F488856

General Info

Members Datasets Scaffolds Average Seq Length
1042 465 1031 144

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100205972|Ga0070708_1002059723
Length 147
Sequence MLALASLLAGLVFGLGLIVSGMANPAKVLGFLDLAGPWDPSLIFVMAGAIAIGLVAFRLATKRIVSLLGAPMRLPQNHRRIDRRLVVGSTLFGLGWGIAGFCPGPGLVALGMGEVKAAVFVLAMLAGMGLFELLEHRHRAVPRGAPT

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
3 2643221672 Variovorax sp. Root434 Isolate Unclassified
4 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
5 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
6 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
7 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
8 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
9 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
10 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
11 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
12 2928070936 Variovorax gossypii 1167 Isolate Unclassified
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
16 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
17 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
18 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
25 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
26 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
27 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
28 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
29 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
30 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
34 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
35 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
38 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
44 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
47 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
65 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
68 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
69 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
70 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
77 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
103 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
104 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
115 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
142 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
146 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
147 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
148 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
149 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
151 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
152 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
153 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
161 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
163 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
164 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
165 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
168 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
169 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
173 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
178 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
230 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
231 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
236 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
237 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
238 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
239 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
240 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
241 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
242 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
243 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
244 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
245 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
246 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
247 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
248 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
249 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
250 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
251 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
252 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
253 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
254 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
255 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
256 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
257 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
258 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
259 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
260 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
261 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
262 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
263 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
266 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
273 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
274 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
275 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
276 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
277 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
278 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
279 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
280 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
281 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
282 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
283 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
284 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
285 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
286 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
287 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
288 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
289 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
290 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
291 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
292 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
293 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
294 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
295 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
296 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
297 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
298 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
301 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
302 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
303 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
304 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
305 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
306 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
307 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
308 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
309 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
310 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
311 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
312 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
313 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
314 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
315 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
316 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
317 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
318 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
319 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
320 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
321 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
322 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
323 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
324 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
325 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
326 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
327 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
328 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
329 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
330 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
331 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
332 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
333 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
334 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
335 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
336 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
337 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
338 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
339 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
340 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
341 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
342 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
343 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
344 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
345 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
346 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
347 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
348 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
349 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
350 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
351 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
352 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
353 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
354 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
355 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
356 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
357 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
358 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
359 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
360 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
361 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
362 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
363 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
364 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
365 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
366 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
367 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
368 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
369 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
370 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
371 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
372 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
373 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
374 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
375 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
376 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
377 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
378 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
379 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
380 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
381 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
382 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
383 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
384 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
385 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
386 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
387 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
388 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
389 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
390 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
391 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
392 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
393 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
394 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
395 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
396 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
397 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
398 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
399 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
400 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
401 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
402 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
403 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
404 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
405 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
406 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
407 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
408 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
409 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
410 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
411 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
412 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
413 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
414 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
424 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
425 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
426 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
427 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
428 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
429 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
430 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
431 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
432 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
434 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
435 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
436 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
437 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
438 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
439 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
440 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
441 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
442 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
443 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
444 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
445 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
446 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
447 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
448 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
449 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
450 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
451 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
452 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
453 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
454 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
455 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
456 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
457 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
458 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
459 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
460 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
461 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
462 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
463 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
464 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
465 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0.1
Isolates 1.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.98
Nodule 0.38
Rhizoplane 4.32
Rhizosphere 66.6
Stem 0
Stem Tuber 0
Unclassified 6.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10772937 2162886012 Bacteria 1017
2 JGI24740J21852_10003426 3300001979 Bacteria 6977
3 JGI24740J21852_10003590 3300001979 Bacteria 6768
4 JGI24740J21852_10016258 3300001979 Bacteria 2693
5 JGI24737J22298_10058755 3300001990 Bacteria 1159
6 JGI25156J39149_1000502 3300002705 Bacteria 22909
7 JGI25156J39149_1038461 3300002705 Bacteria 672
8 JGI25164J39214_1016866 3300002772 Bacteria 663
9 JGI25150J39212_1001373 3300002774 Bacteria 6902
10 JGI25150J39212_1007267 3300002774 Bacteria 2233
11 JGI25150J39212_1007812 3300002774 Bacteria 2128
12 JGI25159J45721_1000359 3300002987 Bacteria 21140
13 JGI25159J45721_1002098 3300002987 Bacteria 7823
14 JGI25159J45721_1004099 3300002987 Bacteria 4942
15 JGI25151J46595_10002668 3300003187 Bacteria 10460
16 JGI25151J46595_10006726 3300003187 Bacteria 5728
17 JGI25151J46595_10041741 3300003187 Bacteria 1662
18 JGI25153J46596_10105088 3300003215 Bacteria 657
19 rootH2_10003443 3300003320 Bacteria 7577
20 rootH2_10141630 3300003320 Bacteria 1883
21 rootL2_10093470 3300003322 Bacteria 9372
22 rootL2_10233829 3300003322 Bacteria 1390
23 JGI25160J50197_1000158 3300003354 Bacteria 58363
24 JGI25160J50197_1030441 3300003354 Bacteria 1407
25 JGI25161J50226_1000040 3300003374 Bacteria 124804
26 Ga0055538_1008028 3300003751 Bacteria 920
27 Ga0055538_1009501 3300003751 Bacteria 787
28 Ga0055539_1000051 3300003752 Bacteria 175048
29 Ga0055539_1014377 3300003752 Bacteria 966
30 Ga0055533_1000025 3300003756 Bacteria 332208
31 Ga0055533_1000351 3300003756 Bacteria 19929
32 Ga0055533_1000485 3300003756 Bacteria 14729
33 Ga0055533_1001339 3300003756 Bacteria 6673
34 Ga0055533_1003923 3300003756 Bacteria 2822
35 Ga0055532_1000006 3300003758 Bacteria 451244
36 Ga0055525_1001177 3300003759 Bacteria 5983
37 Ga0055525_1007688 3300003759 Bacteria 910
38 Ga0055527_1000395 3300003760 Bacteria 18668
39 Ga0055527_1003663 3300003760 Bacteria 2230
40 Ga0055535_1000004 3300003761 Bacteria 451244
41 Ga0055535_1000115 3300003761 Bacteria 86313
42 Ga0055535_1000290 3300003761 Bacteria 52572
43 Ga0055535_1009426 3300003761 Bacteria 1684
44 Ga0055542_1000028 3300003762 Bacteria 251458
45 Ga0055542_1001366 3300003762 Bacteria 12491
46 Ga0055529_1000022 3300003763 Bacteria 320108
47 Ga0055529_1000158 3300003763 Bacteria 93023
48 Ga0055529_1001082 3300003763 Bacteria 12469
49 Ga0055526_1001296 3300003771 Bacteria 17937
50 Ga0055526_1050947 3300003771 Bacteria 945
51 Ga0055537_1000257 3300003773 Bacteria 38816
52 Ga0055537_1004524 3300003773 Bacteria 3962
53 Ga0055524_1000010 3300003775 Bacteria 282893
54 Ga0055524_1000077 3300003775 Bacteria 121584
55 Ga0055536_1000286 3300003781 Bacteria 38408
56 Ga0055536_1000891 3300003781 Bacteria 19442
57 Ga0055536_1001365 3300003781 Bacteria 14843
58 Ga0055534_1004892 3300003784 Bacteria 3748
59 Ga0055528_1002253 3300003790 Bacteria 10499
60 Ga0055530_10000354 3300003791 Bacteria 41444
61 Ga0055530_10003781 3300003791 Bacteria 8345
62 Ga0055530_10019470 3300003791 Bacteria 2055
63 Ga0055540_1000010 3300003792 Bacteria 290865
64 Ga0055540_1000260 3300003792 Bacteria 47714
65 Ga0055540_1001142 3300003792 Bacteria 16576
66 Ga0055540_1001176 3300003792 Bacteria 16190
67 Ga0055540_1037262 3300003792 Bacteria 1073
68 Ga0055531_10000298 3300003794 Bacteria 49437
69 Ga0055531_10000405 3300003794 Bacteria 41493
70 Ga0055531_10000572 3300003794 Bacteria 32155
71 Ga0055531_10006230 3300003794 Bacteria 6813
72 Ga0055541_1002678 3300003841 Bacteria 3489
73 Ga0055543_1000167 3300004625 Bacteria 54995
74 Ga0065165_1001298 3300005262 Bacteria 28029
75 Ga0065165_1003807 3300005262 Bacteria 10071
76 Ga0065165_1019460 3300005262 Bacteria 2422
77 Ga0065165_1020123 3300005262 Bacteria 2361
78 Ga0065712_10511677 3300005290 Unclassified 642
79 Ga0065715_10290991 3300005293 Bacteria 1022
80 Ga0070658_10017253 3300005327 Bacteria 5777
81 Ga0070658_11054427 3300005327 Bacteria 707
82 Ga0070676_10001033 3300005328 Bacteria 13852
83 Ga0070676_10123841 3300005328 Bacteria 1626
84 Ga0070690_100078515 3300005330 Bacteria 2157
85 Ga0070690_100312796 3300005330 Bacteria 1129
86 Ga0070670_100029119 3300005331 Bacteria 4752
87 Ga0070670_100093258 3300005331 Bacteria 2590
88 Ga0070670_100098633 3300005331 Bacteria 2514
89 Ga0070670_100491248 3300005331 Bacteria 1091
90 Ga0070670_101493928 3300005331 Bacteria 620
91 Ga0070677_10003807 3300005333 Bacteria 4888
92 Ga0070677_10044804 3300005333 Bacteria 1762
93 Ga0070677_10108813 3300005333 Unclassified 1234
94 Ga0070677_10515308 3300005333 Bacteria 650
95 Ga0068869_100007313 3300005334 Bacteria 7042
96 Ga0068869_100028125 3300005334 Bacteria 3925
97 Ga0070666_10002326 3300005335 Bacteria 11482
98 Ga0070666_10027614 3300005335 Bacteria 3718
99 Ga0070666_10421891 3300005335 Bacteria 961
100 Ga0070666_10472188 3300005335 Bacteria 907
101 Ga0068868_100000189 3300005338 Bacteria 41014
102 Ga0068868_100020803 3300005338 Bacteria 4937
103 Ga0070660_100515292 3300005339 Bacteria 996
104 Ga0070660_100653151 3300005339 Bacteria 881
105 Ga0070660_101436403 3300005339 Bacteria 586
106 Ga0070689_100033986 3300005340 Bacteria 3889
107 Ga0070687_100478154 3300005343 Bacteria 834
108 Ga0070668_100027232 3300005347 Bacteria 4339
109 Ga0070669_100006752 3300005353 Bacteria 8261
110 Ga0070675_100001259 3300005354 Bacteria 18526
111 Ga0070675_100254930 3300005354 Bacteria 1536
112 Ga0070675_100858205 3300005354 Bacteria 831
113 Ga0070671_100013764 3300005355 Bacteria 6526
114 Ga0070671_100102939 3300005355 Bacteria 2395
115 Ga0070671_100104819 3300005355 Bacteria 2373
116 Ga0070671_100192151 3300005355 Bacteria 1730
117 Ga0070671_100203065 3300005355 Bacteria 1681
118 Ga0070674_100016852 3300005356 Bacteria 4584
119 Ga0070674_100034350 3300005356 Bacteria 3386
120 Ga0070674_100572428 3300005356 Bacteria 951
121 Ga0070673_100001117 3300005364 Bacteria 15388
122 Ga0070673_100084300 3300005364 Bacteria 2584
123 Ga0070673_100141898 3300005364 Bacteria 2027
124 Ga0070673_100169779 3300005364 Bacteria 1861
125 Ga0070673_100226328 3300005364 Bacteria 1621
126 Ga0070688_100013717 3300005365 Bacteria 4578
127 Ga0070688_100027498 3300005365 Bacteria 3389
128 Ga0070688_101135734 3300005365 Bacteria 626
129 Ga0070659_100001408 3300005366 Bacteria 17342
130 Ga0070659_100776201 3300005366 Bacteria 832
131 Ga0070667_100001328 3300005367 Bacteria 22207
132 Ga0070667_100002155 3300005367 Bacteria 17343
133 Ga0070667_100006773 3300005367 Bacteria 9515
134 Ga0070667_100072464 3300005367 Bacteria 2936
135 Ga0070667_100445959 3300005367 Bacteria 1182
136 Ga0070667_101141698 3300005367 Bacteria 729
137 Ga0070714_101043241 3300005435 Bacteria 796
138 Ga0070713_100000264 3300005436 Bacteria 34426
139 Ga0070708_100205972 3300005445 Bacteria 1843
140 Ga0070663_100055204 3300005455 Bacteria 2842
141 Ga0070663_101217542 3300005455 Bacteria 662
142 Ga0070678_100001423 3300005456 Bacteria 12741
143 Ga0070678_100001606 3300005456 Bacteria 12113
144 Ga0070662_100087642 3300005457 Bacteria 2331
145 Ga0070662_100201340 3300005457 Bacteria 1580
146 Ga0070662_100371986 3300005457 Bacteria 1175
147 Ga0070662_100730145 3300005457 Bacteria 839
148 Ga0068867_100002318 3300005459 Bacteria 13391
149 Ga0068867_100027885 3300005459 Bacteria 4063
150 Ga0070685_10036741 3300005466 Bacteria 2770
151 Ga0070685_10253005 3300005466 Bacteria 1168
152 Ga0070706_100926971 3300005467 Bacteria 804
153 Ga0070684_100962261 3300005535 Bacteria 801
154 Ga0068853_100076209 3300005539 Bacteria 2928
155 Ga0068853_100227595 3300005539 Bacteria 1705
156 Ga0068853_100272569 3300005539 Bacteria 1559
157 Ga0068853_100288225 3300005539 Bacteria 1515
158 Ga0068853_101068004 3300005539 Unclassified 778
159 Ga0070672_100001588 3300005543 Bacteria 14096
160 Ga0070672_100072840 3300005543 Bacteria 2736
161 Ga0070672_100117953 3300005543 Bacteria 2170
162 Ga0070665_100005741 3300005548 Bacteria 12741
163 Ga0070665_100244733 3300005548 Bacteria 1794
164 Ga0068855_100110533 3300005563 Bacteria 3155
165 Ga0068855_100346254 3300005563 Bacteria 1638
166 Ga0070664_100979455 3300005564 Bacteria 794
167 Ga0068857_100075627 3300005577 Bacteria 3002
168 Ga0068854_100000020 3300005578 Bacteria 132163
169 Ga0068854_100068921 3300005578 Bacteria 2581
170 Ga0068852_100043480 3300005616 Bacteria 3811
171 Ga0068852_100176013 3300005616 Bacteria 2009
172 Ga0068852_100832953 3300005616 Bacteria 938
173 Ga0068859_100074764 3300005617 Bacteria 3427
174 Ga0068859_100443722 3300005617 Bacteria 1394
175 Ga0068859_100577050 3300005617 Bacteria 1218
176 Ga0068859_101022405 3300005617 Bacteria 908
177 Ga0068864_100002258 3300005618 Bacteria 15938
178 Ga0068864_100003331 3300005618 Bacteria 13278
179 Ga0068864_100175589 3300005618 Bacteria 1955
180 Ga0068866_10063013 3300005718 Bacteria 1931
181 Ga0068861_100035407 3300005719 Bacteria 3698
182 Ga0068851_10178112 3300005834 Bacteria 1176
183 Ga0068870_10103237 3300005840 Bacteria 1615
184 Ga0068863_100032861 3300005841 Bacteria 4943
185 Ga0068863_100035873 3300005841 Bacteria 4722
186 Ga0068863_100119757 3300005841 Bacteria 2509
187 Ga0068863_100189691 3300005841 Bacteria 1975
188 Ga0068863_100539022 3300005841 Bacteria 1151
189 Ga0068858_100002532 3300005842 Bacteria 18418
190 Ga0068858_100058081 3300005842 Bacteria 3577
191 Ga0068858_100228714 3300005842 Bacteria 1763
192 Ga0068858_101240558 3300005842 Bacteria 733
193 Ga0068860_100004123 3300005843 Bacteria 14893
194 Ga0068860_100116600 3300005843 Bacteria 2555
195 Ga0068860_100157401 3300005843 Bacteria 2190
196 Ga0068862_100035495 3300005844 Bacteria 4223
197 Ga0075365_10197629 3300006038 Bacteria 1408
198 Ga0075368_10001280 3300006042 Bacteria 7963
199 Ga0075363_100007512 3300006048 Bacteria 5018
200 Ga0075363_100126416 3300006048 Bacteria 1432
201 Ga0075363_100387195 3300006048 Bacteria 820
202 Ga0075364_10019614 3300006051 Bacteria 4244
203 Ga0075364_10151141 3300006051 Bacteria 1565
204 Ga0075432_10059985 3300006058 Bacteria 1353
205 Ga0070712_100178463 3300006175 Bacteria 1653
206 Ga0075362_10007618 3300006177 Bacteria 4112
207 Ga0075362_10023506 3300006177 Bacteria 2607
208 Ga0075362_10053876 3300006177 Bacteria 1807
209 Ga0075362_10075856 3300006177 Bacteria 1542
210 Ga0075367_10007127 3300006178 Bacteria 5702
211 Ga0075367_10015498 3300006178 Bacteria 4146
212 Ga0075369_10091665 3300006186 Bacteria 1357
213 Ga0075366_10014741 3300006195 Bacteria 4470
214 Ga0075366_10016319 3300006195 Bacteria 4268
215 Ga0075366_10046227 3300006195 Bacteria 2579
216 Ga0075366_10046561 3300006195 Bacteria 2570
217 Ga0075366_10181799 3300006195 Bacteria 1277
218 Ga0075366_10285626 3300006195 Bacteria 1009
219 Ga0075366_10288409 3300006195 Bacteria 1004
220 Ga0097621_100001145 3300006237 Bacteria 18426
221 Ga0097621_100236833 3300006237 Bacteria 1595
222 Ga0097621_100311606 3300006237 Bacteria 1392
223 Ga0075370_10000134 3300006353 Bacteria 24952
224 Ga0075370_10000147 3300006353 Bacteria 24004
225 Ga0075370_10000900 3300006353 Bacteria 12177
226 Ga0075370_10150516 3300006353 Bacteria 1364
227 Ga0075370_10169946 3300006353 Bacteria 1281
228 Ga0075370_10244660 3300006353 Bacteria 1062
229 Ga0068871_100009980 3300006358 Bacteria 6901
230 Ga0068871_100024161 3300006358 Bacteria 4709
231 Ga0068871_100041999 3300006358 Bacteria 3669
232 Ga0068871_100378027 3300006358 Bacteria 1258
233 Ga0068871_101577400 3300006358 Bacteria 621
234 Ga0068871_101874436 3300006358 Bacteria 570
235 Ga0075430_100184105 3300006846 Bacteria 1737
236 Ga0075429_100154417 3300006880 Bacteria 2010
237 Ga0068865_100005004 3300006881 Bacteria 8014
238 Ga0068865_100260352 3300006881 Bacteria 1373
239 Ga0075436_100049187 3300006914 Bacteria 2909
240 Ga0097620_100074767 3300006931 Bacteria 3427
241 Ga0097620_100443742 3300006931 Bacteria 1394
242 Ga0097620_100577108 3300006931 Bacteria 1218
243 Ga0097620_100996988 3300006931 Bacteria 920
244 Ga0097620_101022410 3300006931 Bacteria 908
245 Ga0079104_1037099 3300006946 Bacteria 1164
246 Ga0099826_10000002 3300006948 Bacteria 1125830
247 Ga0099826_10264683 3300006948 Bacteria 898
248 Ga0075435_100355911 3300007076 Bacteria 1255
249 Ga0075435_100558647 3300007076 Bacteria 992
250 Ga0105244_10005002 3300009036 Bacteria 8936
251 Ga0105244_10009242 3300009036 Bacteria 6077
252 Ga0105240_10125209 3300009093 Bacteria 3089
253 Ga0111539_10018854 3300009094 Bacteria 8537
254 Ga0111539_10855462 3300009094 Bacteria 1058
255 Ga0105245_10233506 3300009098 Bacteria 1780
256 Ga0105245_11159294 3300009098 Bacteria 820
257 Ga0114129_10771089 3300009147 Bacteria 1229
258 Ga0105243_10913420 3300009148 Bacteria 874
259 Ga0105241_10060994 3300009174 Bacteria 2903
260 Ga0105242_10002379 3300009176 Bacteria 14834
261 Ga0105242_10185050 3300009176 Bacteria 1840
262 Ga0105242_11446107 3300009176 Bacteria 716
263 Ga0105248_10018960 3300009177 Bacteria 7606
264 Ga0105248_10044730 3300009177 Bacteria 4965
265 Ga0105248_10134284 3300009177 Bacteria 2792
266 Ga0105248_10755082 3300009177 Bacteria 1098
267 Ga0105248_11252211 3300009177 Bacteria 839
268 Ga0105248_11281778 3300009177 Bacteria 829
269 Ga0105248_11941450 3300009177 Bacteria 668
270 Ga0105237_10035515 3300009545 Bacteria 5044
271 Ga0105237_10858644 3300009545 Bacteria 914
272 Ga0105238_12197462 3300009551 Bacteria 586
273 Ga0105249_10260392 3300009553 Bacteria 1723
274 Ga0105249_12041242 3300009553 Unclassified 646
275 Ga0105239_10102223 3300010375 Bacteria 3172
276 Ga0105246_10064976 3300011119 Bacteria 2551
277 Ga0157371_10004426 3300013102 Bacteria 12266
278 Ga0157371_10176109 3300013102 Bacteria 1529
279 Ga0157370_10775583 3300013104 Bacteria 873
280 Ga0157369_10013411 3300013105 Bacteria 9266
281 Ga0157369_10374460 3300013105 Bacteria 1478
282 Ga0157369_11479001 3300013105 Bacteria 691
283 Ga0157374_10001025 3300013296 Bacteria 24286
284 Ga0157374_10031619 3300013296 Bacteria 4813
285 Ga0157374_10675739 3300013296 Bacteria 1045
286 Ga0157374_11935147 3300013296 Bacteria 616
287 Ga0157378_10241003 3300013297 Bacteria 1727
288 Ga0157378_10533140 3300013297 Bacteria 1177
289 Ga0163162_10007526 3300013306 Bacteria 10605
290 Ga0163162_10063034 3300013306 Bacteria 3749
291 Ga0163162_10076553 3300013306 Bacteria 3408
292 Ga0163162_10363558 3300013306 Bacteria 1580
293 Ga0157372_10037972 3300013307 Bacteria 5315
294 Ga0157375_10013201 3300013308 Bacteria 7344
295 Ga0157375_10391485 3300013308 Bacteria 1556
296 Ga0157375_11489158 3300013308 Bacteria 799
297 Ga0157375_11503549 3300013308 Bacteria 795
298 Ga0163163_10027737 3300014325 Bacteria 5429
299 Ga0157380_10655846 3300014326 Bacteria 1048
300 Ga0182008_10004423 3300014497 Bacteria 8220
301 Ga0182008_10065925 3300014497 Bacteria 1781
302 Ga0157377_10038437 3300014745 Bacteria 2642
303 Ga0157379_10002348 3300014968 Bacteria 15791
304 Ga0157379_10025884 3300014968 Bacteria 5217
305 Ga0157379_10043701 3300014968 Bacteria 4000
306 Ga0157376_10034752 3300014969 Bacteria 4073
307 Ga0157376_10092527 3300014969 Bacteria 2622
308 Ga0157376_10093359 3300014969 Bacteria 2612
309 Ga0157376_10246816 3300014969 Bacteria 1666
310 Ga0157376_10272567 3300014969 Bacteria 1590
311 Ga0157376_10488341 3300014969 Bacteria 1208
312 Ga0182006_1000525 3300015261 Bacteria 29114
313 Ga0182006_1011283 3300015261 Bacteria 3938
314 Ga0182007_10001013 3300015262 Bacteria 15397
315 Ga0182007_10003999 3300015262 Bacteria 6801
316 Ga0182007_10011585 3300015262 Bacteria 3428
317 Ga0183362_10012 3300015683 Bacteria 49008
318 Ga0163161_10233239 3300017792 Bacteria 1429
319 Ga0163161_10265900 3300017792 Unclassified 1341
320 Ga0163161_10307694 3300017792 Bacteria 1249
321 Ga0163161_10453474 3300017792 Bacteria 1037
322 Ga0163161_10633617 3300017792 Bacteria 884
323 Ga0206351_10377922 3300020077 Bacteria 1723
324 Ga0213872_10000384 3300021361 Bacteria 37007
325 Ga0213872_10004425 3300021361 Bacteria 7463
326 Ga0213872_10074690 3300021361 Bacteria 1526
327 Ga0213872_10077022 3300021361 Bacteria 1499
328 Ga0213872_10289453 3300021361 Bacteria 682
329 Ga0209435_107774 3300025206 Bacteria 1183
330 Ga0209436_100323 3300025208 Bacteria 21856
331 Ga0209436_100621 3300025208 Bacteria 15167
332 Ga0209784_100581 3300025224 Bacteria 12361
333 Ga0209784_104690 3300025224 Bacteria 945
334 Ga0209566_100409 3300025225 Bacteria 34025
335 Ga0209674_100007 3300025226 Bacteria 1077082
336 Ga0209674_100048 3300025226 Bacteria 353032
337 Ga0209674_100167 3300025226 Bacteria 84961
338 Ga0209674_100228 3300025226 Bacteria 50307
339 Ga0209674_103466 3300025226 Bacteria 2888
340 Ga0209672_100111 3300025228 Bacteria 94440
341 Ga0209672_102138 3300025228 Bacteria 5254
342 Ga0209147_100015 3300025229 Bacteria 565073
343 Ga0209147_100878 3300025229 Bacteria 13846
344 Ga0209563_100052 3300025230 Bacteria 334307
345 Ga0207427_104073 3300025231 Bacteria 2641
346 Ga0209437_100072 3300025233 Bacteria 305152
347 Ga0209258_100021 3300025242 Bacteria 565073
348 Ga0209258_100067 3300025242 Bacteria 287603
349 Ga0209258_100110 3300025242 Bacteria 201322
350 Ga0209258_100789 3300025242 Bacteria 19058
351 Ga0207425_1000128 3300025245 Bacteria 71502
352 Ga0207425_1000171 3300025245 Bacteria 53565
353 Ga0207425_1001472 3300025245 Bacteria 9805
354 Ga0209646_1000055 3300025246 Bacteria 271793
355 Ga0209026_1000790 3300025250 Bacteria 17331
356 Ga0209677_100015 3300025253 Bacteria 532137
357 Ga0209677_102961 3300025253 Bacteria 5917
358 Ga0209148_1000067 3300025254 Bacteria 338678
359 Ga0209148_1000109 3300025254 Bacteria 204266
360 Ga0209148_1003318 3300025254 Bacteria 4540
361 Ga0209148_1005633 3300025254 Bacteria 2839
362 Ga0209759_1000002 3300025256 Bacteria 1027596
363 Ga0209759_1000032 3300025256 Bacteria 278697
364 Ga0209759_1000096 3300025256 Bacteria 157803
365 Ga0209759_1001112 3300025256 Bacteria 17352
366 Ga0209759_1001420 3300025256 Bacteria 13646
367 Ga0209759_1001795 3300025256 Bacteria 10872
368 Ga0209759_1004056 3300025256 Bacteria 5605
369 Ga0209759_1006504 3300025256 Bacteria 3916
370 Ga0209759_1020780 3300025256 Bacteria 1512
371 Ga0209129_1007442 3300025258 Bacteria 3260
372 Ga0209565_1000036 3300025263 Bacteria 293334
373 Ga0209565_1000655 3300025263 Bacteria 22236
374 Ga0209565_1000793 3300025263 Bacteria 18252
375 Ga0209565_1010299 3300025263 Bacteria 2324
376 Ga0209565_1061857 3300025263 Bacteria 648
377 Ga0209455_1000028 3300025272 Bacteria 565073
378 Ga0209455_1000044 3300025272 Bacteria 410787
379 Ga0209455_1000104 3300025272 Bacteria 201321
380 Ga0209673_1000008 3300025273 Bacteria 626013
381 Ga0209673_1041743 3300025273 Bacteria 1298
382 Ga0209130_1000042 3300025284 Bacteria 257581
383 Ga0209130_1000622 3300025284 Bacteria 33932
384 Ga0209130_1001507 3300025284 Bacteria 15032
385 Ga0209130_1003777 3300025284 Bacteria 6168
386 Ga0209675_1000106 3300025291 Bacteria 120459
387 Ga0209675_1000969 3300025291 Bacteria 18144
388 Ga0209675_1001478 3300025291 Bacteria 13505
389 Ga0209676_1000007 3300025292 Bacteria 1029371
390 Ga0209676_1000385 3300025292 Bacteria 81044
391 Ga0209676_1000838 3300025292 Bacteria 39842
392 Ga0209676_1000873 3300025292 Bacteria 38608
393 Ga0209676_1012742 3300025292 Bacteria 3275
394 Ga0209025_1001118 3300025294 Bacteria 38440
395 Ga0209025_1002157 3300025294 Bacteria 21934
396 Ga0209025_1002304 3300025294 Bacteria 20701
397 Ga0209025_1003224 3300025294 Bacteria 15791
398 Ga0209025_1003856 3300025294 Bacteria 13611
399 Ga0209025_1006471 3300025294 Bacteria 9076
400 Ga0209025_1010607 3300025294 Bacteria 6217
401 Ga0209564_1000170 3300025295 Bacteria 156293
402 Ga0209564_1000487 3300025295 Bacteria 65983
403 Ga0209564_1002834 3300025295 Bacteria 12796
404 Ga0209564_1006635 3300025295 Bacteria 6184
405 Ga0209758_1000578 3300025297 Bacteria 57247
406 Ga0209758_1005683 3300025297 Bacteria 9428
407 Ga0209758_1043515 3300025297 Bacteria 1653
408 Ga0209050_1000003 3300025298 Bacteria 1609245
409 Ga0209050_1000078 3300025298 Bacteria 278409
410 Ga0209050_1001437 3300025298 Bacteria 25610
411 Ga0209050_1003829 3300025298 Bacteria 10730
412 Ga0209050_1004842 3300025298 Bacteria 8836
413 Ga0209050_1022600 3300025298 Bacteria 2248
414 Ga0209256_1000001 3300025299 Bacteria 2166974
415 Ga0209256_1000007 3300025299 Bacteria 1136599
416 Ga0209256_1000976 3300025299 Bacteria 34352
417 Ga0209256_1005893 3300025299 Bacteria 6784
418 Ga0207426_1000097 3300025302 Bacteria 265930
419 Ga0207426_1000988 3300025302 Bacteria 27876
420 Ga0207426_1001375 3300025302 Bacteria 20602
421 Ga0207426_1002116 3300025302 Bacteria 13628
422 Ga0209051_1000003 3300025303 Bacteria 1609245
423 Ga0209051_1000137 3300025303 Bacteria 137784
424 Ga0209051_1000247 3300025303 Bacteria 91122
425 Ga0209051_1000773 3300025303 Bacteria 33955
426 Ga0209051_1014258 3300025303 Bacteria 3719
427 Ga0209051_1028039 3300025303 Bacteria 2231
428 Ga0209257_1000020 3300025304 Bacteria 773356
429 Ga0209257_1000097 3300025304 Bacteria 259243
430 Ga0209257_1000141 3300025304 Bacteria 201130
431 Ga0209257_1000205 3300025304 Bacteria 143735
432 Ga0207697_10003125 3300025315 Bacteria 8275
433 Ga0207655_1012412 3300025728 Bacteria 4981
434 Ga0207682_10010692 3300025893 Bacteria 3591
435 Ga0207682_10022645 3300025893 Bacteria 2477
436 Ga0207682_10034635 3300025893 Bacteria 2036
437 Ga0207682_10040443 3300025893 Bacteria 1899
438 Ga0207682_10387804 3300025893 Bacteria 660
439 Ga0207688_10037434 3300025901 Bacteria 2691
440 Ga0207680_10017945 3300025903 Bacteria 3748
441 Ga0207680_11011117 3300025903 Bacteria 595
442 Ga0207647_10007532 3300025904 Bacteria 7858
443 Ga0207645_10000282 3300025907 Bacteria 42311
444 Ga0207705_10155876 3300025909 Bacteria 1713
445 Ga0207705_10820029 3300025909 Bacteria 722
446 Ga0207695_10002587 3300025913 Bacteria 26542
447 Ga0207695_10026145 3300025913 Bacteria 6517
448 Ga0207671_10055406 3300025914 Bacteria 2937
449 Ga0207671_10611980 3300025914 Bacteria 868
450 Ga0207693_10167371 3300025915 Bacteria 1731
451 Ga0207657_10112068 3300025919 Bacteria 2252
452 Ga0207657_10344044 3300025919 Bacteria 1177
453 Ga0207681_10025353 3300025923 Bacteria 3813
454 Ga0207650_10033243 3300025925 Bacteria 3734
455 Ga0207650_10063188 3300025925 Bacteria 2767
456 Ga0207650_10074960 3300025925 Bacteria 2552
457 Ga0207650_10204675 3300025925 Bacteria 1582
458 Ga0207659_10001500 3300025926 Bacteria 13901
459 Ga0207659_10003012 3300025926 Bacteria 10044
460 Ga0207659_10407822 3300025926 Bacteria 1138
461 Ga0207659_10449109 3300025926 Bacteria 1086
462 Ga0207700_10000519 3300025928 Bacteria 22663
463 Ga0207664_10690511 3300025929 Bacteria 918
464 Ga0207644_10012204 3300025931 Bacteria 5701
465 Ga0207644_10078583 3300025931 Bacteria 2432
466 Ga0207644_10274435 3300025931 Bacteria 1352
467 Ga0207644_10790913 3300025931 Bacteria 793
468 Ga0207644_11867689 3300025931 Bacteria 502
469 Ga0207690_10003361 3300025932 Bacteria 9567
470 Ga0207690_10320659 3300025932 Bacteria 1218
471 Ga0207706_10165800 3300025933 Unclassified 1941
472 Ga0207706_10220087 3300025933 Bacteria 1662
473 Ga0207706_10222786 3300025933 Bacteria 1651
474 Ga0207706_10527960 3300025933 Bacteria 1017
475 Ga0207706_11013236 3300025933 Bacteria 697
476 Ga0207686_10469255 3300025934 Bacteria 971
477 Ga0207686_10885598 3300025934 Bacteria 720
478 Ga0207709_10748401 3300025935 Bacteria 785
479 Ga0207709_11488321 3300025935 Bacteria 561
480 Ga0207670_10267459 3300025936 Bacteria 1327
481 Ga0207669_10198054 3300025937 Bacteria 1455
482 Ga0207669_10413131 3300025937 Bacteria 1060
483 Ga0207669_10564349 3300025937 Bacteria 920
484 Ga0207704_10020880 3300025938 Bacteria 3475
485 Ga0207704_10104922 3300025938 Bacteria 1894
486 Ga0207704_10564933 3300025938 Bacteria 926
487 Ga0207665_10228535 3300025939 Bacteria 1366
488 Ga0207691_10000577 3300025940 Bacteria 36651
489 Ga0207691_10274331 3300025940 Bacteria 1452
490 Ga0207691_10500415 3300025940 Bacteria 1032
491 Ga0207711_10008678 3300025941 Bacteria 8504
492 Ga0207711_10184568 3300025941 Bacteria 1898
493 Ga0207711_10291446 3300025941 Bacteria 1504
494 Ga0207711_10469698 3300025941 Bacteria 1171
495 Ga0207689_10001993 3300025942 Bacteria 19284
496 Ga0207689_10039143 3300025942 Bacteria 3926
497 Ga0207689_10061516 3300025942 Bacteria 3088
498 Ga0207667_10044315 3300025949 Bacteria 4715
499 Ga0207667_10800837 3300025949 Bacteria 939
500 Ga0207651_10005847 3300025960 Bacteria 6360
501 Ga0207651_10043654 3300025960 Bacteria 2994
502 Ga0207651_10058430 3300025960 Bacteria 2666
503 Ga0207651_10306146 3300025960 Bacteria 1323
504 Ga0207651_10363965 3300025960 Unclassified 1221
505 Ga0207712_10744990 3300025961 Bacteria 858
506 Ga0207668_10019869 3300025972 Bacteria 4256
507 Ga0207668_10154940 3300025972 Bacteria 1779
508 Ga0207640_10000132 3300025981 Bacteria 55549
509 Ga0207640_10060214 3300025981 Bacteria 2509
510 Ga0207640_10208791 3300025981 Bacteria 1486
511 Ga0207640_10502747 3300025981 Unclassified 1010
512 Ga0207658_10006229 3300025986 Bacteria 8153
513 Ga0207658_10038490 3300025986 Bacteria 3445
514 Ga0207658_10058095 3300025986 Bacteria 2877
515 Ga0207658_10068569 3300025986 Bacteria 2677
516 Ga0207658_10186927 3300025986 Bacteria 1719
517 Ga0207658_10310958 3300025986 Bacteria 1361
518 Ga0207677_10000891 3300026023 Bacteria 16769
519 Ga0207677_10033260 3300026023 Bacteria 3324
520 Ga0207677_11156568 3300026023 Bacteria 707
521 Ga0207703_10128672 3300026035 Bacteria 2184
522 Ga0207703_11089976 3300026035 Bacteria 767
523 Ga0207639_10065074 3300026041 Bacteria 2829
524 Ga0207678_10074895 3300026067 Bacteria 2900
525 Ga0207641_10016984 3300026088 Bacteria 5958
526 Ga0207641_10031684 3300026088 Bacteria 4386
527 Ga0207641_10073571 3300026088 Bacteria 2945
528 Ga0207641_10273085 3300026088 Bacteria 1587
529 Ga0207641_10583461 3300026088 Bacteria 1093
530 Ga0207641_11052935 3300026088 Bacteria 811
531 Ga0207648_10003294 3300026089 Bacteria 16977
532 Ga0207648_10096500 3300026089 Bacteria 2587
533 Ga0207648_10098100 3300026089 Bacteria 2565
534 Ga0207648_10104805 3300026089 Bacteria 2481
535 Ga0207648_10553455 3300026089 Bacteria 1057
536 Ga0207648_10594571 3300026089 Bacteria 1019
537 Ga0207648_11391192 3300026089 Bacteria 659
538 Ga0207676_10071275 3300026095 Bacteria 2789
539 Ga0207676_10482591 3300026095 Bacteria 1174
540 Ga0207674_10001419 3300026116 Bacteria 30946
541 Ga0207674_10054909 3300026116 Bacteria 4053
542 Ga0207675_100015675 3300026118 Bacteria 7068
543 Ga0207683_10001960 3300026121 Bacteria 18224
544 Ga0207683_10022854 3300026121 Bacteria 5372
545 Ga0207683_10076963 3300026121 Bacteria 2954
546 Ga0207683_10327314 3300026121 Bacteria 1404
547 Ga0207698_10103150 3300026142 Bacteria 2370
548 Ga0207698_10209466 3300026142 Bacteria 1753
549 Ga0207698_10774636 3300026142 Bacteria 960
550 Ga0209282_1000001 3300027666 Bacteria 2450367
551 Ga0209813_10029137 3300027866 Bacteria 1615
552 Ga0207428_10018351 3300027907 Bacteria 5978
553 Ga0268266_10198180 3300028379 Bacteria 1837
554 Ga0268266_10283930 3300028379 Bacteria 1540
555 Ga0268266_10897411 3300028379 Bacteria 857
556 Ga0268265_10067661 3300028380 Bacteria 2766
557 Ga0268265_10608404 3300028380 Bacteria 1045
558 Ga0268264_10016184 3300028381 Bacteria 6107
559 Ga0268264_10132647 3300028381 Bacteria 2211
560 Ga0307517_10255853 3300028786 Bacteria 1022
561 Ga0307515_10000282 3300028794 Bacteria 125216
562 Ga0307515_10530262 3300028794 Bacteria 787
563 Ga0265338_10000057 3300028800 Bacteria 200477
564 Ga0314311_1152045 3300030733 Bacteria 1494
565 Ga0316182_1004301 3300030745 Bacteria 3660
566 Ga0265331_10005985 3300031250 Bacteria 7257
567 Ga0265327_10000020 3300031251 Bacteria 424552
568 Ga0265327_10007098 3300031251 Bacteria 8753
569 Ga0265316_10435577 3300031344 Unclassified 941
570 Ga0307513_10000017 3300031456 Bacteria 282386
571 Ga0307509_10001891 3300031507 Bacteria 34576
572 Ga0307509_10066421 3300031507 Bacteria 3784
573 Ga0307408_100006468 3300031548 Bacteria 7767
574 Ga0307408_100009227 3300031548 Bacteria 6502
575 Ga0307408_100040713 3300031548 Bacteria 3291
576 Ga0307408_100051022 3300031548 Bacteria 2978
577 Ga0307508_10000041 3300031616 Bacteria 147868
578 Ga0307508_10030006 3300031616 Bacteria 4914
579 Ga0307514_10003331 3300031649 Bacteria 15561
580 Ga0307514_10412800 3300031649 Bacteria 683
581 Ga0316576_10027203 3300031727 Bacteria 4019
582 Ga0316576_10029075 3300031727 Bacteria 3902
583 Ga0316578_10150991 3300031728 Bacteria 1399
584 Ga0307516_10002079 3300031730 Bacteria 27265
585 Ga0307516_10188670 3300031730 Bacteria 1789
586 Ga0316577_10310978 3300031733 Bacteria 893
587 Ga0307413_12017310 3300031824 Bacteria 520
588 Ga0307412_10000106 3300031911 Bacteria 67067
589 Ga0307409_100921698 3300031995 Bacteria 888
590 Ga0307416_100067405 3300032002 Bacteria 2952
591 Ga0307416_102957567 3300032002 Bacteria 568
592 Ga0307414_10147406 3300032004 Bacteria 1851
593 Ga0307411_10287822 3300032005 Bacteria 1311
594 Ga0307507_10006539 3300033179 Bacteria 17791
595 Ga0307510_10000560 3300033180 Bacteria 37413
596 Ga0373959_0066663 3300034820 Bacteria 806
597 Ga0373934_0040794 3300035086 Bacteria 1832
598 Ga0373940_0179290 3300035088 Bacteria 688
599 Ga0373946_0604944 3300035171 Bacteria 569
600 Ga0373931_0074308 3300035691 Bacteria 1862
601 Ga0373931_0260070 3300035691 Bacteria 1059
602 Ga0316584_0072663 3300036712 Bacteria 2578
603 Ga0373925_0358354 3300037068 Bacteria 1185
604 Ga0395899_0021488 3300037312 Bacteria 4896
605 Ga0395899_0194843 3300037312 Bacteria 1416
606 Ga0395899_0251771 3300037312 Bacteria 1212
607 Ga0395900_0005097 3300037418 Bacteria 13793
608 Ga0395900_0075846 3300037418 Bacteria 3456
609 Ga0395900_0076572 3300037418 Bacteria 3438
610 Ga0395900_0120307 3300037418 Bacteria 2694
611 Ga0395900_0652159 3300037418 Bacteria 989
612 Ga0395898_0053933 3300037466 Bacteria 3925
613 Ga0395898_0127607 3300037466 Bacteria 2437
614 Ga0395905_0000035 3300037471 Bacteria 272014
615 Ga0395905_0010128 3300037471 Bacteria 9189
616 Ga0395905_0014849 3300037471 Bacteria 7428
617 Ga0395905_0219153 3300037471 Bacteria 1781
618 Ga0395905_0541227 3300037471 Bacteria 1065
619 Ga0395901_0008309 3300038443 Bacteria 10492
620 Ga0395901_0018729 3300038443 Bacteria 7073
621 Ga0395901_0021971 3300038443 Bacteria 6540
622 Ga0395901_0069418 3300038443 Bacteria 3670
623 Ga0395901_0489180 3300038443 Bacteria 1254
624 Ga0395901_0612107 3300038443 Bacteria 1097
625 Ga0436361_0024448 3300039447 Bacteria 32744
626 Ga0436361_0426697 3300039447 Bacteria 3012
627 Ga0436361_0505867 3300039447 Bacteria 720
628 Ga0436361_0816616 3300039447 Bacteria 3262
629 Ga0436361_0991880 3300039447 Bacteria 1367
630 Ga0436361_1170005 3300039447 Bacteria 16387
631 Ga0439438_050632 3300041405 Bacteria 1057
632 Ga0439438_066525 3300041405 Bacteria 896
633 Ga0439447_001903 3300041407 Bacteria 7644
634 Ga0439466_0031954 3300041411 Bacteria 1797
635 Ga0451800_1200240 3300041459 Bacteria 544
636 Ga0439431_0213455 3300041997 Bacteria 565
637 Ga0439445_0179493 3300042004 Bacteria 622
638 Ga0439448_0182845 3300042005 Bacteria 733
639 Ga0439449_0137689 3300042007 Bacteria 908
640 Ga0439452_000004 3300042010 Bacteria 764268
641 Ga0439457_123487 3300042014 Bacteria 613
642 Ga0439462_0095897 3300042015 Bacteria 815
643 Ga0450911_002991 3300042115 Bacteria 3112
644 Ga0451577_0348540 3300042876 Bacteria 1343
645 Ga0451577_0505451 3300042876 Bacteria 1097
646 Ga0466969_0032822 3300044656 Bacteria 2638
647 Ga0466972_0000747 3300044658 Bacteria 15487
648 Ga0466978_0002981 3300044671 Bacteria 7585
649 Ga0466982_0042372 3300044672 Bacteria 2762
650 Ga0466965_0008878 3300044683 Bacteria 4658
651 Ga0466966_0000008 3300044684 Bacteria 155597
652 Ga0466966_0055000 3300044684 Bacteria 2521
653 Ga0466961_0000502 3300044693 Bacteria 24971
654 Ga0466961_0001985 3300044693 Bacteria 12731
655 Ga0466961_0333227 3300044693 Bacteria 925
656 Ga0466963_0015782 3300044694 Bacteria 4686
657 Ga0466963_0062450 3300044694 Bacteria 2491
658 Ga0466964_0001030 3300044706 Bacteria 9285
659 Ga0453684_0812921 3300044712 Bacteria 1007
660 Ga0466971_0008438 3300044719 Bacteria 4494
661 Ga0466971_0315751 3300044719 Bacteria 752
662 Ga0466968_0035976 3300044735 Bacteria 2073
663 Ga0466968_0242699 3300044735 Bacteria 853
664 Ga0466970_0000308 3300044765 Bacteria 23772
665 Ga0466957_0112276 3300044842 Bacteria 1729
666 Ga0466960_0006828 3300044901 Bacteria 4600
667 Ga0466959_0003070 3300045049 Bacteria 10812
668 Ga0466959_0036722 3300045049 Bacteria 3619
669 Ga0466959_0601852 3300045049 Bacteria 739
670 Ga0451576_0112109 3300045051 Bacteria 2839
671 Ga0451576_0147441 3300045051 Bacteria 2454
672 Ga0466958_0042750 3300045836 Bacteria 2729
673 Ga0466958_0185696 3300045836 Bacteria 1320
674 Ga0466967_0022965 3300045976 Bacteria 5103
675 Ga0495592_0212945 3300046454 Bacteria 1297
676 Ga0495603_0000088 3300046455 Bacteria 41342
677 Ga0495590_0000010 3300046457 Bacteria 317890
678 Ga0495590_0019251 3300046457 Bacteria 2434
679 Ga0495629_0001578 3300046459 Bacteria 17919
680 Ga0495629_0001651 3300046459 Bacteria 17506
681 Ga0495629_0025278 3300046459 Bacteria 4223
682 Ga0495629_0075758 3300046459 Bacteria 2349
683 Ga0495629_0383771 3300046459 Bacteria 956
684 Ga0495638_0000042 3300046460 Bacteria 232752
685 Ga0495651_0000727 3300046462 Bacteria 25494
686 Ga0495651_0009143 3300046462 Bacteria 7604
687 Ga0495653_0000010 3300046463 Bacteria 274131
688 Ga0495653_0000573 3300046463 Bacteria 28220
689 Ga0495653_0029427 3300046463 Bacteria 4384
690 Ga0495653_0031645 3300046463 Bacteria 4203
691 Ga0495653_0163918 3300046463 Bacteria 1541
692 Ga0495653_0253308 3300046463 Bacteria 1167
693 Ga0495650_0000429 3300046471 Bacteria 68004
694 Ga0495650_0075639 3300046471 Bacteria 1310
695 Ga0495580_0001753 3300046472 Bacteria 19069
696 Ga0495580_0005225 3300046472 Bacteria 10788
697 Ga0495580_0005577 3300046472 Bacteria 10372
698 Ga0495582_0121741 3300046473 Bacteria 1470
699 Ga0495605_0007017 3300046474 Bacteria 6428
700 Ga0495639_0004616 3300046475 Bacteria 5911
701 Ga0495639_0462784 3300046475 Bacteria 645
702 Ga0495662_0478163 3300046476 Bacteria 611
703 Ga0495664_0107616 3300046477 Bacteria 1682
704 Ga0495584_0020617 3300046491 Bacteria 3348
705 Ga0495585_0000003 3300046492 Bacteria 406344
706 Ga0495585_0002914 3300046492 Bacteria 11849
707 Ga0495585_0300215 3300046492 Bacteria 790
708 Ga0495596_0039376 3300046500 Bacteria 1867
709 Ga0495596_0066504 3300046500 Bacteria 1401
710 Ga0495607_0054065 3300046501 Bacteria 2315
711 Ga0495583_0000006 3300046506 Bacteria 436893
712 Ga0495583_0008409 3300046506 Bacteria 6312
713 Ga0495583_0032653 3300046506 Bacteria 2511
714 Ga0495606_0003357 3300046507 Bacteria 17069
715 Ga0495606_0014891 3300046507 Bacteria 6036
716 Ga0495606_0052343 3300046507 Bacteria 2656
717 Ga0495606_0164520 3300046507 Bacteria 1292
718 Ga0495606_0446175 3300046507 Bacteria 664
719 Ga0495608_0484735 3300046511 Bacteria 750
720 Ga0495610_0004664 3300046512 Bacteria 10027
721 Ga0495610_0021196 3300046512 Bacteria 3579
722 Ga0495610_0230884 3300046512 Bacteria 742
723 Ga0495616_0002197 3300046513 Bacteria 13040
724 Ga0495616_0007358 3300046513 Bacteria 6587
725 Ga0495618_0029802 3300046514 Bacteria 3405
726 Ga0495618_0072038 3300046514 Bacteria 2199
727 Ga0495618_0077661 3300046514 Bacteria 2116
728 Ga0495618_0190118 3300046514 Bacteria 1302
729 Ga0495628_0000366 3300046516 Bacteria 41368
730 Ga0495628_0028221 3300046516 Bacteria 4561
731 Ga0495628_0033309 3300046516 Bacteria 4154
732 Ga0495628_0144249 3300046516 Bacteria 1816
733 Ga0495628_0326075 3300046516 Bacteria 1132
734 Ga0495630_0008911 3300046517 Bacteria 7203
735 Ga0495630_0009796 3300046517 Bacteria 6898
736 Ga0495630_0145687 3300046517 Bacteria 1801
737 Ga0495630_1072776 3300046517 Bacteria 611
738 Ga0495632_0021184 3300046519 Bacteria 3506
739 Ga0495637_0013967 3300046520 Bacteria 3799
740 Ga0495643_0001442 3300046522 Bacteria 21926
741 Ga0495643_0113304 3300046522 Bacteria 1377
742 Ga0495648_0000011 3300046524 Bacteria 299518
743 Ga0495648_0001082 3300046524 Bacteria 27695
744 Ga0495648_0001863 3300046524 Bacteria 20176
745 Ga0495648_0011239 3300046524 Bacteria 6759
746 Ga0495648_0015932 3300046524 Bacteria 5432
747 Ga0495648_0080484 3300046524 Bacteria 1856
748 Ga0495648_0172871 3300046524 Bacteria 1105
749 Ga0495666_0000893 3300046526 Bacteria 13970
750 Ga0495666_0001632 3300046526 Bacteria 11046
751 Ga0495666_0040451 3300046526 Bacteria 2261
752 Ga0495642_0046277 3300046528 Bacteria 1780
753 Ga0495642_0058542 3300046528 Bacteria 1595
754 Ga0495642_0094729 3300046528 Bacteria 1266
755 Ga0495642_0108036 3300046528 Bacteria 1188
756 Ga0495652_0001267 3300046529 Bacteria 28252
757 Ga0495652_0059282 3300046529 Bacteria 3239
758 Ga0495652_0078627 3300046529 Bacteria 2729
759 Ga0495654_0004989 3300046530 Bacteria 7795
760 Ga0495654_0021025 3300046530 Bacteria 3398
761 Ga0495665_0000466 3300046531 Bacteria 20362
762 Ga0495665_0089082 3300046531 Bacteria 1621
763 Ga0495640_0011186 3300046533 Bacteria 6908
764 Ga0495640_0098853 3300046533 Bacteria 1917
765 Ga0495586_0000626 3300046535 Bacteria 20354
766 Ga0495586_0056963 3300046535 Bacteria 2120
767 Ga0495621_0520555 3300046539 Bacteria 514
768 Ga0495597_0000111 3300046542 Bacteria 72653
769 Ga0495597_0000567 3300046542 Bacteria 30695
770 Ga0495597_0007752 3300046542 Bacteria 5425
771 Ga0495597_0125286 3300046542 Bacteria 1068
772 Ga0495645_0033419 3300046543 Bacteria 3753
773 Ga0495645_0156948 3300046543 Bacteria 1576
774 Ga0495645_0157631 3300046543 Bacteria 1572
775 Ga0495645_0193410 3300046543 Bacteria 1385
776 Ga0495645_0486291 3300046543 Bacteria 773
777 Ga0495622_0000116 3300046557 Bacteria 69072
778 Ga0495622_0012142 3300046557 Bacteria 3985
779 Ga0495633_0000124 3300046558 Bacteria 104617
780 Ga0495633_0000553 3300046558 Bacteria 36816
781 Ga0495633_0012156 3300046558 Bacteria 4593
782 Ga0495633_0043104 3300046558 Bacteria 2141
783 Ga0495633_0311744 3300046558 Bacteria 714
784 Ga0495656_0320817 3300046615 Bacteria 798
785 Ga0495668_0000843 3300046616 Bacteria 34761
786 Ga0495668_0006379 3300046616 Bacteria 7729
787 Ga0495634_0032866 3300046642 Bacteria 3565
788 Ga0495611_0082400 3300046648 Bacteria 1481
789 Ga0495625_0000218 3300046660 Bacteria 90741
790 Ga0495625_0001835 3300046660 Bacteria 24293
791 Ga0495625_0146479 3300046660 Bacteria 1590
792 Ga0495625_0152615 3300046660 Bacteria 1552
793 Ga0495625_0325141 3300046660 Bacteria 978
794 Ga0495661_0009208 3300046665 Bacteria 6785
795 Ga0495661_0020711 3300046665 Bacteria 4290
796 Ga0495661_0046866 3300046665 Bacteria 2636
797 Ga0495588_0066110 3300046674 Bacteria 1876
798 Ga0495657_0043528 3300046675 Bacteria 3061
799 Ga0495599_0044818 3300046678 Bacteria 2773
800 Ga0495599_0298842 3300046678 Bacteria 972
801 Ga0495623_0001937 3300046679 Bacteria 13902
802 Ga0495623_0016318 3300046679 Bacteria 4797
803 Ga0495623_0055865 3300046679 Bacteria 2487
804 Ga0495623_0210738 3300046679 Bacteria 1112
805 Ga0495646_0026058 3300046680 Bacteria 3672
806 Ga0495658_0657267 3300046683 Bacteria 671
807 Ga0495658_0693474 3300046683 Bacteria 652
808 Ga0495613_0003365 3300046689 Bacteria 11949
809 Ga0495613_0004731 3300046689 Bacteria 10217
810 Ga0495613_0294181 3300046689 Bacteria 1125
811 Ga0495624_0001213 3300046690 Bacteria 20335
812 Ga0495624_0001465 3300046690 Bacteria 18349
813 Ga0495671_0000002 3300046692 Bacteria 1136189
814 Ga0495671_0028513 3300046692 Bacteria 2874
815 Ga0495671_0102142 3300046692 Bacteria 1401
816 Ga0495671_0104577 3300046692 Bacteria 1383
817 Ga0495649_0082834 3300046694 Bacteria 1714
818 Ga0495649_0130007 3300046694 Bacteria 1329
819 Ga0495649_0263824 3300046694 Bacteria 882
820 Ga0495589_0015735 3300046794 Bacteria 3889
821 Ga0495589_0164678 3300046794 Bacteria 1055
822 Ga0495660_0000002 3300046810 Bacteria 1229481
823 Ga0495660_0000362 3300046810 Bacteria 39947
824 Ga0495660_0000799 3300046810 Bacteria 23611
825 Ga0495660_0009555 3300046810 Bacteria 5654
826 Ga0495660_0009627 3300046810 Bacteria 5633
827 Ga0495660_0021858 3300046810 Bacteria 3659
828 Ga0495581_0049111 3300047315 Bacteria 2436
829 Ga0495581_0090834 3300047315 Bacteria 1772
830 Ga0495581_0233335 3300047315 Bacteria 1076
831 Ga0495581_0579374 3300047315 Bacteria 650
832 Ga0495604_0018202 3300047317 Bacteria 5624
833 Ga0495604_0102522 3300047317 Bacteria 2100
834 Ga0495636_0030650 3300047318 Bacteria 2200
835 Ga0495674_0000653 3300047319 Bacteria 32528
836 Ga0495674_0000913 3300047319 Bacteria 28241
837 Ga0495674_0003203 3300047319 Bacteria 15900
838 Ga0495672_0009463 3300047320 Bacteria 7056
839 Ga0495672_0028450 3300047320 Bacteria 3536
840 Ga0495676_0075526 3300047321 Bacteria 2577
841 Ga0495676_0118909 3300047321 Bacteria 1926
842 Ga0495680_0006739 3300047322 Bacteria 10620
843 Ga0495680_0011532 3300047322 Bacteria 7817
844 Ga0495683_0002499 3300047323 Bacteria 11068
845 Ga0495683_0017419 3300047323 Bacteria 3724
846 Ga0495687_000502 3300047443 Bacteria 47227
847 Ga0495687_000965 3300047443 Bacteria 29302
848 Ga0495687_000991 3300047443 Bacteria 28486
849 Ga0495687_010372 3300047443 Bacteria 5113
850 Ga0495687_040005 3300047443 Bacteria 2069
851 Ga0495687_064447 3300047443 Bacteria 1495
852 Ga0495675_0232502 3300047444 Bacteria 1112
853 Ga0495677_0246379 3300047445 Bacteria 698
854 Ga0495679_000489 3300047446 Bacteria 28238
855 Ga0495679_006544 3300047446 Bacteria 4989
856 Ga0495679_037010 3300047446 Bacteria 1537
857 Ga0495685_033437 3300047447 Bacteria 1767
858 Ga0495673_0000026 3300047469 Bacteria 476378
859 Ga0495673_0003513 3300047469 Bacteria 10312
860 Ga0495673_0024334 3300047469 Bacteria 2928
861 Ga0495684_0616158 3300047471 Bacteria 730
862 Ga0495686_0152109 3300047472 Bacteria 1358
863 Ga0495593_0019136 3300047673 Bacteria 3843
864 Ga0495593_0032816 3300047673 Bacteria 2829
865 Ga0495593_0042873 3300047673 Bacteria 2427
866 Ga0495593_0074616 3300047673 Bacteria 1759
867 Ga0495602_0001757 3300048088 Bacteria 21644
868 Ga0495602_0002700 3300048088 Bacteria 18124
869 Ga0495602_0006511 3300048088 Bacteria 12251
870 Ga0495602_0184440 3300048088 Bacteria 1606
871 Ga0495602_0208414 3300048088 Bacteria 1486
872 Ga0495602_0422606 3300048088 Bacteria 946
873 Ga0495614_0000279 3300048089 Bacteria 20099
874 Ga0495614_0323001 3300048089 Bacteria 716
875 Ga0495626_0001005 3300048091 Bacteria 24227
876 Ga0495626_0090173 3300048091 Bacteria 1349
877 Ga0496100_0015583 3300048903 Bacteria 4440
878 Ga0496100_0050912 3300048903 Bacteria 2686
879 Ga0496100_0270808 3300048903 Bacteria 1263
880 Ga0496100_0475345 3300048903 Bacteria 961
881 Ga0496101_0001615 3300048904 Bacteria 13560
882 Ga0496101_0073397 3300048904 Bacteria 2513
883 Ga0496101_0455191 3300048904 Bacteria 1010
884 Ga0496102_0018151 3300048905 Bacteria 6175
885 Ga0496102_0044897 3300048905 Bacteria 4010
886 Ga0496102_0180280 3300048905 Bacteria 1990
887 Ga0496103_0549463 3300048906 Bacteria 737
888 Ga0496104_0010765 3300048907 Bacteria 8181
889 Ga0496104_0042817 3300048907 Bacteria 4251
890 Ga0496104_0416507 3300048907 Bacteria 1256
891 Ga0496104_0755556 3300048907 Bacteria 879
892 Ga0496105_0004091 3300048908 Bacteria 10927
893 Ga0496105_0009938 3300048908 Bacteria 7464
894 Ga0496105_0326975 3300048908 Bacteria 1228
895 Ga0496105_0334706 3300048908 Bacteria 1211
896 Ga0496106_0142179 3300048909 Bacteria 1888
897 Ga0496106_0220985 3300048909 Bacteria 1511
898 Ga0496107_0440096 3300048910 Bacteria 969
899 Ga0496108_0174541 3300048911 Bacteria 1860
900 Ga0496108_0980217 3300048911 Bacteria 723
901 Ga0496109_0022976 3300048912 Bacteria 5530
902 Ga0496109_0046266 3300048912 Bacteria 3952
903 Ga0496109_0103772 3300048912 Bacteria 2639
904 Ga0496109_0209700 3300048912 Bacteria 1832
905 Ga0496109_0331860 3300048912 Bacteria 1436
906 Ga0496110_0028927 3300048913 Bacteria 4763
907 Ga0496110_0030436 3300048913 Bacteria 4653
908 Ga0496110_0583870 3300048913 Bacteria 1014
909 Ga0496110_0621542 3300048913 Bacteria 979
910 Ga0496110_0661357 3300048913 Bacteria 945
911 Ga0496110_1651691 3300048913 Bacteria 551
912 Ga0496111_0050665 3300048914 Bacteria 2996
913 Ga0496112_0012047 3300048915 Bacteria 7933
914 Ga0496113_0000380 3300048916 Bacteria 21429
915 Ga0496113_0004924 3300048916 Bacteria 8273
916 Ga0496113_1140884 3300048916 Bacteria 610
917 Ga0496114_0068915 3300048917 Bacteria 2970
918 Ga0496114_0087137 3300048917 Bacteria 2647
919 Ga0496114_1236166 3300048917 Bacteria 633
920 Ga0496115_0276047 3300048918 Bacteria 1380
921 Ga0496116_0000103 3300048919 Bacteria 193529
922 Ga0496116_0009480 3300048919 Bacteria 8291
923 Ga0496116_0014154 3300048919 Bacteria 6385
924 Ga0496116_0079119 3300048919 Bacteria 2047
925 Ga0496117_0000259 3300048920 Bacteria 99638
926 Ga0496117_0192999 3300048920 Bacteria 1158
927 Ga0496117_0394838 3300048920 Bacteria 700
928 Ga0496118_0001478 3300048921 Bacteria 35190
929 Ga0496118_0007993 3300048921 Bacteria 11057
930 Ga0496118_0098715 3300048921 Bacteria 1982
931 Ga0496119_0344444 3300048922 Bacteria 723
932 Ga0496120_0019391 3300048923 Bacteria 4352
933 Ga0496121_0000195 3300048924 Bacteria 136162
934 Ga0496121_0053401 3300048924 Bacteria 3385
935 Ga0496121_0144609 3300048924 Bacteria 1759
936 Ga0496122_0000936 3300048925 Bacteria 53067
937 Ga0496122_0217696 3300048925 Bacteria 1099
938 Ga0496123_0005971 3300048926 Bacteria 11982
939 Ga0496123_0019941 3300048926 Bacteria 5263
940 Ga0496123_0182359 3300048926 Bacteria 1095
941 Ga0496124_0002244 3300048927 Bacteria 25695
942 Ga0496124_0013961 3300048927 Bacteria 7801
943 Ga0496124_0069982 3300048927 Bacteria 2911
944 Ga0496124_0468261 3300048927 Bacteria 854
945 Ga0496125_0001902 3300048928 Bacteria 28567
946 Ga0496125_0060473 3300048928 Bacteria 3044
947 Ga0496125_0178907 3300048928 Bacteria 1416
948 Ga0496125_0182341 3300048928 Bacteria 1397
949 Ga0496126_0341216 3300048929 Bacteria 1227
950 Ga0496126_0674429 3300048929 Bacteria 806
951 Ga0495678_000936 3300049459 Bacteria 25387
952 Ga0495678_006615 3300049459 Bacteria 6142
953 Ga0495682_0010393 3300049460 Bacteria 3606
954 Ga0501031_0480610 3300049568 Bacteria 802
955 Ga0501034_0223556 3300049571 Bacteria 1834
956 Ga0501036_0294807 3300049572 Bacteria 1357
957 Ga0501036_0408233 3300049572 Bacteria 1133
958 Ga0501037_0245662 3300049573 Bacteria 1253
959 Ga0501037_0924547 3300049573 Bacteria 571
960 Ga0501042_0473816 3300049578 Bacteria 908
961 Ga0501043_0000371 3300049579 Bacteria 40668
962 Ga0501043_0691002 3300049579 Bacteria 746
963 Ga0501046_0000488 3300049580 Bacteria 39620
964 Ga0501046_0440833 3300049580 Bacteria 937
965 Ga0501047_0000564 3300049581 Bacteria 39704
966 Ga0501047_0385498 3300049581 Bacteria 1235
967 Ga0501048_0001830 3300049582 Bacteria 16127
968 Ga0501072_0525712 3300049588 Bacteria 935
969 Ga0501076_0394330 3300049592 Bacteria 1138
970 Ga0501227_056700 3300049665 Bacteria 998
971 Ga0501249_000898 3300049679 Bacteria 6529
972 Ga0501079_0847189 3300049741 Unclassified 720
973 Ga0501080_0698990 3300049742 Bacteria 894
974 Ga0501081_0623619 3300049743 Bacteria 808
975 Ga0501269_000669 3300049766 Bacteria 5828
976 Ga0501279_007950 3300049775 Bacteria 1410
977 Ga0501035_0052513 3300049822 Bacteria 3647
978 Ga0501044_0050386 3300049823 Bacteria 4296
979 nmdc:mga03683_12306_c1 3300050489 Bacteria 3121
980 nmdc:mga03683_197195_c1 3300050489 Bacteria 923
981 nmdc:mga03683_7855_c1 3300050489 Bacteria 3724
982 nmdc:mga03683_93307_c1 3300050489 Bacteria 1315
983 nmdc:mga03n38_1017_c1 3300050490 Bacteria 7686
984 nmdc:mga03n38_51259_c1 3300050490 Bacteria 1842
985 nmdc:mga03n38_553999_c1 3300050490 Bacteria 651
986 nmdc:mga00v17_14316_c1 3300050491 Bacteria 4424
987 nmdc:mga0yw44_18425_c1 3300050492 Bacteria 3824
988 nmdc:mga0k408_1070_c2 3300050493 Bacteria 9350
989 nmdc:mga0k408_12270_c1 3300050493 Bacteria 4682
990 nmdc:mga0k408_137519_c1 3300050493 Bacteria 868
991 nmdc:mga0k408_170706_c1 3300050493 Bacteria 1296
992 nmdc:mga0k408_256625_c1 3300050493 Bacteria 1044
993 nmdc:mga0k408_38300_c1 3300050493 Bacteria 2752
994 nmdc:mga0k408_4660_c1 3300050493 Bacteria 7266
995 nmdc:mga0k408_7031_c1 3300050493 Bacteria 6007
996 nmdc:mga06z11_51325_c1 3300050494 Bacteria 2112
997 nmdc:mga06z11_93271_c1 3300050494 Bacteria 1639
998 nmdc:mga06z11_979197_c1 3300050494 Bacteria 515
999 nmdc:mga04h51_66769_c1 3300050495 Bacteria 1247
1000 nmdc:mga07m45_1404_c1 3300050496 Bacteria 11013
1001 nmdc:mga07m45_18843_c1 3300050496 Bacteria 3733
1002 nmdc:mga07m45_3515_c1 3300050496 Bacteria 7561
1003 nmdc:mga07m45_77352_c1 3300050496 Bacteria 1898
1004 nmdc:mga07m45_81077_c1 3300050496 Bacteria 1853
1005 nmdc:mga05p37_610861_c1 3300050507 Bacteria 1229
1006 nmdc:mga09592_118549_c1 3300050508 Bacteria 2272
1007 nmdc:mga0qj67_43291_c1 3300050509 Bacteria 3545
1008 nmdc:mga08y16_10126_c1 3300050511 Bacteria 9898
1009 nmdc:mga08x19_32067_c1 3300050514 Bacteria 3309
1010 nmdc:mga0sz30_154227_c1 3300050516 Bacteria 1017
1011 nmdc:mga0sz30_330494_c1 3300050516 Bacteria 681
1012 Ga0495601_0733413 3300053077 Bacteria 629
1013 Ga0500610_0395265 3300053079 Bacteria 564
1014 Ga0500644_0001498 3300053088 Bacteria 6141
1015 Ga0500651_0127353 3300053093 Bacteria 1542
1016 Ga0500651_0331495 3300053093 Bacteria 867
1017 Ga0500572_112146 3300053111 Bacteria 878
1018 Ga0500608_002102 3300053122 Bacteria 7146
1019 Ga0500618_004853 3300053125 Bacteria 4199
1020 Ga0500626_053059 3300053128 Bacteria 1822
1021 Ga0500658_0088065 3300053134 Bacteria 1338
1022 Ga0500559_0002116 3300053136 Bacteria 10567
1023 Ga0500568_0018860 3300053139 Bacteria 3009
1024 Ga0500574_006190 3300053141 Bacteria 2389
1025 Ga0500586_007349 3300053145 Bacteria 2931
1026 Ga0500636_0061848 3300053177 Bacteria 2184
1027 Ga0500645_000114 3300053730 Bacteria 64351
1028 Ga0500661_006186 3300055283 Bacteria 2231
1029 Ga0466962_0011690 3300061719 Bacteria 4226
1030 Ga0466962_0046427 3300061719 Bacteria 2075
1031 Ga0530510_0520639 3300061734 Bacteria 902

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0812921 Ga0453684_0812921_280_693 133
2 3300045051 Ga0451576_0147441 Ga0451576_0147441_1292_1705 133
3 3300050516 nmdc:mga0sz30_330494_c1 nmdc:mga0sz30_330494_c1_261_662 133
4 3300015262 Ga0182007_10011585 Ga0182007_100115854 135
5 3300002774 JGI25150J39212_1007267 JGI25150J39212_10072672 136
6 3300021361 Ga0213872_10004425 Ga0213872_100044257 136
7 3300025245 Ga0207425_1000128 Ga0207425_100012825 136
8 3300025294 Ga0209025_1003856 Ga0209025_10038562 136
9 3300025297 Ga0209758_1000578 Ga0209758_100057824 136
10 3300041405 Ga0439438_050632 Ga0439438_050632_167_580 136
11 3300041407 Ga0439447_001903 Ga0439447_001903_634_1047 136
12 3300041411 Ga0439466_0031954 Ga0439466_0031954_1225_1638 136
13 iso_pu_bacteria 2808606415 2809129329 136
14 iso_pu_bacteria 2808606419 2809149616 136
15 iso_pu_bacteria 2852618963 2852619768 136
16 3300001979 JGI24740J21852_10003426 JGI24740J21852_100034266 137
17 3300001979 JGI24740J21852_10003590 JGI24740J21852_100035906 137
18 3300001979 JGI24740J21852_10016258 JGI24740J21852_100162583 137
19 3300003751 Ga0055538_1008028 Ga0055538_10080282 137
20 3300003751 Ga0055538_1009501 Ga0055538_10095012 137
21 3300003752 Ga0055539_1014377 Ga0055539_10143772 137
22 3300003756 Ga0055533_1001339 Ga0055533_10013396 137
23 3300003756 Ga0055533_1003923 Ga0055533_10039233 137
24 3300003758 Ga0055532_1000006 Ga0055532_1000006201 137
25 3300003759 Ga0055525_1007688 Ga0055525_10076881 137
26 3300003760 Ga0055527_1000395 Ga0055527_100039511 137
27 3300003761 Ga0055535_1000004 Ga0055535_1000004201 137
28 3300003762 Ga0055542_1001366 Ga0055542_10013663 137
29 3300003763 Ga0055529_1000022 Ga0055529_1000022120 137
30 3300003841 Ga0055541_1002678 Ga0055541_10026784 137
31 3300005366 Ga0070659_100001408 Ga0070659_1000014085 137
32 3300005578 Ga0068854_100000020 Ga0068854_10000002018 137
33 3300005616 Ga0068852_100043480 Ga0068852_1000434802 137
34 3300006880 Ga0075429_100154417 Ga0075429_1001544172 137
35 3300009094 Ga0111539_10018854 Ga0111539_100188546 137
36 3300009147 Ga0114129_10771089 Ga0114129_107710892 137
37 3300013105 Ga0157369_10013411 Ga0157369_100134119 137
38 3300014497 Ga0182008_10065925 Ga0182008_100659253 137
39 3300015261 Ga0182006_1000525 Ga0182006_100052510 137
40 3300020077 Ga0206351_10377922 Ga0206351_103779222 137
41 3300021361 Ga0213872_10074690 Ga0213872_100746903 137
42 3300021361 Ga0213872_10289453 Ga0213872_102894531 137
43 3300025206 Ga0209435_107774 Ga0209435_1077743 137
44 3300025224 Ga0209784_100581 Ga0209784_1005819 137
45 3300025224 Ga0209784_104690 Ga0209784_1046902 137
46 3300025225 Ga0209566_100409 Ga0209566_10040919 137
47 3300025226 Ga0209674_100228 Ga0209674_10022830 137
48 3300025226 Ga0209674_103466 Ga0209674_1034663 137
49 3300025228 Ga0209672_100111 Ga0209672_10011155 137
50 3300025229 Ga0209147_100015 Ga0209147_100015344 137
51 3300025242 Ga0209258_100021 Ga0209258_100021344 137
52 3300025246 Ga0209646_1000055 Ga0209646_1000055179 137
53 3300025250 Ga0209026_1000790 Ga0209026_10007907 137
54 3300025253 Ga0209677_102961 Ga0209677_1029617 137
55 3300025254 Ga0209148_1000109 Ga0209148_1000109125 137
56 3300025254 Ga0209148_1003318 Ga0209148_10033184 137
57 3300025256 Ga0209759_1001420 Ga0209759_10014203 137
58 3300025256 Ga0209759_1020780 Ga0209759_10207802 137
59 3300025272 Ga0209455_1000028 Ga0209455_1000028344 137
60 3300025913 Ga0207695_10002587 Ga0207695_100025878 137
61 3300025919 Ga0207657_10112068 Ga0207657_101120683 137
62 3300025932 Ga0207690_10003361 Ga0207690_100033616 137
63 3300025981 Ga0207640_10000132 Ga0207640_100001324 137
64 3300026089 Ga0207648_11391192 Ga0207648_113911922 137
65 3300026116 Ga0207674_10001419 Ga0207674_100014197 137
66 3300027907 Ga0207428_10018351 Ga0207428_100183512 137
67 3300031250 Ga0265331_10005985 Ga0265331_100059852 137
68 3300031251 Ga0265327_10000020 Ga0265327_100000205 137
69 3300031911 Ga0307412_10000106 Ga0307412_100001064 137
70 3300037418 Ga0395900_0075846 Ga0395900_0075846_2050_2463 137
71 3300039447 Ga0436361_0426697 Ga0436361_0426697_1162_1575 137
72 3300039447 Ga0436361_0991880 Ga0436361_0991880_188_601 137
73 3300044658 Ga0466972_0000747 Ga0466972_0000747_13150_13563 137
74 3300044671 Ga0466978_0002981 Ga0466978_0002981_3619_4032 137
75 3300044672 Ga0466982_0042372 Ga0466982_0042372_53_466 137
76 3300044683 Ga0466965_0008878 Ga0466965_0008878_4194_4607 137
77 3300044693 Ga0466961_0000502 Ga0466961_0000502_17534_17947 137
78 3300044694 Ga0466963_0062450 Ga0466963_0062450_1081_1494 137
79 3300044706 Ga0466964_0001030 Ga0466964_0001030_7193_7606 137
80 3300044719 Ga0466971_0008438 Ga0466971_0008438_1326_1739 137
81 3300044735 Ga0466968_0035976 Ga0466968_0035976_709_1122 137
82 3300044765 Ga0466970_0000308 Ga0466970_0000308_17343_17756 137
83 3300044901 Ga0466960_0006828 Ga0466960_0006828_38_451 137
84 3300045049 Ga0466959_0003070 Ga0466959_0003070_4073_4486 137
85 3300045836 Ga0466958_0185696 Ga0466958_0185696_519_932 137
86 3300045976 Ga0466967_0022965 Ga0466967_0022965_1214_1627 137
87 3300046457 Ga0495590_0000010 Ga0495590_0000010_10249_10662 137
88 3300046460 Ga0495638_0000042 Ga0495638_0000042_197437_197850 137
89 3300046471 Ga0495650_0000429 Ga0495650_0000429_51635_52048 137
90 3300046501 Ga0495607_0054065 Ga0495607_0054065_1588_2001 137
91 3300046506 Ga0495583_0000006 Ga0495583_0000006_16417_16830 137
92 3300046507 Ga0495606_0003357 Ga0495606_0003357_14301_14714 137
93 3300046507 Ga0495606_0014891 Ga0495606_0014891_3397_3810 137
94 3300046512 Ga0495610_0004664 Ga0495610_0004664_1239_1652 137
95 3300046520 Ga0495637_0013967 Ga0495637_0013967_1084_1497 137
96 3300046522 Ga0495643_0001442 Ga0495643_0001442_15945_16358 137
97 3300046524 Ga0495648_0001082 Ga0495648_0001082_14814_15227 137
98 3300046528 Ga0495642_0094729 Ga0495642_0094729_404_817 137
99 3300046542 Ga0495597_0000111 Ga0495597_0000111_47871_48284 137
100 3300046557 Ga0495622_0000116 Ga0495622_0000116_15802_16215 137
101 3300046558 Ga0495633_0000124 Ga0495633_0000124_21702_22115 137
102 3300046558 Ga0495633_0000553 Ga0495633_0000553_31730_32158 137
103 3300046616 Ga0495668_0000843 Ga0495668_0000843_5275_5688 137
104 3300046660 Ga0495625_0000218 Ga0495625_0000218_73557_73970 137
105 3300046692 Ga0495671_0028513 Ga0495671_0028513_2342_2755 137
106 3300046810 Ga0495660_0009555 Ga0495660_0009555_2376_2789 137
107 3300047443 Ga0495687_000965 Ga0495687_000965_24881_25294 137
108 3300047443 Ga0495687_000991 Ga0495687_000991_24066_24479 137
109 3300048913 Ga0496110_1651691 Ga0496110_1651691_73_492 137
110 3300048919 Ga0496116_0009480 Ga0496116_0009480_2002_2421 137
111 3300048919 Ga0496116_0079119 Ga0496116_0079119_1505_1924 137
112 3300048920 Ga0496117_0192999 Ga0496117_0192999_284_697 137
113 3300048924 Ga0496121_0000195 Ga0496121_0000195_127036_127455 137
114 3300048925 Ga0496122_0000936 Ga0496122_0000936_41617_42036 137
115 3300048926 Ga0496123_0005971 Ga0496123_0005971_532_951 137
116 3300048927 Ga0496124_0069982 Ga0496124_0069982_2088_2507 137
117 3300048928 Ga0496125_0182341 Ga0496125_0182341_861_1280 137
118 3300048929 Ga0496126_0341216 Ga0496126_0341216_282_701 137
119 3300049459 Ga0495678_000936 Ga0495678_000936_16453_16866 137
120 3300049459 Ga0495678_006615 Ga0495678_006615_1294_1707 137
121 3300050507 nmdc:mga05p37_610861_c1 nmdc:mga05p37_610861_c1_179_595 137
122 3300050508 nmdc:mga09592_118549_c1 nmdc:mga09592_118549_c1_1222_1638 137
123 3300050511 nmdc:mga08y16_10126_c1 nmdc:mga08y16_10126_c1_6366_6782 137
124 3300061719 Ga0466962_0046427 Ga0466962_0046427_589_1002 137
125 3300002774 JGI25150J39212_1001373 JGI25150J39212_10013732 138
126 3300002774 JGI25150J39212_1007812 JGI25150J39212_10078124 138
127 3300002987 JGI25159J45721_1000359 JGI25159J45721_100035914 138
128 3300002987 JGI25159J45721_1002098 JGI25159J45721_10020987 138
129 3300003187 JGI25151J46595_10002668 JGI25151J46595_100026685 138
130 3300003187 JGI25151J46595_10006726 JGI25151J46595_100067266 138
131 3300003215 JGI25153J46596_10105088 JGI25153J46596_101050882 138
132 3300003322 rootL2_10093470 rootL2_100934702 138
133 3300003354 JGI25160J50197_1000158 JGI25160J50197_100015841 138
134 3300003374 JGI25161J50226_1000040 JGI25161J50226_100004084 138
135 3300003763 Ga0055529_1001082 Ga0055529_10010827 138
136 3300003771 Ga0055526_1001296 Ga0055526_100129614 138
137 3300003771 Ga0055526_1050947 Ga0055526_10509472 138
138 3300003773 Ga0055537_1000257 Ga0055537_100025716 138
139 3300003773 Ga0055537_1004524 Ga0055537_10045242 138
140 3300003775 Ga0055524_1000077 Ga0055524_100007735 138
141 3300003781 Ga0055536_1001365 Ga0055536_10013658 138
142 3300003784 Ga0055534_1004892 Ga0055534_10048925 138
143 3300003790 Ga0055528_1002253 Ga0055528_10022539 138
144 3300003791 Ga0055530_10000354 Ga0055530_1000035435 138
145 3300003791 Ga0055530_10019470 Ga0055530_100194703 138
146 3300003792 Ga0055540_1000010 Ga0055540_1000010147 138
147 3300003794 Ga0055531_10000298 Ga0055531_1000029843 138
148 3300003794 Ga0055531_10000405 Ga0055531_1000040519 138
149 3300004625 Ga0055543_1000167 Ga0055543_100016732 138
150 3300005262 Ga0065165_1001298 Ga0065165_100129815 138
151 3300005262 Ga0065165_1003807 Ga0065165_10038077 138
152 3300005539 Ga0068853_100288225 Ga0068853_1002882251 138
153 3300006051 Ga0075364_10151141 Ga0075364_101511413 138
154 3300006177 Ga0075362_10053876 Ga0075362_100538762 138
155 3300006177 Ga0075362_10075856 Ga0075362_100758564 138
156 3300006195 Ga0075366_10288409 Ga0075366_102884091 138
157 3300006353 Ga0075370_10150516 Ga0075370_101505162 138
158 3300006946 Ga0079104_1037099 Ga0079104_10370993 138
159 3300006948 Ga0099826_10264683 Ga0099826_102646832 138
160 3300013104 Ga0157370_10775583 Ga0157370_107755831 138
161 3300013307 Ga0157372_10037972 Ga0157372_100379724 138
162 3300014497 Ga0182008_10004423 Ga0182008_1000442312 138
163 3300025208 Ga0209436_100323 Ga0209436_1003235 138
164 3300025208 Ga0209436_100621 Ga0209436_10062110 138
165 3300025245 Ga0207425_1000171 Ga0207425_100017146 138
166 3300025245 Ga0207425_1001472 Ga0207425_10014729 138
167 3300025258 Ga0209129_1007442 Ga0209129_10074424 138
168 3300025263 Ga0209565_1000036 Ga0209565_1000036210 138
169 3300025263 Ga0209565_1000655 Ga0209565_100065516 138
170 3300025263 Ga0209565_1000793 Ga0209565_100079318 138
171 3300025263 Ga0209565_1061857 Ga0209565_10618571 138
172 3300025272 Ga0209455_1000044 Ga0209455_10000447 138
173 3300025273 Ga0209673_1000008 Ga0209673_1000008564 138
174 3300025273 Ga0209673_1041743 Ga0209673_10417433 138
175 3300025284 Ga0209130_1000042 Ga0209130_100004236 138
176 3300025284 Ga0209130_1000622 Ga0209130_100062235 138
177 3300025284 Ga0209130_1003777 Ga0209130_10037777 138
178 3300025291 Ga0209675_1000106 Ga0209675_100010653 138
179 3300025291 Ga0209675_1000969 Ga0209675_100096913 138
180 3300025291 Ga0209675_1001478 Ga0209675_10014783 138
181 3300025292 Ga0209676_1000007 Ga0209676_1000007173 138
182 3300025292 Ga0209676_1012742 Ga0209676_10127424 138
183 3300025294 Ga0209025_1002157 Ga0209025_10021576 138
184 3300025294 Ga0209025_1002304 Ga0209025_10023045 138
185 3300025294 Ga0209025_1003224 Ga0209025_100322413 138
186 3300025294 Ga0209025_1010607 Ga0209025_10106072 138
187 3300025295 Ga0209564_1000487 Ga0209564_100048737 138
188 3300025295 Ga0209564_1002834 Ga0209564_100283418 138
189 3300025295 Ga0209564_1006635 Ga0209564_10066358 138
190 3300025297 Ga0209758_1005683 Ga0209758_100568313 138
191 3300025297 Ga0209758_1043515 Ga0209758_10435154 138
192 3300025298 Ga0209050_1000003 Ga0209050_10000031335 138
193 3300025298 Ga0209050_1000078 Ga0209050_1000078252 138
194 3300025298 Ga0209050_1004842 Ga0209050_10048425 138
195 3300025298 Ga0209050_1022600 Ga0209050_10226004 138
196 3300025299 Ga0209256_1000001 Ga0209256_10000011337 138
197 3300025299 Ga0209256_1000976 Ga0209256_10009765 138
198 3300025299 Ga0209256_1005893 Ga0209256_10058935 138
199 3300025302 Ga0207426_1000097 Ga0207426_100009742 138
200 3300025302 Ga0207426_1000988 Ga0207426_100098823 138
201 3300025302 Ga0207426_1001375 Ga0207426_100137516 138
202 3300025303 Ga0209051_1000003 Ga0209051_10000031335 138
203 3300025303 Ga0209051_1028039 Ga0209051_10280392 138
204 3300025304 Ga0209257_1000020 Ga0209257_1000020173 138
205 3300025304 Ga0209257_1000097 Ga0209257_1000097230 138
206 3300025935 Ga0207709_11488321 Ga0207709_114883212 138
207 3300031456 Ga0307513_10000017 Ga0307513_100000173 138
208 3300031548 Ga0307408_100006468 Ga0307408_1000064685 138
209 3300031548 Ga0307408_100009227 Ga0307408_1000092275 138
210 3300031730 Ga0307516_10188670 Ga0307516_101886704 138
211 3300032002 Ga0307416_102957567 Ga0307416_1029575671 138
212 3300041459 Ga0451800_1200240 Ga0451800_1200240_89_514 138
213 3300046492 Ga0495585_0002914 Ga0495585_0002914_7126_7542 138
214 3300046524 Ga0495648_0001863 Ga0495648_0001863_8013_8429 138
215 3300046524 Ga0495648_0011239 Ga0495648_0011239_2296_2712 138
216 3300046528 Ga0495642_0046277 Ga0495642_0046277_228_653 138
217 3300046530 Ga0495654_0004989 Ga0495654_0004989_3360_3776 138
218 3300046530 Ga0495654_0021025 Ga0495654_0021025_1257_1676 138
219 3300046542 Ga0495597_0000567 Ga0495597_0000567_22552_22968 138
220 3300046558 Ga0495633_0012156 Ga0495633_0012156_449_865 138
221 3300046558 Ga0495633_0043104 Ga0495633_0043104_341_757 138
222 3300046616 Ga0495668_0006379 Ga0495668_0006379_2874_3290 138
223 3300046660 Ga0495625_0152615 Ga0495625_0152615_233_649 138
224 3300046665 Ga0495661_0020711 Ga0495661_0020711_1676_2092 138
225 3300046692 Ga0495671_0000002 Ga0495671_0000002_473194_473610 138
226 3300046810 Ga0495660_0000362 Ga0495660_0000362_3754_4176 138
227 3300046810 Ga0495660_0009627 Ga0495660_0009627_3743_4159 138
228 3300047323 Ga0495683_0017419 Ga0495683_0017419_1097_1513 138
229 3300047469 Ga0495673_0000026 Ga0495673_0000026_360704_361120 138
230 3300047472 Ga0495686_0152109 Ga0495686_0152109_79_495 138
231 3300048921 Ga0496118_0007993 Ga0496118_0007993_3776_4198 138
232 3300048925 Ga0496122_0217696 Ga0496122_0217696_406_822 138
233 3300049573 Ga0501037_0245662 Ga0501037_0245662_764_1183 138
234 3300049665 Ga0501227_056700 Ga0501227_056700_286_702 138
235 3300049679 Ga0501249_000898 Ga0501249_000898_3639_4055 138
236 3300049766 Ga0501269_000669 Ga0501269_000669_635_1051 138
237 3300049775 Ga0501279_007950 Ga0501279_007950_943_1359 138
238 3300050489 nmdc:mga03683_12306_c1 nmdc:mga03683_12306_c1_135_551 138
239 3300050489 nmdc:mga03683_197195_c1 nmdc:mga03683_197195_c1_412_828 138
240 3300050493 nmdc:mga0k408_170706_c1 nmdc:mga0k408_170706_c1_762_1178 138
241 3300050494 nmdc:mga06z11_979197_c1 nmdc:mga06z11_979197_c1_78_494 138
242 3300053088 Ga0500644_0001498 Ga0500644_0001498_1475_1891 138
243 3300053125 Ga0500618_004853 Ga0500618_004853_196_612 138
244 3300053145 Ga0500586_007349 Ga0500586_007349_1707_2123 138
245 3300055283 Ga0500661_006186 Ga0500661_006186_1474_1890 138
246 iso_pu_bacteria 2919688452 2919690399 138
247 3300003761 Ga0055535_1000290 Ga0055535_100029027 139
248 3300003763 Ga0055529_1000158 Ga0055529_100015827 139
249 3300003791 Ga0055530_10003781 Ga0055530_100037816 139
250 3300003792 Ga0055540_1000260 Ga0055540_100026024 139
251 3300003794 Ga0055531_10006230 Ga0055531_100062306 139
252 3300005563 Ga0068855_100110533 Ga0068855_1001105333 139
253 3300005563 Ga0068855_100346254 Ga0068855_1003462542 139
254 3300009036 Ga0105244_10005002 Ga0105244_100050025 139
255 3300009176 Ga0105242_10002379 Ga0105242_1000237910 139
256 3300009551 Ga0105238_12197462 Ga0105238_121974622 139
257 3300013105 Ga0157369_10374460 Ga0157369_103744603 139
258 3300025233 Ga0209437_100072 Ga0209437_100072255 139
259 3300025242 Ga0209258_100110 Ga0209258_10011088 139
260 3300025254 Ga0209148_1005633 Ga0209148_10056332 139
261 3300025256 Ga0209759_1006504 Ga0209759_10065045 139
262 3300025272 Ga0209455_1000104 Ga0209455_100010488 139
263 3300025298 Ga0209050_1003829 Ga0209050_100382914 139
264 3300025303 Ga0209051_1000247 Ga0209051_100024724 139
265 3300025304 Ga0209257_1000141 Ga0209257_100014124 139
266 3300025728 Ga0207655_1012412 Ga0207655_10124124 139
267 3300025934 Ga0207686_10469255 Ga0207686_104692551 139
268 3300025939 Ga0207665_10228535 Ga0207665_102285352 139
269 3300025949 Ga0207667_10044315 Ga0207667_100443153 139
270 3300025949 Ga0207667_10800837 Ga0207667_108008372 139
271 3300026089 Ga0207648_10098100 Ga0207648_100981002 139
272 3300026142 Ga0207698_10774636 Ga0207698_107746362 139
273 3300037312 Ga0395899_0194843 Ga0395899_0194843_743_1186 139
274 3300037418 Ga0395900_0076572 Ga0395900_0076572_2469_2912 139
275 3300039447 Ga0436361_0505867 Ga0436361_0505867_230_679 139
276 3300044684 Ga0466966_0055000 Ga0466966_0055000_177_620 139
277 3300044693 Ga0466961_0333227 Ga0466961_0333227_38_481 139
278 3300044719 Ga0466971_0315751 Ga0466971_0315751_31_474 139
279 3300045049 Ga0466959_0601852 Ga0466959_0601852_265_708 139
280 3300045836 Ga0466958_0042750 Ga0466958_0042750_1444_1887 139
281 3300046463 Ga0495653_0000010 Ga0495653_0000010_261478_261897 139
282 3300046512 Ga0495610_0021196 Ga0495610_0021196_2271_2690 139
283 3300046512 Ga0495610_0230884 Ga0495610_0230884_75_584 139
284 3300048091 Ga0495626_0001005 Ga0495626_0001005_3273_3707 139
285 3300048923 Ga0496120_0019391 Ga0496120_0019391_2267_2686 139
286 3300048926 Ga0496123_0019941 Ga0496123_0019941_2540_2959 139
287 3300048928 Ga0496125_0001902 Ga0496125_0001902_20166_20585 139
288 3300002987 JGI25159J45721_1004099 JGI25159J45721_10040997 140
289 3300003320 rootH2_10141630 rootH2_101416304 140
290 3300003354 JGI25160J50197_1030441 JGI25160J50197_10304413 140
291 3300003760 Ga0055527_1003663 Ga0055527_10036634 140
292 3300003761 Ga0055535_1000115 Ga0055535_100011519 140
293 3300003762 Ga0055542_1000028 Ga0055542_1000028144 140
294 3300005262 Ga0065165_1019460 Ga0065165_10194604 140
295 3300005327 Ga0070658_11054427 Ga0070658_110544272 140
296 3300009098 Ga0105245_11159294 Ga0105245_111592942 140
297 3300009545 Ga0105237_10858644 Ga0105237_108586442 140
298 3300010375 Ga0105239_10102223 Ga0105239_101022231 140
299 3300013105 Ga0157369_11479001 Ga0157369_114790012 140
300 3300025228 Ga0209672_102138 Ga0209672_1021385 140
301 3300025229 Ga0209147_100878 Ga0209147_1008783 140
302 3300025242 Ga0209258_100067 Ga0209258_100067109 140
303 3300025254 Ga0209148_1000067 Ga0209148_1000067152 140
304 3300025284 Ga0209130_1001507 Ga0209130_100150715 140
305 3300025302 Ga0207426_1002116 Ga0207426_100211614 140
306 3300025909 Ga0207705_10820029 Ga0207705_108200291 140
307 3300025961 Ga0207712_10744990 Ga0207712_107449902 140
308 3300028794 Ga0307515_10000282 Ga0307515_1000028239 140
309 3300031649 Ga0307514_10003331 Ga0307514_1000333110 140
310 3300031727 Ga0316576_10027203 Ga0316576_100272034 140
311 3300031727 Ga0316576_10029075 Ga0316576_100290753 140
312 3300031728 Ga0316578_10150991 Ga0316578_101509912 140
313 3300031730 Ga0307516_10002079 Ga0307516_1000207911 140
314 3300031733 Ga0316577_10310978 Ga0316577_103109782 140
315 3300036712 Ga0316584_0072663 Ga0316584_0072663_1921_2373 140
316 3300042005 Ga0439448_0182845 Ga0439448_0182845_299_721 140
317 3300044735 Ga0466968_0242699 Ga0466968_0242699_258_680 140
318 3300046475 Ga0495639_0004616 Ga0495639_0004616_210_635 140
319 3300046492 Ga0495585_0300215 Ga0495585_0300215_74_517 140
320 3300046660 Ga0495625_0001835 Ga0495625_0001835_22343_22786 140
321 3300046683 Ga0495658_0693474 Ga0495658_0693474_195_620 140
322 3300049571 Ga0501034_0223556 Ga0501034_0223556_1037_1462 140
323 3300050489 nmdc:mga03683_93307_c1 nmdc:mga03683_93307_c1_334_759 140
324 3300050490 nmdc:mga03n38_51259_c1 nmdc:mga03n38_51259_c1_469_894 140
325 3300050493 nmdc:mga0k408_1070_c2 nmdc:mga0k408_1070_c2_4303_4728 140
326 3300050494 nmdc:mga06z11_93271_c1 nmdc:mga06z11_93271_c1_13_438 140
327 3300050496 nmdc:mga07m45_3515_c1 nmdc:mga07m45_3515_c1_4395_4820 140
328 3300053177 Ga0500636_0061848 Ga0500636_0061848_179_604 140
329 3300053730 Ga0500645_000114 Ga0500645_000114_16268_16690 140
330 3300005333 Ga0070677_10515308 Ga0070677_105153082 141
331 3300005354 Ga0070675_100858205 Ga0070675_1008582052 141
332 3300006846 Ga0075430_100184105 Ga0075430_1001841052 141
333 3300009098 Ga0105245_10233506 Ga0105245_102335064 141
334 3300009174 Ga0105241_10060994 Ga0105241_100609945 141
335 3300009176 Ga0105242_10185050 Ga0105242_101850502 141
336 3300009177 Ga0105248_11252211 Ga0105248_112522112 141
337 3300015262 Ga0182007_10003999 Ga0182007_100039994 141
338 3300025893 Ga0207682_10387804 Ga0207682_103878041 141
339 3300025926 Ga0207659_10407822 Ga0207659_104078223 141
340 3300026121 Ga0207683_10327314 Ga0207683_103273143 141
341 3300030733 Ga0314311_1152045 Ga0314311_11520453 141
342 3300030745 Ga0316182_1004301 Ga0316182_10043014 141
343 3300044656 Ga0466969_0032822 Ga0466969_0032822_2019_2453 141
344 3300044684 Ga0466966_0000008 Ga0466966_0000008_56398_56832 141
345 3300044693 Ga0466961_0001985 Ga0466961_0001985_5682_6116 141
346 3300044694 Ga0466963_0015782 Ga0466963_0015782_3474_3908 141
347 3300044842 Ga0466957_0112276 Ga0466957_0112276_588_1022 141
348 3300045049 Ga0466959_0036722 Ga0466959_0036722_1074_1508 141
349 3300050509 nmdc:mga0qj67_43291_c1 nmdc:mga0qj67_43291_c1_1439_1867 141
350 3300053139 Ga0500568_0018860 Ga0500568_0018860_1143_1586 141
351 3300061719 Ga0466962_0011690 Ga0466962_0011690_2532_2966 141
352 iso_pu_bacteria 2738541317 2738944703 141
353 iso_pu_bacteria 2913308742 2913309324 141
354 3300003775 Ga0055524_1000010 Ga0055524_100001069 142
355 3300006038 Ga0075365_10197629 Ga0075365_101976292 142
356 3300006042 Ga0075368_10001280 Ga0075368_100012806 142
357 3300006048 Ga0075363_100007512 Ga0075363_1000075125 142
358 3300006051 Ga0075364_10019614 Ga0075364_100196145 142
359 3300006177 Ga0075362_10007618 Ga0075362_100076185 142
360 3300006178 Ga0075367_10015498 Ga0075367_100154982 142
361 3300006195 Ga0075366_10014741 Ga0075366_100147415 142
362 3300006195 Ga0075366_10046227 Ga0075366_100462272 142
363 3300006353 Ga0075370_10244660 Ga0075370_102446602 142
364 3300006948 Ga0099826_10000002 Ga0099826_10000002366 142
365 3300009036 Ga0105244_10009242 Ga0105244_100092426 142
366 3300011119 Ga0105246_10064976 Ga0105246_100649764 142
367 3300013102 Ga0157371_10004426 Ga0157371_1000442613 142
368 3300015261 Ga0182006_1011283 Ga0182006_10112834 142
369 3300017792 Ga0163161_10453474 Ga0163161_104534742 142
370 3300021361 Ga0213872_10000384 Ga0213872_1000038422 142
371 3300025263 Ga0209565_1010299 Ga0209565_10102993 142
372 3300025299 Ga0209256_1000007 Ga0209256_1000007447 142
373 3300027666 Ga0209282_1000001 Ga0209282_1000001783 142
374 3300027866 Ga0209813_10029137 Ga0209813_100291372 142
375 3300028786 Ga0307517_10255853 Ga0307517_102558531 142
376 3300028800 Ga0265338_10000057 Ga0265338_1000005746 142
377 3300031344 Ga0265316_10435577 Ga0265316_104355771 142
378 3300039447 Ga0436361_0816616 Ga0436361_0816616_47_478 142
379 3300039447 Ga0436361_1170005 Ga0436361_1170005_15639_16067 142
380 3300042010 Ga0439452_000004 Ga0439452_000004_132369_132803 142
381 3300046507 Ga0495606_0052343 Ga0495606_0052343_1574_2020 142
382 3300046522 Ga0495643_0113304 Ga0495643_0113304_856_1287 142
383 3300046542 Ga0495597_0007752 Ga0495597_0007752_2693_3124 142
384 3300046558 Ga0495633_0311744 Ga0495633_0311744_47_475 142
385 3300047443 Ga0495687_000502 Ga0495687_000502_3333_3764 142
386 3300048091 Ga0495626_0090173 Ga0495626_0090173_501_932 142
387 3300048907 Ga0496104_0416507 Ga0496104_0416507_781_1221 142
388 3300048912 Ga0496109_0022976 Ga0496109_0022976_1867_2295 142
389 3300048919 Ga0496116_0000103 Ga0496116_0000103_60327_60761 142
390 3300048920 Ga0496117_0000259 Ga0496117_0000259_11139_11573 142
391 3300048927 Ga0496124_0013961 Ga0496124_0013961_2163_2597 142
392 3300050489 nmdc:mga03683_7855_c1 nmdc:mga03683_7855_c1_3174_3602 142
393 3300050490 nmdc:mga03n38_1017_c1 nmdc:mga03n38_1017_c1_4838_5266 142
394 3300050491 nmdc:mga00v17_14316_c1 nmdc:mga00v17_14316_c1_2834_3262 142
395 3300050492 nmdc:mga0yw44_18425_c1 nmdc:mga0yw44_18425_c1_351_779 142
396 3300050493 nmdc:mga0k408_38300_c1 nmdc:mga0k408_38300_c1_2155_2583 142
397 3300050493 nmdc:mga0k408_7031_c1 nmdc:mga0k408_7031_c1_224_655 142
398 3300050494 nmdc:mga06z11_51325_c1 nmdc:mga06z11_51325_c1_1034_1462 142
399 3300050495 nmdc:mga04h51_66769_c1 nmdc:mga04h51_66769_c1_651_1079 142
400 3300050496 nmdc:mga07m45_18843_c1 nmdc:mga07m45_18843_c1_2422_2850 142
401 3300050516 nmdc:mga0sz30_154227_c1 nmdc:mga0sz30_154227_c1_57_485 142
402 iso_pu_bacteria 2643221672 2644401041 142
403 iso_pu_bacteria 2919046199 2919046760 142
404 iso_pu_bacteria 2928070936 2928072673 142
405 3300001990 JGI24737J22298_10058755 JGI24737J22298_100587552 143
406 3300002705 JGI25156J39149_1000502 JGI25156J39149_100050213 143
407 3300002705 JGI25156J39149_1038461 JGI25156J39149_10384611 143
408 3300003187 JGI25151J46595_10041741 JGI25151J46595_100417413 143
409 3300003322 rootL2_10233829 rootL2_102338292 143
410 3300003756 Ga0055533_1000351 Ga0055533_10003518 143
411 3300003756 Ga0055533_1000485 Ga0055533_10004859 143
412 3300003781 Ga0055536_1000286 Ga0055536_100028634 143
413 3300003792 Ga0055540_1037262 Ga0055540_10372621 143
414 3300005328 Ga0070676_10123841 Ga0070676_101238411 143
415 3300005330 Ga0070690_100078515 Ga0070690_1000785153 143
416 3300005331 Ga0070670_101493928 Ga0070670_1014939282 143
417 3300005333 Ga0070677_10044804 Ga0070677_100448043 143
418 3300005334 Ga0068869_100028125 Ga0068869_1000281254 143
419 3300005335 Ga0070666_10027614 Ga0070666_100276144 143
420 3300005338 Ga0068868_100000189 Ga0068868_1000001894 143
421 3300005343 Ga0070687_100478154 Ga0070687_1004781542 143
422 3300005356 Ga0070674_100572428 Ga0070674_1005724282 143
423 3300005364 Ga0070673_100001117 Ga0070673_1000011176 143
424 3300005364 Ga0070673_100226328 Ga0070673_1002263282 143
425 3300005365 Ga0070688_100027498 Ga0070688_1000274982 143
426 3300005366 Ga0070659_100776201 Ga0070659_1007762012 143
427 3300005367 Ga0070667_100001328 Ga0070667_10000132812 143
428 3300005367 Ga0070667_100072464 Ga0070667_1000724643 143
429 3300005367 Ga0070667_101141698 Ga0070667_1011416982 143
430 3300005455 Ga0070663_100055204 Ga0070663_1000552042 143
431 3300005456 Ga0070678_100001606 Ga0070678_1000016065 143
432 3300005457 Ga0070662_100201340 Ga0070662_1002013402 143
433 3300005457 Ga0070662_100371986 Ga0070662_1003719863 143
434 3300005466 Ga0070685_10253005 Ga0070685_102530052 143
435 3300005539 Ga0068853_100227595 Ga0068853_1002275952 143
436 3300005543 Ga0070672_100072840 Ga0070672_1000728405 143
437 3300005564 Ga0070664_100979455 Ga0070664_1009794552 143
438 3300005577 Ga0068857_100075627 Ga0068857_1000756272 143
439 3300005578 Ga0068854_100068921 Ga0068854_1000689214 143
440 3300005616 Ga0068852_100176013 Ga0068852_1001760132 143
441 3300005617 Ga0068859_101022405 Ga0068859_1010224052 143
442 3300005618 Ga0068864_100003331 Ga0068864_1000033315 143
443 3300005840 Ga0068870_10103237 Ga0068870_101032371 143
444 3300005841 Ga0068863_100035873 Ga0068863_1000358735 143
445 3300005842 Ga0068858_100228714 Ga0068858_1002287144 143
446 3300005843 Ga0068860_100157401 Ga0068860_1001574011 143
447 3300006048 Ga0075363_100126416 Ga0075363_1001264162 143
448 3300006048 Ga0075363_100387195 Ga0075363_1003871952 143
449 3300006177 Ga0075362_10023506 Ga0075362_100235062 143
450 3300006178 Ga0075367_10007127 Ga0075367_100071275 143
451 3300006186 Ga0075369_10091665 Ga0075369_100916652 143
452 3300006195 Ga0075366_10016319 Ga0075366_100163196 143
453 3300006237 Ga0097621_100236833 Ga0097621_1002368333 143
454 3300006353 Ga0075370_10000134 Ga0075370_1000013411 143
455 3300006353 Ga0075370_10169946 Ga0075370_101699462 143
456 3300006358 Ga0068871_100024161 Ga0068871_1000241614 143
457 3300006358 Ga0068871_100378027 Ga0068871_1003780273 143
458 3300006931 Ga0097620_101022410 Ga0097620_1010224102 143
459 3300009177 Ga0105248_10044730 Ga0105248_100447305 143
460 3300009177 Ga0105248_10755082 Ga0105248_107550822 143
461 3300013296 Ga0157374_10031619 Ga0157374_100316195 143
462 3300013306 Ga0163162_10063034 Ga0163162_100630345 143
463 3300013308 Ga0157375_11489158 Ga0157375_114891582 143
464 3300013308 Ga0157375_11503549 Ga0157375_115035492 143
465 3300014325 Ga0163163_10027737 Ga0163163_100277375 143
466 3300014326 Ga0157380_10655846 Ga0157380_106558462 143
467 3300014968 Ga0157379_10002348 Ga0157379_100023486 143
468 3300014969 Ga0157376_10034752 Ga0157376_100347524 143
469 3300014969 Ga0157376_10272567 Ga0157376_102725673 143
470 3300015262 Ga0182007_10001013 Ga0182007_1000101313 143
471 3300017792 Ga0163161_10233239 Ga0163161_102332392 143
472 3300017792 Ga0163161_10633617 Ga0163161_106336172 143
473 3300025226 Ga0209674_100048 Ga0209674_100048263 143
474 3300025226 Ga0209674_100167 Ga0209674_10016757 143
475 3300025256 Ga0209759_1000002 Ga0209759_1000002150 143
476 3300025256 Ga0209759_1000032 Ga0209759_100003251 143
477 3300025256 Ga0209759_1000096 Ga0209759_1000096121 143
478 3300025256 Ga0209759_1001112 Ga0209759_10011127 143
479 3300025292 Ga0209676_1000838 Ga0209676_10008389 143
480 3300025294 Ga0209025_1001118 Ga0209025_10011189 143
481 3300025294 Ga0209025_1006471 Ga0209025_10064714 143
482 3300025303 Ga0209051_1014258 Ga0209051_10142584 143
483 3300025893 Ga0207682_10040443 Ga0207682_100404432 143
484 3300025901 Ga0207688_10037434 Ga0207688_100374345 143
485 3300025903 Ga0207680_10017945 Ga0207680_100179455 143
486 3300025904 Ga0207647_10007532 Ga0207647_100075323 143
487 3300025914 Ga0207671_10611980 Ga0207671_106119801 143
488 3300025926 Ga0207659_10003012 Ga0207659_100030122 143
489 3300025931 Ga0207644_11867689 Ga0207644_118676891 143
490 3300025933 Ga0207706_10220087 Ga0207706_102200873 143
491 3300025933 Ga0207706_10222786 Ga0207706_102227863 143
492 3300025933 Ga0207706_10527960 Ga0207706_105279602 143
493 3300025937 Ga0207669_10413131 Ga0207669_104131312 143
494 3300025938 Ga0207704_10564933 Ga0207704_105649332 143
495 3300025941 Ga0207711_10008678 Ga0207711_100086788 143
496 3300025942 Ga0207689_10039143 Ga0207689_100391434 143
497 3300025960 Ga0207651_10058430 Ga0207651_100584303 143
498 3300025981 Ga0207640_10060214 Ga0207640_100602142 143
499 3300025981 Ga0207640_10208791 Ga0207640_102087913 143
500 3300025986 Ga0207658_10006229 Ga0207658_100062295 143
501 3300025986 Ga0207658_10186927 Ga0207658_101869271 143
502 3300025986 Ga0207658_10310958 Ga0207658_103109582 143
503 3300026023 Ga0207677_10000891 Ga0207677_100008918 143
504 3300026067 Ga0207678_10074895 Ga0207678_100748952 143
505 3300026088 Ga0207641_10016984 Ga0207641_100169845 143
506 3300026089 Ga0207648_10553455 Ga0207648_105534552 143
507 3300026116 Ga0207674_10054909 Ga0207674_100549093 143
508 3300026121 Ga0207683_10022854 Ga0207683_100228545 143
509 3300026142 Ga0207698_10209466 Ga0207698_102094662 143
510 3300028381 Ga0268264_10132647 Ga0268264_101326474 143
511 3300031548 Ga0307408_100040713 Ga0307408_1000407135 143
512 3300031548 Ga0307408_100051022 Ga0307408_1000510223 143
513 3300031824 Ga0307413_12017310 Ga0307413_120173101 143
514 3300031995 Ga0307409_100921698 Ga0307409_1009216982 143
515 3300032002 Ga0307416_100067405 Ga0307416_1000674052 143
516 3300032004 Ga0307414_10147406 Ga0307414_101474061 143
517 3300032005 Ga0307411_10287822 Ga0307411_102878222 143
518 3300037471 Ga0395905_0000035 Ga0395905_0000035_45702_46133 143
519 3300041997 Ga0439431_0213455 Ga0439431_0213455_69_500 143
520 3300042007 Ga0439449_0137689 Ga0439449_0137689_100_531 143
521 3300042014 Ga0439457_123487 Ga0439457_123487_43_474 143
522 3300042015 Ga0439462_0095897 Ga0439462_0095897_13_444 143
523 3300046455 Ga0495603_0000088 Ga0495603_0000088_25535_25990 143
524 3300046457 Ga0495590_0019251 Ga0495590_0019251_1793_2248 143
525 3300046459 Ga0495629_0001578 Ga0495629_0001578_14715_15146 143
526 3300046459 Ga0495629_0001651 Ga0495629_0001651_13969_14424 143
527 3300046459 Ga0495629_0025278 Ga0495629_0025278_1149_1580 143
528 3300046459 Ga0495629_0075758 Ga0495629_0075758_546_977 143
529 3300046462 Ga0495651_0000727 Ga0495651_0000727_20600_21031 143
530 3300046463 Ga0495653_0000573 Ga0495653_0000573_25360_25791 143
531 3300046463 Ga0495653_0029427 Ga0495653_0029427_1864_2295 143
532 3300046463 Ga0495653_0031645 Ga0495653_0031645_56_487 143
533 3300046471 Ga0495650_0075639 Ga0495650_0075639_96_551 143
534 3300046472 Ga0495580_0001753 Ga0495580_0001753_16139_16570 143
535 3300046472 Ga0495580_0005225 Ga0495580_0005225_7293_7724 143
536 3300046472 Ga0495580_0005577 Ga0495580_0005577_7511_7966 143
537 3300046473 Ga0495582_0121741 Ga0495582_0121741_618_1049 143
538 3300046474 Ga0495605_0007017 Ga0495605_0007017_2721_3176 143
539 3300046476 Ga0495662_0478163 Ga0495662_0478163_147_578 143
540 3300046477 Ga0495664_0107616 Ga0495664_0107616_622_1053 143
541 3300046491 Ga0495584_0020617 Ga0495584_0020617_1730_2185 143
542 3300046500 Ga0495596_0039376 Ga0495596_0039376_1099_1530 143
543 3300046500 Ga0495596_0066504 Ga0495596_0066504_485_916 143
544 3300046506 Ga0495583_0032653 Ga0495583_0032653_1790_2221 143
545 3300046507 Ga0495606_0164520 Ga0495606_0164520_815_1246 143
546 3300046507 Ga0495606_0446175 Ga0495606_0446175_99_554 143
547 3300046511 Ga0495608_0484735 Ga0495608_0484735_58_489 143
548 3300046513 Ga0495616_0007358 Ga0495616_0007358_4799_5254 143
549 3300046514 Ga0495618_0029802 Ga0495618_0029802_2920_3351 143
550 3300046514 Ga0495618_0072038 Ga0495618_0072038_82_513 143
551 3300046514 Ga0495618_0077661 Ga0495618_0077661_1462_1893 143
552 3300046516 Ga0495628_0028221 Ga0495628_0028221_192_623 143
553 3300046516 Ga0495628_0033309 Ga0495628_0033309_2668_3099 143
554 3300046516 Ga0495628_0326075 Ga0495628_0326075_67_498 143
555 3300046517 Ga0495630_0008911 Ga0495630_0008911_6119_6550 143
556 3300046517 Ga0495630_0009796 Ga0495630_0009796_2388_2819 143
557 3300046524 Ga0495648_0015932 Ga0495648_0015932_4802_5233 143
558 3300046524 Ga0495648_0172871 Ga0495648_0172871_290_721 143
559 3300046526 Ga0495666_0000893 Ga0495666_0000893_2475_2906 143
560 3300046526 Ga0495666_0001632 Ga0495666_0001632_5289_5720 143
561 3300046526 Ga0495666_0040451 Ga0495666_0040451_732_1187 143
562 3300046528 Ga0495642_0058542 Ga0495642_0058542_509_964 143
563 3300046529 Ga0495652_0001267 Ga0495652_0001267_2500_2931 143
564 3300046529 Ga0495652_0078627 Ga0495652_0078627_1579_2010 143
565 3300046531 Ga0495665_0000466 Ga0495665_0000466_2494_2925 143
566 3300046531 Ga0495665_0089082 Ga0495665_0089082_670_1101 143
567 3300046533 Ga0495640_0011186 Ga0495640_0011186_4027_4458 143
568 3300046533 Ga0495640_0098853 Ga0495640_0098853_1351_1782 143
569 3300046535 Ga0495586_0000626 Ga0495586_0000626_17444_17875 143
570 3300046535 Ga0495586_0056963 Ga0495586_0056963_1670_2101 143
571 3300046542 Ga0495597_0125286 Ga0495597_0125286_552_1007 143
572 3300046543 Ga0495645_0033419 Ga0495645_0033419_3063_3518 143
573 3300046543 Ga0495645_0193410 Ga0495645_0193410_98_529 143
574 3300046543 Ga0495645_0486291 Ga0495645_0486291_210_641 143
575 3300046557 Ga0495622_0012142 Ga0495622_0012142_2992_3447 143
576 3300046642 Ga0495634_0032866 Ga0495634_0032866_647_1078 143
577 3300046665 Ga0495661_0009208 Ga0495661_0009208_3589_4020 143
578 3300046665 Ga0495661_0046866 Ga0495661_0046866_320_751 143
579 3300046678 Ga0495599_0044818 Ga0495599_0044818_1989_2420 143
580 3300046678 Ga0495599_0298842 Ga0495599_0298842_132_563 143
581 3300046679 Ga0495623_0001937 Ga0495623_0001937_5819_6250 143
582 3300046679 Ga0495623_0016318 Ga0495623_0016318_77_508 143
583 3300046679 Ga0495623_0055865 Ga0495623_0055865_1418_1849 143
584 3300046680 Ga0495646_0026058 Ga0495646_0026058_2163_2594 143
585 3300046689 Ga0495613_0003365 Ga0495613_0003365_8174_8605 143
586 3300046689 Ga0495613_0004731 Ga0495613_0004731_4483_4914 143
587 3300046689 Ga0495613_0294181 Ga0495613_0294181_236_691 143
588 3300046690 Ga0495624_0001213 Ga0495624_0001213_2472_2903 143
589 3300046690 Ga0495624_0001465 Ga0495624_0001465_1749_2180 143
590 3300046692 Ga0495671_0102142 Ga0495671_0102142_78_533 143
591 3300046694 Ga0495649_0130007 Ga0495649_0130007_326_781 143
592 3300046794 Ga0495589_0015735 Ga0495589_0015735_1815_2270 143
593 3300046794 Ga0495589_0164678 Ga0495589_0164678_428_859 143
594 3300046810 Ga0495660_0000799 Ga0495660_0000799_19267_19707 143
595 3300047315 Ga0495581_0049111 Ga0495581_0049111_1532_1963 143
596 3300047315 Ga0495581_0233335 Ga0495581_0233335_16_471 143
597 3300047315 Ga0495581_0579374 Ga0495581_0579374_23_454 143
598 3300047317 Ga0495604_0018202 Ga0495604_0018202_2758_3189 143
599 3300047317 Ga0495604_0102522 Ga0495604_0102522_981_1412 143
600 3300047319 Ga0495674_0000653 Ga0495674_0000653_27000_27431 143
601 3300047319 Ga0495674_0000913 Ga0495674_0000913_2489_2920 143
602 3300047319 Ga0495674_0003203 Ga0495674_0003203_13481_13936 143
603 3300047320 Ga0495672_0009463 Ga0495672_0009463_6078_6509 143
604 3300047320 Ga0495672_0028450 Ga0495672_0028450_548_1003 143
605 3300047321 Ga0495676_0075526 Ga0495676_0075526_1509_1940 143
606 3300047321 Ga0495676_0118909 Ga0495676_0118909_1057_1488 143
607 3300047322 Ga0495680_0006739 Ga0495680_0006739_2871_3302 143
608 3300047322 Ga0495680_0011532 Ga0495680_0011532_3179_3610 143
609 3300047323 Ga0495683_0002499 Ga0495683_0002499_7049_7480 143
610 3300047443 Ga0495687_040005 Ga0495687_040005_251_706 143
611 3300047444 Ga0495675_0232502 Ga0495675_0232502_132_563 143
612 3300047445 Ga0495677_0246379 Ga0495677_0246379_131_586 143
613 3300047446 Ga0495679_000489 Ga0495679_000489_25317_25748 143
614 3300047446 Ga0495679_006544 Ga0495679_006544_1968_2399 143
615 3300047446 Ga0495679_037010 Ga0495679_037010_239_694 143
616 3300047447 Ga0495685_033437 Ga0495685_033437_1265_1720 143
617 3300047469 Ga0495673_0003513 Ga0495673_0003513_6221_6676 143
618 3300047469 Ga0495673_0024334 Ga0495673_0024334_2150_2581 143
619 3300047471 Ga0495684_0616158 Ga0495684_0616158_243_674 143
620 3300047673 Ga0495593_0019136 Ga0495593_0019136_2285_2716 143
621 3300047673 Ga0495593_0042873 Ga0495593_0042873_186_617 143
622 3300048088 Ga0495602_0001757 Ga0495602_0001757_2804_3235 143
623 3300048088 Ga0495602_0002700 Ga0495602_0002700_11937_12368 143
624 3300048088 Ga0495602_0006511 Ga0495602_0006511_7121_7552 143
625 3300048088 Ga0495602_0184440 Ga0495602_0184440_498_929 143
626 3300048089 Ga0495614_0000279 Ga0495614_0000279_2472_2903 143
627 3300048089 Ga0495614_0323001 Ga0495614_0323001_29_460 143
628 3300048904 Ga0496101_0073397 Ga0496101_0073397_421_876 143
629 3300048905 Ga0496102_0180280 Ga0496102_0180280_698_1129 143
630 3300048906 Ga0496103_0549463 Ga0496103_0549463_268_699 143
631 3300048907 Ga0496104_0042817 Ga0496104_0042817_3450_3905 143
632 3300048908 Ga0496105_0009938 Ga0496105_0009938_2735_3190 143
633 3300048908 Ga0496105_0334706 Ga0496105_0334706_221_655 143
634 3300048909 Ga0496106_0142179 Ga0496106_0142179_1129_1584 143
635 3300048910 Ga0496107_0440096 Ga0496107_0440096_206_637 143
636 3300048913 Ga0496110_0621542 Ga0496110_0621542_136_591 143
637 3300048915 Ga0496112_0012047 Ga0496112_0012047_704_1159 143
638 3300048916 Ga0496113_0000380 Ga0496113_0000380_11643_12098 143
639 3300048916 Ga0496113_1140884 Ga0496113_1140884_121_555 143
640 3300048917 Ga0496114_1236166 Ga0496114_1236166_47_481 143
641 3300048919 Ga0496116_0014154 Ga0496116_0014154_5690_6121 143
642 3300048920 Ga0496117_0394838 Ga0496117_0394838_215_649 143
643 3300048921 Ga0496118_0001478 Ga0496118_0001478_8687_9121 143
644 3300048921 Ga0496118_0098715 Ga0496118_0098715_1297_1728 143
645 3300048922 Ga0496119_0344444 Ga0496119_0344444_257_712 143
646 3300048924 Ga0496121_0053401 Ga0496121_0053401_729_1181 143
647 3300048924 Ga0496121_0144609 Ga0496121_0144609_511_966 143
648 3300049460 Ga0495682_0010393 Ga0495682_0010393_2595_3050 143
649 3300050490 nmdc:mga03n38_553999_c1 nmdc:mga03n38_553999_c1_20_457 143
650 3300050493 nmdc:mga0k408_4660_c1 nmdc:mga0k408_4660_c1_3224_3661 143
651 3300050496 nmdc:mga07m45_1404_c1 nmdc:mga07m45_1404_c1_8696_9133 143
652 3300053136 Ga0500559_0002116 Ga0500559_0002116_5837_6286 143
653 iso_pu_bacteria 2562617112 2563056909 143
654 iso_pu_bacteria 2711768613 2713481070 143
655 3300003752 Ga0055539_1000051 Ga0055539_1000051125 144
656 3300003756 Ga0055533_1000025 Ga0055533_100002575 144
657 3300003759 Ga0055525_1001177 Ga0055525_10011774 144
658 3300003761 Ga0055535_1009426 Ga0055535_10094263 144
659 3300005290 Ga0065712_10511677 Ga0065712_105116771 144
660 3300005331 Ga0070670_100029119 Ga0070670_1000291195 144
661 3300005339 Ga0070660_100515292 Ga0070660_1005152921 144
662 3300005354 Ga0070675_100254930 Ga0070675_1002549302 144
663 3300005355 Ga0070671_100104819 Ga0070671_1001048193 144
664 3300005356 Ga0070674_100034350 Ga0070674_1000343504 144
665 3300005459 Ga0068867_100027885 Ga0068867_1000278854 144
666 3300005539 Ga0068853_101068004 Ga0068853_1010680041 144
667 3300005841 Ga0068863_100189691 Ga0068863_1001896912 144
668 3300006195 Ga0075366_10181799 Ga0075366_101817993 144
669 3300006195 Ga0075366_10285626 Ga0075366_102856261 144
670 3300006358 Ga0068871_101874436 Ga0068871_1018744362 144
671 3300006914 Ga0075436_100049187 Ga0075436_1000491872 144
672 3300007076 Ga0075435_100558647 Ga0075435_1005586472 144
673 3300009176 Ga0105242_11446107 Ga0105242_114461072 144
674 3300009177 Ga0105248_10134284 Ga0105248_101342845 144
675 3300009177 Ga0105248_11281778 Ga0105248_112817781 144
676 3300013296 Ga0157374_10675739 Ga0157374_106757392 144
677 3300013306 Ga0163162_10363558 Ga0163162_103635583 144
678 3300014969 Ga0157376_10488341 Ga0157376_104883411 144
679 3300017792 Ga0163161_10265900 Ga0163161_102659002 144
680 3300025226 Ga0209674_100007 Ga0209674_100007436 144
681 3300025230 Ga0209563_100052 Ga0209563_100052175 144
682 3300025242 Ga0209258_100789 Ga0209258_1007899 144
683 3300025253 Ga0209677_100015 Ga0209677_100015355 144
684 3300025256 Ga0209759_1001795 Ga0209759_10017952 144
685 3300025256 Ga0209759_1004056 Ga0209759_10040564 144
686 3300025919 Ga0207657_10344044 Ga0207657_103440442 144
687 3300025925 Ga0207650_10204675 Ga0207650_102046754 144
688 3300025926 Ga0207659_10449109 Ga0207659_104491092 144
689 3300025931 Ga0207644_10274435 Ga0207644_102744352 144
690 3300025932 Ga0207690_10320659 Ga0207690_103206592 144
691 3300025934 Ga0207686_10885598 Ga0207686_108855982 144
692 3300025941 Ga0207711_10291446 Ga0207711_102914463 144
693 3300026088 Ga0207641_10273085 Ga0207641_102730854 144
694 3300026088 Ga0207641_11052935 Ga0207641_110529351 144
695 3300026089 Ga0207648_10096500 Ga0207648_100965004 144
696 3300026095 Ga0207676_10482591 Ga0207676_104825912 144
697 3300026121 Ga0207683_10076963 Ga0207683_100769633 144
698 3300028379 Ga0268266_10897411 Ga0268266_108974111 144
699 3300034820 Ga0373959_0066663 Ga0373959_0066663_323_757 144
700 3300035086 Ga0373934_0040794 Ga0373934_0040794_144_584 144
701 3300035691 Ga0373931_0260070 Ga0373931_0260070_487_939 144
702 3300042004 Ga0439445_0179493 Ga0439445_0179493_142_576 144
703 3300046463 Ga0495653_0253308 Ga0495653_0253308_720_1154 144
704 3300046492 Ga0495585_0000003 Ga0495585_0000003_101408_101842 144
705 3300046513 Ga0495616_0002197 Ga0495616_0002197_11835_12269 144
706 3300046517 Ga0495630_0145687 Ga0495630_0145687_832_1266 144
707 3300046524 Ga0495648_0000011 Ga0495648_0000011_26499_26933 144
708 3300046648 Ga0495611_0082400 Ga0495611_0082400_983_1417 144
709 3300047673 Ga0495593_0032816 Ga0495593_0032816_52_486 144
710 3300048903 Ga0496100_0475345 Ga0496100_0475345_107_541 144
711 3300048912 Ga0496109_0331860 Ga0496109_0331860_896_1330 144
712 3300048918 Ga0496115_0276047 Ga0496115_0276047_520_954 144
713 3300049568 Ga0501031_0480610 Ga0501031_0480610_327_767 144
714 3300049572 Ga0501036_0294807 Ga0501036_0294807_644_1102 144
715 3300049572 Ga0501036_0408233 Ga0501036_0408233_466_903 144
716 3300049573 Ga0501037_0924547 Ga0501037_0924547_51_491 144
717 3300049578 Ga0501042_0473816 Ga0501042_0473816_378_812 144
718 3300049579 Ga0501043_0000371 Ga0501043_0000371_18974_19411 144
719 3300049579 Ga0501043_0691002 Ga0501043_0691002_77_535 144
720 3300049580 Ga0501046_0000488 Ga0501046_0000488_20210_20647 144
721 3300049580 Ga0501046_0440833 Ga0501046_0440833_348_806 144
722 3300049581 Ga0501047_0000564 Ga0501047_0000564_18973_19410 144
723 3300049581 Ga0501047_0385498 Ga0501047_0385498_160_618 144
724 3300049582 Ga0501048_0001830 Ga0501048_0001830_10245_10682 144
725 3300049588 Ga0501072_0525712 Ga0501072_0525712_210_644 144
726 3300049592 Ga0501076_0394330 Ga0501076_0394330_605_1039 144
727 3300049742 Ga0501080_0698990 Ga0501080_0698990_16_456 144
728 3300049743 Ga0501081_0623619 Ga0501081_0623619_276_710 144
729 3300049822 Ga0501035_0052513 Ga0501035_0052513_474_932 144
730 3300049823 Ga0501044_0050386 Ga0501044_0050386_2394_2852 144
731 3300050493 nmdc:mga0k408_12270_c1 nmdc:mga0k408_12270_c1_698_1132 144
732 3300050514 nmdc:mga08x19_32067_c1 nmdc:mga08x19_32067_c1_350_802 144
733 3300061734 Ga0530510_0520639 Ga0530510_0520639_90_524 144
734 3300003320 rootH2_10003443 rootH2_100034433 145
735 3300003781 Ga0055536_1000891 Ga0055536_100089112 145
736 3300003792 Ga0055540_1001142 Ga0055540_100114210 145
737 3300003792 Ga0055540_1001176 Ga0055540_100117610 145
738 3300003794 Ga0055531_10000572 Ga0055531_1000057225 145
739 3300005262 Ga0065165_1020123 Ga0065165_10201233 145
740 3300005330 Ga0070690_100312796 Ga0070690_1003127962 145
741 3300005331 Ga0070670_100098633 Ga0070670_1000986332 145
742 3300005364 Ga0070673_100141898 Ga0070673_1001418982 145
743 3300005367 Ga0070667_100006773 Ga0070667_1000067732 145
744 3300005367 Ga0070667_100445959 Ga0070667_1004459592 145
745 3300005445 Ga0070708_100205972 Ga0070708_1002059723 145
746 3300005467 Ga0070706_100926971 Ga0070706_1009269711 145
747 3300005543 Ga0070672_100117953 Ga0070672_1001179534 145
748 3300005548 Ga0070665_100244733 Ga0070665_1002447332 145
749 3300005617 Ga0068859_100577050 Ga0068859_1005770503 145
750 3300005841 Ga0068863_100119757 Ga0068863_1001197573 145
751 3300005841 Ga0068863_100539022 Ga0068863_1005390221 145
752 3300006058 Ga0075432_10059985 Ga0075432_100599852 145
753 3300006195 Ga0075366_10046561 Ga0075366_100465614 145
754 3300006237 Ga0097621_100311606 Ga0097621_1003116062 145
755 3300006353 Ga0075370_10000147 Ga0075370_1000014721 145
756 3300006353 Ga0075370_10000900 Ga0075370_100009004 145
757 3300006358 Ga0068871_101577400 Ga0068871_1015774001 145
758 3300006931 Ga0097620_100577108 Ga0097620_1005771083 145
759 3300007076 Ga0075435_100355911 Ga0075435_1003559112 145
760 3300009545 Ga0105237_10035515 Ga0105237_100355155 145
761 3300013306 Ga0163162_10076553 Ga0163162_100765535 145
762 3300013308 Ga0157375_10391485 Ga0157375_103914852 145
763 3300014969 Ga0157376_10246816 Ga0157376_102468161 145
764 3300015683 Ga0183362_10012 Ga0183362_1001218 145
765 3300021361 Ga0213872_10077022 Ga0213872_100770223 145
766 3300025292 Ga0209676_1000385 Ga0209676_100038517 145
767 3300025292 Ga0209676_1000873 Ga0209676_100087312 145
768 3300025298 Ga0209050_1001437 Ga0209050_100143716 145
769 3300025303 Ga0209051_1000137 Ga0209051_100013732 145
770 3300025303 Ga0209051_1000773 Ga0209051_100077313 145
771 3300025304 Ga0209257_1000205 Ga0209257_100020535 145
772 3300025893 Ga0207682_10034635 Ga0207682_100346352 145
773 3300025914 Ga0207671_10055406 Ga0207671_100554063 145
774 3300025925 Ga0207650_10074960 Ga0207650_100749604 145
775 3300025933 Ga0207706_11013236 Ga0207706_110132361 145
776 3300025940 Ga0207691_10274331 Ga0207691_102743313 145
777 3300025941 Ga0207711_10184568 Ga0207711_101845682 145
778 3300025960 Ga0207651_10306146 Ga0207651_103061462 145
779 3300025986 Ga0207658_10058095 Ga0207658_100580955 145
780 3300025986 Ga0207658_10068569 Ga0207658_100685692 145
781 3300026023 Ga0207677_11156568 Ga0207677_111565681 145
782 3300026088 Ga0207641_10073571 Ga0207641_100735713 145
783 3300026088 Ga0207641_10583461 Ga0207641_105834611 145
784 3300026089 Ga0207648_10594571 Ga0207648_105945713 145
785 3300028379 Ga0268266_10198180 Ga0268266_101981802 145
786 3300031251 Ga0265327_10007098 Ga0265327_100070988 145
787 3300031507 Ga0307509_10066421 Ga0307509_100664213 145
788 3300031616 Ga0307508_10030006 Ga0307508_100300066 145
789 3300031649 Ga0307514_10412800 Ga0307514_104128001 145
790 3300035088 Ga0373940_0179290 Ga0373940_0179290_95_535 145
791 3300035691 Ga0373931_0074308 Ga0373931_0074308_1264_1704 145
792 3300037312 Ga0395899_0251771 Ga0395899_0251771_621_1058 145
793 3300037418 Ga0395900_0652159 Ga0395900_0652159_160_597 145
794 3300037466 Ga0395898_0053933 Ga0395898_0053933_2756_3193 145
795 3300037471 Ga0395905_0014849 Ga0395905_0014849_2712_3149 145
796 3300037471 Ga0395905_0219153 Ga0395905_0219153_498_935 145
797 3300038443 Ga0395901_0008309 Ga0395901_0008309_4712_5149 145
798 3300038443 Ga0395901_0069418 Ga0395901_0069418_2895_3332 145
799 3300038443 Ga0395901_0612107 Ga0395901_0612107_16_453 145
800 3300039447 Ga0436361_0024448 Ga0436361_0024448_1462_1917 145
801 3300041405 Ga0439438_066525 Ga0439438_066525_348_794 145
802 3300042876 Ga0451577_0505451 Ga0451577_0505451_466_909 145
803 3300045051 Ga0451576_0112109 Ga0451576_0112109_1412_1855 145
804 3300046454 Ga0495592_0212945 Ga0495592_0212945_338_775 145
805 3300046459 Ga0495629_0383771 Ga0495629_0383771_29_466 145
806 3300046463 Ga0495653_0163918 Ga0495653_0163918_336_773 145
807 3300046475 Ga0495639_0462784 Ga0495639_0462784_37_474 145
808 3300046506 Ga0495583_0008409 Ga0495583_0008409_3806_4243 145
809 3300046517 Ga0495630_1072776 Ga0495630_1072776_77_514 145
810 3300046528 Ga0495642_0108036 Ga0495642_0108036_645_1082 145
811 3300046539 Ga0495621_0520555 Ga0495621_0520555_39_476 145
812 3300046543 Ga0495645_0156948 Ga0495645_0156948_948_1385 145
813 3300046615 Ga0495656_0320817 Ga0495656_0320817_85_522 145
814 3300046674 Ga0495588_0066110 Ga0495588_0066110_1270_1707 145
815 3300046675 Ga0495657_0043528 Ga0495657_0043528_1880_2317 145
816 3300046683 Ga0495658_0657267 Ga0495658_0657267_17_454 145
817 3300046694 Ga0495649_0082834 Ga0495649_0082834_1053_1493 145
818 3300046810 Ga0495660_0000002 Ga0495660_0000002_488666_489103 145
819 3300047315 Ga0495581_0090834 Ga0495581_0090834_367_804 145
820 3300047318 Ga0495636_0030650 Ga0495636_0030650_819_1256 145
821 3300047673 Ga0495593_0074616 Ga0495593_0074616_754_1191 145
822 3300048903 Ga0496100_0015583 Ga0496100_0015583_2391_2828 145
823 3300048904 Ga0496101_0001615 Ga0496101_0001615_2557_2994 145
824 3300048905 Ga0496102_0018151 Ga0496102_0018151_1937_2374 145
825 3300048905 Ga0496102_0044897 Ga0496102_0044897_1970_2407 145
826 3300048907 Ga0496104_0010765 Ga0496104_0010765_5397_5834 145
827 3300048908 Ga0496105_0004091 Ga0496105_0004091_2680_3117 145
828 3300048908 Ga0496105_0326975 Ga0496105_0326975_110_547 145
829 3300048909 Ga0496106_0220985 Ga0496106_0220985_922_1359 145
830 3300048912 Ga0496109_0209700 Ga0496109_0209700_130_567 145
831 3300048913 Ga0496110_0028927 Ga0496110_0028927_3957_4394 145
832 3300048913 Ga0496110_0030436 Ga0496110_0030436_1133_1570 145
833 3300048914 Ga0496111_0050665 Ga0496111_0050665_350_787 145
834 3300048917 Ga0496114_0068915 Ga0496114_0068915_1139_1576 145
835 3300048926 Ga0496123_0182359 Ga0496123_0182359_234_671 145
836 3300048927 Ga0496124_0468261 Ga0496124_0468261_111_557 145
837 3300048928 Ga0496125_0178907 Ga0496125_0178907_200_637 145
838 3300050493 nmdc:mga0k408_137519_c1 nmdc:mga0k408_137519_c1_395_832 145
839 3300050493 nmdc:mga0k408_256625_c1 nmdc:mga0k408_256625_c1_558_995 145
840 3300050496 nmdc:mga07m45_77352_c1 nmdc:mga07m45_77352_c1_826_1263 145
841 3300050496 nmdc:mga07m45_81077_c1 nmdc:mga07m45_81077_c1_265_705 145
842 3300053093 Ga0500651_0331495 Ga0500651_0331495_46_483 145
843 3300053111 Ga0500572_112146 Ga0500572_112146_48_485 145
844 3300053122 Ga0500608_002102 Ga0500608_002102_474_911 145
845 3300053128 Ga0500626_053059 Ga0500626_053059_838_1275 145
846 3300053141 Ga0500574_006190 Ga0500574_006190_980_1417 145
847 3300002772 JGI25164J39214_1016866 JGI25164J39214_10168662 146
848 3300005333 Ga0070677_10108813 Ga0070677_101088131 146
849 3300005355 Ga0070671_100013764 Ga0070671_1000137648 146
850 3300009093 Ga0105240_10125209 Ga0105240_101252092 146
851 3300009094 Ga0111539_10855462 Ga0111539_108554622 146
852 3300009177 Ga0105248_11941450 Ga0105248_119414501 146
853 3300013297 Ga0157378_10533140 Ga0157378_105331402 146
854 3300014969 Ga0157376_10092527 Ga0157376_100925272 146
855 3300025231 Ga0207427_104073 Ga0207427_1040733 146
856 3300025295 Ga0209564_1000170 Ga0209564_1000170141 146
857 3300025893 Ga0207682_10010692 Ga0207682_100106923 146
858 3300025913 Ga0207695_10026145 Ga0207695_100261457 146
859 3300025931 Ga0207644_10012204 Ga0207644_100122046 146
860 3300037312 Ga0395899_0021488 Ga0395899_0021488_3119_3571 146
861 3300037418 Ga0395900_0005097 Ga0395900_0005097_7396_7848 146
862 3300037418 Ga0395900_0120307 Ga0395900_0120307_780_1229 146
863 3300037466 Ga0395898_0127607 Ga0395898_0127607_1306_1758 146
864 3300037471 Ga0395905_0010128 Ga0395905_0010128_6757_7209 146
865 3300037471 Ga0395905_0541227 Ga0395905_0541227_128_580 146
866 3300038443 Ga0395901_0018729 Ga0395901_0018729_1690_2139 146
867 3300038443 Ga0395901_0021971 Ga0395901_0021971_5066_5518 146
868 3300038443 Ga0395901_0489180 Ga0395901_0489180_378_830 146
869 3300042115 Ga0450911_002991 Ga0450911_002991_2027_2473 146
870 3300046519 Ga0495632_0021184 Ga0495632_0021184_2675_3118 146
871 3300046660 Ga0495625_0325141 Ga0495625_0325141_206_649 146
872 3300046692 Ga0495671_0104577 Ga0495671_0104577_762_1205 146
873 3300046694 Ga0495649_0263824 Ga0495649_0263824_24_467 146
874 3300046810 Ga0495660_0021858 Ga0495660_0021858_1624_2067 146
875 3300047443 Ga0495687_010372 Ga0495687_010372_876_1319 146
876 3300047443 Ga0495687_064447 Ga0495687_064447_173_616 146
877 3300048903 Ga0496100_0050912 Ga0496100_0050912_1474_1926 146
878 3300048911 Ga0496108_0980217 Ga0496108_0980217_23_475 146
879 3300048912 Ga0496109_0103772 Ga0496109_0103772_1810_2262 146
880 3300048913 Ga0496110_0661357 Ga0496110_0661357_450_902 146
881 3300048916 Ga0496113_0004924 Ga0496113_0004924_5076_5528 146
882 3300049741 Ga0501079_0847189 Ga0501079_0847189_48_491 146
883 3300053093 Ga0500651_0127353 Ga0500651_0127353_572_1015 146
884 3300053134 Ga0500658_0088065 Ga0500658_0088065_777_1220 146
885 3300005327 Ga0070658_10017253 Ga0070658_100172531 147
886 3300005843 Ga0068860_100116600 Ga0068860_1001166003 147
887 3300006931 Ga0097620_100996988 Ga0097620_1009969882 147
888 3300009553 Ga0105249_12041242 Ga0105249_120412421 147
889 3300025909 Ga0207705_10155876 Ga0207705_101558762 147
890 3300026088 Ga0207641_10031684 Ga0207641_100316844 147
891 3300046462 Ga0495651_0009143 Ga0495651_0009143_2893_3339 147
892 3300046514 Ga0495618_0190118 Ga0495618_0190118_37_495 147
893 3300046516 Ga0495628_0000366 Ga0495628_0000366_7812_8258 147
894 3300046529 Ga0495652_0059282 Ga0495652_0059282_2767_3213 147
895 3300046679 Ga0495623_0210738 Ga0495623_0210738_362_808 147
896 3300048088 Ga0495602_0208414 Ga0495602_0208414_903_1349 147
897 3300005335 Ga0070666_10472188 Ga0070666_104721881 148
898 3300005339 Ga0070660_100653151 Ga0070660_1006531512 148
899 3300005365 Ga0070688_101135734 Ga0070688_1011357341 148
900 3300005535 Ga0070684_100962261 Ga0070684_1009622611 148
901 3300005618 Ga0068864_100175589 Ga0068864_1001755894 148
902 3300005842 Ga0068858_100058081 Ga0068858_1000580815 148
903 3300006358 Ga0068871_100041999 Ga0068871_1000419992 148
904 3300006881 Ga0068865_100260352 Ga0068865_1002603522 148
905 3300009553 Ga0105249_10260392 Ga0105249_102603922 148
906 3300013102 Ga0157371_10176109 Ga0157371_101761092 148
907 3300013296 Ga0157374_11935147 Ga0157374_119351472 148
908 3300014745 Ga0157377_10038437 Ga0157377_100384374 148
909 3300014968 Ga0157379_10025884 Ga0157379_100258847 148
910 3300025903 Ga0207680_11011117 Ga0207680_110111171 148
911 3300025925 Ga0207650_10063188 Ga0207650_100631883 148
912 3300025931 Ga0207644_10078583 Ga0207644_100785834 148
913 3300025933 Ga0207706_10165800 Ga0207706_101658001 148
914 3300025938 Ga0207704_10104922 Ga0207704_101049222 148
915 3300025942 Ga0207689_10061516 Ga0207689_100615164 148
916 3300025960 Ga0207651_10363965 Ga0207651_103639652 148
917 3300025981 Ga0207640_10502747 Ga0207640_105027472 148
918 3300026035 Ga0207703_11089976 Ga0207703_110899762 148
919 3300026089 Ga0207648_10104805 Ga0207648_101048054 148
920 3300028379 Ga0268266_10283930 Ga0268266_102839302 148
921 3300028380 Ga0268265_10608404 Ga0268265_106084042 148
922 3300028794 Ga0307515_10530262 Ga0307515_105302622 148
923 3300031507 Ga0307509_10001891 Ga0307509_1000189132 148
924 3300031616 Ga0307508_10000041 Ga0307508_1000004186 148
925 3300033179 Ga0307507_10006539 Ga0307507_1000653917 148
926 3300033180 Ga0307510_10000560 Ga0307510_1000056027 148
927 3300035171 Ga0373946_0604944 Ga0373946_0604944_92_541 148
928 3300042876 Ga0451577_0348540 Ga0451577_0348540_555_1064 148
929 3300046524 Ga0495648_0080484 Ga0495648_0080484_1033_1482 148
930 3300046660 Ga0495625_0146479 Ga0495625_0146479_176_625 148
931 3300048088 Ga0495602_0422606 Ga0495602_0422606_51_512 148
932 3300048903 Ga0496100_0270808 Ga0496100_0270808_677_1126 148
933 3300048907 Ga0496104_0755556 Ga0496104_0755556_100_549 148
934 3300005435 Ga0070714_101043241 Ga0070714_1010432411 149
935 3300005436 Ga0070713_100000264 Ga0070713_1000002647 149
936 3300006175 Ga0070712_100178463 Ga0070712_1001784632 149
937 3300025915 Ga0207693_10167371 Ga0207693_101673712 149
938 3300025928 Ga0207700_10000519 Ga0207700_100005196 149
939 3300025929 Ga0207664_10690511 Ga0207664_106905112 149
940 3300037068 Ga0373925_0358354 Ga0373925_0358354_552_1007 149
941 3300048927 Ga0496124_0002244 Ga0496124_0002244_11772_12233 149
942 3300048928 Ga0496125_0060473 Ga0496125_0060473_2263_2724 149
943 3300048929 Ga0496126_0674429 Ga0496126_0674429_62_523 149
944 3300053077 Ga0495601_0733413 Ga0495601_0733413_108_560 149
945 3300053079 Ga0500610_0395265 Ga0500610_0395265_70_528 149
946 3300005331 Ga0070670_100491248 Ga0070670_1004912482 150
947 3300005364 Ga0070673_100169779 Ga0070673_1001697792 150
948 3300005617 Ga0068859_100443722 Ga0068859_1004437222 150
949 3300005842 Ga0068858_101240558 Ga0068858_1012405582 150
950 3300006931 Ga0097620_100443742 Ga0097620_1004437422 150
951 3300025937 Ga0207669_10564349 Ga0207669_105643492 150
952 3300025940 Ga0207691_10500415 Ga0207691_105004152 150
953 3300025960 Ga0207651_10043654 Ga0207651_100436542 150
954 3300046516 Ga0495628_0144249 Ga0495628_0144249_579_1049 150
955 3300046543 Ga0495645_0157631 Ga0495645_0157631_156_626 150
956 2162886012 MBSR1b_contig_10772937 MBSR1b_0197.00003000 151
957 3300005293 Ga0065715_10290991 Ga0065715_102909912 151
958 3300005328 Ga0070676_10001033 Ga0070676_1000103311 151
959 3300005331 Ga0070670_100093258 Ga0070670_1000932582 151
960 3300005333 Ga0070677_10003807 Ga0070677_100038074 151
961 3300005334 Ga0068869_100007313 Ga0068869_1000073138 151
962 3300005335 Ga0070666_10002326 Ga0070666_100023268 151
963 3300005335 Ga0070666_10421891 Ga0070666_104218912 151
964 3300005338 Ga0068868_100020803 Ga0068868_1000208033 151
965 3300005339 Ga0070660_101436403 Ga0070660_1014364031 151
966 3300005340 Ga0070689_100033986 Ga0070689_1000339862 151
967 3300005347 Ga0070668_100027232 Ga0070668_1000272322 151
968 3300005353 Ga0070669_100006752 Ga0070669_1000067525 151
969 3300005354 Ga0070675_100001259 Ga0070675_1000012594 151
970 3300005355 Ga0070671_100102939 Ga0070671_1001029394 151
971 3300005355 Ga0070671_100192151 Ga0070671_1001921513 151
972 3300005355 Ga0070671_100203065 Ga0070671_1002030652 151
973 3300005356 Ga0070674_100016852 Ga0070674_1000168525 151
974 3300005364 Ga0070673_100084300 Ga0070673_1000843003 151
975 3300005365 Ga0070688_100013717 Ga0070688_1000137172 151
976 3300005367 Ga0070667_100002155 Ga0070667_10000215513 151
977 3300005455 Ga0070663_101217542 Ga0070663_1012175422 151
978 3300005456 Ga0070678_100001423 Ga0070678_1000014238 151
979 3300005457 Ga0070662_100087642 Ga0070662_1000876421 151
980 3300005457 Ga0070662_100730145 Ga0070662_1007301452 151
981 3300005459 Ga0068867_100002318 Ga0068867_1000023186 151
982 3300005466 Ga0070685_10036741 Ga0070685_100367412 151
983 3300005539 Ga0068853_100076209 Ga0068853_1000762094 151
984 3300005539 Ga0068853_100272569 Ga0068853_1002725693 151
985 3300005543 Ga0070672_100001588 Ga0070672_10000158816 151
986 3300005548 Ga0070665_100005741 Ga0070665_10000574110 151
987 3300005616 Ga0068852_100832953 Ga0068852_1008329531 151
988 3300005617 Ga0068859_100074764 Ga0068859_1000747642 151
989 3300005618 Ga0068864_100002258 Ga0068864_10000225816 151
990 3300005718 Ga0068866_10063013 Ga0068866_100630132 151
991 3300005719 Ga0068861_100035407 Ga0068861_1000354072 151
992 3300005834 Ga0068851_10178112 Ga0068851_101781122 151
993 3300005841 Ga0068863_100032861 Ga0068863_1000328613 151
994 3300005842 Ga0068858_100002532 Ga0068858_1000025322 151
995 3300005843 Ga0068860_100004123 Ga0068860_1000041232 151
996 3300005844 Ga0068862_100035495 Ga0068862_1000354955 151
997 3300006237 Ga0097621_100001145 Ga0097621_10000114517 151
998 3300006358 Ga0068871_100009980 Ga0068871_1000099805 151
999 3300006881 Ga0068865_100005004 Ga0068865_1000050048 151
1000 3300006931 Ga0097620_100074767 Ga0097620_1000747676 151
1001 3300009148 Ga0105243_10913420 Ga0105243_109134202 151
1002 3300009177 Ga0105248_10018960 Ga0105248_100189602 151
1003 3300013296 Ga0157374_10001025 Ga0157374_1000102523 151
1004 3300013297 Ga0157378_10241003 Ga0157378_102410032 151
1005 3300013306 Ga0163162_10007526 Ga0163162_100075266 151
1006 3300013308 Ga0157375_10013201 Ga0157375_100132018 151
1007 3300014968 Ga0157379_10043701 Ga0157379_100437013 151
1008 3300014969 Ga0157376_10093359 Ga0157376_100933593 151
1009 3300017792 Ga0163161_10307694 Ga0163161_103076943 151
1010 3300025315 Ga0207697_10003125 Ga0207697_100031258 151
1011 3300025893 Ga0207682_10022645 Ga0207682_100226455 151
1012 3300025907 Ga0207645_10000282 Ga0207645_100002825 151
1013 3300025923 Ga0207681_10025353 Ga0207681_100253532 151
1014 3300025925 Ga0207650_10033243 Ga0207650_100332435 151
1015 3300025926 Ga0207659_10001500 Ga0207659_100015009 151
1016 3300025931 Ga0207644_10790913 Ga0207644_107909132 151
1017 3300025935 Ga0207709_10748401 Ga0207709_107484012 151
1018 3300025936 Ga0207670_10267459 Ga0207670_102674592 151
1019 3300025937 Ga0207669_10198054 Ga0207669_101980542 151
1020 3300025938 Ga0207704_10020880 Ga0207704_100208802 151
1021 3300025940 Ga0207691_10000577 Ga0207691_1000057721 151
1022 3300025941 Ga0207711_10469698 Ga0207711_104696983 151
1023 3300025942 Ga0207689_10001993 Ga0207689_1000199318 151
1024 3300025960 Ga0207651_10005847 Ga0207651_100058472 151
1025 3300025972 Ga0207668_10019869 Ga0207668_100198692 151
1026 3300025972 Ga0207668_10154940 Ga0207668_101549402 151
1027 3300025986 Ga0207658_10038490 Ga0207658_100384906 151
1028 3300026023 Ga0207677_10033260 Ga0207677_100332606 151
1029 3300026035 Ga0207703_10128672 Ga0207703_101286722 151
1030 3300026041 Ga0207639_10065074 Ga0207639_100650742 151
1031 3300026089 Ga0207648_10003294 Ga0207648_1000329414 151
1032 3300026095 Ga0207676_10071275 Ga0207676_100712752 151
1033 3300026118 Ga0207675_100015675 Ga0207675_1000156754 151
1034 3300026121 Ga0207683_10001960 Ga0207683_1000196015 151
1035 3300026142 Ga0207698_10103150 Ga0207698_101031502 151
1036 3300028380 Ga0268265_10067661 Ga0268265_100676613 151
1037 3300028381 Ga0268264_10016184 Ga0268264_100161846 151
1038 3300048904 Ga0496101_0455191 Ga0496101_0455191_358_813 151
1039 3300048911 Ga0496108_0174541 Ga0496108_0174541_1381_1836 151
1040 3300048912 Ga0496109_0046266 Ga0496109_0046266_2322_2777 151
1041 3300048913 Ga0496110_0583870 Ga0496110_0583870_286_741 151
1042 3300048917 Ga0496114_0087137 Ga0496114_0087137_1459_1914 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20398

DUF6691

Family of unknown function (DUF6691)

1

142

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End Superfamily
af_I1MMI0_226_612_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2116 8 100 1.20.1250.20
af_I1MMI0_226_612_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.1616 8 100 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1T2Y7J5-F1-model_v4 deleted 0.937 1 138
AF-A0A7W2PSA4-F1-model_v4 YeeE/YedE family protein 0.9338 1 137 GO:0016020
AF-A0A441UP52-F1-model_v4 YeeE/YedE family protein 0.9297 1 107 GO:0016020
AF-D7DKH1-F1-model_v4 Uncharacterized protein 0.9287 3 135 GO:0016020
AF-A0A370SG02-F1-model_v4 YeeE/YedE family protein 0.928 1 138 GO:0016020

Feature Viewer

pLDDT pTM Quality
77.38 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map