | Bacteria | 7374 |
| 664 | Ga0496114_0024971 | 3300048917 | Bacteria | 4880 |
| 665 | Ga0496114_0133492 | 3300048917 | Bacteria | 2145 |
| 666 | Ga0496114_0501293 | 3300048917 | Bacteria | 1074 |
| 667 | Ga0496118_0301799 | 3300048921 | Bacteria | 879 |
| 668 | Ga0496119_0000287 | 3300048922 | Bacteria | 70711 |
| 669 | Ga0496119_0001906 | 3300048922 | Bacteria | 23895 |
| 670 | Ga0496119_0018434 | 3300048922 | Bacteria | 5196 |
| 671 | Ga0496119_0068757 | 3300048922 | Bacteria | 2084 |
| 672 | Ga0496119_0092923 | 3300048922 | Bacteria | 1710 |
| 673 | Ga0496120_0016091 | 3300048923 | Bacteria | 4900 |
| 674 | Ga0496120_0026492 | 3300048923 | Bacteria | 3579 |
| 675 | Ga0496120_0037272 | 3300048923 | Bacteria | 2887 |
| 676 | Ga0496120_0118128 | 3300048923 | Bacteria | 1375 |
| 677 | Ga0496122_0000911 | 3300048925 | Bacteria | 54375 |
| 678 | Ga0496122_0001286 | 3300048925 | Bacteria | 41681 |
| 679 | Ga0496122_0109159 | 3300048925 | Bacteria | 1822 |
| 680 | Ga0496123_0001055 | 3300048926 | Bacteria | 41698 |
| 681 | Ga0496123_0074172 | 3300048926 | Bacteria | 2107 |
| 682 | Ga0496124_0002228 | 3300048927 | Bacteria | 25820 |
| 683 | Ga0496124_0029110 | 3300048927 | Bacteria | 4928 |
| 684 | Ga0496125_0000172 | 3300048928 | Bacteria | 144915 |
| 685 | Ga0496125_0001197 | 3300048928 | Bacteria | 39065 |
| 686 | Ga0496125_0136819 | 3300048928 | Bacteria | 1712 |
| 687 | Ga0496126_0000006 | 3300048929 | Bacteria | 798804 |
| 688 | Ga0496126_0143757 | 3300048929 | Bacteria | 2051 |
| 689 | Ga0496126_0316588 | 3300048929 | Bacteria | 1284 |
| 690 | Ga0495678_076863 | 3300049459 | Bacteria | 1208 |
| 691 | Ga0501316_003151 | 3300049532 | Bacteria | 1583 |
| 692 | Ga0501316_007283 | 3300049532 | Bacteria | 1198 |
| 693 | Ga0501323_007545 | 3300049539 | Bacteria | 1244 |
| 694 | Ga0501031_0003586 | 3300049568 | Bacteria | 9985 |
| 695 | Ga0501031_0025632 | 3300049568 | Bacteria | 3846 |
| 696 | Ga0501031_0087453 | 3300049568 | Bacteria | 2032 |
| 697 | Ga0501031_0098726 | 3300049568 | Bacteria | 1905 |
| 698 | Ga0501031_0293392 | 3300049568 | Bacteria | 1054 |
| 699 | Ga0501032_0002783 | 3300049569 | Bacteria | 13607 |
| 700 | Ga0501032_0011504 | 3300049569 | Bacteria | 6356 |
| 701 | Ga0501032_0013299 | 3300049569 | Bacteria | 5859 |
| 702 | Ga0501032_0020894 | 3300049569 | Bacteria | 4555 |
| 703 | Ga0501032_0078719 | 3300049569 | Bacteria | 2194 |
| 704 | Ga0501032_0155137 | 3300049569 | Bacteria | 1504 |
| 705 | Ga0501032_0157763 | 3300049569 | Bacteria | 1490 |
| 706 | Ga0501032_0252925 | 3300049569 | Bacteria | 1143 |
| 707 | Ga0501032_0318222 | 3300049569 | Bacteria | 1004 |
| 708 | Ga0501033_0004222 | 3300049570 | Bacteria | 11562 |
| 709 | Ga0501033_0011161 | 3300049570 | Bacteria | 6881 |
| 710 | Ga0501033_0013104 | 3300049570 | Bacteria | 6318 |
| 711 | Ga0501033_0040134 | 3300049570 | Bacteria | 3495 |
| 712 | Ga0501033_0056095 | 3300049570 | Bacteria | 2912 |
| 713 | Ga0501033_0090325 | 3300049570 | Bacteria | 2241 |
| 714 | Ga0501033_0152941 | 3300049570 | Bacteria | 1663 |
| 715 | Ga0501033_0171598 | 3300049570 | Bacteria | 1557 |
| 716 | Ga0501033_0389348 | 3300049570 | Bacteria | 973 |
| 717 | Ga0501034_0011290 | 3300049571 | Bacteria | 9267 |
| 718 | Ga0501034_0011768 | 3300049571 | Bacteria | 9054 |
| 719 | Ga0501034_0013123 | 3300049571 | Bacteria | 8539 |
| 720 | Ga0501034_0047293 | 3300049571 | Bacteria | 4345 |
| 721 | Ga0501034_0049354 | 3300049571 | Bacteria | 4246 |
| 722 | Ga0501034_0051315 | 3300049571 | Bacteria | 4159 |
| 723 | Ga0501034_0054911 | 3300049571 | Bacteria | 4009 |
| 724 | Ga0501034_0068991 | 3300049571 | Bacteria | 3546 |
| 725 | Ga0501034_0072216 | 3300049571 | Bacteria | 3459 |
| 726 | Ga0501034_0077554 | 3300049571 | Bacteria | 3328 |
| 727 | Ga0501034_0243782 | 3300049571 | Bacteria | 1743 |
| 728 | Ga0501036_0016093 | 3300049572 | Bacteria | 6250 |
| 729 | Ga0501036_0020715 | 3300049572 | Bacteria | 5524 |
| 730 | Ga0501036_0021723 | 3300049572 | Bacteria | 5395 |
| 731 | Ga0501036_0023329 | 3300049572 | Bacteria | 5211 |
| 732 | Ga0501036_0470870 | 3300049572 | Bacteria | 1046 |
| 733 | Ga0501037_0002837 | 3300049573 | Bacteria | 12560 |
| 734 | Ga0501037_0009899 | 3300049573 | Bacteria | 6994 |
| 735 | Ga0501037_0034880 | 3300049573 | Bacteria | 3711 |
| 736 | Ga0501037_0180397 | 3300049573 | Bacteria | 1498 |
| 737 | Ga0501037_0466051 | 3300049573 | Bacteria | 860 |
| 738 | Ga0501038_0000236 | 3300049574 | Bacteria | 46834 |
| 739 | Ga0501038_0000642 | 3300049574 | Bacteria | 31067 |
| 740 | Ga0501038_0002092 | 3300049574 | Bacteria | 18498 |
| 741 | Ga0501038_0008112 | 3300049574 | Bacteria | 9665 |
| 742 | Ga0501038_0016192 | 3300049574 | Bacteria | 6762 |
| 743 | Ga0501038_0018752 | 3300049574 | Bacteria | 6246 |
| 744 | Ga0501038_0018834 | 3300049574 | Bacteria | 6231 |
| 745 | Ga0501038_0020044 | 3300049574 | Bacteria | 6019 |
| 746 | Ga0501038_0034542 | 3300049574 | Bacteria | 4445 |
| 747 | Ga0501038_0140967 | 3300049574 | Bacteria | 1972 |
| 748 | Ga0501039_0021706 | 3300049575 | Bacteria | 4926 |
| 749 | Ga0501039_0067064 | 3300049575 | Bacteria | 2787 |
| 750 | Ga0501039_0086631 | 3300049575 | Bacteria | 2439 |
| 751 | Ga0501039_0125731 | 3300049575 | Bacteria | 2011 |
| 752 | Ga0501039_0370043 | 3300049575 | Bacteria | 1126 |
| 753 | Ga0501039_0498598 | 3300049575 | Bacteria | 956 |
| 754 | Ga0501040_0006289 | 3300049576 | Bacteria | 7708 |
| 755 | Ga0501040_0077505 | 3300049576 | Bacteria | 2299 |
| 756 | Ga0501041_0010790 | 3300049577 | Bacteria | 5390 |
| 757 | Ga0501042_0119923 | 3300049578 | Bacteria | 1894 |
| 758 | Ga0501042_0142261 | 3300049578 | Bacteria | 1729 |
| 759 | Ga0501042_0195315 | 3300049578 | Bacteria | 1459 |
| 760 | Ga0501042_0198535 | 3300049578 | Bacteria | 1447 |
| 761 | Ga0501042_0253527 | 3300049578 | Bacteria | 1270 |
| 762 | Ga0501043_0003942 | 3300049579 | Bacteria | 12173 |
| 763 | Ga0501043_0012723 | 3300049579 | Bacteria | 6578 |
| 764 | Ga0501043_0017479 | 3300049579 | Bacteria | 5622 |
| 765 | Ga0501043_0065199 | 3300049579 | Bacteria | 2860 |
| 766 | Ga0501043_0106646 | 3300049579 | Bacteria | 2200 |
| 767 | Ga0501043_0229700 | 3300049579 | Bacteria | 1433 |
| 768 | Ga0501043_0331670 | 3300049579 | Bacteria | 1158 |
| 769 | Ga0501046_0001520 | 3300049580 | Bacteria | 22125 |
| 770 | Ga0501046_0012735 | 3300049580 | Bacteria | 7153 |
| 771 | Ga0501046_0122653 | 3300049580 | Bacteria | 1976 |
| 772 | Ga0501046_0123166 | 3300049580 | Bacteria | 1972 |
| 773 | Ga0501046_0262140 | 3300049580 | Bacteria | 1269 |
| 774 | Ga0501046_0560730 | 3300049580 | Bacteria | 813 |
| 775 | Ga0501047_0000242 | 3300049581 | Bacteria | 64647 |
| 776 | Ga0501047_0002545 | 3300049581 | Bacteria | 17375 |
| 777 | Ga0501047_0013453 | 3300049581 | Bacteria | 7757 |
| 778 | Ga0501047_0020231 | 3300049581 | Bacteria | 6391 |
| 779 | Ga0501047_0036990 | 3300049581 | Bacteria | 4718 |
| 780 | Ga0501047_0047148 | 3300049581 | Bacteria | 4164 |
| 781 | Ga0501047_0049204 | 3300049581 | Bacteria | 4070 |
| 782 | Ga0501047_0056449 | 3300049581 | Bacteria | 3797 |
| 783 | Ga0501047_0057352 | 3300049581 | Bacteria | 3766 |
| 784 | Ga0501047_0074002 | 3300049581 | Bacteria | 3279 |
| 785 | Ga0501047_0093311 | 3300049581 | Bacteria | 2889 |
| 786 | Ga0501047_0498782 | 3300049581 | Bacteria | 1044 |
| 787 | Ga0501048_0000017 | 3300049582 | Bacteria | 72572 |
| 788 | Ga0501048_0005662 | 3300049582 | Bacteria | 9503 |
| 789 | Ga0501048_0011943 | 3300049582 | Bacteria | 6473 |
| 790 | Ga0501048_0025620 | 3300049582 | Bacteria | 4299 |
| 791 | Ga0501067_0042361 | 3300049583 | Bacteria | 2528 |
| 792 | Ga0501068_0026861 | 3300049584 | Bacteria | 3395 |
| 793 | Ga0501068_0031024 | 3300049584 | Bacteria | 3174 |
| 794 | Ga0501068_0270715 | 3300049584 | Bacteria | 1084 |
| 795 | Ga0501069_0126207 | 3300049585 | Bacteria | 1463 |
| 796 | Ga0501070_0005659 | 3300049586 | Bacteria | 10653 |
| 797 | Ga0501070_0029209 | 3300049586 | Bacteria | 4624 |
| 798 | Ga0501070_0041603 | 3300049586 | Bacteria | 3828 |
| 799 | Ga0501070_0139438 | 3300049586 | Bacteria | 2002 |
| 800 | Ga0501070_0360492 | 3300049586 | Bacteria | 1179 |
| 801 | Ga0501070_0556102 | 3300049586 | Bacteria | 918 |
| 802 | Ga0501071_0008875 | 3300049587 | Bacteria | 6665 |
| 803 | Ga0501072_0003634 | 3300049588 | Bacteria | 11605 |
| 804 | Ga0501072_0216488 | 3300049588 | Bacteria | 1526 |
| 805 | Ga0501072_0469874 | 3300049588 | Bacteria | 996 |
| 806 | Ga0501073_0184770 | 3300049589 | Bacteria | 1443 |
| 807 | Ga0501073_0195845 | 3300049589 | Bacteria | 1397 |
| 808 | Ga0501073_0398361 | 3300049589 | Bacteria | 951 |
| 809 | Ga0501074_0093437 | 3300049590 | Bacteria | 2154 |
| 810 | Ga0501074_0347747 | 3300049590 | Bacteria | 1052 |
| 811 | Ga0501076_0002750 | 3300049592 | Bacteria | 12180 |
| 812 | Ga0501076_0860439 | 3300049592 | Bacteria | 748 |
| 813 | Ga0501077_0009068 | 3300049593 | Bacteria | 6176 |
| 814 | Ga0501079_0011123 | 3300049741 | Bacteria | 6863 |
| 815 | Ga0501079_0264761 | 3300049741 | Bacteria | 1344 |
| 816 | Ga0501080_0029049 | 3300049742 | Bacteria | 5147 |
| 817 | Ga0501080_0283111 | 3300049742 | Bacteria | 1507 |
| 818 | Ga0501081_0153760 | 3300049743 | Bacteria | 1654 |
| 819 | Ga0501083_0009247 | 3300049744 | Bacteria | 6957 |
| 820 | Ga0501083_0019054 | 3300049744 | Bacteria | 4778 |
| 821 | Ga0501035_0008203 | 3300049822 | Bacteria | 9734 |
| 822 | Ga0501035_0013623 | 3300049822 | Bacteria | 7502 |
| 823 | Ga0501035_0016971 | 3300049822 | Bacteria | 6709 |
| 824 | Ga0501035_0017639 | 3300049822 | Bacteria | 6585 |
| 825 | Ga0501035_0021024 | 3300049822 | Bacteria | 5999 |
| 826 | Ga0501035_0047883 | 3300049822 | Bacteria | 3835 |
| 827 | Ga0501035_0071919 | 3300049822 | Bacteria | 3061 |
| 828 | Ga0501035_0092344 | 3300049822 | Bacteria | 2663 |
| 829 | Ga0501035_0126030 | 3300049822 | Bacteria | 2235 |
| 830 | Ga0501035_0321880 | 3300049822 | Bacteria | 1299 |
| 831 | Ga0501044_0001763 | 3300049823 | Bacteria | 25278 |
| 832 | Ga0501044_0005221 | 3300049823 | Bacteria | 14453 |
| 833 | Ga0501044_0005946 | 3300049823 | Bacteria | 13510 |
| 834 | Ga0501044_0006363 | 3300049823 | Bacteria | 13055 |
| 835 | Ga0501044_0006713 | 3300049823 | Bacteria | 12684 |
| 836 | Ga0501044_0009459 | 3300049823 | Bacteria | 10613 |
| 837 | Ga0501044_0013559 | 3300049823 | Bacteria | 8808 |
| 838 | Ga0501044_0013651 | 3300049823 | Bacteria | 8778 |
| 839 | Ga0501044_0016458 | 3300049823 | Bacteria | 7937 |
| 840 | Ga0501044_0057165 | 3300049823 | Bacteria | 4003 |
| 841 | Ga0501044_0541364 | 3300049823 | Bacteria | 1062 |
| 842 | Ga0501045_0056529 | 3300049824 | Bacteria | 2870 |
| 843 | Ga0501045_0072361 | 3300049824 | Bacteria | 2538 |
| 844 | Ga0501045_0088426 | 3300049824 | Bacteria | 2288 |
| 845 | Ga0501045_0190144 | 3300049824 | Bacteria | 1530 |
| 846 | nmdc:mga03n38_33572_c1 | 3300050490 | Bacteria | 2184 |
| 847 | nmdc:mga00v17_2658_c1 | 3300050491 | Bacteria | 9161 |
| 848 | nmdc:mga04h51_14526_c1 | 3300050495 | Bacteria | 2252 |
| 849 | nmdc:mga07m45_30018_c3 | 3300050496 | Bacteria | 2052 |
| 850 | nmdc:mga09592_404987_c1 | 3300050508 | Bacteria | 1179 |
| 851 | nmdc:mga0n895_17970_c1 | 3300050512 | Bacteria | 6535 |
| 852 | nmdc:mga0rr50_15996_c1 | 3300050513 | Bacteria | 4969 |
| 853 | nmdc:mga08x19_117413_c1 | 3300050514 | Bacteria | 1780 |
| 854 | nmdc:mga0a205_192749_c1 | 3300050515 | Bacteria | 1930 |
| 855 | Ga0495601_0003606 | 3300053077 | Bacteria | 8907 |
| 856 | Ga0495612_0019542 | 3300053078 | Bacteria | 2713 |
| 857 | Ga0495612_0035189 | 3300053078 | Bacteria | 2029 |
| 858 | Ga0495619_0034364 | 3300053085 | Bacteria | 3296 |
| 859 | Ga0495619_0052281 | 3300053085 | Bacteria | 2700 |
| 860 | Ga0495619_0143557 | 3300053085 | Bacteria | 1645 |
| 861 | Ga0500644_0043545 | 3300053088 | Bacteria | 1502 |
| 862 | Ga0500651_0233972 | 3300053093 | Bacteria | 1074 |
| 863 | Ga0500566_0017617 | 3300053094 | Bacteria | 4197 |
| 864 | Ga0500640_014535 | 3300053095 | Bacteria | 3279 |
| 865 | Ga0500560_014684 | 3300053107 | Bacteria | 2094 |
| 866 | Ga0500562_046540 | 3300053108 | Bacteria | 1157 |
| 867 | Ga0500569_001652 | 3300053109 | Bacteria | 4250 |
| 868 | Ga0500652_001263 | 3300053131 | Bacteria | 8037 |
| 869 | Ga0500655_031140 | 3300053133 | Bacteria | 1028 |
| 870 | Ga0500559_0000929 | 3300053136 | Bacteria | 18495 |
| 871 | Ga0500559_0019924 | 3300053136 | Bacteria | 2835 |
| 872 | Ga0500561_0000299 | 3300053137 | Bacteria | 8535 |
| 873 | Ga0500573_0000007 | 3300053140 | Bacteria | 272970 |
| 874 | Ga0500573_0021820 | 3300053140 | Bacteria | 3674 |
| 875 | Ga0500573_0075010 | 3300053140 | Bacteria | 1926 |
| 876 | Ga0500577_0067301 | 3300053142 | Bacteria | 1396 |
| 877 | Ga0500588_0029040 | 3300053146 | Bacteria | 1574 |
| 878 | Ga0500600_0009099 | 3300053149 | Bacteria | 5990 |
| 879 | Ga0500600_0093442 | 3300053149 | Bacteria | 1601 |
| 880 | Ga0500616_0009856 | 3300053153 | Bacteria | 5758 |
| 881 | Ga0500616_0019007 | 3300053153 | Bacteria | 3879 |
| 882 | Ga0500624_002698 | 3300053157 | Bacteria | 2363 |
| 883 | Ga0500633_0000386 | 3300053160 | Bacteria | 6799 |
| 884 | Ga0500634_0000473 | 3300053161 | Bacteria | 13030 |
| 885 | Ga0500656_000142 | 3300053732 | Bacteria | 4385 |
| 886 | Ga0500587_000104 | 3300053739 | Bacteria | 7496 |
| 887 | Ga0501084_0040371 | 3300054114 | Bacteria | 3903 |
| 888 | Ga0501084_0111344 | 3300054114 | Bacteria | 2301 |
| 889 | Ga0501084_0144427 | 3300054114 | Bacteria | 2004 |
| 890 | Ga0501084_0329255 | 3300054114 | Bacteria | 1290 |
| 891 | Ga0501082_0001659 | 3300060353 | Bacteria | 19597 |
| 892 | Ga0501082_0006677 | 3300060353 | Bacteria | 9982 |
| 893 | Ga0501082_0030518 | 3300060353 | Bacteria | 4645 |
| 894 | Ga0501082_0151126 | 3300060353 | Bacteria | 2017 |
| 895 | Ga0466962_0000264 | 3300061719 | Bacteria | 22152 |
| 896 | Ga0466962_0002007 | 3300061719 | Bacteria | 9618 |
| 897 | Ga0466962_0003662 | 3300061719 | Bacteria | 7330 |
| 898 | Ga0466962_0024435 | 3300061719 | Bacteria | 2902 |
| 899 | Ga0466962_0101381 | 3300061719 | Bacteria | 1382 |
| 900 | Ga0466962_0133557 | 3300061719 | Bacteria | 1200 |
| 901 | Ga0530510_0009623 | 3300061734 | Bacteria | 6779 |
| 902 | Ga0530510_0263182 | 3300061734 | Bacteria | 1286 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046524 | Ga0495648_0332640 | Ga0495648_0332640_64_687 | 203 |
| 2 | 3300048904 | Ga0496101_0086077 | Ga0496101_0086077_703_1515 | 209 |
| 3 | 3300048905 | Ga0496102_0001262 | Ga0496102_0001262_1776_2588 | 209 |
| 4 | 3300048909 | Ga0496106_0284451 | Ga0496106_0284451_470_1282 | 209 |
| 5 | 3300048910 | Ga0496107_0400601 | Ga0496107_0400601_111_923 | 209 |
| 6 | 3300048917 | Ga0496114_0024971 | Ga0496114_0024971_2093_2905 | 209 |
| 7 | 3300021388 | Ga0213875_10000071 | Ga0213875_1000007155 | 218 |
| 8 | 3300049578 | Ga0501042_0198535 | Ga0501042_0198535_178_912 | 218 |
| 9 | 3300049592 | Ga0501076_0860439 | Ga0501076_0860439_67_729 | 220 |
| 10 | 3300009098 | Ga0105245_10574172 | Ga0105245_105741722 | 221 |
| 11 | 3300037853 | Ga0436364_0619304 | Ga0436364_0619304_59025_59759 | 221 |
| 12 | 3300046674 | Ga0495588_0121383 | Ga0495588_0121383_700_1365 | 221 |
| 13 | 3300020082 | Ga0206353_10114382 | Ga0206353_101143822 | 222 |
| 14 | 3300025919 | Ga0207657_10240635 | Ga0207657_102406352 | 222 |
| 15 | 3300006051 | Ga0075364_10003377 | Ga0075364_100033772 | 223 |
| 16 | 3300013102 | Ga0157371_10004092 | Ga0157371_100040929 | 229 |
| 17 | 3300044658 | Ga0466972_0009202 | Ga0466972_0009202_2529_3230 | 229 |
| 18 | 3300044658 | Ga0466972_0038057 | Ga0466972_0038057_327_1028 | 229 |
| 19 | 3300044683 | Ga0466965_0000544 | Ga0466965_0000544_7444_8145 | 229 |
| 20 | 3300044683 | Ga0466965_0003850 | Ga0466965_0003850_5394_6095 | 229 |
| 21 | 3300044683 | Ga0466965_0055567 | Ga0466965_0055567_1140_1841 | 229 |
| 22 | 3300044735 | Ga0466968_0108827 | Ga0466968_0108827_369_1070 | 229 |
| 23 | 3300044901 | Ga0466960_0002663 | Ga0466960_0002663_25_726 | 229 |
| 24 | 3300049588 | Ga0501072_0469874 | Ga0501072_0469874_156_857 | 229 |
| 25 | 3300005440 | Ga0070705_100153705 | Ga0070705_1001537051 | 230 |
| 26 | 3300005615 | Ga0070702_100000907 | Ga0070702_10000090710 | 230 |
| 27 | 3300009148 | Ga0105243_10097794 | Ga0105243_100977942 | 230 |
| 28 | 3300009176 | Ga0105242_10055393 | Ga0105242_100553935 | 230 |
| 29 | 3300009551 | Ga0105238_10060498 | Ga0105238_100604983 | 230 |
| 30 | 3300009553 | Ga0105249_10577107 | Ga0105249_105771071 | 230 |
| 31 | 3300013297 | Ga0157378_10291884 | Ga0157378_102918841 | 230 |
| 32 | 3300013306 | Ga0163162_10436577 | Ga0163162_104365771 | 230 |
| 33 | 3300014968 | Ga0157379_10170874 | Ga0157379_101708743 | 230 |
| 34 | 3300025972 | Ga0207668_10055981 | Ga0207668_100559813 | 230 |
| 35 | 3300026121 | Ga0207683_10152206 | Ga0207683_101522061 | 230 |
| 36 | 3300044656 | Ga0466969_0126177 | Ga0466969_0126177_116_847 | 230 |
| 37 | 3300045976 | Ga0466967_0005297 | Ga0466967_0005297_7524_8255 | 231 |
| 38 | 3300046454 | Ga0495592_0015690 | Ga0495592_0015690_4133_4846 | 231 |
| 39 | 3300046462 | Ga0495651_0001024 | Ga0495651_0001024_1035_1748 | 231 |
| 40 | 3300046463 | Ga0495653_0005610 | Ga0495653_0005610_7490_8203 | 231 |
| 41 | 3300046472 | Ga0495580_0038672 | Ga0495580_0038672_1010_1723 | 231 |
| 42 | 3300046476 | Ga0495662_0001508 | Ga0495662_0001508_5047_5760 | 231 |
| 43 | 3300046477 | Ga0495664_0023458 | Ga0495664_0023458_2422_3135 | 231 |
| 44 | 3300046511 | Ga0495608_0021342 | Ga0495608_0021342_1744_2457 | 231 |
| 45 | 3300046516 | Ga0495628_0022766 | Ga0495628_0022766_2219_2932 | 231 |
| 46 | 3300046517 | Ga0495630_0042372 | Ga0495630_0042372_2625_3338 | 231 |
| 47 | 3300046526 | Ga0495666_0000276 | Ga0495666_0000276_20318_21031 | 231 |
| 48 | 3300046529 | Ga0495652_0022724 | Ga0495652_0022724_3070_3783 | 231 |
| 49 | 3300046531 | Ga0495665_0048588 | Ga0495665_0048588_513_1226 | 231 |
| 50 | 3300046535 | Ga0495586_0009432 | Ga0495586_0009432_1643_2356 | 231 |
| 51 | 3300046536 | Ga0495587_0014977 | Ga0495587_0014977_2098_2811 | 231 |
| 52 | 3300046543 | Ga0495645_0008635 | Ga0495645_0008635_3934_4647 | 231 |
| 53 | 3300046642 | Ga0495634_0021694 | Ga0495634_0021694_1655_2368 | 231 |
| 54 | 3300046663 | Ga0495635_0016123 | Ga0495635_0016123_2625_3338 | 231 |
| 55 | 3300046675 | Ga0495657_0007303 | Ga0495657_0007303_5229_5942 | 231 |
| 56 | 3300046678 | Ga0495599_0051104 | Ga0495599_0051104_843_1556 | 231 |
| 57 | 3300046679 | Ga0495623_0027516 | Ga0495623_0027516_1066_1779 | 231 |
| 58 | 3300046680 | Ga0495646_0011796 | Ga0495646_0011796_2625_3338 | 231 |
| 59 | 3300046689 | Ga0495613_0029375 | Ga0495613_0029375_1162_1875 | 231 |
| 60 | 3300046809 | Ga0495600_0057223 | Ga0495600_0057223_1066_1779 | 231 |
| 61 | 3300047315 | Ga0495581_0011305 | Ga0495581_0011305_2802_3515 | 231 |
| 62 | 3300047317 | Ga0495604_0001211 | Ga0495604_0001211_1776_2489 | 231 |
| 63 | 3300047444 | Ga0495675_0036473 | Ga0495675_0036473_1197_1910 | 231 |
| 64 | 3300053085 | Ga0495619_0052281 | Ga0495619_0052281_584_1297 | 231 |
| 65 | 3300005544 | Ga0070686_100126260 | Ga0070686_1001262602 | 232 |
| 66 | iso_pu_bacteria | 2643221692 | 2644518282 | 232 |
| 67 | iso_pu_bacteria | 2675903058 | 2676476792 | 232 |
| 68 | iso_pu_bacteria | 2827628540 | 2827630118 | 232 |
| 69 | iso_pu_bacteria | 2767802112 | 2768646841 | 234 |
| 70 | iso_pu_bacteria | 2867346516 | 2867351219 | 234 |
| 71 | iso_pu_bacteria | 2558860280 | 2559429917 | 235 |
| 72 | iso_pu_bacteria | 2643221681 | 2644457438 | 235 |
| 73 | iso_pu_bacteria | 2643221961 | 2645719339 | 235 |
| 74 | iso_pu_bacteria | 2643221962 | 2645726255 | 235 |
| 75 | iso_pu_bacteria | 2795385470 | 2795783252 | 235 |
| 76 | iso_pu_bacteria | 2899370129 | 2899371780 | 235 |
| 77 | iso_pu_bacteria | 3002998708 | 3003007089 | 235 |
| 78 | iso_pu_bacteria | 8053945823 | 8053947382 | 235 |
| 79 | 3300014745 | Ga0157377_10347686 | Ga0157377_103476862 | 236 |
| 80 | 3300035398 | Ga0316574_0141240 | Ga0316574_0141240_502_1215 | 236 |
| 81 | 3300036647 | Ga0316582_0058991 | Ga0316582_0058991_777_1490 | 236 |
| 82 | 3300036712 | Ga0316584_0028637 | Ga0316584_0028637_839_1552 | 236 |
| 83 | 3300037588 | Ga0316581_0051225 | Ga0316581_0051225_352_1065 | 236 |
| 84 | iso_pu_bacteria | 2558860112 | 2558912085 | 236 |
| 85 | iso_pu_bacteria | 2585427649 | 2586059576 | 236 |
| 86 | iso_pu_bacteria | 2643221613 | 2644081692 | 236 |
| 87 | iso_pu_bacteria | 2643221721 | 2644665265 | 236 |
| 88 | iso_pu_bacteria | 2643221722 | 2644671291 | 236 |
| 89 | iso_pu_bacteria | 2738543011 | 2739240497 | 236 |
| 90 | iso_pu_bacteria | 2744054611 | 2744955040 | 236 |
| 91 | iso_pu_bacteria | 2791354901 | 2791913491 | 236 |
| 92 | iso_pu_bacteria | 2808606375 | 2808919104 | 236 |
| 93 | iso_pu_bacteria | 2808606522 | 2809591660 | 236 |
| 94 | iso_pu_bacteria | 2835188231 | 2835189344 | 236 |
| 95 | iso_pu_bacteria | 2839986021 | 2839986329 | 236 |
| 96 | iso_pu_bacteria | 2842888712 | 2842891855 | 236 |
| 97 | iso_pu_bacteria | 2862507626 | 2862513617 | 236 |
| 98 | iso_pu_bacteria | 2870782633 | 2870789820 | 236 |
| 99 | iso_pu_bacteria | 2884994152 | 2884995154 | 236 |
| 100 | iso_pu_bacteria | 2887443736 | 2887447574 | 236 |
| 101 | iso_pu_bacteria | 2889300758 | 2889302092 | 236 |
| 102 | iso_pu_bacteria | 2904765812 | 2904769286 | 236 |
| 103 | iso_pu_bacteria | 2904770941 | 2904772842 | 236 |
| 104 | iso_pu_bacteria | 2908811453 | 2908814352 | 236 |
| 105 | iso_pu_bacteria | 2912715099 | 2912721707 | 236 |
| 106 | iso_pu_bacteria | 2919420072 | 2919422793 | 236 |
| 107 | iso_pu_bacteria | 2919432681 | 2919434954 | 236 |
| 108 | iso_pu_bacteria | 2935890801 | 2935891429 | 236 |
| 109 | iso_pu_bacteria | 2939743619 | 2939748080 | 236 |
| 110 | iso_pu_bacteria | 2956939328 | 2956941278 | 236 |
| 111 | iso_pu_bacteria | 3001119090 | 3001120294 | 236 |
| 112 | 3300005327 | Ga0070658_10008378 | Ga0070658_100083782 | 237 |
| 113 | 3300005435 | Ga0070714_100685964 | Ga0070714_1006859641 | 237 |
| 114 | 3300005614 | Ga0068856_100101506 | Ga0068856_1001015062 | 237 |
| 115 | 3300005614 | Ga0068856_100154063 | Ga0068856_1001540635 | 237 |
| 116 | 3300005985 | Ga0081539_10004512 | Ga0081539_100045123 | 237 |
| 117 | 3300006175 | Ga0070712_100397857 | Ga0070712_1003978572 | 237 |
| 118 | 3300013105 | Ga0157369_10118308 | Ga0157369_101183082 | 237 |
| 119 | 3300013307 | Ga0157372_10912574 | Ga0157372_109125741 | 237 |
| 120 | 3300025909 | Ga0207705_10193151 | Ga0207705_101931512 | 237 |
| 121 | 3300025911 | Ga0207654_10132764 | Ga0207654_101327642 | 237 |
| 122 | 3300025929 | Ga0207664_10562169 | Ga0207664_105621692 | 237 |
| 123 | 3300026078 | Ga0207702_10130418 | Ga0207702_101304183 | 237 |
| 124 | 3300026142 | Ga0207698_10196474 | Ga0207698_101964742 | 237 |
| 125 | 3300035207 | Ga0373942_0057929 | Ga0373942_0057929_100_822 | 237 |
| 126 | 3300037312 | Ga0395899_0012802 | Ga0395899_0012802_290_1024 | 237 |
| 127 | 3300044683 | Ga0466965_0140284 | Ga0466965_0140284_471_1202 | 237 |
| 128 | 3300044694 | Ga0466963_0321552 | Ga0466963_0321552_274_1005 | 237 |
| 129 | 3300045836 | Ga0466958_0322136 | Ga0466958_0322136_225_959 | 237 |
| 130 | 3300045976 | Ga0466967_0278286 | Ga0466967_0278286_299_1030 | 237 |
| 131 | 3300045976 | Ga0466967_0701272 | Ga0466967_0701272_145_858 | 237 |
| 132 | 3300048912 | Ga0496109_0001713 | Ga0496109_0001713_16249_16962 | 237 |
| 133 | 3300048912 | Ga0496109_0753766 | Ga0496109_0753766_142_873 | 237 |
| 134 | 3300048913 | Ga0496110_0150624 | Ga0496110_0150624_1309_2034 | 237 |
| 135 | 3300048916 | Ga0496113_0375015 | Ga0496113_0375015_193_918 | 237 |
| 136 | 3300048922 | Ga0496119_0000287 | Ga0496119_0000287_68133_68846 | 237 |
| 137 | 3300048923 | Ga0496120_0016091 | Ga0496120_0016091_1581_2294 | 237 |
| 138 | 3300049822 | Ga0501035_0321880 | Ga0501035_0321880_142_855 | 237 |
| 139 | iso_pu_bacteria | 2547132111 | 2547409663 | 237 |
| 140 | iso_pu_bacteria | 2554235005 | 2554259044 | 237 |
| 141 | iso_pu_bacteria | 2582581313 | 2585306730 | 237 |
| 142 | iso_pu_bacteria | 2582581314 | 2585314159 | 237 |
| 143 | iso_pu_bacteria | 2643221647 | 2644271049 | 237 |
| 144 | iso_pu_bacteria | 2643221678 | 2644435716 | 237 |
| 145 | iso_pu_bacteria | 2643221679 | 2644446373 | 237 |
| 146 | iso_pu_bacteria | 2643221714 | 2644629458 | 237 |
| 147 | iso_pu_bacteria | 2731639228 | 2731905581 | 237 |
| 148 | iso_pu_bacteria | 2773857759 | 2774383400 | 237 |
| 149 | iso_pu_bacteria | 2784132109 | 2784472452 | 237 |
| 150 | iso_pu_bacteria | 2784132148 | 2784587310 | 237 |
| 151 | iso_pu_bacteria | 2784746763 | 2785345016 | 237 |
| 152 | iso_pu_bacteria | 2799112218 | 2799186091 | 237 |
| 153 | iso_pu_bacteria | 2802429296 | 2804844327 | 237 |
| 154 | iso_pu_bacteria | 2808606359 | 2808840525 | 237 |
| 155 | iso_pu_bacteria | 2808606448 | 2809230883 | 237 |
| 156 | iso_pu_bacteria | 2808606982 | 2811847535 | 237 |
| 157 | iso_pu_bacteria | 2811994917 | 2812481782 | 237 |
| 158 | iso_pu_bacteria | 2818991472 | 2819743331 | 237 |
| 159 | iso_pu_bacteria | 2848551377 | 2848553060 | 237 |
| 160 | iso_pu_bacteria | 2857729791 | 2857733570 | 237 |
| 161 | iso_pu_bacteria | 2857737099 | 2857738625 | 237 |
| 162 | iso_pu_bacteria | 2862290372 | 2862296601 | 237 |
| 163 | iso_pu_bacteria | 2862382967 | 2862385430 | 237 |
| 164 | iso_pu_bacteria | 2863404153 | 2863406278 | 237 |
| 165 | iso_pu_bacteria | 2867428634 | 2867430736 | 237 |
| 166 | iso_pu_bacteria | 2873151551 | 2873157090 | 237 |
| 167 | iso_pu_bacteria | 2895660088 | 2895662776 | 237 |
| 168 | iso_pu_bacteria | 2905926851 | 2905930257 | 237 |
| 169 | iso_pu_bacteria | 2912723979 | 2912725553 | 237 |
| 170 | iso_pu_bacteria | 2919446982 | 2919450786 | 237 |
| 171 | iso_pu_bacteria | 2919468124 | 2919473029 | 237 |
| 172 | iso_pu_bacteria | 2920879853 | 2920883714 | 237 |
| 173 | iso_pu_bacteria | 2935390628 | 2935396217 | 237 |
| 174 | iso_pu_bacteria | 2939660829 | 2939663744 | 237 |
| 175 | iso_pu_bacteria | 2946003308 | 2946004044 | 237 |
| 176 | iso_pu_bacteria | 2946072368 | 2946074521 | 237 |
| 177 | iso_pu_bacteria | 2947224130 | 2947231124 | 237 |
| 178 | iso_pu_bacteria | 2954002825 | 2954004433 | 237 |
| 179 | iso_pu_bacteria | 2954380949 | 2954387881 | 237 |
| 180 | iso_pu_bacteria | 2954691527 | 2954698694 | 237 |
| 181 | iso_pu_bacteria | 2954701450 | 2954703529 | 237 |
| 182 | iso_pu_bacteria | 2954711539 | 2954717666 | 237 |
| 183 | iso_pu_bacteria | 2954721474 | 2954727632 | 237 |
| 184 | iso_pu_bacteria | 2954731030 | 2954734170 | 237 |
| 185 | iso_pu_bacteria | 2954740390 | 2954746526 | 237 |
| 186 | iso_pu_bacteria | 2954749733 | 2954753054 | 237 |
| 187 | iso_pu_bacteria | 2954759201 | 2954765642 | 237 |
| 188 | iso_pu_bacteria | 2964326757 | 2964327070 | 237 |
| 189 | iso_pu_bacteria | 2977251589 | 2977253589 | 237 |
| 190 | iso_pu_bacteria | 2990059506 | 2990064308 | 237 |
| 191 | iso_pu_bacteria | 3006321560 | 3006322375 | 237 |
| 192 | iso_pu_bacteria | 3006493962 | 3006495476 | 237 |
| 193 | iso_pu_bacteria | 8004021418 | 8004022914 | 237 |
| 194 | iso_pu_bacteria | 8004025490 | 8004026133 | 237 |
| 195 | iso_pu_bacteria | 8008558824 | 8008562030 | 237 |
| 196 | iso_pu_bacteria | 8008574985 | 8008580149 | 237 |
| 197 | iso_pu_bacteria | 8025413630 | 8025417010 | 237 |
| 198 | iso_pu_bacteria | 8025478263 | 8025479909 | 237 |
| 199 | iso_pu_bacteria | 8046352972 | 8046356061 | 237 |
| 200 | iso_pu_bacteria | 8048406513 | 8048410053 | 237 |
| 201 | iso_pu_bacteria | 8056447290 | 8056450122 | 237 |
| 202 | iso_pu_bacteria | 8056829672 | 8056831157 | 237 |
| 203 | 3300005441 | Ga0070700_100000007 | Ga0070700_100000007131 | 238 |
| 204 | 3300006880 | Ga0075429_100326061 | Ga0075429_1003260613 | 238 |
| 205 | 3300009545 | Ga0105237_10612707 | Ga0105237_106127072 | 238 |
| 206 | 3300025914 | Ga0207671_10489531 | Ga0207671_104895312 | 238 |
| 207 | 3300026075 | Ga0207708_10000006 | Ga0207708_1000000647 | 238 |
| 208 | 3300030742 | Ga0316183_1045511 | Ga0316183_10455113 | 238 |
| 209 | 3300030744 | Ga0316181_1125033 | Ga0316181_11250333 | 238 |
| 210 | 3300030745 | Ga0316182_1357079 | Ga0316182_13570795 | 238 |
| 211 | 3300031665 | Ga0316575_10029147 | Ga0316575_100291473 | 238 |
| 212 | 3300031727 | Ga0316576_10000880 | Ga0316576_100008809 | 238 |
| 213 | 3300031727 | Ga0316576_10020558 | Ga0316576_100205586 | 238 |
| 214 | 3300031728 | Ga0316578_10051659 | Ga0316578_100516593 | 238 |
| 215 | 3300031733 | Ga0316577_10032890 | Ga0316577_100328903 | 238 |
| 216 | 3300032133 | Ga0316583_10013089 | Ga0316583_100130894 | 238 |
| 217 | 3300032137 | Ga0316585_10009189 | Ga0316585_100091894 | 238 |
| 218 | 3300032139 | Ga0316580_10010121 | Ga0316580_100101212 | 238 |
| 219 | 3300038443 | Ga0395901_0003409 | Ga0395901_0003409_9462_10187 | 238 |
| 220 | 3300045976 | Ga0466967_0480116 | Ga0466967_0480116_257_994 | 238 |
| 221 | 3300048911 | Ga0496108_0321196 | Ga0496108_0321196_362_1099 | 238 |
| 222 | 3300048917 | Ga0496114_0501293 | Ga0496114_0501293_50_814 | 238 |
| 223 | 3300048929 | Ga0496126_0316588 | Ga0496126_0316588_306_1031 | 238 |
| 224 | 3300049575 | Ga0501039_0125731 | Ga0501039_0125731_1084_1815 | 238 |
| 225 | 3300049578 | Ga0501042_0253527 | Ga0501042_0253527_424_1155 | 238 |
| 226 | 3300050508 | nmdc:mga09592_404987_c1 | nmdc:mga09592_404987_c1_250_978 | 238 |
| 227 | iso_pu_bacteria | 2582581312 | 2585302063 | 238 |
| 228 | iso_pu_bacteria | 2643221670 | 2644387453 | 238 |
| 229 | iso_pu_bacteria | 2784746768 | 2785367861 | 238 |
| 230 | iso_pu_bacteria | 2786546132 | 2786668915 | 238 |
| 231 | iso_pu_bacteria | 2857479173 | 2857479258 | 238 |
| 232 | iso_pu_bacteria | 2862178590 | 2862183017 | 238 |
| 233 | iso_pu_bacteria | 2862574272 | 2862583010 | 238 |
| 234 | iso_pu_bacteria | 2868088558 | 2868089157 | 238 |
| 235 | iso_pu_bacteria | 2918501144 | 2918503125 | 238 |
| 236 | iso_pu_bacteria | 2954673503 | 2954675196 | 238 |
| 237 | iso_pu_bacteria | 2954682443 | 2954688939 | 238 |
| 238 | 3300003285 | Ga0007423J48922_100139 | Ga0007423J48922_10013929 | 239 |
| 239 | 3300005327 | Ga0070658_10001257 | Ga0070658_1000125718 | 239 |
| 240 | 3300005327 | Ga0070658_10015310 | Ga0070658_100153103 | 239 |
| 241 | 3300005327 | Ga0070658_10199462 | Ga0070658_101994622 | 239 |
| 242 | 3300005327 | Ga0070658_10602833 | Ga0070658_106028331 | 239 |
| 243 | 3300005336 | Ga0070680_100224733 | Ga0070680_1002247333 | 239 |
| 244 | 3300005339 | Ga0070660_100098521 | Ga0070660_1000985211 | 239 |
| 245 | 3300005339 | Ga0070660_100153009 | Ga0070660_1001530091 | 239 |
| 246 | 3300005435 | Ga0070714_100004987 | Ga0070714_1000049877 | 239 |
| 247 | 3300005437 | Ga0070710_10000044 | Ga0070710_1000004444 | 239 |
| 248 | 3300005455 | Ga0070663_100117229 | Ga0070663_1001172292 | 239 |
| 249 | 3300005458 | Ga0070681_10091626 | Ga0070681_100916265 | 239 |
| 250 | 3300005458 | Ga0070681_10908481 | Ga0070681_109084811 | 239 |
| 251 | 3300005530 | Ga0070679_100007399 | Ga0070679_1000073997 | 239 |
| 252 | 3300005539 | Ga0068853_100022098 | Ga0068853_1000220983 | 239 |
| 253 | 3300005563 | Ga0068855_100099049 | Ga0068855_1000990493 | 239 |
| 254 | 3300005840 | Ga0068870_10202948 | Ga0068870_102029481 | 239 |
| 255 | 3300005937 | Ga0081455_10000443 | Ga0081455_1000044358 | 239 |
| 256 | 3300005983 | Ga0081540_1004894 | Ga0081540_10048943 | 239 |
| 257 | 3300005985 | Ga0081539_10008926 | Ga0081539_100089264 | 239 |
| 258 | 3300005985 | Ga0081539_10133842 | Ga0081539_101338422 | 239 |
| 259 | 3300006931 | Ga0097620_100051607 | Ga0097620_1000516076 | 239 |
| 260 | 3300009093 | Ga0105240_10504435 | Ga0105240_105044351 | 239 |
| 261 | 3300009098 | Ga0105245_10474514 | Ga0105245_104745142 | 239 |
| 262 | 3300009101 | Ga0105247_10001304 | Ga0105247_1000130413 | 239 |
| 263 | 3300009551 | Ga0105238_10047653 | Ga0105238_100476536 | 239 |
| 264 | 3300009551 | Ga0105238_10367498 | Ga0105238_103674982 | 239 |
| 265 | 3300009553 | Ga0105249_10685609 | Ga0105249_106856092 | 239 |
| 266 | 3300011119 | Ga0105246_10227605 | Ga0105246_102276052 | 239 |
| 267 | 3300013104 | Ga0157370_10004259 | Ga0157370_1000425918 | 239 |
| 268 | 3300013104 | Ga0157370_10038416 | Ga0157370_100384167 | 239 |
| 269 | 3300013105 | Ga0157369_10016379 | Ga0157369_100163795 | 239 |
| 270 | 3300013105 | Ga0157369_10199185 | Ga0157369_101991852 | 239 |
| 271 | 3300013306 | Ga0163162_10292191 | Ga0163162_102921912 | 239 |
| 272 | 3300013307 | Ga0157372_10000079 | Ga0157372_1000007912 | 239 |
| 273 | 3300014326 | Ga0157380_10973232 | Ga0157380_109732321 | 239 |
| 274 | 3300020081 | Ga0206354_10024324 | Ga0206354_100243242 | 239 |
| 275 | 3300020082 | Ga0206353_10447514 | Ga0206353_104475144 | 239 |
| 276 | 3300020082 | Ga0206353_10600692 | Ga0206353_106006922 | 239 |
| 277 | 3300021358 | Ga0213873_10000058 | Ga0213873_100000582 | 239 |
| 278 | 3300021388 | Ga0213875_10081951 | Ga0213875_100819512 | 239 |
| 279 | 3300025898 | Ga0207692_10000357 | Ga0207692_1000035714 | 239 |
| 280 | 3300025900 | Ga0207710_10023559 | Ga0207710_100235593 | 239 |
| 281 | 3300025901 | Ga0207688_10368977 | Ga0207688_103689771 | 239 |
| 282 | 3300025908 | Ga0207643_10040861 | Ga0207643_100408614 | 239 |
| 283 | 3300025909 | Ga0207705_10000001 | Ga0207705_100000012027 | 239 |
| 284 | 3300025909 | Ga0207705_10209977 | Ga0207705_102099771 | 239 |
| 285 | 3300025912 | Ga0207707_10060501 | Ga0207707_100605015 | 239 |
| 286 | 3300025913 | Ga0207695_10604979 | Ga0207695_106049792 | 239 |
| 287 | 3300025917 | Ga0207660_10161899 | Ga0207660_101618993 | 239 |
| 288 | 3300025919 | Ga0207657_10106689 | Ga0207657_101066894 | 239 |
| 289 | 3300025921 | Ga0207652_10173637 | Ga0207652_101736372 | 239 |
| 290 | 3300025921 | Ga0207652_10206926 | Ga0207652_102069263 | 239 |
| 291 | 3300025924 | Ga0207694_10054186 | Ga0207694_100541864 | 239 |
| 292 | 3300025928 | Ga0207700_10345017 | Ga0207700_103450172 | 239 |
| 293 | 3300025929 | Ga0207664_10000091 | Ga0207664_1000009115 | 239 |
| 294 | 3300025929 | Ga0207664_10023671 | Ga0207664_100236714 | 239 |
| 295 | 3300025932 | Ga0207690_10017351 | Ga0207690_100173515 | 239 |
| 296 | 3300025935 | Ga0207709_10029752 | Ga0207709_100297522 | 239 |
| 297 | 3300025938 | Ga0207704_10257852 | Ga0207704_102578522 | 239 |
| 298 | 3300025949 | Ga0207667_10057590 | Ga0207667_100575902 | 239 |
| 299 | 3300025972 | Ga0207668_10429322 | Ga0207668_104293222 | 239 |
| 300 | 3300026041 | Ga0207639_10055224 | Ga0207639_100552243 | 239 |
| 301 | 3300026067 | Ga0207678_10023532 | Ga0207678_100235324 | 239 |
| 302 | 3300026078 | Ga0207702_10505883 | Ga0207702_105058832 | 239 |
| 303 | 3300026078 | Ga0207702_10514038 | Ga0207702_105140382 | 239 |
| 304 | 3300026116 | Ga0207674_10015577 | Ga0207674_100155775 | 239 |
| 305 | 3300026118 | Ga0207675_100073159 | Ga0207675_1000731593 | 239 |
| 306 | 3300026121 | Ga0207683_10328499 | Ga0207683_103284992 | 239 |
| 307 | 3300030521 | Ga0307511_10001719 | Ga0307511_1000171925 | 239 |
| 308 | 3300030732 | Ga0316176_1150059 | Ga0316176_115005911 | 239 |
| 309 | 3300030733 | Ga0314311_1039871 | Ga0314311_10398712 | 239 |
| 310 | 3300030735 | Ga0316178_1163203 | Ga0316178_11632032 | 239 |
| 311 | 3300030736 | Ga0316180_1049974 | Ga0316180_10499742 | 239 |
| 312 | 3300031247 | Ga0265340_10003524 | Ga0265340_100035247 | 239 |
| 313 | 3300031456 | Ga0307513_10000483 | Ga0307513_100004834 | 239 |
| 314 | 3300031507 | Ga0307509_10053988 | Ga0307509_100539882 | 239 |
| 315 | 3300031548 | Ga0307408_100100359 | Ga0307408_1001003591 | 239 |
| 316 | 3300031548 | Ga0307408_100583191 | Ga0307408_1005831911 | 239 |
| 317 | 3300031665 | Ga0316575_10001025 | Ga0316575_1000102511 | 239 |
| 318 | 3300031665 | Ga0316575_10002244 | Ga0316575_100022448 | 239 |
| 319 | 3300031665 | Ga0316575_10129354 | Ga0316575_101293542 | 239 |
| 320 | 3300031691 | Ga0316579_10001944 | Ga0316579_100019447 | 239 |
| 321 | 3300031727 | Ga0316576_10005583 | Ga0316576_100055838 | 239 |
| 322 | 3300031727 | Ga0316576_10047954 | Ga0316576_100479542 | 239 |
| 323 | 3300031728 | Ga0316578_10019894 | Ga0316578_100198945 | 239 |
| 324 | 3300031728 | Ga0316578_10184467 | Ga0316578_101844672 | 239 |
| 325 | 3300031731 | Ga0307405_10142830 | Ga0307405_101428302 | 239 |
| 326 | 3300031733 | Ga0316577_10099308 | Ga0316577_100993081 | 239 |
| 327 | 3300031852 | Ga0307410_10054604 | Ga0307410_100546045 | 239 |
| 328 | 3300031852 | Ga0307410_10120873 | Ga0307410_101208732 | 239 |
| 329 | 3300031852 | Ga0307410_10217344 | Ga0307410_102173441 | 239 |
| 330 | 3300031901 | Ga0307406_10128713 | Ga0307406_101287132 | 239 |
| 331 | 3300031903 | Ga0307407_10253504 | Ga0307407_102535043 | 239 |
| 332 | 3300031911 | Ga0307412_10015695 | Ga0307412_100156955 | 239 |
| 333 | 3300031911 | Ga0307412_10052924 | Ga0307412_100529244 | 239 |
| 334 | 3300031911 | Ga0307412_10548421 | Ga0307412_105484212 | 239 |
| 335 | 3300031995 | Ga0307409_100003904 | Ga0307409_1000039048 | 239 |
| 336 | 3300031995 | Ga0307409_100038860 | Ga0307409_1000388602 | 239 |
| 337 | 3300031995 | Ga0307409_100598414 | Ga0307409_1005984141 | 239 |
| 338 | 3300031995 | Ga0307409_100649547 | Ga0307409_1006495472 | 239 |
| 339 | 3300032002 | Ga0307416_100012870 | Ga0307416_1000128705 | 239 |
| 340 | 3300032002 | Ga0307416_100370147 | Ga0307416_1003701472 | 239 |
| 341 | 3300032002 | Ga0307416_100427894 | Ga0307416_1004278941 | 239 |
| 342 | 3300032137 | Ga0316585_10003252 | Ga0316585_100032522 | 239 |
| 343 | 3300035398 | Ga0316574_0004754 | Ga0316574_0004754_2901_3650 | 239 |
| 344 | 3300036647 | Ga0316582_0007848 | Ga0316582_0007848_84_833 | 239 |
| 345 | 3300036647 | Ga0316582_0246618 | Ga0316582_0246618_319_1053 | 239 |
| 346 | 3300036712 | Ga0316584_0003071 | Ga0316584_0003071_6648_7397 | 239 |
| 347 | 3300036712 | Ga0316584_0179957 | Ga0316584_0179957_723_1457 | 239 |
| 348 | 3300037068 | Ga0373925_0130767 | Ga0373925_0130767_333_1064 | 239 |
| 349 | 3300037312 | Ga0395899_0011707 | Ga0395899_0011707_1953_2693 | 239 |
| 350 | 3300037312 | Ga0395899_0133485 | Ga0395899_0133485_940_1680 | 239 |
| 351 | 3300037418 | Ga0395900_0054388 | Ga0395900_0054388_2269_3009 | 239 |
| 352 | 3300037418 | Ga0395900_0059411 | Ga0395900_0059411_2563_3303 | 239 |
| 353 | 3300037466 | Ga0395898_0003138 | Ga0395898_0003138_16195_16935 | 239 |
| 354 | 3300037466 | Ga0395898_0151883 | Ga0395898_0151883_956_1696 | 239 |
| 355 | 3300037471 | Ga0395905_0024507 | Ga0395905_0024507_133_873 | 239 |
| 356 | 3300037853 | Ga0436364_1193326 | Ga0436364_1193326_5028_5765 | 239 |
| 357 | 3300038443 | Ga0395901_0011881 | Ga0395901_0011881_7677_8417 | 239 |
| 358 | 3300038443 | Ga0395901_0100620 | Ga0395901_0100620_280_1017 | 239 |
| 359 | 3300038443 | Ga0395901_0116605 | Ga0395901_0116605_2023_2763 | 239 |
| 360 | 3300039437 | Ga0436365_1156973 | Ga0436365_1156973_497_1228 | 239 |
| 361 | 3300041443 | Ga0451789_0675791 | Ga0451789_0675791_508_1263 | 239 |
| 362 | 3300041456 | Ga0451795_0121483 | Ga0451795_0121483_116_886 | 239 |
| 363 | 3300041498 | Ga0451841_1174457 | Ga0451841_1174457_163_933 | 239 |
| 364 | 3300041509 | Ga0451843_1293141 | Ga0451843_1293141_1031_1801 | 239 |
| 365 | 3300044656 | Ga0466969_0063271 | Ga0466969_0063271_249_980 | 239 |
| 366 | 3300044656 | Ga0466969_0082283 | Ga0466969_0082283_141_872 | 239 |
| 367 | 3300044683 | Ga0466965_0091716 | Ga0466965_0091716_516_1265 | 239 |
| 368 | 3300044684 | Ga0466966_0000853 | Ga0466966_0000853_11712_12443 | 239 |
| 369 | 3300044693 | Ga0466961_0024952 | Ga0466961_0024952_882_1613 | 239 |
| 370 | 3300044693 | Ga0466961_0094173 | Ga0466961_0094173_500_1243 | 239 |
| 371 | 3300044694 | Ga0466963_0020362 | Ga0466963_0020362_2417_3148 | 239 |
| 372 | 3300044694 | Ga0466963_0314793 | Ga0466963_0314793_369_1088 | 239 |
| 373 | 3300044719 | Ga0466971_0013856 | Ga0466971_0013856_1883_2602 | 239 |
| 374 | 3300044719 | Ga0466971_0033927 | Ga0466971_0033927_258_989 | 239 |
| 375 | 3300044735 | Ga0466968_0000913 | Ga0466968_0000913_828_1559 | 239 |
| 376 | 3300044765 | Ga0466970_0002247 | Ga0466970_0002247_7775_8506 | 239 |
| 377 | 3300044765 | Ga0466970_0002697 | Ga0466970_0002697_481_1212 | 239 |
| 378 | 3300044765 | Ga0466970_0016567 | Ga0466970_0016567_1609_2328 | 239 |
| 379 | 3300044842 | Ga0466957_0262665 | Ga0466957_0262665_243_989 | 239 |
| 380 | 3300044842 | Ga0466957_0286834 | Ga0466957_0286834_173_904 | 239 |
| 381 | 3300044901 | Ga0466960_0005164 | Ga0466960_0005164_3125_3859 | 239 |
| 382 | 3300044901 | Ga0466960_0024045 | Ga0466960_0024045_551_1285 | 239 |
| 383 | 3300044901 | Ga0466960_0298100 | Ga0466960_0298100_117_848 | 239 |
| 384 | 3300045049 | Ga0466959_0003628 | Ga0466959_0003628_702_1433 | 239 |
| 385 | 3300045836 | Ga0466958_0004524 | Ga0466958_0004524_6083_6802 | 239 |
| 386 | 3300045836 | Ga0466958_0030508 | Ga0466958_0030508_1464_2195 | 239 |
| 387 | 3300045976 | Ga0466967_0229605 | Ga0466967_0229605_959_1678 | 239 |
| 388 | 3300046460 | Ga0495638_0064804 | Ga0495638_0064804_1167_1913 | 239 |
| 389 | 3300047320 | Ga0495672_0030419 | Ga0495672_0030419_2208_2927 | 239 |
| 390 | 3300048903 | Ga0496100_0038361 | Ga0496100_0038361_1112_1858 | 239 |
| 391 | 3300048904 | Ga0496101_0004424 | Ga0496101_0004424_2094_2840 | 239 |
| 392 | 3300048905 | Ga0496102_0000072 | Ga0496102_0000072_66026_66757 | 239 |
| 393 | 3300048905 | Ga0496102_0528348 | Ga0496102_0528348_70_816 | 239 |
| 394 | 3300048906 | Ga0496103_0000053 | Ga0496103_0000053_146094_146825 | 239 |
| 395 | 3300048907 | Ga0496104_0044248 | Ga0496104_0044248_2260_3006 | 239 |
| 396 | 3300048909 | Ga0496106_0138934 | Ga0496106_0138934_279_1016 | 239 |
| 397 | 3300048910 | Ga0496107_0148337 | Ga0496107_0148337_812_1558 | 239 |
| 398 | 3300048912 | Ga0496109_0076809 | Ga0496109_0076809_2004_2750 | 239 |
| 399 | 3300048913 | Ga0496110_0039360 | Ga0496110_0039360_3279_4025 | 239 |
| 400 | 3300048914 | Ga0496111_0106454 | Ga0496111_0106454_565_1311 | 239 |
| 401 | 3300048916 | Ga0496113_0027136 | Ga0496113_0027136_2096_2818 | 239 |
| 402 | 3300048916 | Ga0496113_0034505 | Ga0496113_0034505_196_942 | 239 |
| 403 | 3300048916 | Ga0496113_0050697 | Ga0496113_0050697_2024_2770 | 239 |
| 404 | 3300048917 | Ga0496114_0010486 | Ga0496114_0010486_1810_2544 | 239 |
| 405 | 3300048917 | Ga0496114_0133492 | Ga0496114_0133492_1194_1931 | 239 |
| 406 | 3300048921 | Ga0496118_0301799 | Ga0496118_0301799_60_806 | 239 |
| 407 | 3300048922 | Ga0496119_0001906 | Ga0496119_0001906_18935_19681 | 239 |
| 408 | 3300048922 | Ga0496119_0018434 | Ga0496119_0018434_2247_2993 | 239 |
| 409 | 3300048922 | Ga0496119_0068757 | Ga0496119_0068757_884_1615 | 239 |
| 410 | 3300048922 | Ga0496119_0092923 | Ga0496119_0092923_703_1455 | 239 |
| 411 | 3300048923 | Ga0496120_0026492 | Ga0496120_0026492_2698_3444 | 239 |
| 412 | 3300048923 | Ga0496120_0037272 | Ga0496120_0037272_1926_2657 | 239 |
| 413 | 3300048923 | Ga0496120_0118128 | Ga0496120_0118128_533_1279 | 239 |
| 414 | 3300048925 | Ga0496122_0000911 | Ga0496122_0000911_5425_6177 | 239 |
| 415 | 3300048925 | Ga0496122_0001286 | Ga0496122_0001286_7747_8487 | 239 |
| 416 | 3300048925 | Ga0496122_0109159 | Ga0496122_0109159_114_836 | 239 |
| 417 | 3300048926 | Ga0496123_0001055 | Ga0496123_0001055_33195_33935 | 239 |
| 418 | 3300048926 | Ga0496123_0074172 | Ga0496123_0074172_380_1105 | 239 |
| 419 | 3300048927 | Ga0496124_0002228 | Ga0496124_0002228_7700_8440 | 239 |
| 420 | 3300048927 | Ga0496124_0029110 | Ga0496124_0029110_2567_3292 | 239 |
| 421 | 3300048928 | Ga0496125_0000172 | Ga0496125_0000172_102059_102811 | 239 |
| 422 | 3300048928 | Ga0496125_0001197 | Ga0496125_0001197_6561_7301 | 239 |
| 423 | 3300048929 | Ga0496126_0000006 | Ga0496126_0000006_783530_784273 | 239 |
| 424 | 3300049532 | Ga0501316_003151 | Ga0501316_003151_416_1159 | 239 |
| 425 | 3300049569 | Ga0501032_0011504 | Ga0501032_0011504_4787_5515 | 239 |
| 426 | 3300049569 | Ga0501032_0020894 | Ga0501032_0020894_719_1459 | 239 |
| 427 | 3300049570 | Ga0501033_0040134 | Ga0501033_0040134_919_1659 | 239 |
| 428 | 3300049571 | Ga0501034_0011290 | Ga0501034_0011290_5866_6606 | 239 |
| 429 | 3300049571 | Ga0501034_0013123 | Ga0501034_0013123_2312_3040 | 239 |
| 430 | 3300049571 | Ga0501034_0051315 | Ga0501034_0051315_3193_3930 | 239 |
| 431 | 3300049571 | Ga0501034_0068991 | Ga0501034_0068991_2101_2838 | 239 |
| 432 | 3300049571 | Ga0501034_0077554 | Ga0501034_0077554_255_1001 | 239 |
| 433 | 3300049572 | Ga0501036_0020715 | Ga0501036_0020715_795_1535 | 239 |
| 434 | 3300049572 | Ga0501036_0470870 | Ga0501036_0470870_258_1004 | 239 |
| 435 | 3300049573 | Ga0501037_0009899 | Ga0501037_0009899_5270_6016 | 239 |
| 436 | 3300049573 | Ga0501037_0034880 | Ga0501037_0034880_1157_1885 | 239 |
| 437 | 3300049574 | Ga0501038_0000236 | Ga0501038_0000236_13252_13992 | 239 |
| 438 | 3300049574 | Ga0501038_0002092 | Ga0501038_0002092_8308_9054 | 239 |
| 439 | 3300049574 | Ga0501038_0008112 | Ga0501038_0008112_1141_1869 | 239 |
| 440 | 3300049575 | Ga0501039_0498598 | Ga0501039_0498598_96_821 | 239 |
| 441 | 3300049578 | Ga0501042_0119923 | Ga0501042_0119923_286_1026 | 239 |
| 442 | 3300049579 | Ga0501043_0017479 | Ga0501043_0017479_2942_3670 | 239 |
| 443 | 3300049579 | Ga0501043_0065199 | Ga0501043_0065199_992_1732 | 239 |
| 444 | 3300049580 | Ga0501046_0001520 | Ga0501046_0001520_5471_6211 | 239 |
| 445 | 3300049580 | Ga0501046_0122653 | Ga0501046_0122653_960_1688 | 239 |
| 446 | 3300049580 | Ga0501046_0560730 | Ga0501046_0560730_46_774 | 239 |
| 447 | 3300049581 | Ga0501047_0013453 | Ga0501047_0013453_4088_4816 | 239 |
| 448 | 3300049581 | Ga0501047_0036990 | Ga0501047_0036990_1678_2418 | 239 |
| 449 | 3300049581 | Ga0501047_0047148 | Ga0501047_0047148_2576_3322 | 239 |
| 450 | 3300049581 | Ga0501047_0498782 | Ga0501047_0498782_80_811 | 239 |
| 451 | 3300049582 | Ga0501048_0000017 | Ga0501048_0000017_63591_64319 | 239 |
| 452 | 3300049582 | Ga0501048_0025620 | Ga0501048_0025620_1207_1947 | 239 |
| 453 | 3300049586 | Ga0501070_0029209 | Ga0501070_0029209_133_861 | 239 |
| 454 | 3300049586 | Ga0501070_0041603 | Ga0501070_0041603_2361_3101 | 239 |
| 455 | 3300049589 | Ga0501073_0184770 | Ga0501073_0184770_431_1159 | 239 |
| 456 | 3300049590 | Ga0501074_0093437 | Ga0501074_0093437_207_947 | 239 |
| 457 | 3300049741 | Ga0501079_0264761 | Ga0501079_0264761_568_1296 | 239 |
| 458 | 3300049744 | Ga0501083_0019054 | Ga0501083_0019054_820_1560 | 239 |
| 459 | 3300049822 | Ga0501035_0013623 | Ga0501035_0013623_4480_5220 | 239 |
| 460 | 3300049822 | Ga0501035_0021024 | Ga0501035_0021024_1570_2316 | 239 |
| 461 | 3300049823 | Ga0501044_0005946 | Ga0501044_0005946_3424_4152 | 239 |
| 462 | 3300049823 | Ga0501044_0006713 | Ga0501044_0006713_2899_3630 | 239 |
| 463 | 3300049823 | Ga0501044_0009459 | Ga0501044_0009459_5261_6007 | 239 |
| 464 | 3300049823 | Ga0501044_0013559 | Ga0501044_0013559_3687_4427 | 239 |
| 465 | 3300049823 | Ga0501044_0541364 | Ga0501044_0541364_112_834 | 239 |
| 466 | 3300050491 | nmdc:mga00v17_2658_c1 | nmdc:mga00v17_2658_c1_8077_8802 | 239 |
| 467 | 3300053136 | Ga0500559_0000929 | Ga0500559_0000929_2743_3489 | 239 |
| 468 | 3300053136 | Ga0500559_0019924 | Ga0500559_0019924_1595_2332 | 239 |
| 469 | 3300053140 | Ga0500573_0000007 | Ga0500573_0000007_244921_245670 | 239 |
| 470 | 3300053140 | Ga0500573_0021820 | Ga0500573_0021820_2016_2765 | 239 |
| 471 | 3300053153 | Ga0500616_0019007 | Ga0500616_0019007_2882_3652 | 239 |
| 472 | 3300054114 | Ga0501084_0111344 | Ga0501084_0111344_1233_1973 | 239 |
| 473 | 3300060353 | Ga0501082_0001659 | Ga0501082_0001659_11988_12725 | 239 |
| 474 | 3300060353 | Ga0501082_0006677 | Ga0501082_0006677_8578_9318 | 239 |
| 475 | 3300061719 | Ga0466962_0101381 | Ga0466962_0101381_575_1306 | 239 |
| 476 | 3300061719 | Ga0466962_0133557 | Ga0466962_0133557_365_1084 | 239 |
| 477 | iso_pu_bacteria | 2728369276 | 2729906155 | 239 |
| 478 | iso_pu_bacteria | 2791355406 | 2793984585 | 239 |
| 479 | iso_pu_bacteria | 2997600082 | 2997606661 | 239 |
| 480 | iso_pu_bacteria | 8047893842 | 8047899683 | 239 |
| 481 | iso_pu_bacteria | 8048127548 | 8048137498 | 239 |
| 482 | iso_pu_bacteria | 8048356638 | 8048359247 | 239 |
| 483 | iso_pu_bacteria | 8048369669 | 8048376632 | 239 |
| 484 | iso_pu_bacteria | 8048379754 | 8048385685 | 239 |
| 485 | 3300003203 | JGI25406J46586_10002838 | JGI25406J46586_1000283811 | 240 |
| 486 | 3300005339 | Ga0070660_100259018 | Ga0070660_1002590182 | 240 |
| 487 | 3300005455 | Ga0070663_100175118 | Ga0070663_1001751182 | 240 |
| 488 | 3300005535 | Ga0070684_100067183 | Ga0070684_1000671833 | 240 |
| 489 | 3300005535 | Ga0070684_100379274 | Ga0070684_1003792742 | 240 |
| 490 | 3300005539 | Ga0068853_100097278 | Ga0068853_1000972782 | 240 |
| 491 | 3300005548 | Ga0070665_100021952 | Ga0070665_1000219526 | 240 |
| 492 | 3300005563 | Ga0068855_100013558 | Ga0068855_1000135588 | 240 |
| 493 | 3300005616 | Ga0068852_100030459 | Ga0068852_1000304592 | 240 |
| 494 | 3300005985 | Ga0081539_10000988 | Ga0081539_1000098823 | 240 |
| 495 | 3300006175 | Ga0070712_100267205 | Ga0070712_1002672052 | 240 |
| 496 | 3300006852 | Ga0075433_10025524 | Ga0075433_100255244 | 240 |
| 497 | 3300006914 | Ga0075436_100132597 | Ga0075436_1001325972 | 240 |
| 498 | 3300007076 | Ga0075435_100002359 | Ga0075435_1000023595 | 240 |
| 499 | 3300009093 | Ga0105240_10002006 | Ga0105240_100020067 | 240 |
| 500 | 3300009148 | Ga0105243_10012714 | Ga0105243_100127148 | 240 |
| 501 | 3300009148 | Ga0105243_10592998 | Ga0105243_105929982 | 240 |
| 502 | 3300009174 | Ga0105241_10009224 | Ga0105241_100092247 | 240 |
| 503 | 3300009545 | Ga0105237_10032397 | Ga0105237_100323974 | 240 |
| 504 | 3300009551 | Ga0105238_10013809 | Ga0105238_100138098 | 240 |
| 505 | 3300009551 | Ga0105238_10095585 | Ga0105238_100955853 | 240 |
| 506 | 3300010375 | Ga0105239_10073281 | Ga0105239_100732812 | 240 |
| 507 | 3300013105 | Ga0157369_10155606 | Ga0157369_101556064 | 240 |
| 508 | 3300013296 | Ga0157374_10450774 | Ga0157374_104507742 | 240 |
| 509 | 3300013307 | Ga0157372_10132319 | Ga0157372_101323193 | 240 |
| 510 | 3300015688 | Ga0183367_1007 | Ga0183367_1007349 | 240 |
| 511 | 3300021388 | Ga0213875_10001897 | Ga0213875_100018977 | 240 |
| 512 | 3300025904 | Ga0207647_10016380 | Ga0207647_100163805 | 240 |
| 513 | 3300025913 | Ga0207695_10001622 | Ga0207695_100016226 | 240 |
| 514 | 3300025914 | Ga0207671_10000976 | Ga0207671_1000097618 | 240 |
| 515 | 3300025919 | Ga0207657_10620790 | Ga0207657_106207901 | 240 |
| 516 | 3300025924 | Ga0207694_10000220 | Ga0207694_100002203 | 240 |
| 517 | 3300025926 | Ga0207659_10547828 | Ga0207659_105478282 | 240 |
| 518 | 3300025935 | Ga0207709_10004841 | Ga0207709_100048417 | 240 |
| 519 | 3300025944 | Ga0207661_10226208 | Ga0207661_102262082 | 240 |
| 520 | 3300025949 | Ga0207667_10050485 | Ga0207667_100504855 | 240 |
| 521 | 3300025981 | Ga0207640_10005073 | Ga0207640_100050736 | 240 |
| 522 | 3300026041 | Ga0207639_10206353 | Ga0207639_102063532 | 240 |
| 523 | 3300026067 | Ga0207678_10250594 | Ga0207678_102505942 | 240 |
| 524 | 3300026142 | Ga0207698_10209726 | Ga0207698_102097262 | 240 |
| 525 | 3300028794 | Ga0307515_10044259 | Ga0307515_100442595 | 240 |
| 526 | 3300031456 | Ga0307513_10171194 | Ga0307513_101711941 | 240 |
| 527 | 3300031727 | Ga0316576_10006505 | Ga0316576_100065056 | 240 |
| 528 | 3300031728 | Ga0316578_10073838 | Ga0316578_100738382 | 240 |
| 529 | 3300031824 | Ga0307413_10001807 | Ga0307413_1000180711 | 240 |
| 530 | 3300031824 | Ga0307413_10073897 | Ga0307413_100738973 | 240 |
| 531 | 3300031838 | Ga0307518_10000187 | Ga0307518_1000018750 | 240 |
| 532 | 3300031901 | Ga0307406_10098078 | Ga0307406_100980782 | 240 |
| 533 | 3300031995 | Ga0307409_100222765 | Ga0307409_1002227652 | 240 |
| 534 | 3300032004 | Ga0307414_10585579 | Ga0307414_105855791 | 240 |
| 535 | 3300032005 | Ga0307411_10004675 | Ga0307411_100046758 | 240 |
| 536 | 3300032126 | Ga0307415_100089055 | Ga0307415_1000890553 | 240 |
| 537 | 3300035398 | Ga0316574_0278298 | Ga0316574_0278298_57_797 | 240 |
| 538 | 3300036712 | Ga0316584_0042701 | Ga0316584_0042701_396_1136 | 240 |
| 539 | 3300037466 | Ga0395898_0003389 | Ga0395898_0003389_1300_2031 | 240 |
| 540 | 3300037466 | Ga0395898_0169704 | Ga0395898_0169704_1236_2030 | 240 |
| 541 | 3300037466 | Ga0395898_0631775 | Ga0395898_0631775_172_948 | 240 |
| 542 | 3300037853 | Ga0436364_0383034 | Ga0436364_0383034_7514_8254 | 240 |
| 543 | 3300038443 | Ga0395901_0179986 | Ga0395901_0179986_671_1447 | 240 |
| 544 | 3300038443 | Ga0395901_0274685 | Ga0395901_0274685_58_789 | 240 |
| 545 | 3300038443 | Ga0395901_0339111 | Ga0395901_0339111_110_886 | 240 |
| 546 | 3300038735 | Ga0400485_07745 | Ga0400485_07745_702_1436 | 240 |
| 547 | 3300038741 | Ga0400488_11659 | Ga0400488_11659_6463_7200 | 240 |
| 548 | 3300038742 | Ga0400486_04200 | Ga0400486_04200_34794_35528 | 240 |
| 549 | 3300041491 | Ga0451833_1101346 | Ga0451833_1101346_3363_4103 | 240 |
| 550 | 3300041512 | Ga0451853_1635577 | Ga0451853_1635577_3281_4003 | 240 |
| 551 | 3300041512 | Ga0451853_2882476 | Ga0451853_2882476_169_903 | 240 |
| 552 | 3300042002 | Ga0439442_003740 | Ga0439442_003740_1873_2595 | 240 |
| 553 | 3300042006 | Ga0439432_015276 | Ga0439432_015276_450_1172 | 240 |
| 554 | 3300042131 | Ga0450894_000108 | Ga0450894_000108_8194_8919 | 240 |
| 555 | 3300042133 | Ga0450896_000133 | Ga0450896_000133_2682_3407 | 240 |
| 556 | 3300042134 | Ga0450898_000249 | Ga0450898_000249_1227_1952 | 240 |
| 557 | 3300042184 | Ga0450908_003192 | Ga0450908_003192_1358_2083 | 240 |
| 558 | 3300042876 | Ga0451577_0252036 | Ga0451577_0252036_148_879 | 240 |
| 559 | 3300044656 | Ga0466969_0092650 | Ga0466969_0092650_249_971 | 240 |
| 560 | 3300044656 | Ga0466969_0122548 | Ga0466969_0122548_362_1108 | 240 |
| 561 | 3300044658 | Ga0466972_0019146 | Ga0466972_0019146_96_818 | 240 |
| 562 | 3300044683 | Ga0466965_0185174 | Ga0466965_0185174_267_1022 | 240 |
| 563 | 3300044684 | Ga0466966_0000681 | Ga0466966_0000681_19949_20671 | 240 |
| 564 | 3300044684 | Ga0466966_0175444 | Ga0466966_0175444_251_997 | 240 |
| 565 | 3300044693 | Ga0466961_0004550 | Ga0466961_0004550_4580_5326 | 240 |
| 566 | 3300044693 | Ga0466961_0020506 | Ga0466961_0020506_230_952 | 240 |
| 567 | 3300044719 | Ga0466971_0038368 | Ga0466971_0038368_1120_1875 | 240 |
| 568 | 3300044765 | Ga0466970_0003067 | Ga0466970_0003067_4680_5435 | 240 |
| 569 | 3300045049 | Ga0466959_0014819 | Ga0466959_0014819_4192_4938 | 240 |
| 570 | 3300045049 | Ga0466959_0201267 | Ga0466959_0201267_290_1012 | 240 |
| 571 | 3300046454 | Ga0495592_0074713 | Ga0495592_0074713_1307_2038 | 240 |
| 572 | 3300046455 | Ga0495603_0000118 | Ga0495603_0000118_35804_36532 | 240 |
| 573 | 3300046459 | Ga0495629_0001225 | Ga0495629_0001225_1542_2270 | 240 |
| 574 | 3300046459 | Ga0495629_0003945 | Ga0495629_0003945_8462_9190 | 240 |
| 575 | 3300046462 | Ga0495651_0000324 | Ga0495651_0000324_28030_28761 | 240 |
| 576 | 3300046499 | Ga0495594_0001176 | Ga0495594_0001176_11589_12317 | 240 |
| 577 | 3300046506 | Ga0495583_0090564 | Ga0495583_0090564_529_1251 | 240 |
| 578 | 3300046511 | Ga0495608_0038537 | Ga0495608_0038537_2198_2926 | 240 |
| 579 | 3300046516 | Ga0495628_0126088 | Ga0495628_0126088_380_1111 | 240 |
| 580 | 3300046518 | Ga0495631_0089949 | Ga0495631_0089949_539_1270 | 240 |
| 581 | 3300046525 | Ga0495663_0049205 | Ga0495663_0049205_14_745 | 240 |
| 582 | 3300046529 | Ga0495652_0010670 | Ga0495652_0010670_3120_3851 | 240 |
| 583 | 3300046529 | Ga0495652_0158330 | Ga0495652_0158330_483_1214 | 240 |
| 584 | 3300046557 | Ga0495622_0004164 | Ga0495622_0004164_5593_6321 | 240 |
| 585 | 3300046557 | Ga0495622_0051737 | Ga0495622_0051737_718_1449 | 240 |
| 586 | 3300046648 | Ga0495611_0007776 | Ga0495611_0007776_3351_4079 | 240 |
| 587 | 3300046674 | Ga0495588_0171135 | Ga0495588_0171135_92_820 | 240 |
| 588 | 3300046679 | Ga0495623_0200114 | Ga0495623_0200114_162_893 | 240 |
| 589 | 3300046689 | Ga0495613_0004176 | Ga0495613_0004176_8421_9149 | 240 |
| 590 | 3300046794 | Ga0495589_0064498 | Ga0495589_0064498_718_1446 | 240 |
| 591 | 3300046794 | Ga0495589_0122686 | Ga0495589_0122686_485_1207 | 240 |
| 592 | 3300046809 | Ga0495600_0064496 | Ga0495600_0064496_847_1578 | 240 |
| 593 | 3300047318 | Ga0495636_0001821 | Ga0495636_0001821_72_794 | 240 |
| 594 | 3300047318 | Ga0495636_0054921 | Ga0495636_0054921_432_1160 | 240 |
| 595 | 3300047321 | Ga0495676_0006095 | Ga0495676_0006095_8595_9323 | 240 |
| 596 | 3300047321 | Ga0495676_0030679 | Ga0495676_0030679_2287_3015 | 240 |
| 597 | 3300047443 | Ga0495687_005383 | Ga0495687_005383_7373_8095 | 240 |
| 598 | 3300047444 | Ga0495675_0014848 | Ga0495675_0014848_2915_3643 | 240 |
| 599 | 3300047447 | Ga0495685_050876 | Ga0495685_050876_115_846 | 240 |
| 600 | 3300048089 | Ga0495614_0006743 | Ga0495614_0006743_1326_2054 | 240 |
| 601 | 3300048090 | Ga0495615_0024698 | Ga0495615_0024698_550_1281 | 240 |
| 602 | 3300048904 | Ga0496101_0248801 | Ga0496101_0248801_413_1159 | 240 |
| 603 | 3300048909 | Ga0496106_0201711 | Ga0496106_0201711_321_1049 | 240 |
| 604 | 3300048911 | Ga0496108_0070849 | Ga0496108_0070849_1392_2135 | 240 |
| 605 | 3300049569 | Ga0501032_0157763 | Ga0501032_0157763_475_1200 | 240 |
| 606 | 3300049570 | Ga0501033_0389348 | Ga0501033_0389348_23_748 | 240 |
| 607 | 3300049580 | Ga0501046_0123166 | Ga0501046_0123166_1131_1856 | 240 |
| 608 | 3300049823 | Ga0501044_0001763 | Ga0501044_0001763_12182_12907 | 240 |
| 609 | 3300050512 | nmdc:mga0n895_17970_c1 | nmdc:mga0n895_17970_c1_4990_5712 | 240 |
| 610 | 3300050513 | nmdc:mga0rr50_15996_c1 | nmdc:mga0rr50_15996_c1_3470_4192 | 240 |
| 611 | 3300050514 | nmdc:mga08x19_117413_c1 | nmdc:mga08x19_117413_c1_535_1257 | 240 |
| 612 | 3300050515 | nmdc:mga0a205_192749_c1 | nmdc:mga0a205_192749_c1_223_945 | 240 |
| 613 | 3300053077 | Ga0495601_0003606 | Ga0495601_0003606_3319_4050 | 240 |
| 614 | 3300053108 | Ga0500562_046540 | Ga0500562_046540_95_841 | 240 |
| 615 | 3300053133 | Ga0500655_031140 | Ga0500655_031140_275_1015 | 240 |
| 616 | 3300061719 | Ga0466962_0002007 | Ga0466962_0002007_3249_3995 | 240 |
| 617 | iso_pu_bacteria | 2643221587 | 2643945223 | 240 |
| 618 | iso_pu_bacteria | 2643221677 | 2644432122 | 240 |
| 619 | iso_pu_bacteria | 2738541308 | 2738886846 | 240 |
| 620 | iso_pu_bacteria | 2995463766 | 2995464588 | 240 |
| 621 | iso_pu_bacteria | 3006425503 | 3006426685 | 240 |
| 622 | iso_pu_bacteria | 8023623736 | 8023627572 | 240 |
| 623 | iso_pu_bacteria | 8033684223 | 8033684702 | 240 |
| 624 | iso_pu_bacteria | 8056667051 | 8056667883 | 240 |
| 625 | 3300001989 | JGI24739J22299_10010664 | JGI24739J22299_100106643 | 241 |
| 626 | 3300001990 | JGI24737J22298_10020253 | JGI24737J22298_100202533 | 241 |
| 627 | 3300002075 | JGI24738J21930_10012514 | JGI24738J21930_100125143 | 241 |
| 628 | 3300003320 | rootH2_10070449 | rootH2_100704492 | 241 |
| 629 | 3300003322 | rootL2_10011701 | rootL2_100117015 | 241 |
| 630 | 3300003578 | Ga0006562J51391_1157002 | Ga0006562J51391_11570026 | 241 |
| 631 | 3300003578 | Ga0006562J51391_1157005 | Ga0006562J51391_11570052 | 241 |
| 632 | 3300005435 | Ga0070714_100004428 | Ga0070714_1000044289 | 241 |
| 633 | 3300005548 | Ga0070665_100213759 | Ga0070665_1002137592 | 241 |
| 634 | 3300005563 | Ga0068855_100250917 | Ga0068855_1002509173 | 241 |
| 635 | 3300005614 | Ga0068856_100118454 | Ga0068856_1001184543 | 241 |
| 636 | 3300005614 | Ga0068856_100341016 | Ga0068856_1003410162 | 241 |
| 637 | 3300005937 | Ga0081455_10054131 | Ga0081455_100541315 | 241 |
| 638 | 3300006028 | Ga0070717_10312129 | Ga0070717_103121291 | 241 |
| 639 | 3300006042 | Ga0075368_10008947 | Ga0075368_100089474 | 241 |
| 640 | 3300006178 | Ga0075367_10001030 | Ga0075367_100010309 | 241 |
| 641 | 3300006353 | Ga0075370_10064971 | Ga0075370_100649714 | 241 |
| 642 | 3300006948 | Ga0099826_10055096 | Ga0099826_100550964 | 241 |
| 643 | 3300009092 | Ga0105250_10012833 | Ga0105250_100128335 | 241 |
| 644 | 3300011119 | Ga0105246_10232949 | Ga0105246_102329493 | 241 |
| 645 | 3300013307 | Ga0157372_10148987 | Ga0157372_101489872 | 241 |
| 646 | 3300013308 | Ga0157375_10596968 | Ga0157375_105969681 | 241 |
| 647 | 3300014497 | Ga0182008_10002930 | Ga0182008_100029305 | 241 |
| 648 | 3300015261 | Ga0182006_1067333 | Ga0182006_10673332 | 241 |
| 649 | 3300015262 | Ga0182007_10004606 | Ga0182007_100046067 | 241 |
| 650 | 3300020082 | Ga0206353_11478345 | Ga0206353_114783452 | 241 |
| 651 | 3300025904 | Ga0207647_10073596 | Ga0207647_100735962 | 241 |
| 652 | 3300025915 | Ga0207693_10347695 | Ga0207693_103476952 | 241 |
| 653 | 3300025929 | Ga0207664_10015771 | Ga0207664_100157712 | 241 |
| 654 | 3300025929 | Ga0207664_10157794 | Ga0207664_101577941 | 241 |
| 655 | 3300025944 | Ga0207661_10161058 | Ga0207661_101610582 | 241 |
| 656 | 3300025949 | Ga0207667_10503441 | Ga0207667_105034412 | 241 |
| 657 | 3300027866 | Ga0209813_10017241 | Ga0209813_100172413 | 241 |
| 658 | 3300028786 | Ga0307517_10010039 | Ga0307517_1001003910 | 241 |
| 659 | 3300028786 | Ga0307517_10045407 | Ga0307517_100454075 | 241 |
| 660 | 3300028794 | Ga0307515_10001023 | Ga0307515_1000102316 | 241 |
| 661 | 3300028794 | Ga0307515_10028171 | Ga0307515_100281717 | 241 |
| 662 | 3300030521 | Ga0307511_10002015 | Ga0307511_1000201512 | 241 |
| 663 | 3300030521 | Ga0307511_10099457 | Ga0307511_100994573 | 241 |
| 664 | 3300030521 | Ga0307511_10106659 | Ga0307511_101066592 | 241 |
| 665 | 3300030521 | Ga0307511_10121505 | Ga0307511_101215052 | 241 |
| 666 | 3300030522 | Ga0307512_10001219 | Ga0307512_1000121929 | 241 |
| 667 | 3300030522 | Ga0307512_10030796 | Ga0307512_100307964 | 241 |
| 668 | 3300031456 | Ga0307513_10007993 | Ga0307513_100079934 | 241 |
| 669 | 3300031456 | Ga0307513_10053872 | Ga0307513_100538726 | 241 |
| 670 | 3300031507 | Ga0307509_10062666 | Ga0307509_100626664 | 241 |
| 671 | 3300031507 | Ga0307509_10136899 | Ga0307509_101368993 | 241 |
| 672 | 3300031616 | Ga0307508_10002617 | Ga0307508_100026171 | 241 |
| 673 | 3300031616 | Ga0307508_10005838 | Ga0307508_100058388 | 241 |
| 674 | 3300031616 | Ga0307508_10048095 | Ga0307508_100480953 | 241 |
| 675 | 3300031616 | Ga0307508_10085607 | Ga0307508_100856074 | 241 |
| 676 | 3300031616 | Ga0307508_10125154 | Ga0307508_101251543 | 241 |
| 677 | 3300031616 | Ga0307508_10257165 | Ga0307508_102571651 | 241 |
| 678 | 3300031649 | Ga0307514_10000866 | Ga0307514_100008665 | 241 |
| 679 | 3300031649 | Ga0307514_10068123 | Ga0307514_100681232 | 241 |
| 680 | 3300031649 | Ga0307514_10082594 | Ga0307514_100825941 | 241 |
| 681 | 3300031730 | Ga0307516_10000836 | Ga0307516_1000083622 | 241 |
| 682 | 3300031730 | Ga0307516_10017241 | Ga0307516_100172416 | 241 |
| 683 | 3300031730 | Ga0307516_10039317 | Ga0307516_100393172 | 241 |
| 684 | 3300031730 | Ga0307516_10278049 | Ga0307516_102780493 | 241 |
| 685 | 3300031824 | Ga0307413_10085581 | Ga0307413_100855813 | 241 |
| 686 | 3300031824 | Ga0307413_10415129 | Ga0307413_104151292 | 241 |
| 687 | 3300031838 | Ga0307518_10168033 | Ga0307518_101680332 | 241 |
| 688 | 3300031911 | Ga0307412_10064375 | Ga0307412_100643753 | 241 |
| 689 | 3300031995 | Ga0307409_100425048 | Ga0307409_1004250482 | 241 |
| 690 | 3300032002 | Ga0307416_100102010 | Ga0307416_1001020102 | 241 |
| 691 | 3300032005 | Ga0307411_10305639 | Ga0307411_103056391 | 241 |
| 692 | 3300033179 | Ga0307507_10000019 | Ga0307507_1000001993 | 241 |
| 693 | 3300033179 | Ga0307507_10017958 | Ga0307507_100179588 | 241 |
| 694 | 3300033179 | Ga0307507_10045870 | Ga0307507_100458702 | 241 |
| 695 | 3300033179 | Ga0307507_10308330 | Ga0307507_103083302 | 241 |
| 696 | 3300033180 | Ga0307510_10011375 | Ga0307510_100113753 | 241 |
| 697 | 3300033180 | Ga0307510_10031973 | Ga0307510_100319738 | 241 |
| 698 | 3300033180 | Ga0307510_10124243 | Ga0307510_101242434 | 241 |
| 699 | 3300033180 | Ga0307510_10194466 | Ga0307510_101944662 | 241 |
| 700 | 3300037418 | Ga0395900_0024030 | Ga0395900_0024030_5007_5732 | 241 |
| 701 | 3300037466 | Ga0395898_0078790 | Ga0395898_0078790_2238_2972 | 241 |
| 702 | 3300037466 | Ga0395898_0124866 | Ga0395898_0124866_1245_1970 | 241 |
| 703 | 3300037466 | Ga0395898_0125388 | Ga0395898_0125388_493_1218 | 241 |
| 704 | 3300037471 | Ga0395905_0385676 | Ga0395905_0385676_129_854 | 241 |
| 705 | 3300038443 | Ga0395901_0187487 | Ga0395901_0187487_1061_1786 | 241 |
| 706 | 3300041404 | Ga0439436_0004093 | Ga0439436_0004093_1612_2337 | 241 |
| 707 | 3300041406 | Ga0439439_0015650 | Ga0439439_0015650_187_912 | 241 |
| 708 | 3300041491 | Ga0451833_1314909 | Ga0451833_1314909_31_756 | 241 |
| 709 | 3300041492 | Ga0451835_0497006 | Ga0451835_0497006_248_973 | 241 |
| 710 | 3300041494 | Ga0451837_0076298 | Ga0451837_0076298_4141_4866 | 241 |
| 711 | 3300042005 | Ga0439448_0086255 | Ga0439448_0086255_237_962 | 241 |
| 712 | 3300042007 | Ga0439449_0001767 | Ga0439449_0001767_72_797 | 241 |
| 713 | 3300042008 | Ga0439450_019447 | Ga0439450_019447_547_1272 | 241 |
| 714 | 3300042012 | Ga0439455_0053092 | Ga0439455_0053092_118_846 | 241 |
| 715 | 3300042014 | Ga0439457_000358 | Ga0439457_000358_8214_8939 | 241 |
| 716 | 3300042134 | Ga0450898_005549 | Ga0450898_005549_929_1654 | 241 |
| 717 | 3300042157 | Ga0439458_0000302 | Ga0439458_0000302_3024_3752 | 241 |
| 718 | 3300042533 | Ga0450901_002785 | Ga0450901_002785_682_1410 | 241 |
| 719 | 3300044656 | Ga0466969_0000312 | Ga0466969_0000312_2584_3324 | 241 |
| 720 | 3300044658 | Ga0466972_0007209 | Ga0466972_0007209_4426_5154 | 241 |
| 721 | 3300044658 | Ga0466972_0164233 | Ga0466972_0164233_88_813 | 241 |
| 722 | 3300044683 | Ga0466965_0024888 | Ga0466965_0024888_649_1377 | 241 |
| 723 | 3300044684 | Ga0466966_0001836 | Ga0466966_0001836_10178_10906 | 241 |
| 724 | 3300044684 | Ga0466966_0006747 | Ga0466966_0006747_6407_7153 | 241 |
| 725 | 3300044684 | Ga0466966_0017580 | Ga0466966_0017580_966_1709 | 241 |
| 726 | 3300044693 | Ga0466961_0001762 | Ga0466961_0001762_10093_10833 | 241 |
| 727 | 3300044693 | Ga0466961_0012188 | Ga0466961_0012188_1652_2398 | 241 |
| 728 | 3300044693 | Ga0466961_0033050 | Ga0466961_0033050_1204_1932 | 241 |
| 729 | 3300044694 | Ga0466963_0000206 | Ga0466963_0000206_13992_14720 | 241 |
| 730 | 3300044694 | Ga0466963_0000614 | Ga0466963_0000614_10885_11610 | 241 |
| 731 | 3300044694 | Ga0466963_0037006 | Ga0466963_0037006_1478_2203 | 241 |
| 732 | 3300044694 | Ga0466963_0161976 | Ga0466963_0161976_31_765 | 241 |
| 733 | 3300044706 | Ga0466964_0037040 | Ga0466964_0037040_226_951 | 241 |
| 734 | 3300044706 | Ga0466964_0040300 | Ga0466964_0040300_554_1282 | 241 |
| 735 | 3300044719 | Ga0466971_0008218 | Ga0466971_0008218_2205_2948 | 241 |
| 736 | 3300044719 | Ga0466971_0009107 | Ga0466971_0009107_1521_2249 | 241 |
| 737 | 3300044765 | Ga0466970_0001751 | Ga0466970_0001751_5001_5729 | 241 |
| 738 | 3300044765 | Ga0466970_0019046 | Ga0466970_0019046_788_1531 | 241 |
| 739 | 3300044765 | Ga0466970_0263882 | Ga0466970_0263882_204_950 | 241 |
| 740 | 3300044842 | Ga0466957_0000450 | Ga0466957_0000450_12926_13654 | 241 |
| 741 | 3300044842 | Ga0466957_0164363 | Ga0466957_0164363_514_1239 | 241 |
| 742 | 3300044901 | Ga0466960_0025324 | Ga0466960_0025324_1294_2019 | 241 |
| 743 | 3300045049 | Ga0466959_0000702 | Ga0466959_0000702_13864_14592 | 241 |
| 744 | 3300045049 | Ga0466959_0004881 | Ga0466959_0004881_1915_2661 | 241 |
| 745 | 3300045836 | Ga0466958_0000246 | Ga0466958_0000246_4873_5601 | 241 |
| 746 | 3300045836 | Ga0466958_0019819 | Ga0466958_0019819_2708_3448 | 241 |
| 747 | 3300045836 | Ga0466958_0052067 | Ga0466958_0052067_1066_1809 | 241 |
| 748 | 3300045836 | Ga0466958_0265827 | Ga0466958_0265827_333_1067 | 241 |
| 749 | 3300045976 | Ga0466967_0000259 | Ga0466967_0000259_8664_9392 | 241 |
| 750 | 3300046452 | Ga0495617_015956 | Ga0495617_015956_1593_2318 | 241 |
| 751 | 3300046453 | Ga0495627_023753 | Ga0495627_023753_113_838 | 241 |
| 752 | 3300046453 | Ga0495627_039221 | Ga0495627_039221_378_1112 | 241 |
| 753 | 3300046454 | Ga0495592_0006146 | Ga0495592_0006146_195_920 | 241 |
| 754 | 3300046454 | Ga0495592_0055209 | Ga0495592_0055209_947_1675 | 241 |
| 755 | 3300046454 | Ga0495592_0101946 | Ga0495592_0101946_419_1144 | 241 |
| 756 | 3300046454 | Ga0495592_0163579 | Ga0495592_0163579_345_1082 | 241 |
| 757 | 3300046455 | Ga0495603_0002495 | Ga0495603_0002495_81_806 | 241 |
| 758 | 3300046455 | Ga0495603_0053210 | Ga0495603_0053210_1651_2376 | 241 |
| 759 | 3300046455 | Ga0495603_0233520 | Ga0495603_0233520_95_823 | 241 |
| 760 | 3300046459 | Ga0495629_0006546 | Ga0495629_0006546_6946_7671 | 241 |
| 761 | 3300046459 | Ga0495629_0015712 | Ga0495629_0015712_2816_3541 | 241 |
| 762 | 3300046459 | Ga0495629_0158648 | Ga0495629_0158648_791_1522 | 241 |
| 763 | 3300046461 | Ga0495641_0082886 | Ga0495641_0082886_635_1360 | 241 |
| 764 | 3300046462 | Ga0495651_0000211 | Ga0495651_0000211_33146_33883 | 241 |
| 765 | 3300046462 | Ga0495651_0003371 | Ga0495651_0003371_2456_3184 | 241 |
| 766 | 3300046462 | Ga0495651_0020877 | Ga0495651_0020877_3953_4678 | 241 |
| 767 | 3300046473 | Ga0495582_0082387 | Ga0495582_0082387_995_1720 | 241 |
| 768 | 3300046474 | Ga0495605_0011696 | Ga0495605_0011696_591_1316 | 241 |
| 769 | 3300046475 | Ga0495639_0006635 | Ga0495639_0006635_3548_4273 | 241 |
| 770 | 3300046476 | Ga0495662_0002106 | Ga0495662_0002106_1269_1997 | 241 |
| 771 | 3300046476 | Ga0495662_0022833 | Ga0495662_0022833_521_1246 | 241 |
| 772 | 3300046476 | Ga0495662_0036208 | Ga0495662_0036208_920_1645 | 241 |
| 773 | 3300046477 | Ga0495664_0002194 | Ga0495664_0002194_2552_3280 | 241 |
| 774 | 3300046477 | Ga0495664_0107191 | Ga0495664_0107191_203_928 | 241 |
| 775 | 3300046477 | Ga0495664_0242584 | Ga0495664_0242584_186_923 | 241 |
| 776 | 3300046491 | Ga0495584_0010442 | Ga0495584_0010442_455_1180 | 241 |
| 777 | 3300046492 | Ga0495585_0031988 | Ga0495585_0031988_523_1248 | 241 |
| 778 | 3300046492 | Ga0495585_0061848 | Ga0495585_0061848_952_1677 | 241 |
| 779 | 3300046499 | Ga0495594_0010207 | Ga0495594_0010207_1285_2010 | 241 |
| 780 | 3300046499 | Ga0495594_0014082 | Ga0495594_0014082_250_978 | 241 |
| 781 | 3300046500 | Ga0495596_0012530 | Ga0495596_0012530_1840_2565 | 241 |
| 782 | 3300046506 | Ga0495583_0030333 | Ga0495583_0030333_1796_2521 | 241 |
| 783 | 3300046507 | Ga0495606_0017255 | Ga0495606_0017255_330_1055 | 241 |
| 784 | 3300046511 | Ga0495608_0032629 | Ga0495608_0032629_2322_3047 | 241 |
| 785 | 3300046511 | Ga0495608_0066984 | Ga0495608_0066984_1067_1795 | 241 |
| 786 | 3300046511 | Ga0495608_0243723 | Ga0495608_0243723_368_1105 | 241 |
| 787 | 3300046512 | Ga0495610_0007469 | Ga0495610_0007469_994_1719 | 241 |
| 788 | 3300046513 | Ga0495616_0013521 | Ga0495616_0013521_1548_2273 | 241 |
| 789 | 3300046514 | Ga0495618_0037100 | Ga0495618_0037100_162_887 | 241 |
| 790 | 3300046514 | Ga0495618_0040123 | Ga0495618_0040123_1082_1810 | 241 |
| 791 | 3300046514 | Ga0495618_0044642 | Ga0495618_0044642_1327_2064 | 241 |
| 792 | 3300046514 | Ga0495618_0140578 | Ga0495618_0140578_686_1411 | 241 |
| 793 | 3300046515 | Ga0495620_0031617 | Ga0495620_0031617_1376_2101 | 241 |
| 794 | 3300046516 | Ga0495628_0026002 | Ga0495628_0026002_2946_3683 | 241 |
| 795 | 3300046516 | Ga0495628_0026462 | Ga0495628_0026462_2132_2857 | 241 |
| 796 | 3300046517 | Ga0495630_0046801 | Ga0495630_0046801_1175_1903 | 241 |
| 797 | 3300046518 | Ga0495631_0005465 | Ga0495631_0005465_4770_5495 | 241 |
| 798 | 3300046519 | Ga0495632_0028913 | Ga0495632_0028913_1654_2379 | 241 |
| 799 | 3300046519 | Ga0495632_0031247 | Ga0495632_0031247_665_1396 | 241 |
| 800 | 3300046522 | Ga0495643_0004048 | Ga0495643_0004048_7084_7815 | 241 |
| 801 | 3300046526 | Ga0495666_0020869 | Ga0495666_0020869_2438_3163 | 241 |
| 802 | 3300046528 | Ga0495642_0035377 | Ga0495642_0035377_305_1030 | 241 |
| 803 | 3300046529 | Ga0495652_0018950 | Ga0495652_0018950_1434_2159 | 241 |
| 804 | 3300046529 | Ga0495652_0063283 | Ga0495652_0063283_2199_2924 | 241 |
| 805 | 3300046529 | Ga0495652_0289364 | Ga0495652_0289364_74_802 | 241 |
| 806 | 3300046530 | Ga0495654_0037013 | Ga0495654_0037013_447_1172 | 241 |
| 807 | 3300046533 | Ga0495640_0004853 | Ga0495640_0004853_3422_4147 | 241 |
| 808 | 3300046533 | Ga0495640_0053029 | Ga0495640_0053029_458_1183 | 241 |
| 809 | 3300046535 | Ga0495586_0089008 | Ga0495586_0089008_838_1575 | 241 |
| 810 | 3300046535 | Ga0495586_0293070 | Ga0495586_0293070_71_796 | 241 |
| 811 | 3300046536 | Ga0495587_0008553 | Ga0495587_0008553_4680_5408 | 241 |
| 812 | 3300046538 | Ga0495609_0003387 | Ga0495609_0003387_5993_6718 | 241 |
| 813 | 3300046542 | Ga0495597_0062332 | Ga0495597_0062332_72_797 | 241 |
| 814 | 3300046543 | Ga0495645_0033596 | Ga0495645_0033596_50_787 | 241 |
| 815 | 3300046543 | Ga0495645_0054473 | Ga0495645_0054473_959_1687 | 241 |
| 816 | 3300046543 | Ga0495645_0191490 | Ga0495645_0191490_367_1092 | 241 |
| 817 | 3300046557 | Ga0495622_0002898 | Ga0495622_0002898_1299_2024 | 241 |
| 818 | 3300046558 | Ga0495633_0023178 | Ga0495633_0023178_2068_2793 | 241 |
| 819 | 3300046559 | Ga0495667_0134369 | Ga0495667_0134369_321_1046 | 241 |
| 820 | 3300046615 | Ga0495656_0139360 | Ga0495656_0139360_289_1014 | 241 |
| 821 | 3300046616 | Ga0495668_0104241 | Ga0495668_0104241_135_860 | 241 |
| 822 | 3300046642 | Ga0495634_0004021 | Ga0495634_0004021_6119_6847 | 241 |
| 823 | 3300046642 | Ga0495634_0025930 | Ga0495634_0025930_1167_1892 | 241 |
| 824 | 3300046648 | Ga0495611_0006244 | Ga0495611_0006244_1027_1752 | 241 |
| 825 | 3300046660 | Ga0495625_0007626 | Ga0495625_0007626_1270_1998 | 241 |
| 826 | 3300046660 | Ga0495625_0083574 | Ga0495625_0083574_995_1720 | 241 |
| 827 | 3300046663 | Ga0495635_0001097 | Ga0495635_0001097_7382_8110 | 241 |
| 828 | 3300046663 | Ga0495635_0003328 | Ga0495635_0003328_9094_9831 | 241 |
| 829 | 3300046663 | Ga0495635_0009396 | Ga0495635_0009396_1846_2571 | 241 |
| 830 | 3300046665 | Ga0495661_0157471 | Ga0495661_0157471_114_845 | 241 |
| 831 | 3300046674 | Ga0495588_0010629 | Ga0495588_0010629_2849_3577 | 241 |
| 832 | 3300046674 | Ga0495588_0058330 | Ga0495588_0058330_1037_1762 | 241 |
| 833 | 3300046675 | Ga0495657_0002044 | Ga0495657_0002044_6372_7100 | 241 |
| 834 | 3300046675 | Ga0495657_0018070 | Ga0495657_0018070_564_1289 | 241 |
| 835 | 3300046675 | Ga0495657_0068042 | Ga0495657_0068042_910_1635 | 241 |
| 836 | 3300046678 | Ga0495599_0175117 | Ga0495599_0175117_191_916 | 241 |
| 837 | 3300046679 | Ga0495623_0011914 | Ga0495623_0011914_2754_3491 | 241 |
| 838 | 3300046679 | Ga0495623_0072871 | Ga0495623_0072871_546_1271 | 241 |
| 839 | 3300046679 | Ga0495623_0250043 | Ga0495623_0250043_144_869 | 241 |
| 840 | 3300046680 | Ga0495646_0001636 | Ga0495646_0001636_7671_8399 | 241 |
| 841 | 3300046683 | Ga0495658_0018195 | Ga0495658_0018195_1606_2334 | 241 |
| 842 | 3300046689 | Ga0495613_0001306 | Ga0495613_0001306_124_852 | 241 |
| 843 | 3300046689 | Ga0495613_0058110 | Ga0495613_0058110_27_752 | 241 |
| 844 | 3300046689 | Ga0495613_0175787 | Ga0495613_0175787_574_1299 | 241 |
| 845 | 3300046690 | Ga0495624_0075230 | Ga0495624_0075230_635_1360 | 241 |
| 846 | 3300046690 | Ga0495624_0130302 | Ga0495624_0130302_622_1353 | 241 |
| 847 | 3300046691 | Ga0495670_0007279 | Ga0495670_0007279_1370_2101 | 241 |
| 848 | 3300046694 | Ga0495649_0129369 | Ga0495649_0129369_66_791 | 241 |
| 849 | 3300046794 | Ga0495589_0023370 | Ga0495589_0023370_500_1231 | 241 |
| 850 | 3300046794 | Ga0495589_0030384 | Ga0495589_0030384_1005_1733 | 241 |
| 851 | 3300046794 | Ga0495589_0044773 | Ga0495589_0044773_423_1148 | 241 |
| 852 | 3300046809 | Ga0495600_0013546 | Ga0495600_0013546_2920_3645 | 241 |
| 853 | 3300046809 | Ga0495600_0021836 | Ga0495600_0021836_2424_3152 | 241 |
| 854 | 3300047315 | Ga0495581_0001702 | Ga0495581_0001702_6865_7593 | 241 |
| 855 | 3300047315 | Ga0495581_0015062 | Ga0495581_0015062_357_1082 | 241 |
| 856 | 3300047315 | Ga0495581_0057044 | Ga0495581_0057044_1450_2175 | 241 |
| 857 | 3300047315 | Ga0495581_0326859 | Ga0495581_0326859_43_768 | 241 |
| 858 | 3300047317 | Ga0495604_0004607 | Ga0495604_0004607_6768_7493 | 241 |
| 859 | 3300047317 | Ga0495604_0009596 | Ga0495604_0009596_2110_2838 | 241 |
| 860 | 3300047317 | Ga0495604_0021693 | Ga0495604_0021693_2143_2868 | 241 |
| 861 | 3300047317 | Ga0495604_0022107 | Ga0495604_0022107_3400_4125 | 241 |
| 862 | 3300047317 | Ga0495604_0034066 | Ga0495604_0034066_2025_2750 | 241 |
| 863 | 3300047318 | Ga0495636_0001395 | Ga0495636_0001395_5023_5748 | 241 |
| 864 | 3300047318 | Ga0495636_0016622 | Ga0495636_0016622_357_1082 | 241 |
| 865 | 3300047318 | Ga0495636_0081577 | Ga0495636_0081577_589_1314 | 241 |
| 866 | 3300047319 | Ga0495674_0122208 | Ga0495674_0122208_1163_1891 | 241 |
| 867 | 3300047321 | Ga0495676_0006378 | Ga0495676_0006378_1567_2292 | 241 |
| 868 | 3300047321 | Ga0495676_0026496 | Ga0495676_0026496_2475_3203 | 241 |
| 869 | 3300047322 | Ga0495680_0023976 | Ga0495680_0023976_484_1209 | 241 |
| 870 | 3300047443 | Ga0495687_001939 | Ga0495687_001939_8167_8892 | 241 |
| 871 | 3300047443 | Ga0495687_043409 | Ga0495687_043409_182_907 | 241 |
| 872 | 3300047443 | Ga0495687_043860 | Ga0495687_043860_1174_1899 | 241 |
| 873 | 3300047444 | Ga0495675_0016868 | Ga0495675_0016868_125_850 | 241 |
| 874 | 3300047444 | Ga0495675_0101022 | Ga0495675_0101022_1029_1754 | 241 |
| 875 | 3300047447 | Ga0495685_000366 | Ga0495685_000366_13388_14119 | 241 |
| 876 | 3300047447 | Ga0495685_002245 | Ga0495685_002245_2638_3363 | 241 |
| 877 | 3300047447 | Ga0495685_005998 | Ga0495685_005998_2720_3448 | 241 |
| 878 | 3300047447 | Ga0495685_030359 | Ga0495685_030359_289_1014 | 241 |
| 879 | 3300047470 | Ga0495681_0000244 | Ga0495681_0000244_29122_29853 | 241 |
| 880 | 3300047470 | Ga0495681_0001646 | Ga0495681_0001646_1224_1952 | 241 |
| 881 | 3300047471 | Ga0495684_0021677 | Ga0495684_0021677_3647_4372 | 241 |
| 882 | 3300047471 | Ga0495684_0112895 | Ga0495684_0112895_208_936 | 241 |
| 883 | 3300047472 | Ga0495686_0193984 | Ga0495686_0193984_203_931 | 241 |
| 884 | 3300047673 | Ga0495593_0006642 | Ga0495593_0006642_4962_5690 | 241 |
| 885 | 3300048088 | Ga0495602_0032581 | Ga0495602_0032581_851_1579 | 241 |
| 886 | 3300048905 | Ga0496102_0216325 | Ga0496102_0216325_25_750 | 241 |
| 887 | 3300048908 | Ga0496105_0629683 | Ga0496105_0629683_57_782 | 241 |
| 888 | 3300048910 | Ga0496107_0144284 | Ga0496107_0144284_242_967 | 241 |
| 889 | 3300048912 | Ga0496109_0046548 | Ga0496109_0046548_1000_1725 | 241 |
| 890 | 3300048914 | Ga0496111_0196835 | Ga0496111_0196835_717_1442 | 241 |
| 891 | 3300048915 | Ga0496112_0488311 | Ga0496112_0488311_333_1058 | 241 |
| 892 | 3300048916 | Ga0496113_0660335 | Ga0496113_0660335_90_815 | 241 |
| 893 | 3300048928 | Ga0496125_0136819 | Ga0496125_0136819_373_1098 | 241 |
| 894 | 3300048929 | Ga0496126_0143757 | Ga0496126_0143757_847_1584 | 241 |
| 895 | 3300049459 | Ga0495678_076863 | Ga0495678_076863_154_879 | 241 |
| 896 | 3300049532 | Ga0501316_007283 | Ga0501316_007283_212_946 | 241 |
| 897 | 3300049539 | Ga0501323_007545 | Ga0501323_007545_501_1226 | 241 |
| 898 | 3300049568 | Ga0501031_0003586 | Ga0501031_0003586_6112_6849 | 241 |
| 899 | 3300049568 | Ga0501031_0025632 | Ga0501031_0025632_2375_3100 | 241 |
| 900 | 3300049568 | Ga0501031_0087453 | Ga0501031_0087453_664_1389 | 241 |
| 901 | 3300049568 | Ga0501031_0098726 | Ga0501031_0098726_169_894 | 241 |
| 902 | 3300049568 | Ga0501031_0293392 | Ga0501031_0293392_56_784 | 241 |
| 903 | 3300049569 | Ga0501032_0002783 | Ga0501032_0002783_2852_3589 | 241 |
| 904 | 3300049569 | Ga0501032_0013299 | Ga0501032_0013299_5083_5808 | 241 |
| 905 | 3300049569 | Ga0501032_0078719 | Ga0501032_0078719_1138_1869 | 241 |
| 906 | 3300049569 | Ga0501032_0155137 | Ga0501032_0155137_709_1434 | 241 |
| 907 | 3300049569 | Ga0501032_0252925 | Ga0501032_0252925_29_754 | 241 |
| 908 | 3300049569 | Ga0501032_0318222 | Ga0501032_0318222_18_743 | 241 |
| 909 | 3300049570 | Ga0501033_0004222 | Ga0501033_0004222_2528_3253 | 241 |
| 910 | 3300049570 | Ga0501033_0011161 | Ga0501033_0011161_4276_5007 | 241 |
| 911 | 3300049570 | Ga0501033_0013104 | Ga0501033_0013104_3245_3970 | 241 |
| 912 | 3300049570 | Ga0501033_0056095 | Ga0501033_0056095_1053_1778 | 241 |
| 913 | 3300049570 | Ga0501033_0090325 | Ga0501033_0090325_1082_1810 | 241 |
| 914 | 3300049570 | Ga0501033_0152941 | Ga0501033_0152941_120_848 | 241 |
| 915 | 3300049570 | Ga0501033_0171598 | Ga0501033_0171598_789_1517 | 241 |
| 916 | 3300049571 | Ga0501034_0011768 | Ga0501034_0011768_5002_5739 | 241 |
| 917 | 3300049571 | Ga0501034_0047293 | Ga0501034_0047293_3020_3745 | 241 |
| 918 | 3300049571 | Ga0501034_0049354 | Ga0501034_0049354_2373_3098 | 241 |
| 919 | 3300049571 | Ga0501034_0054911 | Ga0501034_0054911_1438_2169 | 241 |
| 920 | 3300049571 | Ga0501034_0072216 | Ga0501034_0072216_1421_2146 | 241 |
| 921 | 3300049571 | Ga0501034_0243782 | Ga0501034_0243782_12_737 | 241 |
| 922 | 3300049572 | Ga0501036_0016093 | Ga0501036_0016093_5031_5756 | 241 |
| 923 | 3300049572 | Ga0501036_0021723 | Ga0501036_0021723_1395_2126 | 241 |
| 924 | 3300049572 | Ga0501036_0023329 | Ga0501036_0023329_2755_3483 | 241 |
| 925 | 3300049573 | Ga0501037_0002837 | Ga0501037_0002837_6862_7599 | 241 |
| 926 | 3300049573 | Ga0501037_0180397 | Ga0501037_0180397_277_1002 | 241 |
| 927 | 3300049573 | Ga0501037_0466051 | Ga0501037_0466051_29_754 | 241 |
| 928 | 3300049574 | Ga0501038_0000642 | Ga0501038_0000642_12648_13373 | 241 |
| 929 | 3300049574 | Ga0501038_0016192 | Ga0501038_0016192_1918_2643 | 241 |
| 930 | 3300049574 | Ga0501038_0018752 | Ga0501038_0018752_2717_3448 | 241 |
| 931 | 3300049574 | Ga0501038_0018834 | Ga0501038_0018834_322_1059 | 241 |
| 932 | 3300049574 | Ga0501038_0020044 | Ga0501038_0020044_3450_4175 | 241 |
| 933 | 3300049574 | Ga0501038_0034542 | Ga0501038_0034542_3096_3821 | 241 |
| 934 | 3300049574 | Ga0501038_0140967 | Ga0501038_0140967_1087_1815 | 241 |
| 935 | 3300049575 | Ga0501039_0021706 | Ga0501039_0021706_2519_3250 | 241 |
| 936 | 3300049575 | Ga0501039_0067064 | Ga0501039_0067064_1141_1866 | 241 |
| 937 | 3300049575 | Ga0501039_0086631 | Ga0501039_0086631_1687_2415 | 241 |
| 938 | 3300049575 | Ga0501039_0370043 | Ga0501039_0370043_371_1096 | 241 |
| 939 | 3300049576 | Ga0501040_0006289 | Ga0501040_0006289_1357_2094 | 241 |
| 940 | 3300049576 | Ga0501040_0077505 | Ga0501040_0077505_1245_1973 | 241 |
| 941 | 3300049577 | Ga0501041_0010790 | Ga0501041_0010790_1387_2124 | 241 |
| 942 | 3300049578 | Ga0501042_0142261 | Ga0501042_0142261_548_1285 | 241 |
| 943 | 3300049578 | Ga0501042_0195315 | Ga0501042_0195315_166_894 | 241 |
| 944 | 3300049579 | Ga0501043_0003942 | Ga0501043_0003942_1499_2227 | 241 |
| 945 | 3300049579 | Ga0501043_0012723 | Ga0501043_0012723_3883_4608 | 241 |
| 946 | 3300049579 | Ga0501043_0106646 | Ga0501043_0106646_986_1711 | 241 |
| 947 | 3300049579 | Ga0501043_0229700 | Ga0501043_0229700_333_1058 | 241 |
| 948 | 3300049579 | Ga0501043_0331670 | Ga0501043_0331670_295_1026 | 241 |
| 949 | 3300049580 | Ga0501046_0012735 | Ga0501046_0012735_1998_2723 | 241 |
| 950 | 3300049580 | Ga0501046_0262140 | Ga0501046_0262140_420_1157 | 241 |
| 951 | 3300049581 | Ga0501047_0000242 | Ga0501047_0000242_53451_54176 | 241 |
| 952 | 3300049581 | Ga0501047_0002545 | Ga0501047_0002545_9777_10514 | 241 |
| 953 | 3300049581 | Ga0501047_0020231 | Ga0501047_0020231_1650_2375 | 241 |
| 954 | 3300049581 | Ga0501047_0049204 | Ga0501047_0049204_2164_2889 | 241 |
| 955 | 3300049581 | Ga0501047_0056449 | Ga0501047_0056449_3020_3745 | 241 |
| 956 | 3300049581 | Ga0501047_0057352 | Ga0501047_0057352_407_1132 | 241 |
| 957 | 3300049581 | Ga0501047_0074002 | Ga0501047_0074002_288_1019 | 241 |
| 958 | 3300049581 | Ga0501047_0093311 | Ga0501047_0093311_429_1154 | 241 |
| 959 | 3300049582 | Ga0501048_0005662 | Ga0501048_0005662_5682_6419 | 241 |
| 960 | 3300049582 | Ga0501048_0011943 | Ga0501048_0011943_444_1169 | 241 |
| 961 | 3300049583 | Ga0501067_0042361 | Ga0501067_0042361_1329_2066 | 241 |
| 962 | 3300049584 | Ga0501068_0026861 | Ga0501068_0026861_417_1154 | 241 |
| 963 | 3300049584 | Ga0501068_0031024 | Ga0501068_0031024_625_1353 | 241 |
| 964 | 3300049584 | Ga0501068_0270715 | Ga0501068_0270715_288_1019 | 241 |
| 965 | 3300049585 | Ga0501069_0126207 | Ga0501069_0126207_180_908 | 241 |
| 966 | 3300049586 | Ga0501070_0005659 | Ga0501070_0005659_1181_1909 | 241 |
| 967 | 3300049586 | Ga0501070_0139438 | Ga0501070_0139438_1085_1810 | 241 |
| 968 | 3300049586 | Ga0501070_0360492 | Ga0501070_0360492_399_1124 | 241 |
| 969 | 3300049586 | Ga0501070_0556102 | Ga0501070_0556102_140_868 | 241 |
| 970 | 3300049587 | Ga0501071_0008875 | Ga0501071_0008875_5735_6472 | 241 |
| 971 | 3300049588 | Ga0501072_0003634 | Ga0501072_0003634_3555_4292 | 241 |
| 972 | 3300049588 | Ga0501072_0216488 | Ga0501072_0216488_753_1481 | 241 |
| 973 | 3300049589 | Ga0501073_0195845 | Ga0501073_0195845_113_850 | 241 |
| 974 | 3300049589 | Ga0501073_0398361 | Ga0501073_0398361_153_878 | 241 |
| 975 | 3300049590 | Ga0501074_0347747 | Ga0501074_0347747_11_739 | 241 |
| 976 | 3300049592 | Ga0501076_0002750 | Ga0501076_0002750_5967_6704 | 241 |
| 977 | 3300049593 | Ga0501077_0009068 | Ga0501077_0009068_4848_5585 | 241 |
| 978 | 3300049741 | Ga0501079_0011123 | Ga0501079_0011123_965_1693 | 241 |
| 979 | 3300049742 | Ga0501080_0029049 | Ga0501080_0029049_3740_4465 | 241 |
| 980 | 3300049742 | Ga0501080_0283111 | Ga0501080_0283111_315_1043 | 241 |
| 981 | 3300049743 | Ga0501081_0153760 | Ga0501081_0153760_338_1066 | 241 |
| 982 | 3300049744 | Ga0501083_0009247 | Ga0501083_0009247_5799_6536 | 241 |
| 983 | 3300049822 | Ga0501035_0008203 | Ga0501035_0008203_5791_6528 | 241 |
| 984 | 3300049822 | Ga0501035_0016971 | Ga0501035_0016971_4017_4742 | 241 |
| 985 | 3300049822 | Ga0501035_0017639 | Ga0501035_0017639_5290_6015 | 241 |
| 986 | 3300049822 | Ga0501035_0047883 | Ga0501035_0047883_2657_3382 | 241 |
| 987 | 3300049822 | Ga0501035_0071919 | Ga0501035_0071919_1411_2142 | 241 |
| 988 | 3300049822 | Ga0501035_0092344 | Ga0501035_0092344_816_1544 | 241 |
| 989 | 3300049822 | Ga0501035_0126030 | Ga0501035_0126030_484_1209 | 241 |
| 990 | 3300049823 | Ga0501044_0005221 | Ga0501044_0005221_9974_10699 | 241 |
| 991 | 3300049823 | Ga0501044_0006363 | Ga0501044_0006363_4563_5288 | 241 |
| 992 | 3300049823 | Ga0501044_0013651 | Ga0501044_0013651_6862_7599 | 241 |
| 993 | 3300049823 | Ga0501044_0016458 | Ga0501044_0016458_6710_7435 | 241 |
| 994 | 3300049823 | Ga0501044_0057165 | Ga0501044_0057165_2825_3550 | 241 |
| 995 | 3300049824 | Ga0501045_0056529 | Ga0501045_0056529_1089_1814 | 241 |
| 996 | 3300049824 | Ga0501045_0072361 | Ga0501045_0072361_1312_2049 | 241 |
| 997 | 3300049824 | Ga0501045_0088426 | Ga0501045_0088426_709_1437 | 241 |
| 998 | 3300049824 | Ga0501045_0190144 | Ga0501045_0190144_679_1410 | 241 |
| 999 | 3300050490 | nmdc:mga03n38_33572_c1 | nmdc:mga03n38_33572_c1_984_1712 | 241 |
| 1000 | 3300050495 | nmdc:mga04h51_14526_c1 | nmdc:mga04h51_14526_c1_642_1367 | 241 |
| 1001 | 3300050496 | nmdc:mga07m45_30018_c3 | nmdc:mga07m45_30018_c3_1262_1990 | 241 |
| 1002 | 3300053078 | Ga0495612_0019542 | Ga0495612_0019542_328_1056 | 241 |
| 1003 | 3300053078 | Ga0495612_0035189 | Ga0495612_0035189_1259_1996 | 241 |
| 1004 | 3300053085 | Ga0495619_0034364 | Ga0495619_0034364_1391_2119 | 241 |
| 1005 | 3300053085 | Ga0495619_0143557 | Ga0495619_0143557_19_756 | 241 |
| 1006 | 3300053088 | Ga0500644_0043545 | Ga0500644_0043545_692_1420 | 241 |
| 1007 | 3300053093 | Ga0500651_0233972 | Ga0500651_0233972_89_820 | 241 |
| 1008 | 3300053094 | Ga0500566_0017617 | Ga0500566_0017617_540_1271 | 241 |
| 1009 | 3300053095 | Ga0500640_014535 | Ga0500640_014535_1205_1933 | 241 |
| 1010 | 3300053107 | Ga0500560_014684 | Ga0500560_014684_395_1126 | 241 |
| 1011 | 3300053109 | Ga0500569_001652 | Ga0500569_001652_725_1456 | 241 |
| 1012 | 3300053131 | Ga0500652_001263 | Ga0500652_001263_2751_3482 | 241 |
| 1013 | 3300053137 | Ga0500561_0000299 | Ga0500561_0000299_6964_7695 | 241 |
| 1014 | 3300053140 | Ga0500573_0075010 | Ga0500573_0075010_16_744 | 241 |
| 1015 | 3300053142 | Ga0500577_0067301 | Ga0500577_0067301_65_796 | 241 |
| 1016 | 3300053146 | Ga0500588_0029040 | Ga0500588_0029040_488_1219 | 241 |
| 1017 | 3300053149 | Ga0500600_0009099 | Ga0500600_0009099_1841_2572 | 241 |
| 1018 | 3300053149 | Ga0500600_0093442 | Ga0500600_0093442_213_938 | 241 |
| 1019 | 3300053153 | Ga0500616_0009856 | Ga0500616_0009856_2508_3239 | 241 |
| 1020 | 3300053157 | Ga0500624_002698 | Ga0500624_002698_671_1399 | 241 |
| 1021 | 3300053160 | Ga0500633_0000386 | Ga0500633_0000386_3360_4091 | 241 |
| 1022 | 3300053161 | Ga0500634_0000473 | Ga0500634_0000473_5139_5870 | 241 |
| 1023 | 3300053732 | Ga0500656_000142 | Ga0500656_000142_1245_1976 | 241 |
| 1024 | 3300053739 | Ga0500587_000104 | Ga0500587_000104_301_1032 | 241 |
| 1025 | 3300054114 | Ga0501084_0040371 | Ga0501084_0040371_1044_1781 | 241 |
| 1026 | 3300054114 | Ga0501084_0144427 | Ga0501084_0144427_724_1452 | 241 |
| 1027 | 3300054114 | Ga0501084_0329255 | Ga0501084_0329255_254_979 | 241 |
| 1028 | 3300060353 | Ga0501082_0030518 | Ga0501082_0030518_3554_4291 | 241 |
| 1029 | 3300060353 | Ga0501082_0151126 | Ga0501082_0151126_719_1447 | 241 |
| 1030 | 3300061719 | Ga0466962_0000264 | Ga0466962_0000264_8372_9100 | 241 |
| 1031 | 3300061719 | Ga0466962_0003662 | Ga0466962_0003662_4488_5231 | 241 |
| 1032 | 3300061719 | Ga0466962_0024435 | Ga0466962_0024435_1196_1936 | 241 |
| 1033 | 3300061734 | Ga0530510_0009623 | Ga0530510_0009623_5839_6576 | 241 |
| 1034 | 3300061734 | Ga0530510_0263182 | Ga0530510_0263182_271_999 | 241 |
| 1035 | iso_pu_bacteria | 2862281513 | 2862288759 | 241 |
| 1036 | iso_pu_bacteria | 2862705112 | 2862707759 | 241 |
| 1037 | iso_pu_bacteria | 2867369537 | 2867370564 | 241 |
| 1038 | iso_pu_bacteria | 2877676314 | 2877682699 | 241 |
| 1039 | iso_pu_bacteria | 2912757875 | 2912759442 | 241 |
| 1040 | iso_pu_bacteria | 2990044586 | 2990049353 | 241 |
| 1041 | iso_pu_bacteria | 3006486233 | 3006488000 | 241 |
| 1042 | iso_pu_bacteria | 8025524527 | 8025528842 | 241 |
| 1043 | iso_pu_bacteria | 8025530807 | 8025535444 | 241 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4u28-assembly1.cif.gz_A | crystal structure of apo phosphoribosyl isomerase a from streptomyces sviceus atcc 29083 | 0.9964 | 2 | 241 |
| 4w9t-assembly1.cif.gz_A | crystal structure of hisap from streptomyces sp. mg1 | 0.9958 | 3 | 241 |
| 4u28-assembly1.cif.gz_A | crystal structure of apo phosphoribosyl isomerase a from streptomyces sviceus atcc 29083 | 0.9922 | 2 | 241 |
| 4x2r-assembly1.cif.gz_A | crystal structure of pria from actinomyces urogenitalis | 0.9888 | 2 | 241 |
| 4tx9-assembly1.cif.gz_A | crystal structure of hisap from streptomyces sviceus with degraded profar | 0.9877 | 1 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x2rA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9889 | 2 | 241 | 3.20.20.70 |
| 4x2rA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9606 | 2 | 241 | 3.20.20.70 |
| af_P10371_1_245_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9453 | 6 | 240 | 3.20.20.70 |
| af_Q58927_1_237_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9421 | 4 | 241 | 3.20.20.70 |
| af_Q58927_1_237_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9383 | 4 | 241 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J7TZ86-F1-model_v4 | Unannotated protein | 0.9992 | 128 | 239 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A6I2XYG1-F1-model_v4 | Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) | 0.999 | 115 | 239 |
GO:0000105
GO:0000162 GO:0003949 GO:0004640 GO:0005737 |
| AF-A0A132MPP7-F1-model_v4 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) | 0.9989 | 22 | 239 |
GO:0000105
GO:0000162 GO:0003949 GO:0004640 GO:0005737 |
| AF-A0A6G3XFK6-F1-model_v4 | Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) | 0.998 | 1 | 122 |
GO:0000105
GO:0000162 GO:0003949 GO:0004640 GO:0005737 |
| AF-A0A6N9YAZ4-F1-model_v4 | deleted | 0.9969 | 74 | 239 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar