F488856
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1042 | 465 | 1031 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100205972|Ga0070708_1002059723 |
| Length | 147 |
| Sequence | MLALASLLAGLVFGLGLIVSGMANPAKVLGFLDLAGPWDPSLIFVMAGAIAIGLVAFRLATKRIVSLLGAPMRLPQNHRRIDRRLVVGSTLFGLGWGIAGFCPGPGLVALGMGEVKAAVFVLAMLAGMGLFELLEHRHRAVPRGAPT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 3 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 4 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 5 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 6 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 7 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 8 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 9 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 10 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 11 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 12 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 13 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 16 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 18 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 19 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 24 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 25 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 45 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 46 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 47 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 54 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 79 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 97 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 101 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 103 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 104 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 105 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 106 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 108 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 115 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 116 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 117 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 142 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 147 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 148 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 151 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 165 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 168 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 230 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 232 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 236 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 237 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 239 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 240 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 241 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 242 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 243 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 244 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 245 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 246 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 247 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 248 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 249 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 250 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 251 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 252 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 253 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 254 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 255 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 256 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 257 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 258 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 259 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 260 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 266 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 268 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 269 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 270 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 271 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 272 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 273 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 274 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 275 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 276 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 278 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 279 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 280 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 281 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 282 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 283 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 284 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 285 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 286 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 287 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 288 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 289 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 290 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 291 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 292 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 293 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 294 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 295 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 296 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 297 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 298 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 299 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 300 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 301 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 302 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 303 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 304 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 305 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 387 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 388 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 389 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 390 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 391 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 392 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 393 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 395 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 396 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 397 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 398 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 399 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 400 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 401 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 402 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 403 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 404 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 405 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 406 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 407 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 408 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 409 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 410 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 411 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 412 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 426 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 427 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 431 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 432 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 435 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 436 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 437 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 438 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 439 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 440 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 441 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 442 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 448 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 450 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 451 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 452 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 453 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 454 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 455 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 456 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 457 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 458 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 459 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 460 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 461 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 462 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 463 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 464 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 465 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.85 |
| Metatranscriptomes | 0.1 |
| Isolates | 1.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.98 |
| Nodule | 0.38 |
| Rhizoplane | 4.32 |
| Rhizosphere | 66.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_10772937 | 2162886012 | Bacteria | 1017 |
| 2 | JGI24740J21852_10003426 | 3300001979 | Bacteria | 6977 |
| 3 | JGI24740J21852_10003590 | 3300001979 | Bacteria | 6768 |
| 4 | JGI24740J21852_10016258 | 3300001979 | Bacteria | 2693 |
| 5 | JGI24737J22298_10058755 | 3300001990 | Bacteria | 1159 |
| 6 | JGI25156J39149_1000502 | 3300002705 | Bacteria | 22909 |
| 7 | JGI25156J39149_1038461 | 3300002705 | Bacteria | 672 |
| 8 | JGI25164J39214_1016866 | 3300002772 | Bacteria | 663 |
| 9 | JGI25150J39212_1001373 | 3300002774 | Bacteria | 6902 |
| 10 | JGI25150J39212_1007267 | 3300002774 | Bacteria | 2233 |
| 11 | JGI25150J39212_1007812 | 3300002774 | Bacteria | 2128 |
| 12 | JGI25159J45721_1000359 | 3300002987 | Bacteria | 21140 |
| 13 | JGI25159J45721_1002098 | 3300002987 | Bacteria | 7823 |
| 14 | JGI25159J45721_1004099 | 3300002987 | Bacteria | 4942 |
| 15 | JGI25151J46595_10002668 | 3300003187 | Bacteria | 10460 |
| 16 | JGI25151J46595_10006726 | 3300003187 | Bacteria | 5728 |
| 17 | JGI25151J46595_10041741 | 3300003187 | Bacteria | 1662 |
| 18 | JGI25153J46596_10105088 | 3300003215 | Bacteria | 657 |
| 19 | rootH2_10003443 | 3300003320 | Bacteria | 7577 |
| 20 | rootH2_10141630 | 3300003320 | Bacteria | 1883 |
| 21 | rootL2_10093470 | 3300003322 | Bacteria | 9372 |
| 22 | rootL2_10233829 | 3300003322 | Bacteria | 1390 |
| 23 | JGI25160J50197_1000158 | 3300003354 | Bacteria | 58363 |
| 24 | JGI25160J50197_1030441 | 3300003354 | Bacteria | 1407 |
| 25 | JGI25161J50226_1000040 | 3300003374 | Bacteria | 124804 |
| 26 | Ga0055538_1008028 | 3300003751 | Bacteria | 920 |
| 27 | Ga0055538_1009501 | 3300003751 | Bacteria | 787 |
| 28 | Ga0055539_1000051 | 3300003752 | Bacteria | 175048 |
| 29 | Ga0055539_1014377 | 3300003752 | Bacteria | 966 |
| 30 | Ga0055533_1000025 | 3300003756 | Bacteria | 332208 |
| 31 | Ga0055533_1000351 | 3300003756 | Bacteria | 19929 |
| 32 | Ga0055533_1000485 | 3300003756 | Bacteria | 14729 |
| 33 | Ga0055533_1001339 | 3300003756 | Bacteria | 6673 |
| 34 | Ga0055533_1003923 | 3300003756 | Bacteria | 2822 |
| 35 | Ga0055532_1000006 | 3300003758 | Bacteria | 451244 |
| 36 | Ga0055525_1001177 | 3300003759 | Bacteria | 5983 |
| 37 | Ga0055525_1007688 | 3300003759 | Bacteria | 910 |
| 38 | Ga0055527_1000395 | 3300003760 | Bacteria | 18668 |
| 39 | Ga0055527_1003663 | 3300003760 | Bacteria | 2230 |
| 40 | Ga0055535_1000004 | 3300003761 | Bacteria | 451244 |
| 41 | Ga0055535_1000115 | 3300003761 | Bacteria | 86313 |
| 42 | Ga0055535_1000290 | 3300003761 | Bacteria | 52572 |
| 43 | Ga0055535_1009426 | 3300003761 | Bacteria | 1684 |
| 44 | Ga0055542_1000028 | 3300003762 | Bacteria | 251458 |
| 45 | Ga0055542_1001366 | 3300003762 | Bacteria | 12491 |
| 46 | Ga0055529_1000022 | 3300003763 | Bacteria | 320108 |
| 47 | Ga0055529_1000158 | 3300003763 | Bacteria | 93023 |
| 48 | Ga0055529_1001082 | 3300003763 | Bacteria | 12469 |
| 49 | Ga0055526_1001296 | 3300003771 | Bacteria | 17937 |
| 50 | Ga0055526_1050947 | 3300003771 | Bacteria | 945 |
| 51 | Ga0055537_1000257 | 3300003773 | Bacteria | 38816 |
| 52 | Ga0055537_1004524 | 3300003773 | Bacteria | 3962 |
| 53 | Ga0055524_1000010 | 3300003775 | Bacteria | 282893 |
| 54 | Ga0055524_1000077 | 3300003775 | Bacteria | 121584 |
| 55 | Ga0055536_1000286 | 3300003781 | Bacteria | 38408 |
| 56 | Ga0055536_1000891 | 3300003781 | Bacteria | 19442 |
| 57 | Ga0055536_1001365 | 3300003781 | Bacteria | 14843 |
| 58 | Ga0055534_1004892 | 3300003784 | Bacteria | 3748 |
| 59 | Ga0055528_1002253 | 3300003790 | Bacteria | 10499 |
| 60 | Ga0055530_10000354 | 3300003791 | Bacteria | 41444 |
| 61 | Ga0055530_10003781 | 3300003791 | Bacteria | 8345 |
| 62 | Ga0055530_10019470 | 3300003791 | Bacteria | 2055 |
| 63 | Ga0055540_1000010 | 3300003792 | Bacteria | 290865 |
| 64 | Ga0055540_1000260 | 3300003792 | Bacteria | 47714 |
| 65 | Ga0055540_1001142 | 3300003792 | Bacteria | 16576 |
| 66 | Ga0055540_1001176 | 3300003792 | Bacteria | 16190 |
| 67 | Ga0055540_1037262 | 3300003792 | Bacteria | 1073 |
| 68 | Ga0055531_10000298 | 3300003794 | Bacteria | 49437 |
| 69 | Ga0055531_10000405 | 3300003794 | Bacteria | 41493 |
| 70 | Ga0055531_10000572 | 3300003794 | Bacteria | 32155 |
| 71 | Ga0055531_10006230 | 3300003794 | Bacteria | 6813 |
| 72 | Ga0055541_1002678 | 3300003841 | Bacteria | 3489 |
| 73 | Ga0055543_1000167 | 3300004625 | Bacteria | 54995 |
| 74 | Ga0065165_1001298 | 3300005262 | Bacteria | 28029 |
| 75 | Ga0065165_1003807 | 3300005262 | Bacteria | 10071 |
| 76 | Ga0065165_1019460 | 3300005262 | Bacteria | 2422 |
| 77 | Ga0065165_1020123 | 3300005262 | Bacteria | 2361 |
| 78 | Ga0065712_10511677 | 3300005290 | Unclassified | 642 |
| 79 | Ga0065715_10290991 | 3300005293 | Bacteria | 1022 |
| 80 | Ga0070658_10017253 | 3300005327 | Bacteria | 5777 |
| 81 | Ga0070658_11054427 | 3300005327 | Bacteria | 707 |
| 82 | Ga0070676_10001033 | 3300005328 | Bacteria | 13852 |
| 83 | Ga0070676_10123841 | 3300005328 | Bacteria | 1626 |
| 84 | Ga0070690_100078515 | 3300005330 | Bacteria | 2157 |
| 85 | Ga0070690_100312796 | 3300005330 | Bacteria | 1129 |
| 86 | Ga0070670_100029119 | 3300005331 | Bacteria | 4752 |
| 87 | Ga0070670_100093258 | 3300005331 | Bacteria | 2590 |
| 88 | Ga0070670_100098633 | 3300005331 | Bacteria | 2514 |
| 89 | Ga0070670_100491248 | 3300005331 | Bacteria | 1091 |
| 90 | Ga0070670_101493928 | 3300005331 | Bacteria | 620 |
| 91 | Ga0070677_10003807 | 3300005333 | Bacteria | 4888 |
| 92 | Ga0070677_10044804 | 3300005333 | Bacteria | 1762 |
| 93 | Ga0070677_10108813 | 3300005333 | Unclassified | 1234 |
| 94 | Ga0070677_10515308 | 3300005333 | Bacteria | 650 |
| 95 | Ga0068869_100007313 | 3300005334 | Bacteria | 7042 |
| 96 | Ga0068869_100028125 | 3300005334 | Bacteria | 3925 |
| 97 | Ga0070666_10002326 | 3300005335 | Bacteria | 11482 |
| 98 | Ga0070666_10027614 | 3300005335 | Bacteria | 3718 |
| 99 | Ga0070666_10421891 | 3300005335 | Bacteria | 961 |
| 100 | Ga0070666_10472188 | 3300005335 | Bacteria | 907 |
| 101 | Ga0068868_100000189 | 3300005338 | Bacteria | 41014 |
| 102 | Ga0068868_100020803 | 3300005338 | Bacteria | 4937 |
| 103 | Ga0070660_100515292 | 3300005339 | Bacteria | 996 |
| 104 | Ga0070660_100653151 | 3300005339 | Bacteria | 881 |
| 105 | Ga0070660_101436403 | 3300005339 | Bacteria | 586 |
| 106 | Ga0070689_100033986 | 3300005340 | Bacteria | 3889 |
| 107 | Ga0070687_100478154 | 3300005343 | Bacteria | 834 |
| 108 | Ga0070668_100027232 | 3300005347 | Bacteria | 4339 |
| 109 | Ga0070669_100006752 | 3300005353 | Bacteria | 8261 |
| 110 | Ga0070675_100001259 | 3300005354 | Bacteria | 18526 |
| 111 | Ga0070675_100254930 | 3300005354 | Bacteria | 1536 |
| 112 | Ga0070675_100858205 | 3300005354 | Bacteria | 831 |
| 113 | Ga0070671_100013764 | 3300005355 | Bacteria | 6526 |
| 114 | Ga0070671_100102939 | 3300005355 | Bacteria | 2395 |
| 115 | Ga0070671_100104819 | 3300005355 | Bacteria | 2373 |
| 116 | Ga0070671_100192151 | 3300005355 | Bacteria | 1730 |
| 117 | Ga0070671_100203065 | 3300005355 | Bacteria | 1681 |
| 118 | Ga0070674_100016852 | 3300005356 | Bacteria | 4584 |
| 119 | Ga0070674_100034350 | 3300005356 | Bacteria | 3386 |
| 120 | Ga0070674_100572428 | 3300005356 | Bacteria | 951 |
| 121 | Ga0070673_100001117 | 3300005364 | Bacteria | 15388 |
| 122 | Ga0070673_100084300 | 3300005364 | Bacteria | 2584 |
| 123 | Ga0070673_100141898 | 3300005364 | Bacteria | 2027 |
| 124 | Ga0070673_100169779 | 3300005364 | Bacteria | 1861 |
| 125 | Ga0070673_100226328 | 3300005364 | Bacteria | 1621 |
| 126 | Ga0070688_100013717 | 3300005365 | Bacteria | 4578 |
| 127 | Ga0070688_100027498 | 3300005365 | Bacteria | 3389 |
| 128 | Ga0070688_101135734 | 3300005365 | Bacteria | 626 |
| 129 | Ga0070659_100001408 | 3300005366 | Bacteria | 17342 |
| 130 | Ga0070659_100776201 | 3300005366 | Bacteria | 832 |
| 131 | Ga0070667_100001328 | 3300005367 | Bacteria | 22207 |
| 132 | Ga0070667_100002155 | 3300005367 | Bacteria | 17343 |
| 133 | Ga0070667_100006773 | 3300005367 | Bacteria | 9515 |
| 134 | Ga0070667_100072464 | 3300005367 | Bacteria | 2936 |
| 135 | Ga0070667_100445959 | 3300005367 | Bacteria | 1182 |
| 136 | Ga0070667_101141698 | 3300005367 | Bacteria | 729 |
| 137 | Ga0070714_101043241 | 3300005435 | Bacteria | 796 |
| 138 | Ga0070713_100000264 | 3300005436 | Bacteria | 34426 |
| 139 | Ga0070708_100205972 | 3300005445 | Bacteria | 1843 |
| 140 | Ga0070663_100055204 | 3300005455 | Bacteria | 2842 |
| 141 | Ga0070663_101217542 | 3300005455 | Bacteria | 662 |
| 142 | Ga0070678_100001423 | 3300005456 | Bacteria | 12741 |
| 143 | Ga0070678_100001606 | 3300005456 | Bacteria | 12113 |
| 144 | Ga0070662_100087642 | 3300005457 | Bacteria | 2331 |
| 145 | Ga0070662_100201340 | 3300005457 | Bacteria | 1580 |
| 146 | Ga0070662_100371986 | 3300005457 | Bacteria | 1175 |
| 147 | Ga0070662_100730145 | 3300005457 | Bacteria | 839 |
| 148 | Ga0068867_100002318 | 3300005459 | Bacteria | 13391 |
| 149 | Ga0068867_100027885 | 3300005459 | Bacteria | 4063 |
| 150 | Ga0070685_10036741 | 3300005466 | Bacteria | 2770 |
| 151 | Ga0070685_10253005 | 3300005466 | Bacteria | 1168 |
| 152 | Ga0070706_100926971 | 3300005467 | Bacteria | 804 |
| 153 | Ga0070684_100962261 | 3300005535 | Bacteria | 801 |
| 154 | Ga0068853_100076209 | 3300005539 | Bacteria | 2928 |
| 155 | Ga0068853_100227595 | 3300005539 | Bacteria | 1705 |
| 156 | Ga0068853_100272569 | 3300005539 | Bacteria | 1559 |
| 157 | Ga0068853_100288225 | 3300005539 | Bacteria | 1515 |
| 158 | Ga0068853_101068004 | 3300005539 | Unclassified | 778 |
| 159 | Ga0070672_100001588 | 3300005543 | Bacteria | 14096 |
| 160 | Ga0070672_100072840 | 3300005543 | Bacteria | 2736 |
| 161 | Ga0070672_100117953 | 3300005543 | Bacteria | 2170 |
| 162 | Ga0070665_100005741 | 3300005548 | Bacteria | 12741 |
| 163 | Ga0070665_100244733 | 3300005548 | Bacteria | 1794 |
| 164 | Ga0068855_100110533 | 3300005563 | Bacteria | 3155 |
| 165 | Ga0068855_100346254 | 3300005563 | Bacteria | 1638 |
| 166 | Ga0070664_100979455 | 3300005564 | Bacteria | 794 |
| 167 | Ga0068857_100075627 | 3300005577 | Bacteria | 3002 |
| 168 | Ga0068854_100000020 | 3300005578 | Bacteria | 132163 |
| 169 | Ga0068854_100068921 | 3300005578 | Bacteria | 2581 |
| 170 | Ga0068852_100043480 | 3300005616 | Bacteria | 3811 |
| 171 | Ga0068852_100176013 | 3300005616 | Bacteria | 2009 |
| 172 | Ga0068852_100832953 | 3300005616 | Bacteria | 938 |
| 173 | Ga0068859_100074764 | 3300005617 | Bacteria | 3427 |
| 174 | Ga0068859_100443722 | 3300005617 | Bacteria | 1394 |
| 175 | Ga0068859_100577050 | 3300005617 | Bacteria | 1218 |
| 176 | Ga0068859_101022405 | 3300005617 | Bacteria | 908 |
| 177 | Ga0068864_100002258 | 3300005618 | Bacteria | 15938 |
| 178 | Ga0068864_100003331 | 3300005618 | Bacteria | 13278 |
| 179 | Ga0068864_100175589 | 3300005618 | Bacteria | 1955 |
| 180 | Ga0068866_10063013 | 3300005718 | Bacteria | 1931 |
| 181 | Ga0068861_100035407 | 3300005719 | Bacteria | 3698 |
| 182 | Ga0068851_10178112 | 3300005834 | Bacteria | 1176 |
| 183 | Ga0068870_10103237 | 3300005840 | Bacteria | 1615 |
| 184 | Ga0068863_100032861 | 3300005841 | Bacteria | 4943 |
| 185 | Ga0068863_100035873 | 3300005841 | Bacteria | 4722 |
| 186 | Ga0068863_100119757 | 3300005841 | Bacteria | 2509 |
| 187 | Ga0068863_100189691 | 3300005841 | Bacteria | 1975 |
| 188 | Ga0068863_100539022 | 3300005841 | Bacteria | 1151 |
| 189 | Ga0068858_100002532 | 3300005842 | Bacteria | 18418 |
| 190 | Ga0068858_100058081 | 3300005842 | Bacteria | 3577 |
| 191 | Ga0068858_100228714 | 3300005842 | Bacteria | 1763 |
| 192 | Ga0068858_101240558 | 3300005842 | Bacteria | 733 |
| 193 | Ga0068860_100004123 | 3300005843 | Bacteria | 14893 |
| 194 | Ga0068860_100116600 | 3300005843 | Bacteria | 2555 |
| 195 | Ga0068860_100157401 | 3300005843 | Bacteria | 2190 |
| 196 | Ga0068862_100035495 | 3300005844 | Bacteria | 4223 |
| 197 | Ga0075365_10197629 | 3300006038 | Bacteria | 1408 |
| 198 | Ga0075368_10001280 | 3300006042 | Bacteria | 7963 |
| 199 | Ga0075363_100007512 | 3300006048 | Bacteria | 5018 |
| 200 | Ga0075363_100126416 | 3300006048 | Bacteria | 1432 |
| 201 | Ga0075363_100387195 | 3300006048 | Bacteria | 820 |
| 202 | Ga0075364_10019614 | 3300006051 | Bacteria | 4244 |
| 203 | Ga0075364_10151141 | 3300006051 | Bacteria | 1565 |
| 204 | Ga0075432_10059985 | 3300006058 | Bacteria | 1353 |
| 205 | Ga0070712_100178463 | 3300006175 | Bacteria | 1653 |
| 206 | Ga0075362_10007618 | 3300006177 | Bacteria | 4112 |
| 207 | Ga0075362_10023506 | 3300006177 | Bacteria | 2607 |
| 208 | Ga0075362_10053876 | 3300006177 | Bacteria | 1807 |
| 209 | Ga0075362_10075856 | 3300006177 | Bacteria | 1542 |
| 210 | Ga0075367_10007127 | 3300006178 | Bacteria | 5702 |
| 211 | Ga0075367_10015498 | 3300006178 | Bacteria | 4146 |
| 212 | Ga0075369_10091665 | 3300006186 | Bacteria | 1357 |
| 213 | Ga0075366_10014741 | 3300006195 | Bacteria | 4470 |
| 214 | Ga0075366_10016319 | 3300006195 | Bacteria | 4268 |
| 215 | Ga0075366_10046227 | 3300006195 | Bacteria | 2579 |
| 216 | Ga0075366_10046561 | 3300006195 | Bacteria | 2570 |
| 217 | Ga0075366_10181799 | 3300006195 | Bacteria | 1277 |
| 218 | Ga0075366_10285626 | 3300006195 | Bacteria | 1009 |
| 219 | Ga0075366_10288409 | 3300006195 | Bacteria | 1004 |
| 220 | Ga0097621_100001145 | 3300006237 | Bacteria | 18426 |
| 221 | Ga0097621_100236833 | 3300006237 | Bacteria | 1595 |
| 222 | Ga0097621_100311606 | 3300006237 | Bacteria | 1392 |
| 223 | Ga0075370_10000134 | 3300006353 | Bacteria | 24952 |
| 224 | Ga0075370_10000147 | 3300006353 | Bacteria | 24004 |
| 225 | Ga0075370_10000900 | 3300006353 | Bacteria | 12177 |
| 226 | Ga0075370_10150516 | 3300006353 | Bacteria | 1364 |
| 227 | Ga0075370_10169946 | 3300006353 | Bacteria | 1281 |
| 228 | Ga0075370_10244660 | 3300006353 | Bacteria | 1062 |
| 229 | Ga0068871_100009980 | 3300006358 | Bacteria | 6901 |
| 230 | Ga0068871_100024161 | 3300006358 | Bacteria | 4709 |
| 231 | Ga0068871_100041999 | 3300006358 | Bacteria | 3669 |
| 232 | Ga0068871_100378027 | 3300006358 | Bacteria | 1258 |
| 233 | Ga0068871_101577400 | 3300006358 | Bacteria | 621 |
| 234 | Ga0068871_101874436 | 3300006358 | Bacteria | 570 |
| 235 | Ga0075430_100184105 | 3300006846 | Bacteria | 1737 |
| 236 | Ga0075429_100154417 | 3300006880 | Bacteria | 2010 |
| 237 | Ga0068865_100005004 | 3300006881 | Bacteria | 8014 |
| 238 | Ga0068865_100260352 | 3300006881 | Bacteria | 1373 |
| 239 | Ga0075436_100049187 | 3300006914 | Bacteria | 2909 |
| 240 | Ga0097620_100074767 | 3300006931 | Bacteria | 3427 |
| 241 | Ga0097620_100443742 | 3300006931 | Bacteria | 1394 |
| 242 | Ga0097620_100577108 | 3300006931 | Bacteria | 1218 |
| 243 | Ga0097620_100996988 | 3300006931 | Bacteria | 920 |
| 244 | Ga0097620_101022410 | 3300006931 | Bacteria | 908 |
| 245 | Ga0079104_1037099 | 3300006946 | Bacteria | 1164 |
| 246 | Ga0099826_10000002 | 3300006948 | Bacteria | 1125830 |
| 247 | Ga0099826_10264683 | 3300006948 | Bacteria | 898 |
| 248 | Ga0075435_100355911 | 3300007076 | Bacteria | 1255 |
| 249 | Ga0075435_100558647 | 3300007076 | Bacteria | 992 |
| 250 | Ga0105244_10005002 | 3300009036 | Bacteria | 8936 |
| 251 | Ga0105244_10009242 | 3300009036 | Bacteria | 6077 |
| 252 | Ga0105240_10125209 | 3300009093 | Bacteria | 3089 |
| 253 | Ga0111539_10018854 | 3300009094 | Bacteria | 8537 |
| 254 | Ga0111539_10855462 | 3300009094 | Bacteria | 1058 |
| 255 | Ga0105245_10233506 | 3300009098 | Bacteria | 1780 |
| 256 | Ga0105245_11159294 | 3300009098 | Bacteria | 820 |
| 257 | Ga0114129_10771089 | 3300009147 | Bacteria | 1229 |
| 258 | Ga0105243_10913420 | 3300009148 | Bacteria | 874 |
| 259 | Ga0105241_10060994 | 3300009174 | Bacteria | 2903 |
| 260 | Ga0105242_10002379 | 3300009176 | Bacteria | 14834 |
| 261 | Ga0105242_10185050 | 3300009176 | Bacteria | 1840 |
| 262 | Ga0105242_11446107 | 3300009176 | Bacteria | 716 |
| 263 | Ga0105248_10018960 | 3300009177 | Bacteria | 7606 |
| 264 | Ga0105248_10044730 | 3300009177 | Bacteria | 4965 |
| 265 | Ga0105248_10134284 | 3300009177 | Bacteria | 2792 |
| 266 | Ga0105248_10755082 | 3300009177 | Bacteria | 1098 |
| 267 | Ga0105248_11252211 | 3300009177 | Bacteria | 839 |
| 268 | Ga0105248_11281778 | 3300009177 | Bacteria | 829 |
| 269 | Ga0105248_11941450 | 3300009177 | Bacteria | 668 |
| 270 | Ga0105237_10035515 | 3300009545 | Bacteria | 5044 |
| 271 | Ga0105237_10858644 | 3300009545 | Bacteria | 914 |
| 272 | Ga0105238_12197462 | 3300009551 | Bacteria | 586 |
| 273 | Ga0105249_10260392 | 3300009553 | Bacteria | 1723 |
| 274 | Ga0105249_12041242 | 3300009553 | Unclassified | 646 |
| 275 | Ga0105239_10102223 | 3300010375 | Bacteria | 3172 |
| 276 | Ga0105246_10064976 | 3300011119 | Bacteria | 2551 |
| 277 | Ga0157371_10004426 | 3300013102 | Bacteria | 12266 |
| 278 | Ga0157371_10176109 | 3300013102 | Bacteria | 1529 |
| 279 | Ga0157370_10775583 | 3300013104 | Bacteria | 873 |
| 280 | Ga0157369_10013411 | 3300013105 | Bacteria | 9266 |
| 281 | Ga0157369_10374460 | 3300013105 | Bacteria | 1478 |
| 282 | Ga0157369_11479001 | 3300013105 | Bacteria | 691 |
| 283 | Ga0157374_10001025 | 3300013296 | Bacteria | 24286 |
| 284 | Ga0157374_10031619 | 3300013296 | Bacteria | 4813 |
| 285 | Ga0157374_10675739 | 3300013296 | Bacteria | 1045 |
| 286 | Ga0157374_11935147 | 3300013296 | Bacteria | 616 |
| 287 | Ga0157378_10241003 | 3300013297 | Bacteria | 1727 |
| 288 | Ga0157378_10533140 | 3300013297 | Bacteria | 1177 |
| 289 | Ga0163162_10007526 | 3300013306 | Bacteria | 10605 |
| 290 | Ga0163162_10063034 | 3300013306 | Bacteria | 3749 |
| 291 | Ga0163162_10076553 | 3300013306 | Bacteria | 3408 |
| 292 | Ga0163162_10363558 | 3300013306 | Bacteria | 1580 |
| 293 | Ga0157372_10037972 | 3300013307 | Bacteria | 5315 |
| 294 | Ga0157375_10013201 | 3300013308 | Bacteria | 7344 |
| 295 | Ga0157375_10391485 | 3300013308 | Bacteria | 1556 |
| 296 | Ga0157375_11489158 | 3300013308 | Bacteria | 799 |
| 297 | Ga0157375_11503549 | 3300013308 | Bacteria | 795 |
| 298 | Ga0163163_10027737 | 3300014325 | Bacteria | 5429 |
| 299 | Ga0157380_10655846 | 3300014326 | Bacteria | 1048 |
| 300 | Ga0182008_10004423 | 3300014497 | Bacteria | 8220 |
| 301 | Ga0182008_10065925 | 3300014497 | Bacteria | 1781 |
| 302 | Ga0157377_10038437 | 3300014745 | Bacteria | 2642 |
| 303 | Ga0157379_10002348 | 3300014968 | Bacteria | 15791 |
| 304 | Ga0157379_10025884 | 3300014968 | Bacteria | 5217 |
| 305 | Ga0157379_10043701 | 3300014968 | Bacteria | 4000 |
| 306 | Ga0157376_10034752 | 3300014969 | Bacteria | 4073 |
| 307 | Ga0157376_10092527 | 3300014969 | Bacteria | 2622 |
| 308 | Ga0157376_10093359 | 3300014969 | Bacteria | 2612 |
| 309 | Ga0157376_10246816 | 3300014969 | Bacteria | 1666 |
| 310 | Ga0157376_10272567 | 3300014969 | Bacteria | 1590 |
| 311 | Ga0157376_10488341 | 3300014969 | Bacteria | 1208 |
| 312 | Ga0182006_1000525 | 3300015261 | Bacteria | 29114 |
| 313 | Ga0182006_1011283 | 3300015261 | Bacteria | 3938 |
| 314 | Ga0182007_10001013 | 3300015262 | Bacteria | 15397 |
| 315 | Ga0182007_10003999 | 3300015262 | Bacteria | 6801 |
| 316 | Ga0182007_10011585 | 3300015262 | Bacteria | 3428 |
| 317 | Ga0183362_10012 | 3300015683 | Bacteria | 49008 |
| 318 | Ga0163161_10233239 | 3300017792 | Bacteria | 1429 |
| 319 | Ga0163161_10265900 | 3300017792 | Unclassified | 1341 |
| 320 | Ga0163161_10307694 | 3300017792 | Bacteria | 1249 |
| 321 | Ga0163161_10453474 | 3300017792 | Bacteria | 1037 |
| 322 | Ga0163161_10633617 | 3300017792 | Bacteria | 884 |
| 323 | Ga0206351_10377922 | 3300020077 | Bacteria | 1723 |
| 324 | Ga0213872_10000384 | 3300021361 | Bacteria | 37007 |
| 325 | Ga0213872_10004425 | 3300021361 | Bacteria | 7463 |
| 326 | Ga0213872_10074690 | 3300021361 | Bacteria | 1526 |
| 327 | Ga0213872_10077022 | 3300021361 | Bacteria | 1499 |
| 328 | Ga0213872_10289453 | 3300021361 | Bacteria | 682 |
| 329 | Ga0209435_107774 | 3300025206 | Bacteria | 1183 |
| 330 | Ga0209436_100323 | 3300025208 | Bacteria | 21856 |
| 331 | Ga0209436_100621 | 3300025208 | Bacteria | 15167 |
| 332 | Ga0209784_100581 | 3300025224 | Bacteria | 12361 |
| 333 | Ga0209784_104690 | 3300025224 | Bacteria | 945 |
| 334 | Ga0209566_100409 | 3300025225 | Bacteria | 34025 |
| 335 | Ga0209674_100007 | 3300025226 | Bacteria | 1077082 |
| 336 | Ga0209674_100048 | 3300025226 | Bacteria | 353032 |
| 337 | Ga0209674_100167 | 3300025226 | Bacteria | 84961 |
| 338 | Ga0209674_100228 | 3300025226 | Bacteria | 50307 |
| 339 | Ga0209674_103466 | 3300025226 | Bacteria | 2888 |
| 340 | Ga0209672_100111 | 3300025228 | Bacteria | 94440 |
| 341 | Ga0209672_102138 | 3300025228 | Bacteria | 5254 |
| 342 | Ga0209147_100015 | 3300025229 | Bacteria | 565073 |
| 343 | Ga0209147_100878 | 3300025229 | Bacteria | 13846 |
| 344 | Ga0209563_100052 | 3300025230 | Bacteria | 334307 |
| 345 | Ga0207427_104073 | 3300025231 | Bacteria | 2641 |
| 346 | Ga0209437_100072 | 3300025233 | Bacteria | 305152 |
| 347 | Ga0209258_100021 | 3300025242 | Bacteria | 565073 |
| 348 | Ga0209258_100067 | 3300025242 | Bacteria | 287603 |
| 349 | Ga0209258_100110 | 3300025242 | Bacteria | 201322 |
| 350 | Ga0209258_100789 | 3300025242 | Bacteria | 19058 |
| 351 | Ga0207425_1000128 | 3300025245 | Bacteria | 71502 |
| 352 | Ga0207425_1000171 | 3300025245 | Bacteria | 53565 |
| 353 | Ga0207425_1001472 | 3300025245 | Bacteria | 9805 |
| 354 | Ga0209646_1000055 | 3300025246 | Bacteria | 271793 |
| 355 | Ga0209026_1000790 | 3300025250 | Bacteria | 17331 |
| 356 | Ga0209677_100015 | 3300025253 | Bacteria | 532137 |
| 357 | Ga0209677_102961 | 3300025253 | Bacteria | 5917 |
| 358 | Ga0209148_1000067 | 3300025254 | Bacteria | 338678 |
| 359 | Ga0209148_1000109 | 3300025254 | Bacteria | 204266 |
| 360 | Ga0209148_1003318 | 3300025254 | Bacteria | 4540 |
| 361 | Ga0209148_1005633 | 3300025254 | Bacteria | 2839 |
| 362 | Ga0209759_1000002 | 3300025256 | Bacteria | 1027596 |
| 363 | Ga0209759_1000032 | 3300025256 | Bacteria | 278697 |
| 364 | Ga0209759_1000096 | 3300025256 | Bacteria | 157803 |
| 365 | Ga0209759_1001112 | 3300025256 | Bacteria | 17352 |
| 366 | Ga0209759_1001420 | 3300025256 | Bacteria | 13646 |
| 367 | Ga0209759_1001795 | 3300025256 | Bacteria | 10872 |
| 368 | Ga0209759_1004056 | 3300025256 | Bacteria | 5605 |
| 369 | Ga0209759_1006504 | 3300025256 | Bacteria | 3916 |
| 370 | Ga0209759_1020780 | 3300025256 | Bacteria | 1512 |
| 371 | Ga0209129_1007442 | 3300025258 | Bacteria | 3260 |
| 372 | Ga0209565_1000036 | 3300025263 | Bacteria | 293334 |
| 373 | Ga0209565_1000655 | 3300025263 | Bacteria | 22236 |
| 374 | Ga0209565_1000793 | 3300025263 | Bacteria | 18252 |
| 375 | Ga0209565_1010299 | 3300025263 | Bacteria | 2324 |
| 376 | Ga0209565_1061857 | 3300025263 | Bacteria | 648 |
| 377 | Ga0209455_1000028 | 3300025272 | Bacteria | 565073 |
| 378 | Ga0209455_1000044 | 3300025272 | Bacteria | 410787 |
| 379 | Ga0209455_1000104 | 3300025272 | Bacteria | 201321 |
| 380 | Ga0209673_1000008 | 3300025273 | Bacteria | 626013 |
| 381 | Ga0209673_1041743 | 3300025273 | Bacteria | 1298 |
| 382 | Ga0209130_1000042 | 3300025284 | Bacteria | 257581 |
| 383 | Ga0209130_1000622 | 3300025284 | Bacteria | 33932 |
| 384 | Ga0209130_1001507 | 3300025284 | Bacteria | 15032 |
| 385 | Ga0209130_1003777 | 3300025284 | Bacteria | 6168 |
| 386 | Ga0209675_1000106 | 3300025291 | Bacteria | 120459 |
| 387 | Ga0209675_1000969 | 3300025291 | Bacteria | 18144 |
| 388 | Ga0209675_1001478 | 3300025291 | Bacteria | 13505 |
| 389 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 390 | Ga0209676_1000385 | 3300025292 | Bacteria | 81044 |
| 391 | Ga0209676_1000838 | 3300025292 | Bacteria | 39842 |
| 392 | Ga0209676_1000873 | 3300025292 | Bacteria | 38608 |
| 393 | Ga0209676_1012742 | 3300025292 | Bacteria | 3275 |
| 394 | Ga0209025_1001118 | 3300025294 | Bacteria | 38440 |
| 395 | Ga0209025_1002157 | 3300025294 | Bacteria | 21934 |
| 396 | Ga0209025_1002304 | 3300025294 | Bacteria | 20701 |
| 397 | Ga0209025_1003224 | 3300025294 | Bacteria | 15791 |
| 398 | Ga0209025_1003856 | 3300025294 | Bacteria | 13611 |
| 399 | Ga0209025_1006471 | 3300025294 | Bacteria | 9076 |
| 400 | Ga0209025_1010607 | 3300025294 | Bacteria | 6217 |
| 401 | Ga0209564_1000170 | 3300025295 | Bacteria | 156293 |
| 402 | Ga0209564_1000487 | 3300025295 | Bacteria | 65983 |
| 403 | Ga0209564_1002834 | 3300025295 | Bacteria | 12796 |
| 404 | Ga0209564_1006635 | 3300025295 | Bacteria | 6184 |
| 405 | Ga0209758_1000578 | 3300025297 | Bacteria | 57247 |
| 406 | Ga0209758_1005683 | 3300025297 | Bacteria | 9428 |
| 407 | Ga0209758_1043515 | 3300025297 | Bacteria | 1653 |
| 408 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 409 | Ga0209050_1000078 | 3300025298 | Bacteria | 278409 |
| 410 | Ga0209050_1001437 | 3300025298 | Bacteria | 25610 |
| 411 | Ga0209050_1003829 | 3300025298 | Bacteria | 10730 |
| 412 | Ga0209050_1004842 | 3300025298 | Bacteria | 8836 |
| 413 | Ga0209050_1022600 | 3300025298 | Bacteria | 2248 |
| 414 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 415 | Ga0209256_1000007 | 3300025299 | Bacteria | 1136599 |
| 416 | Ga0209256_1000976 | 3300025299 | Bacteria | 34352 |
| 417 | Ga0209256_1005893 | 3300025299 | Bacteria | 6784 |
| 418 | Ga0207426_1000097 | 3300025302 | Bacteria | 265930 |
| 419 | Ga0207426_1000988 | 3300025302 | Bacteria | 27876 |
| 420 | Ga0207426_1001375 | 3300025302 | Bacteria | 20602 |
| 421 | Ga0207426_1002116 | 3300025302 | Bacteria | 13628 |
| 422 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 423 | Ga0209051_1000137 | 3300025303 | Bacteria | 137784 |
| 424 | Ga0209051_1000247 | 3300025303 | Bacteria | 91122 |
| 425 | Ga0209051_1000773 | 3300025303 | Bacteria | 33955 |
| 426 | Ga0209051_1014258 | 3300025303 | Bacteria | 3719 |
| 427 | Ga0209051_1028039 | 3300025303 | Bacteria | 2231 |
| 428 | Ga0209257_1000020 | 3300025304 | Bacteria | 773356 |
| 429 | Ga0209257_1000097 | 3300025304 | Bacteria | 259243 |
| 430 | Ga0209257_1000141 | 3300025304 | Bacteria | 201130 |
| 431 | Ga0209257_1000205 | 3300025304 | Bacteria | 143735 |
| 432 | Ga0207697_10003125 | 3300025315 | Bacteria | 8275 |
| 433 | Ga0207655_1012412 | 3300025728 | Bacteria | 4981 |
| 434 | Ga0207682_10010692 | 3300025893 | Bacteria | 3591 |
| 435 | Ga0207682_10022645 | 3300025893 | Bacteria | 2477 |
| 436 | Ga0207682_10034635 | 3300025893 | Bacteria | 2036 |
| 437 | Ga0207682_10040443 | 3300025893 | Bacteria | 1899 |
| 438 | Ga0207682_10387804 | 3300025893 | Bacteria | 660 |
| 439 | Ga0207688_10037434 | 3300025901 | Bacteria | 2691 |
| 440 | Ga0207680_10017945 | 3300025903 | Bacteria | 3748 |
| 441 | Ga0207680_11011117 | 3300025903 | Bacteria | 595 |
| 442 | Ga0207647_10007532 | 3300025904 | Bacteria | 7858 |
| 443 | Ga0207645_10000282 | 3300025907 | Bacteria | 42311 |
| 444 | Ga0207705_10155876 | 3300025909 | Bacteria | 1713 |
| 445 | Ga0207705_10820029 | 3300025909 | Bacteria | 722 |
| 446 | Ga0207695_10002587 | 3300025913 | Bacteria | 26542 |
| 447 | Ga0207695_10026145 | 3300025913 | Bacteria | 6517 |
| 448 | Ga0207671_10055406 | 3300025914 | Bacteria | 2937 |
| 449 | Ga0207671_10611980 | 3300025914 | Bacteria | 868 |
| 450 | Ga0207693_10167371 | 3300025915 | Bacteria | 1731 |
| 451 | Ga0207657_10112068 | 3300025919 | Bacteria | 2252 |
| 452 | Ga0207657_10344044 | 3300025919 | Bacteria | 1177 |
| 453 | Ga0207681_10025353 | 3300025923 | Bacteria | 3813 |
| 454 | Ga0207650_10033243 | 3300025925 | Bacteria | 3734 |
| 455 | Ga0207650_10063188 | 3300025925 | Bacteria | 2767 |
| 456 | Ga0207650_10074960 | 3300025925 | Bacteria | 2552 |
| 457 | Ga0207650_10204675 | 3300025925 | Bacteria | 1582 |
| 458 | Ga0207659_10001500 | 3300025926 | Bacteria | 13901 |
| 459 | Ga0207659_10003012 | 3300025926 | Bacteria | 10044 |
| 460 | Ga0207659_10407822 | 3300025926 | Bacteria | 1138 |
| 461 | Ga0207659_10449109 | 3300025926 | Bacteria | 1086 |
| 462 | Ga0207700_10000519 | 3300025928 | Bacteria | 22663 |
| 463 | Ga0207664_10690511 | 3300025929 | Bacteria | 918 |
| 464 | Ga0207644_10012204 | 3300025931 | Bacteria | 5701 |
| 465 | Ga0207644_10078583 | 3300025931 | Bacteria | 2432 |
| 466 | Ga0207644_10274435 | 3300025931 | Bacteria | 1352 |
| 467 | Ga0207644_10790913 | 3300025931 | Bacteria | 793 |
| 468 | Ga0207644_11867689 | 3300025931 | Bacteria | 502 |
| 469 | Ga0207690_10003361 | 3300025932 | Bacteria | 9567 |
| 470 | Ga0207690_10320659 | 3300025932 | Bacteria | 1218 |
| 471 | Ga0207706_10165800 | 3300025933 | Unclassified | 1941 |
| 472 | Ga0207706_10220087 | 3300025933 | Bacteria | 1662 |
| 473 | Ga0207706_10222786 | 3300025933 | Bacteria | 1651 |
| 474 | Ga0207706_10527960 | 3300025933 | Bacteria | 1017 |
| 475 | Ga0207706_11013236 | 3300025933 | Bacteria | 697 |
| 476 | Ga0207686_10469255 | 3300025934 | Bacteria | 971 |
| 477 | Ga0207686_10885598 | 3300025934 | Bacteria | 720 |
| 478 | Ga0207709_10748401 | 3300025935 | Bacteria | 785 |
| 479 | Ga0207709_11488321 | 3300025935 | Bacteria | 561 |
| 480 | Ga0207670_10267459 | 3300025936 | Bacteria | 1327 |
| 481 | Ga0207669_10198054 | 3300025937 | Bacteria | 1455 |
| 482 | Ga0207669_10413131 | 3300025937 | Bacteria | 1060 |
| 483 | Ga0207669_10564349 | 3300025937 | Bacteria | 920 |
| 484 | Ga0207704_10020880 | 3300025938 | Bacteria | 3475 |
| 485 | Ga0207704_10104922 | 3300025938 | Bacteria | 1894 |
| 486 | Ga0207704_10564933 | 3300025938 | Bacteria | 926 |
| 487 | Ga0207665_10228535 | 3300025939 | Bacteria | 1366 |
| 488 | Ga0207691_10000577 | 3300025940 | Bacteria | 36651 |
| 489 | Ga0207691_10274331 | 3300025940 | Bacteria | 1452 |
| 490 | Ga0207691_10500415 | 3300025940 | Bacteria | 1032 |
| 491 | Ga0207711_10008678 | 3300025941 | Bacteria | 8504 |
| 492 | Ga0207711_10184568 | 3300025941 | Bacteria | 1898 |
| 493 | Ga0207711_10291446 | 3300025941 | Bacteria | 1504 |
| 494 | Ga0207711_10469698 | 3300025941 | Bacteria | 1171 |
| 495 | Ga0207689_10001993 | 3300025942 | Bacteria | 19284 |
| 496 | Ga0207689_10039143 | 3300025942 | Bacteria | 3926 |
| 497 | Ga0207689_10061516 | 3300025942 | Bacteria | 3088 |
| 498 | Ga0207667_10044315 | 3300025949 | Bacteria | 4715 |
| 499 | Ga0207667_10800837 | 3300025949 | Bacteria | 939 |
| 500 | Ga0207651_10005847 | 3300025960 | Bacteria | 6360 |
| 501 | Ga0207651_10043654 | 3300025960 | Bacteria | 2994 |
| 502 | Ga0207651_10058430 | 3300025960 | Bacteria | 2666 |
| 503 | Ga0207651_10306146 | 3300025960 | Bacteria | 1323 |
| 504 | Ga0207651_10363965 | 3300025960 | Unclassified | 1221 |
| 505 | Ga0207712_10744990 | 3300025961 | Bacteria | 858 |
| 506 | Ga0207668_10019869 | 3300025972 | Bacteria | 4256 |
| 507 | Ga0207668_10154940 | 3300025972 | Bacteria | 1779 |
| 508 | Ga0207640_10000132 | 3300025981 | Bacteria | 55549 |
| 509 | Ga0207640_10060214 | 3300025981 | Bacteria | 2509 |
| 510 | Ga0207640_10208791 | 3300025981 | Bacteria | 1486 |
| 511 | Ga0207640_10502747 | 3300025981 | Unclassified | 1010 |
| 512 | Ga0207658_10006229 | 3300025986 | Bacteria | 8153 |
| 513 | Ga0207658_10038490 | 3300025986 | Bacteria | 3445 |
| 514 | Ga0207658_10058095 | 3300025986 | Bacteria | 2877 |
| 515 | Ga0207658_10068569 | 3300025986 | Bacteria | 2677 |
| 516 | Ga0207658_10186927 | 3300025986 | Bacteria | 1719 |
| 517 | Ga0207658_10310958 | 3300025986 | Bacteria | 1361 |
| 518 | Ga0207677_10000891 | 3300026023 | Bacteria | 16769 |
| 519 | Ga0207677_10033260 | 3300026023 | Bacteria | 3324 |
| 520 | Ga0207677_11156568 | 3300026023 | Bacteria | 707 |
| 521 | Ga0207703_10128672 | 3300026035 | Bacteria | 2184 |
| 522 | Ga0207703_11089976 | 3300026035 | Bacteria | 767 |
| 523 | Ga0207639_10065074 | 3300026041 | Bacteria | 2829 |
| 524 | Ga0207678_10074895 | 3300026067 | Bacteria | 2900 |
| 525 | Ga0207641_10016984 | 3300026088 | Bacteria | 5958 |
| 526 | Ga0207641_10031684 | 3300026088 | Bacteria | 4386 |
| 527 | Ga0207641_10073571 | 3300026088 | Bacteria | 2945 |
| 528 | Ga0207641_10273085 | 3300026088 | Bacteria | 1587 |
| 529 | Ga0207641_10583461 | 3300026088 | Bacteria | 1093 |
| 530 | Ga0207641_11052935 | 3300026088 | Bacteria | 811 |
| 531 | Ga0207648_10003294 | 3300026089 | Bacteria | 16977 |
| 532 | Ga0207648_10096500 | 3300026089 | Bacteria | 2587 |
| 533 | Ga0207648_10098100 | 3300026089 | Bacteria | 2565 |
| 534 | Ga0207648_10104805 | 3300026089 | Bacteria | 2481 |
| 535 | Ga0207648_10553455 | 3300026089 | Bacteria | 1057 |
| 536 | Ga0207648_10594571 | 3300026089 | Bacteria | 1019 |
| 537 | Ga0207648_11391192 | 3300026089 | Bacteria | 659 |
| 538 | Ga0207676_10071275 | 3300026095 | Bacteria | 2789 |
| 539 | Ga0207676_10482591 | 3300026095 | Bacteria | 1174 |
| 540 | Ga0207674_10001419 | 3300026116 | Bacteria | 30946 |
| 541 | Ga0207674_10054909 | 3300026116 | Bacteria | 4053 |
| 542 | Ga0207675_100015675 | 3300026118 | Bacteria | 7068 |
| 543 | Ga0207683_10001960 | 3300026121 | Bacteria | 18224 |
| 544 | Ga0207683_10022854 | 3300026121 | Bacteria | 5372 |
| 545 | Ga0207683_10076963 | 3300026121 | Bacteria | 2954 |
| 546 | Ga0207683_10327314 | 3300026121 | Bacteria | 1404 |
| 547 | Ga0207698_10103150 | 3300026142 | Bacteria | 2370 |
| 548 | Ga0207698_10209466 | 3300026142 | Bacteria | 1753 |
| 549 | Ga0207698_10774636 | 3300026142 | Bacteria | 960 |
| 550 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 551 | Ga0209813_10029137 | 3300027866 | Bacteria | 1615 |
| 552 | Ga0207428_10018351 | 3300027907 | Bacteria | 5978 |
| 553 | Ga0268266_10198180 | 3300028379 | Bacteria | 1837 |
| 554 | Ga0268266_10283930 | 3300028379 | Bacteria | 1540 |
| 555 | Ga0268266_10897411 | 3300028379 | Bacteria | 857 |
| 556 | Ga0268265_10067661 | 3300028380 | Bacteria | 2766 |
| 557 | Ga0268265_10608404 | 3300028380 | Bacteria | 1045 |
| 558 | Ga0268264_10016184 | 3300028381 | Bacteria | 6107 |
| 559 | Ga0268264_10132647 | 3300028381 | Bacteria | 2211 |
| 560 | Ga0307517_10255853 | 3300028786 | Bacteria | 1022 |
| 561 | Ga0307515_10000282 | 3300028794 | Bacteria | 125216 |
| 562 | Ga0307515_10530262 | 3300028794 | Bacteria | 787 |
| 563 | Ga0265338_10000057 | 3300028800 | Bacteria | 200477 |
| 564 | Ga0314311_1152045 | 3300030733 | Bacteria | 1494 |
| 565 | Ga0316182_1004301 | 3300030745 | Bacteria | 3660 |
| 566 | Ga0265331_10005985 | 3300031250 | Bacteria | 7257 |
| 567 | Ga0265327_10000020 | 3300031251 | Bacteria | 424552 |
| 568 | Ga0265327_10007098 | 3300031251 | Bacteria | 8753 |
| 569 | Ga0265316_10435577 | 3300031344 | Unclassified | 941 |
| 570 | Ga0307513_10000017 | 3300031456 | Bacteria | 282386 |
| 571 | Ga0307509_10001891 | 3300031507 | Bacteria | 34576 |
| 572 | Ga0307509_10066421 | 3300031507 | Bacteria | 3784 |
| 573 | Ga0307408_100006468 | 3300031548 | Bacteria | 7767 |
| 574 | Ga0307408_100009227 | 3300031548 | Bacteria | 6502 |
| 575 | Ga0307408_100040713 | 3300031548 | Bacteria | 3291 |
| 576 | Ga0307408_100051022 | 3300031548 | Bacteria | 2978 |
| 577 | Ga0307508_10000041 | 3300031616 | Bacteria | 147868 |
| 578 | Ga0307508_10030006 | 3300031616 | Bacteria | 4914 |
| 579 | Ga0307514_10003331 | 3300031649 | Bacteria | 15561 |
| 580 | Ga0307514_10412800 | 3300031649 | Bacteria | 683 |
| 581 | Ga0316576_10027203 | 3300031727 | Bacteria | 4019 |
| 582 | Ga0316576_10029075 | 3300031727 | Bacteria | 3902 |
| 583 | Ga0316578_10150991 | 3300031728 | Bacteria | 1399 |
| 584 | Ga0307516_10002079 | 3300031730 | Bacteria | 27265 |
| 585 | Ga0307516_10188670 | 3300031730 | Bacteria | 1789 |
| 586 | Ga0316577_10310978 | 3300031733 | Bacteria | 893 |
| 587 | Ga0307413_12017310 | 3300031824 | Bacteria | 520 |
| 588 | Ga0307412_10000106 | 3300031911 | Bacteria | 67067 |
| 589 | Ga0307409_100921698 | 3300031995 | Bacteria | 888 |
| 590 | Ga0307416_100067405 | 3300032002 | Bacteria | 2952 |
| 591 | Ga0307416_102957567 | 3300032002 | Bacteria | 568 |
| 592 | Ga0307414_10147406 | 3300032004 | Bacteria | 1851 |
| 593 | Ga0307411_10287822 | 3300032005 | Bacteria | 1311 |
| 594 | Ga0307507_10006539 | 3300033179 | Bacteria | 17791 |
| 595 | Ga0307510_10000560 | 3300033180 | Bacteria | 37413 |
| 596 | Ga0373959_0066663 | 3300034820 | Bacteria | 806 |
| 597 | Ga0373934_0040794 | 3300035086 | Bacteria | 1832 |
| 598 | Ga0373940_0179290 | 3300035088 | Bacteria | 688 |
| 599 | Ga0373946_0604944 | 3300035171 | Bacteria | 569 |
| 600 | Ga0373931_0074308 | 3300035691 | Bacteria | 1862 |
| 601 | Ga0373931_0260070 | 3300035691 | Bacteria | 1059 |
| 602 | Ga0316584_0072663 | 3300036712 | Bacteria | 2578 |
| 603 | Ga0373925_0358354 | 3300037068 | Bacteria | 1185 |
| 604 | Ga0395899_0021488 | 3300037312 | Bacteria | 4896 |
| 605 | Ga0395899_0194843 | 3300037312 | Bacteria | 1416 |
| 606 | Ga0395899_0251771 | 3300037312 | Bacteria | 1212 |
| 607 | Ga0395900_0005097 | 3300037418 | Bacteria | 13793 |
| 608 | Ga0395900_0075846 | 3300037418 | Bacteria | 3456 |
| 609 | Ga0395900_0076572 | 3300037418 | Bacteria | 3438 |
| 610 | Ga0395900_0120307 | 3300037418 | Bacteria | 2694 |
| 611 | Ga0395900_0652159 | 3300037418 | Bacteria | 989 |
| 612 | Ga0395898_0053933 | 3300037466 | Bacteria | 3925 |
| 613 | Ga0395898_0127607 | 3300037466 | Bacteria | 2437 |
| 614 | Ga0395905_0000035 | 3300037471 | Bacteria | 272014 |
| 615 | Ga0395905_0010128 | 3300037471 | Bacteria | 9189 |
| 616 | Ga0395905_0014849 | 3300037471 | Bacteria | 7428 |
| 617 | Ga0395905_0219153 | 3300037471 | Bacteria | 1781 |
| 618 | Ga0395905_0541227 | 3300037471 | Bacteria | 1065 |
| 619 | Ga0395901_0008309 | 3300038443 | Bacteria | 10492 |
| 620 | Ga0395901_0018729 | 3300038443 | Bacteria | 7073 |
| 621 | Ga0395901_0021971 | 3300038443 | Bacteria | 6540 |
| 622 | Ga0395901_0069418 | 3300038443 | Bacteria | 3670 |
| 623 | Ga0395901_0489180 | 3300038443 | Bacteria | 1254 |
| 624 | Ga0395901_0612107 | 3300038443 | Bacteria | 1097 |
| 625 | Ga0436361_0024448 | 3300039447 | Bacteria | 32744 |
| 626 | Ga0436361_0426697 | 3300039447 | Bacteria | 3012 |
| 627 | Ga0436361_0505867 | 3300039447 | Bacteria | 720 |
| 628 | Ga0436361_0816616 | 3300039447 | Bacteria | 3262 |
| 629 | Ga0436361_0991880 | 3300039447 | Bacteria | 1367 |
| 630 | Ga0436361_1170005 | 3300039447 | Bacteria | 16387 |
| 631 | Ga0439438_050632 | 3300041405 | Bacteria | 1057 |
| 632 | Ga0439438_066525 | 3300041405 | Bacteria | 896 |
| 633 | Ga0439447_001903 | 3300041407 | Bacteria | 7644 |
| 634 | Ga0439466_0031954 | 3300041411 | Bacteria | 1797 |
| 635 | Ga0451800_1200240 | 3300041459 | Bacteria | 544 |
| 636 | Ga0439431_0213455 | 3300041997 | Bacteria | 565 |
| 637 | Ga0439445_0179493 | 3300042004 | Bacteria | 622 |
| 638 | Ga0439448_0182845 | 3300042005 | Bacteria | 733 |
| 639 | Ga0439449_0137689 | 3300042007 | Bacteria | 908 |
| 640 | Ga0439452_000004 | 3300042010 | Bacteria | 764268 |
| 641 | Ga0439457_123487 | 3300042014 | Bacteria | 613 |
| 642 | Ga0439462_0095897 | 3300042015 | Bacteria | 815 |
| 643 | Ga0450911_002991 | 3300042115 | Bacteria | 3112 |
| 644 | Ga0451577_0348540 | 3300042876 | Bacteria | 1343 |
| 645 | Ga0451577_0505451 | 3300042876 | Bacteria | 1097 |
| 646 | Ga0466969_0032822 | 3300044656 | Bacteria | 2638 |
| 647 | Ga0466972_0000747 | 3300044658 | Bacteria | 15487 |
| 648 | Ga0466978_0002981 | 3300044671 | Bacteria | 7585 |
| 649 | Ga0466982_0042372 | 3300044672 | Bacteria | 2762 |
| 650 | Ga0466965_0008878 | 3300044683 | Bacteria | 4658 |
| 651 | Ga0466966_0000008 | 3300044684 | Bacteria | 155597 |
| 652 | Ga0466966_0055000 | 3300044684 | Bacteria | 2521 |
| 653 | Ga0466961_0000502 | 3300044693 | Bacteria | 24971 |
| 654 | Ga0466961_0001985 | 3300044693 | Bacteria | 12731 |
| 655 | Ga0466961_0333227 | 3300044693 | Bacteria | 925 |
| 656 | Ga0466963_0015782 | 3300044694 | Bacteria | 4686 |
| 657 | Ga0466963_0062450 | 3300044694 | Bacteria | 2491 |
| 658 | Ga0466964_0001030 | 3300044706 | Bacteria | 9285 |
| 659 | Ga0453684_0812921 | 3300044712 | Bacteria | 1007 |
| 660 | Ga0466971_0008438 | 3300044719 | Bacteria | 4494 |
| 661 | Ga0466971_0315751 | 3300044719 | Bacteria | 752 |
| 662 | Ga0466968_0035976 | 3300044735 | Bacteria | 2073 |
| 663 | Ga0466968_0242699 | 3300044735 | Bacteria | 853 |
| 664 | Ga0466970_0000308 | 3300044765 | Bacteria | 23772 |
| 665 | Ga0466957_0112276 | 3300044842 | Bacteria | 1729 |
| 666 | Ga0466960_0006828 | 3300044901 | Bacteria | 4600 |
| 667 | Ga0466959_0003070 | 3300045049 | Bacteria | 10812 |
| 668 | Ga0466959_0036722 | 3300045049 | Bacteria | 3619 |
| 669 | Ga0466959_0601852 | 3300045049 | Bacteria | 739 |
| 670 | Ga0451576_0112109 | 3300045051 | Bacteria | 2839 |
| 671 | Ga0451576_0147441 | 3300045051 | Bacteria | 2454 |
| 672 | Ga0466958_0042750 | 3300045836 | Bacteria | 2729 |
| 673 | Ga0466958_0185696 | 3300045836 | Bacteria | 1320 |
| 674 | Ga0466967_0022965 | 3300045976 | Bacteria | 5103 |
| 675 | Ga0495592_0212945 | 3300046454 | Bacteria | 1297 |
| 676 | Ga0495603_0000088 | 3300046455 | Bacteria | 41342 |
| 677 | Ga0495590_0000010 | 3300046457 | Bacteria | 317890 |
| 678 | Ga0495590_0019251 | 3300046457 | Bacteria | 2434 |
| 679 | Ga0495629_0001578 | 3300046459 | Bacteria | 17919 |
| 680 | Ga0495629_0001651 | 3300046459 | Bacteria | 17506 |
| 681 | Ga0495629_0025278 | 3300046459 | Bacteria | 4223 |
| 682 | Ga0495629_0075758 | 3300046459 | Bacteria | 2349 |
| 683 | Ga0495629_0383771 | 3300046459 | Bacteria | 956 |
| 684 | Ga0495638_0000042 | 3300046460 | Bacteria | 232752 |
| 685 | Ga0495651_0000727 | 3300046462 | Bacteria | 25494 |
| 686 | Ga0495651_0009143 | 3300046462 | Bacteria | 7604 |
| 687 | Ga0495653_0000010 | 3300046463 | Bacteria | 274131 |
| 688 | Ga0495653_0000573 | 3300046463 | Bacteria | 28220 |
| 689 | Ga0495653_0029427 | 3300046463 | Bacteria | 4384 |
| 690 | Ga0495653_0031645 | 3300046463 | Bacteria | 4203 |
| 691 | Ga0495653_0163918 | 3300046463 | Bacteria | 1541 |
| 692 | Ga0495653_0253308 | 3300046463 | Bacteria | 1167 |
| 693 | Ga0495650_0000429 | 3300046471 | Bacteria | 68004 |
| 694 | Ga0495650_0075639 | 3300046471 | Bacteria | 1310 |
| 695 | Ga0495580_0001753 | 3300046472 | Bacteria | 19069 |
| 696 | Ga0495580_0005225 | 3300046472 | Bacteria | 10788 |
| 697 | Ga0495580_0005577 | 3300046472 | Bacteria | 10372 |
| 698 | Ga0495582_0121741 | 3300046473 | Bacteria | 1470 |
| 699 | Ga0495605_0007017 | 3300046474 | Bacteria | 6428 |
| 700 | Ga0495639_0004616 | 3300046475 | Bacteria | 5911 |
| 701 | Ga0495639_0462784 | 3300046475 | Bacteria | 645 |
| 702 | Ga0495662_0478163 | 3300046476 | Bacteria | 611 |
| 703 | Ga0495664_0107616 | 3300046477 | Bacteria | 1682 |
| 704 | Ga0495584_0020617 | 3300046491 | Bacteria | 3348 |
| 705 | Ga0495585_0000003 | 3300046492 | Bacteria | 406344 |
| 706 | Ga0495585_0002914 | 3300046492 | Bacteria | 11849 |
| 707 | Ga0495585_0300215 | 3300046492 | Bacteria | 790 |
| 708 | Ga0495596_0039376 | 3300046500 | Bacteria | 1867 |
| 709 | Ga0495596_0066504 | 3300046500 | Bacteria | 1401 |
| 710 | Ga0495607_0054065 | 3300046501 | Bacteria | 2315 |
| 711 | Ga0495583_0000006 | 3300046506 | Bacteria | 436893 |
| 712 | Ga0495583_0008409 | 3300046506 | Bacteria | 6312 |
| 713 | Ga0495583_0032653 | 3300046506 | Bacteria | 2511 |
| 714 | Ga0495606_0003357 | 3300046507 | Bacteria | 17069 |
| 715 | Ga0495606_0014891 | 3300046507 | Bacteria | 6036 |
| 716 | Ga0495606_0052343 | 3300046507 | Bacteria | 2656 |
| 717 | Ga0495606_0164520 | 3300046507 | Bacteria | 1292 |
| 718 | Ga0495606_0446175 | 3300046507 | Bacteria | 664 |
| 719 | Ga0495608_0484735 | 3300046511 | Bacteria | 750 |
| 720 | Ga0495610_0004664 | 3300046512 | Bacteria | 10027 |
| 721 | Ga0495610_0021196 | 3300046512 | Bacteria | 3579 |
| 722 | Ga0495610_0230884 | 3300046512 | Bacteria | 742 |
| 723 | Ga0495616_0002197 | 3300046513 | Bacteria | 13040 |
| 724 | Ga0495616_0007358 | 3300046513 | Bacteria | 6587 |
| 725 | Ga0495618_0029802 | 3300046514 | Bacteria | 3405 |
| 726 | Ga0495618_0072038 | 3300046514 | Bacteria | 2199 |
| 727 | Ga0495618_0077661 | 3300046514 | Bacteria | 2116 |
| 728 | Ga0495618_0190118 | 3300046514 | Bacteria | 1302 |
| 729 | Ga0495628_0000366 | 3300046516 | Bacteria | 41368 |
| 730 | Ga0495628_0028221 | 3300046516 | Bacteria | 4561 |
| 731 | Ga0495628_0033309 | 3300046516 | Bacteria | 4154 |
| 732 | Ga0495628_0144249 | 3300046516 | Bacteria | 1816 |
| 733 | Ga0495628_0326075 | 3300046516 | Bacteria | 1132 |
| 734 | Ga0495630_0008911 | 3300046517 | Bacteria | 7203 |
| 735 | Ga0495630_0009796 | 3300046517 | Bacteria | 6898 |
| 736 | Ga0495630_0145687 | 3300046517 | Bacteria | 1801 |
| 737 | Ga0495630_1072776 | 3300046517 | Bacteria | 611 |
| 738 | Ga0495632_0021184 | 3300046519 | Bacteria | 3506 |
| 739 | Ga0495637_0013967 | 3300046520 | Bacteria | 3799 |
| 740 | Ga0495643_0001442 | 3300046522 | Bacteria | 21926 |
| 741 | Ga0495643_0113304 | 3300046522 | Bacteria | 1377 |
| 742 | Ga0495648_0000011 | 3300046524 | Bacteria | 299518 |
| 743 | Ga0495648_0001082 | 3300046524 | Bacteria | 27695 |
| 744 | Ga0495648_0001863 | 3300046524 | Bacteria | 20176 |
| 745 | Ga0495648_0011239 | 3300046524 | Bacteria | 6759 |
| 746 | Ga0495648_0015932 | 3300046524 | Bacteria | 5432 |
| 747 | Ga0495648_0080484 | 3300046524 | Bacteria | 1856 |
| 748 | Ga0495648_0172871 | 3300046524 | Bacteria | 1105 |
| 749 | Ga0495666_0000893 | 3300046526 | Bacteria | 13970 |
| 750 | Ga0495666_0001632 | 3300046526 | Bacteria | 11046 |
| 751 | Ga0495666_0040451 | 3300046526 | Bacteria | 2261 |
| 752 | Ga0495642_0046277 | 3300046528 | Bacteria | 1780 |
| 753 | Ga0495642_0058542 | 3300046528 | Bacteria | 1595 |
| 754 | Ga0495642_0094729 | 3300046528 | Bacteria | 1266 |
| 755 | Ga0495642_0108036 | 3300046528 | Bacteria | 1188 |
| 756 | Ga0495652_0001267 | 3300046529 | Bacteria | 28252 |
| 757 | Ga0495652_0059282 | 3300046529 | Bacteria | 3239 |
| 758 | Ga0495652_0078627 | 3300046529 | Bacteria | 2729 |
| 759 | Ga0495654_0004989 | 3300046530 | Bacteria | 7795 |
| 760 | Ga0495654_0021025 | 3300046530 | Bacteria | 3398 |
| 761 | Ga0495665_0000466 | 3300046531 | Bacteria | 20362 |
| 762 | Ga0495665_0089082 | 3300046531 | Bacteria | 1621 |
| 763 | Ga0495640_0011186 | 3300046533 | Bacteria | 6908 |
| 764 | Ga0495640_0098853 | 3300046533 | Bacteria | 1917 |
| 765 | Ga0495586_0000626 | 3300046535 | Bacteria | 20354 |
| 766 | Ga0495586_0056963 | 3300046535 | Bacteria | 2120 |
| 767 | Ga0495621_0520555 | 3300046539 | Bacteria | 514 |
| 768 | Ga0495597_0000111 | 3300046542 | Bacteria | 72653 |
| 769 | Ga0495597_0000567 | 3300046542 | Bacteria | 30695 |
| 770 | Ga0495597_0007752 | 3300046542 | Bacteria | 5425 |
| 771 | Ga0495597_0125286 | 3300046542 | Bacteria | 1068 |
| 772 | Ga0495645_0033419 | 3300046543 | Bacteria | 3753 |
| 773 | Ga0495645_0156948 | 3300046543 | Bacteria | 1576 |
| 774 | Ga0495645_0157631 | 3300046543 | Bacteria | 1572 |
| 775 | Ga0495645_0193410 | 3300046543 | Bacteria | 1385 |
| 776 | Ga0495645_0486291 | 3300046543 | Bacteria | 773 |
| 777 | Ga0495622_0000116 | 3300046557 | Bacteria | 69072 |
| 778 | Ga0495622_0012142 | 3300046557 | Bacteria | 3985 |
| 779 | Ga0495633_0000124 | 3300046558 | Bacteria | 104617 |
| 780 | Ga0495633_0000553 | 3300046558 | Bacteria | 36816 |
| 781 | Ga0495633_0012156 | 3300046558 | Bacteria | 4593 |
| 782 | Ga0495633_0043104 | 3300046558 | Bacteria | 2141 |
| 783 | Ga0495633_0311744 | 3300046558 | Bacteria | 714 |
| 784 | Ga0495656_0320817 | 3300046615 | Bacteria | 798 |
| 785 | Ga0495668_0000843 | 3300046616 | Bacteria | 34761 |
| 786 | Ga0495668_0006379 | 3300046616 | Bacteria | 7729 |
| 787 | Ga0495634_0032866 | 3300046642 | Bacteria | 3565 |
| 788 | Ga0495611_0082400 | 3300046648 | Bacteria | 1481 |
| 789 | Ga0495625_0000218 | 3300046660 | Bacteria | 90741 |
| 790 | Ga0495625_0001835 | 3300046660 | Bacteria | 24293 |
| 791 | Ga0495625_0146479 | 3300046660 | Bacteria | 1590 |
| 792 | Ga0495625_0152615 | 3300046660 | Bacteria | 1552 |
| 793 | Ga0495625_0325141 | 3300046660 | Bacteria | 978 |
| 794 | Ga0495661_0009208 | 3300046665 | Bacteria | 6785 |
| 795 | Ga0495661_0020711 | 3300046665 | Bacteria | 4290 |
| 796 | Ga0495661_0046866 | 3300046665 | Bacteria | 2636 |
| 797 | Ga0495588_0066110 | 3300046674 | Bacteria | 1876 |
| 798 | Ga0495657_0043528 | 3300046675 | Bacteria | 3061 |
| 799 | Ga0495599_0044818 | 3300046678 | Bacteria | 2773 |
| 800 | Ga0495599_0298842 | 3300046678 | Bacteria | 972 |
| 801 | Ga0495623_0001937 | 3300046679 | Bacteria | 13902 |
| 802 | Ga0495623_0016318 | 3300046679 | Bacteria | 4797 |
| 803 | Ga0495623_0055865 | 3300046679 | Bacteria | 2487 |
| 804 | Ga0495623_0210738 | 3300046679 | Bacteria | 1112 |
| 805 | Ga0495646_0026058 | 3300046680 | Bacteria | 3672 |
| 806 | Ga0495658_0657267 | 3300046683 | Bacteria | 671 |
| 807 | Ga0495658_0693474 | 3300046683 | Bacteria | 652 |
| 808 | Ga0495613_0003365 | 3300046689 | Bacteria | 11949 |
| 809 | Ga0495613_0004731 | 3300046689 | Bacteria | 10217 |
| 810 | Ga0495613_0294181 | 3300046689 | Bacteria | 1125 |
| 811 | Ga0495624_0001213 | 3300046690 | Bacteria | 20335 |
| 812 | Ga0495624_0001465 | 3300046690 | Bacteria | 18349 |
| 813 | Ga0495671_0000002 | 3300046692 | Bacteria | 1136189 |
| 814 | Ga0495671_0028513 | 3300046692 | Bacteria | 2874 |
| 815 | Ga0495671_0102142 | 3300046692 | Bacteria | 1401 |
| 816 | Ga0495671_0104577 | 3300046692 | Bacteria | 1383 |
| 817 | Ga0495649_0082834 | 3300046694 | Bacteria | 1714 |
| 818 | Ga0495649_0130007 | 3300046694 | Bacteria | 1329 |
| 819 | Ga0495649_0263824 | 3300046694 | Bacteria | 882 |
| 820 | Ga0495589_0015735 | 3300046794 | Bacteria | 3889 |
| 821 | Ga0495589_0164678 | 3300046794 | Bacteria | 1055 |
| 822 | Ga0495660_0000002 | 3300046810 | Bacteria | 1229481 |
| 823 | Ga0495660_0000362 | 3300046810 | Bacteria | 39947 |
| 824 | Ga0495660_0000799 | 3300046810 | Bacteria | 23611 |
| 825 | Ga0495660_0009555 | 3300046810 | Bacteria | 5654 |
| 826 | Ga0495660_0009627 | 3300046810 | Bacteria | 5633 |
| 827 | Ga0495660_0021858 | 3300046810 | Bacteria | 3659 |
| 828 | Ga0495581_0049111 | 3300047315 | Bacteria | 2436 |
| 829 | Ga0495581_0090834 | 3300047315 | Bacteria | 1772 |
| 830 | Ga0495581_0233335 | 3300047315 | Bacteria | 1076 |
| 831 | Ga0495581_0579374 | 3300047315 | Bacteria | 650 |
| 832 | Ga0495604_0018202 | 3300047317 | Bacteria | 5624 |
| 833 | Ga0495604_0102522 | 3300047317 | Bacteria | 2100 |
| 834 | Ga0495636_0030650 | 3300047318 | Bacteria | 2200 |
| 835 | Ga0495674_0000653 | 3300047319 | Bacteria | 32528 |
| 836 | Ga0495674_0000913 | 3300047319 | Bacteria | 28241 |
| 837 | Ga0495674_0003203 | 3300047319 | Bacteria | 15900 |
| 838 | Ga0495672_0009463 | 3300047320 | Bacteria | 7056 |
| 839 | Ga0495672_0028450 | 3300047320 | Bacteria | 3536 |
| 840 | Ga0495676_0075526 | 3300047321 | Bacteria | 2577 |
| 841 | Ga0495676_0118909 | 3300047321 | Bacteria | 1926 |
| 842 | Ga0495680_0006739 | 3300047322 | Bacteria | 10620 |
| 843 | Ga0495680_0011532 | 3300047322 | Bacteria | 7817 |
| 844 | Ga0495683_0002499 | 3300047323 | Bacteria | 11068 |
| 845 | Ga0495683_0017419 | 3300047323 | Bacteria | 3724 |
| 846 | Ga0495687_000502 | 3300047443 | Bacteria | 47227 |
| 847 | Ga0495687_000965 | 3300047443 | Bacteria | 29302 |
| 848 | Ga0495687_000991 | 3300047443 | Bacteria | 28486 |
| 849 | Ga0495687_010372 | 3300047443 | Bacteria | 5113 |
| 850 | Ga0495687_040005 | 3300047443 | Bacteria | 2069 |
| 851 | Ga0495687_064447 | 3300047443 | Bacteria | 1495 |
| 852 | Ga0495675_0232502 | 3300047444 | Bacteria | 1112 |
| 853 | Ga0495677_0246379 | 3300047445 | Bacteria | 698 |
| 854 | Ga0495679_000489 | 3300047446 | Bacteria | 28238 |
| 855 | Ga0495679_006544 | 3300047446 | Bacteria | 4989 |
| 856 | Ga0495679_037010 | 3300047446 | Bacteria | 1537 |
| 857 | Ga0495685_033437 | 3300047447 | Bacteria | 1767 |
| 858 | Ga0495673_0000026 | 3300047469 | Bacteria | 476378 |
| 859 | Ga0495673_0003513 | 3300047469 | Bacteria | 10312 |
| 860 | Ga0495673_0024334 | 3300047469 | Bacteria | 2928 |
| 861 | Ga0495684_0616158 | 3300047471 | Bacteria | 730 |
| 862 | Ga0495686_0152109 | 3300047472 | Bacteria | 1358 |
| 863 | Ga0495593_0019136 | 3300047673 | Bacteria | 3843 |
| 864 | Ga0495593_0032816 | 3300047673 | Bacteria | 2829 |
| 865 | Ga0495593_0042873 | 3300047673 | Bacteria | 2427 |
| 866 | Ga0495593_0074616 | 3300047673 | Bacteria | 1759 |
| 867 | Ga0495602_0001757 | 3300048088 | Bacteria | 21644 |
| 868 | Ga0495602_0002700 | 3300048088 | Bacteria | 18124 |
| 869 | Ga0495602_0006511 | 3300048088 | Bacteria | 12251 |
| 870 | Ga0495602_0184440 | 3300048088 | Bacteria | 1606 |
| 871 | Ga0495602_0208414 | 3300048088 | Bacteria | 1486 |
| 872 | Ga0495602_0422606 | 3300048088 | Bacteria | 946 |
| 873 | Ga0495614_0000279 | 3300048089 | Bacteria | 20099 |
| 874 | Ga0495614_0323001 | 3300048089 | Bacteria | 716 |
| 875 | Ga0495626_0001005 | 3300048091 | Bacteria | 24227 |
| 876 | Ga0495626_0090173 | 3300048091 | Bacteria | 1349 |
| 877 | Ga0496100_0015583 | 3300048903 | Bacteria | 4440 |
| 878 | Ga0496100_0050912 | 3300048903 | Bacteria | 2686 |
| 879 | Ga0496100_0270808 | 3300048903 | Bacteria | 1263 |
| 880 | Ga0496100_0475345 | 3300048903 | Bacteria | 961 |
| 881 | Ga0496101_0001615 | 3300048904 | Bacteria | 13560 |
| 882 | Ga0496101_0073397 | 3300048904 | Bacteria | 2513 |
| 883 | Ga0496101_0455191 | 3300048904 | Bacteria | 1010 |
| 884 | Ga0496102_0018151 | 3300048905 | Bacteria | 6175 |
| 885 | Ga0496102_0044897 | 3300048905 | Bacteria | 4010 |
| 886 | Ga0496102_0180280 | 3300048905 | Bacteria | 1990 |
| 887 | Ga0496103_0549463 | 3300048906 | Bacteria | 737 |
| 888 | Ga0496104_0010765 | 3300048907 | Bacteria | 8181 |
| 889 | Ga0496104_0042817 | 3300048907 | Bacteria | 4251 |
| 890 | Ga0496104_0416507 | 3300048907 | Bacteria | 1256 |
| 891 | Ga0496104_0755556 | 3300048907 | Bacteria | 879 |
| 892 | Ga0496105_0004091 | 3300048908 | Bacteria | 10927 |
| 893 | Ga0496105_0009938 | 3300048908 | Bacteria | 7464 |
| 894 | Ga0496105_0326975 | 3300048908 | Bacteria | 1228 |
| 895 | Ga0496105_0334706 | 3300048908 | Bacteria | 1211 |
| 896 | Ga0496106_0142179 | 3300048909 | Bacteria | 1888 |
| 897 | Ga0496106_0220985 | 3300048909 | Bacteria | 1511 |
| 898 | Ga0496107_0440096 | 3300048910 | Bacteria | 969 |
| 899 | Ga0496108_0174541 | 3300048911 | Bacteria | 1860 |
| 900 | Ga0496108_0980217 | 3300048911 | Bacteria | 723 |
| 901 | Ga0496109_0022976 | 3300048912 | Bacteria | 5530 |
| 902 | Ga0496109_0046266 | 3300048912 | Bacteria | 3952 |
| 903 | Ga0496109_0103772 | 3300048912 | Bacteria | 2639 |
| 904 | Ga0496109_0209700 | 3300048912 | Bacteria | 1832 |
| 905 | Ga0496109_0331860 | 3300048912 | Bacteria | 1436 |
| 906 | Ga0496110_0028927 | 3300048913 | Bacteria | 4763 |
| 907 | Ga0496110_0030436 | 3300048913 | Bacteria | 4653 |
| 908 | Ga0496110_0583870 | 3300048913 | Bacteria | 1014 |
| 909 | Ga0496110_0621542 | 3300048913 | Bacteria | 979 |
| 910 | Ga0496110_0661357 | 3300048913 | Bacteria | 945 |
| 911 | Ga0496110_1651691 | 3300048913 | Bacteria | 551 |
| 912 | Ga0496111_0050665 | 3300048914 | Bacteria | 2996 |
| 913 | Ga0496112_0012047 | 3300048915 | Bacteria | 7933 |
| 914 | Ga0496113_0000380 | 3300048916 | Bacteria | 21429 |
| 915 | Ga0496113_0004924 | 3300048916 | Bacteria | 8273 |
| 916 | Ga0496113_1140884 | 3300048916 | Bacteria | 610 |
| 917 | Ga0496114_0068915 | 3300048917 | Bacteria | 2970 |
| 918 | Ga0496114_0087137 | 3300048917 | Bacteria | 2647 |
| 919 | Ga0496114_1236166 | 3300048917 | Bacteria | 633 |
| 920 | Ga0496115_0276047 | 3300048918 | Bacteria | 1380 |
| 921 | Ga0496116_0000103 | 3300048919 | Bacteria | 193529 |
| 922 | Ga0496116_0009480 | 3300048919 | Bacteria | 8291 |
| 923 | Ga0496116_0014154 | 3300048919 | Bacteria | 6385 |
| 924 | Ga0496116_0079119 | 3300048919 | Bacteria | 2047 |
| 925 | Ga0496117_0000259 | 3300048920 | Bacteria | 99638 |
| 926 | Ga0496117_0192999 | 3300048920 | Bacteria | 1158 |
| 927 | Ga0496117_0394838 | 3300048920 | Bacteria | 700 |
| 928 | Ga0496118_0001478 | 3300048921 | Bacteria | 35190 |
| 929 | Ga0496118_0007993 | 3300048921 | Bacteria | 11057 |
| 930 | Ga0496118_0098715 | 3300048921 | Bacteria | 1982 |
| 931 | Ga0496119_0344444 | 3300048922 | Bacteria | 723 |
| 932 | Ga0496120_0019391 | 3300048923 | Bacteria | 4352 |
| 933 | Ga0496121_0000195 | 3300048924 | Bacteria | 136162 |
| 934 | Ga0496121_0053401 | 3300048924 | Bacteria | 3385 |
| 935 | Ga0496121_0144609 | 3300048924 | Bacteria | 1759 |
| 936 | Ga0496122_0000936 | 3300048925 | Bacteria | 53067 |
| 937 | Ga0496122_0217696 | 3300048925 | Bacteria | 1099 |
| 938 | Ga0496123_0005971 | 3300048926 | Bacteria | 11982 |
| 939 | Ga0496123_0019941 | 3300048926 | Bacteria | 5263 |
| 940 | Ga0496123_0182359 | 3300048926 | Bacteria | 1095 |
| 941 | Ga0496124_0002244 | 3300048927 | Bacteria | 25695 |
| 942 | Ga0496124_0013961 | 3300048927 | Bacteria | 7801 |
| 943 | Ga0496124_0069982 | 3300048927 | Bacteria | 2911 |
| 944 | Ga0496124_0468261 | 3300048927 | Bacteria | 854 |
| 945 | Ga0496125_0001902 | 3300048928 | Bacteria | 28567 |
| 946 | Ga0496125_0060473 | 3300048928 | Bacteria | 3044 |
| 947 | Ga0496125_0178907 | 3300048928 | Bacteria | 1416 |
| 948 | Ga0496125_0182341 | 3300048928 | Bacteria | 1397 |
| 949 | Ga0496126_0341216 | 3300048929 | Bacteria | 1227 |
| 950 | Ga0496126_0674429 | 3300048929 | Bacteria | 806 |
| 951 | Ga0495678_000936 | 3300049459 | Bacteria | 25387 |
| 952 | Ga0495678_006615 | 3300049459 | Bacteria | 6142 |
| 953 | Ga0495682_0010393 | 3300049460 | Bacteria | 3606 |
| 954 | Ga0501031_0480610 | 3300049568 | Bacteria | 802 |
| 955 | Ga0501034_0223556 | 3300049571 | Bacteria | 1834 |
| 956 | Ga0501036_0294807 | 3300049572 | Bacteria | 1357 |
| 957 | Ga0501036_0408233 | 3300049572 | Bacteria | 1133 |
| 958 | Ga0501037_0245662 | 3300049573 | Bacteria | 1253 |
| 959 | Ga0501037_0924547 | 3300049573 | Bacteria | 571 |
| 960 | Ga0501042_0473816 | 3300049578 | Bacteria | 908 |
| 961 | Ga0501043_0000371 | 3300049579 | Bacteria | 40668 |
| 962 | Ga0501043_0691002 | 3300049579 | Bacteria | 746 |
| 963 | Ga0501046_0000488 | 3300049580 | Bacteria | 39620 |
| 964 | Ga0501046_0440833 | 3300049580 | Bacteria | 937 |
| 965 | Ga0501047_0000564 | 3300049581 | Bacteria | 39704 |
| 966 | Ga0501047_0385498 | 3300049581 | Bacteria | 1235 |
| 967 | Ga0501048_0001830 | 3300049582 | Bacteria | 16127 |
| 968 | Ga0501072_0525712 | 3300049588 | Bacteria | 935 |
| 969 | Ga0501076_0394330 | 3300049592 | Bacteria | 1138 |
| 970 | Ga0501227_056700 | 3300049665 | Bacteria | 998 |
| 971 | Ga0501249_000898 | 3300049679 | Bacteria | 6529 |
| 972 | Ga0501079_0847189 | 3300049741 | Unclassified | 720 |
| 973 | Ga0501080_0698990 | 3300049742 | Bacteria | 894 |
| 974 | Ga0501081_0623619 | 3300049743 | Bacteria | 808 |
| 975 | Ga0501269_000669 | 3300049766 | Bacteria | 5828 |
| 976 | Ga0501279_007950 | 3300049775 | Bacteria | 1410 |
| 977 | Ga0501035_0052513 | 3300049822 | Bacteria | 3647 |
| 978 | Ga0501044_0050386 | 3300049823 | Bacteria | 4296 |
| 979 | nmdc:mga03683_12306_c1 | 3300050489 | Bacteria | 3121 |
| 980 | nmdc:mga03683_197195_c1 | 3300050489 | Bacteria | 923 |
| 981 | nmdc:mga03683_7855_c1 | 3300050489 | Bacteria | 3724 |
| 982 | nmdc:mga03683_93307_c1 | 3300050489 | Bacteria | 1315 |
| 983 | nmdc:mga03n38_1017_c1 | 3300050490 | Bacteria | 7686 |
| 984 | nmdc:mga03n38_51259_c1 | 3300050490 | Bacteria | 1842 |
| 985 | nmdc:mga03n38_553999_c1 | 3300050490 | Bacteria | 651 |
| 986 | nmdc:mga00v17_14316_c1 | 3300050491 | Bacteria | 4424 |
| 987 | nmdc:mga0yw44_18425_c1 | 3300050492 | Bacteria | 3824 |
| 988 | nmdc:mga0k408_1070_c2 | 3300050493 | Bacteria | 9350 |
| 989 | nmdc:mga0k408_12270_c1 | 3300050493 | Bacteria | 4682 |
| 990 | nmdc:mga0k408_137519_c1 | 3300050493 | Bacteria | 868 |
| 991 | nmdc:mga0k408_170706_c1 | 3300050493 | Bacteria | 1296 |
| 992 | nmdc:mga0k408_256625_c1 | 3300050493 | Bacteria | 1044 |
| 993 | nmdc:mga0k408_38300_c1 | 3300050493 | Bacteria | 2752 |
| 994 | nmdc:mga0k408_4660_c1 | 3300050493 | Bacteria | 7266 |
| 995 | nmdc:mga0k408_7031_c1 | 3300050493 | Bacteria | 6007 |
| 996 | nmdc:mga06z11_51325_c1 | 3300050494 | Bacteria | 2112 |
| 997 | nmdc:mga06z11_93271_c1 | 3300050494 | Bacteria | 1639 |
| 998 | nmdc:mga06z11_979197_c1 | 3300050494 | Bacteria | 515 |
| 999 | nmdc:mga04h51_66769_c1 | 3300050495 | Bacteria | 1247 |
| 1000 | nmdc:mga07m45_1404_c1 | 3300050496 | Bacteria | 11013 |
| 1001 | nmdc:mga07m45_18843_c1 | 3300050496 | Bacteria | 3733 |
| 1002 | nmdc:mga07m45_3515_c1 | 3300050496 | Bacteria | 7561 |
| 1003 | nmdc:mga07m45_77352_c1 | 3300050496 | Bacteria | 1898 |
| 1004 | nmdc:mga07m45_81077_c1 | 3300050496 | Bacteria | 1853 |
| 1005 | nmdc:mga05p37_610861_c1 | 3300050507 | Bacteria | 1229 |
| 1006 | nmdc:mga09592_118549_c1 | 3300050508 | Bacteria | 2272 |
| 1007 | nmdc:mga0qj67_43291_c1 | 3300050509 | Bacteria | 3545 |
| 1008 | nmdc:mga08y16_10126_c1 | 3300050511 | Bacteria | 9898 |
| 1009 | nmdc:mga08x19_32067_c1 | 3300050514 | Bacteria | 3309 |
| 1010 | nmdc:mga0sz30_154227_c1 | 3300050516 | Bacteria | 1017 |
| 1011 | nmdc:mga0sz30_330494_c1 | 3300050516 | Bacteria | 681 |
| 1012 | Ga0495601_0733413 | 3300053077 | Bacteria | 629 |
| 1013 | Ga0500610_0395265 | 3300053079 | Bacteria | 564 |
| 1014 | Ga0500644_0001498 | 3300053088 | Bacteria | 6141 |
| 1015 | Ga0500651_0127353 | 3300053093 | Bacteria | 1542 |
| 1016 | Ga0500651_0331495 | 3300053093 | Bacteria | 867 |
| 1017 | Ga0500572_112146 | 3300053111 | Bacteria | 878 |
| 1018 | Ga0500608_002102 | 3300053122 | Bacteria | 7146 |
| 1019 | Ga0500618_004853 | 3300053125 | Bacteria | 4199 |
| 1020 | Ga0500626_053059 | 3300053128 | Bacteria | 1822 |
| 1021 | Ga0500658_0088065 | 3300053134 | Bacteria | 1338 |
| 1022 | Ga0500559_0002116 | 3300053136 | Bacteria | 10567 |
| 1023 | Ga0500568_0018860 | 3300053139 | Bacteria | 3009 |
| 1024 | Ga0500574_006190 | 3300053141 | Bacteria | 2389 |
| 1025 | Ga0500586_007349 | 3300053145 | Bacteria | 2931 |
| 1026 | Ga0500636_0061848 | 3300053177 | Bacteria | 2184 |
| 1027 | Ga0500645_000114 | 3300053730 | Bacteria | 64351 |
| 1028 | Ga0500661_006186 | 3300055283 | Bacteria | 2231 |
| 1029 | Ga0466962_0011690 | 3300061719 | Bacteria | 4226 |
| 1030 | Ga0466962_0046427 | 3300061719 | Bacteria | 2075 |
| 1031 | Ga0530510_0520639 | 3300061734 | Bacteria | 902 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_0812921 | Ga0453684_0812921_280_693 | 133 |
| 2 | 3300045051 | Ga0451576_0147441 | Ga0451576_0147441_1292_1705 | 133 |
| 3 | 3300050516 | nmdc:mga0sz30_330494_c1 | nmdc:mga0sz30_330494_c1_261_662 | 133 |
| 4 | 3300015262 | Ga0182007_10011585 | Ga0182007_100115854 | 135 |
| 5 | 3300002774 | JGI25150J39212_1007267 | JGI25150J39212_10072672 | 136 |
| 6 | 3300021361 | Ga0213872_10004425 | Ga0213872_100044257 | 136 |
| 7 | 3300025245 | Ga0207425_1000128 | Ga0207425_100012825 | 136 |
| 8 | 3300025294 | Ga0209025_1003856 | Ga0209025_10038562 | 136 |
| 9 | 3300025297 | Ga0209758_1000578 | Ga0209758_100057824 | 136 |
| 10 | 3300041405 | Ga0439438_050632 | Ga0439438_050632_167_580 | 136 |
| 11 | 3300041407 | Ga0439447_001903 | Ga0439447_001903_634_1047 | 136 |
| 12 | 3300041411 | Ga0439466_0031954 | Ga0439466_0031954_1225_1638 | 136 |
| 13 | iso_pu_bacteria | 2808606415 | 2809129329 | 136 |
| 14 | iso_pu_bacteria | 2808606419 | 2809149616 | 136 |
| 15 | iso_pu_bacteria | 2852618963 | 2852619768 | 136 |
| 16 | 3300001979 | JGI24740J21852_10003426 | JGI24740J21852_100034266 | 137 |
| 17 | 3300001979 | JGI24740J21852_10003590 | JGI24740J21852_100035906 | 137 |
| 18 | 3300001979 | JGI24740J21852_10016258 | JGI24740J21852_100162583 | 137 |
| 19 | 3300003751 | Ga0055538_1008028 | Ga0055538_10080282 | 137 |
| 20 | 3300003751 | Ga0055538_1009501 | Ga0055538_10095012 | 137 |
| 21 | 3300003752 | Ga0055539_1014377 | Ga0055539_10143772 | 137 |
| 22 | 3300003756 | Ga0055533_1001339 | Ga0055533_10013396 | 137 |
| 23 | 3300003756 | Ga0055533_1003923 | Ga0055533_10039233 | 137 |
| 24 | 3300003758 | Ga0055532_1000006 | Ga0055532_1000006201 | 137 |
| 25 | 3300003759 | Ga0055525_1007688 | Ga0055525_10076881 | 137 |
| 26 | 3300003760 | Ga0055527_1000395 | Ga0055527_100039511 | 137 |
| 27 | 3300003761 | Ga0055535_1000004 | Ga0055535_1000004201 | 137 |
| 28 | 3300003762 | Ga0055542_1001366 | Ga0055542_10013663 | 137 |
| 29 | 3300003763 | Ga0055529_1000022 | Ga0055529_1000022120 | 137 |
| 30 | 3300003841 | Ga0055541_1002678 | Ga0055541_10026784 | 137 |
| 31 | 3300005366 | Ga0070659_100001408 | Ga0070659_1000014085 | 137 |
| 32 | 3300005578 | Ga0068854_100000020 | Ga0068854_10000002018 | 137 |
| 33 | 3300005616 | Ga0068852_100043480 | Ga0068852_1000434802 | 137 |
| 34 | 3300006880 | Ga0075429_100154417 | Ga0075429_1001544172 | 137 |
| 35 | 3300009094 | Ga0111539_10018854 | Ga0111539_100188546 | 137 |
| 36 | 3300009147 | Ga0114129_10771089 | Ga0114129_107710892 | 137 |
| 37 | 3300013105 | Ga0157369_10013411 | Ga0157369_100134119 | 137 |
| 38 | 3300014497 | Ga0182008_10065925 | Ga0182008_100659253 | 137 |
| 39 | 3300015261 | Ga0182006_1000525 | Ga0182006_100052510 | 137 |
| 40 | 3300020077 | Ga0206351_10377922 | Ga0206351_103779222 | 137 |
| 41 | 3300021361 | Ga0213872_10074690 | Ga0213872_100746903 | 137 |
| 42 | 3300021361 | Ga0213872_10289453 | Ga0213872_102894531 | 137 |
| 43 | 3300025206 | Ga0209435_107774 | Ga0209435_1077743 | 137 |
| 44 | 3300025224 | Ga0209784_100581 | Ga0209784_1005819 | 137 |
| 45 | 3300025224 | Ga0209784_104690 | Ga0209784_1046902 | 137 |
| 46 | 3300025225 | Ga0209566_100409 | Ga0209566_10040919 | 137 |
| 47 | 3300025226 | Ga0209674_100228 | Ga0209674_10022830 | 137 |
| 48 | 3300025226 | Ga0209674_103466 | Ga0209674_1034663 | 137 |
| 49 | 3300025228 | Ga0209672_100111 | Ga0209672_10011155 | 137 |
| 50 | 3300025229 | Ga0209147_100015 | Ga0209147_100015344 | 137 |
| 51 | 3300025242 | Ga0209258_100021 | Ga0209258_100021344 | 137 |
| 52 | 3300025246 | Ga0209646_1000055 | Ga0209646_1000055179 | 137 |
| 53 | 3300025250 | Ga0209026_1000790 | Ga0209026_10007907 | 137 |
| 54 | 3300025253 | Ga0209677_102961 | Ga0209677_1029617 | 137 |
| 55 | 3300025254 | Ga0209148_1000109 | Ga0209148_1000109125 | 137 |
| 56 | 3300025254 | Ga0209148_1003318 | Ga0209148_10033184 | 137 |
| 57 | 3300025256 | Ga0209759_1001420 | Ga0209759_10014203 | 137 |
| 58 | 3300025256 | Ga0209759_1020780 | Ga0209759_10207802 | 137 |
| 59 | 3300025272 | Ga0209455_1000028 | Ga0209455_1000028344 | 137 |
| 60 | 3300025913 | Ga0207695_10002587 | Ga0207695_100025878 | 137 |
| 61 | 3300025919 | Ga0207657_10112068 | Ga0207657_101120683 | 137 |
| 62 | 3300025932 | Ga0207690_10003361 | Ga0207690_100033616 | 137 |
| 63 | 3300025981 | Ga0207640_10000132 | Ga0207640_100001324 | 137 |
| 64 | 3300026089 | Ga0207648_11391192 | Ga0207648_113911922 | 137 |
| 65 | 3300026116 | Ga0207674_10001419 | Ga0207674_100014197 | 137 |
| 66 | 3300027907 | Ga0207428_10018351 | Ga0207428_100183512 | 137 |
| 67 | 3300031250 | Ga0265331_10005985 | Ga0265331_100059852 | 137 |
| 68 | 3300031251 | Ga0265327_10000020 | Ga0265327_100000205 | 137 |
| 69 | 3300031911 | Ga0307412_10000106 | Ga0307412_100001064 | 137 |
| 70 | 3300037418 | Ga0395900_0075846 | Ga0395900_0075846_2050_2463 | 137 |
| 71 | 3300039447 | Ga0436361_0426697 | Ga0436361_0426697_1162_1575 | 137 |
| 72 | 3300039447 | Ga0436361_0991880 | Ga0436361_0991880_188_601 | 137 |
| 73 | 3300044658 | Ga0466972_0000747 | Ga0466972_0000747_13150_13563 | 137 |
| 74 | 3300044671 | Ga0466978_0002981 | Ga0466978_0002981_3619_4032 | 137 |
| 75 | 3300044672 | Ga0466982_0042372 | Ga0466982_0042372_53_466 | 137 |
| 76 | 3300044683 | Ga0466965_0008878 | Ga0466965_0008878_4194_4607 | 137 |
| 77 | 3300044693 | Ga0466961_0000502 | Ga0466961_0000502_17534_17947 | 137 |
| 78 | 3300044694 | Ga0466963_0062450 | Ga0466963_0062450_1081_1494 | 137 |
| 79 | 3300044706 | Ga0466964_0001030 | Ga0466964_0001030_7193_7606 | 137 |
| 80 | 3300044719 | Ga0466971_0008438 | Ga0466971_0008438_1326_1739 | 137 |
| 81 | 3300044735 | Ga0466968_0035976 | Ga0466968_0035976_709_1122 | 137 |
| 82 | 3300044765 | Ga0466970_0000308 | Ga0466970_0000308_17343_17756 | 137 |
| 83 | 3300044901 | Ga0466960_0006828 | Ga0466960_0006828_38_451 | 137 |
| 84 | 3300045049 | Ga0466959_0003070 | Ga0466959_0003070_4073_4486 | 137 |
| 85 | 3300045836 | Ga0466958_0185696 | Ga0466958_0185696_519_932 | 137 |
| 86 | 3300045976 | Ga0466967_0022965 | Ga0466967_0022965_1214_1627 | 137 |
| 87 | 3300046457 | Ga0495590_0000010 | Ga0495590_0000010_10249_10662 | 137 |
| 88 | 3300046460 | Ga0495638_0000042 | Ga0495638_0000042_197437_197850 | 137 |
| 89 | 3300046471 | Ga0495650_0000429 | Ga0495650_0000429_51635_52048 | 137 |
| 90 | 3300046501 | Ga0495607_0054065 | Ga0495607_0054065_1588_2001 | 137 |
| 91 | 3300046506 | Ga0495583_0000006 | Ga0495583_0000006_16417_16830 | 137 |
| 92 | 3300046507 | Ga0495606_0003357 | Ga0495606_0003357_14301_14714 | 137 |
| 93 | 3300046507 | Ga0495606_0014891 | Ga0495606_0014891_3397_3810 | 137 |
| 94 | 3300046512 | Ga0495610_0004664 | Ga0495610_0004664_1239_1652 | 137 |
| 95 | 3300046520 | Ga0495637_0013967 | Ga0495637_0013967_1084_1497 | 137 |
| 96 | 3300046522 | Ga0495643_0001442 | Ga0495643_0001442_15945_16358 | 137 |
| 97 | 3300046524 | Ga0495648_0001082 | Ga0495648_0001082_14814_15227 | 137 |
| 98 | 3300046528 | Ga0495642_0094729 | Ga0495642_0094729_404_817 | 137 |
| 99 | 3300046542 | Ga0495597_0000111 | Ga0495597_0000111_47871_48284 | 137 |
| 100 | 3300046557 | Ga0495622_0000116 | Ga0495622_0000116_15802_16215 | 137 |
| 101 | 3300046558 | Ga0495633_0000124 | Ga0495633_0000124_21702_22115 | 137 |
| 102 | 3300046558 | Ga0495633_0000553 | Ga0495633_0000553_31730_32158 | 137 |
| 103 | 3300046616 | Ga0495668_0000843 | Ga0495668_0000843_5275_5688 | 137 |
| 104 | 3300046660 | Ga0495625_0000218 | Ga0495625_0000218_73557_73970 | 137 |
| 105 | 3300046692 | Ga0495671_0028513 | Ga0495671_0028513_2342_2755 | 137 |
| 106 | 3300046810 | Ga0495660_0009555 | Ga0495660_0009555_2376_2789 | 137 |
| 107 | 3300047443 | Ga0495687_000965 | Ga0495687_000965_24881_25294 | 137 |
| 108 | 3300047443 | Ga0495687_000991 | Ga0495687_000991_24066_24479 | 137 |
| 109 | 3300048913 | Ga0496110_1651691 | Ga0496110_1651691_73_492 | 137 |
| 110 | 3300048919 | Ga0496116_0009480 | Ga0496116_0009480_2002_2421 | 137 |
| 111 | 3300048919 | Ga0496116_0079119 | Ga0496116_0079119_1505_1924 | 137 |
| 112 | 3300048920 | Ga0496117_0192999 | Ga0496117_0192999_284_697 | 137 |
| 113 | 3300048924 | Ga0496121_0000195 | Ga0496121_0000195_127036_127455 | 137 |
| 114 | 3300048925 | Ga0496122_0000936 | Ga0496122_0000936_41617_42036 | 137 |
| 115 | 3300048926 | Ga0496123_0005971 | Ga0496123_0005971_532_951 | 137 |
| 116 | 3300048927 | Ga0496124_0069982 | Ga0496124_0069982_2088_2507 | 137 |
| 117 | 3300048928 | Ga0496125_0182341 | Ga0496125_0182341_861_1280 | 137 |
| 118 | 3300048929 | Ga0496126_0341216 | Ga0496126_0341216_282_701 | 137 |
| 119 | 3300049459 | Ga0495678_000936 | Ga0495678_000936_16453_16866 | 137 |
| 120 | 3300049459 | Ga0495678_006615 | Ga0495678_006615_1294_1707 | 137 |
| 121 | 3300050507 | nmdc:mga05p37_610861_c1 | nmdc:mga05p37_610861_c1_179_595 | 137 |
| 122 | 3300050508 | nmdc:mga09592_118549_c1 | nmdc:mga09592_118549_c1_1222_1638 | 137 |
| 123 | 3300050511 | nmdc:mga08y16_10126_c1 | nmdc:mga08y16_10126_c1_6366_6782 | 137 |
| 124 | 3300061719 | Ga0466962_0046427 | Ga0466962_0046427_589_1002 | 137 |
| 125 | 3300002774 | JGI25150J39212_1001373 | JGI25150J39212_10013732 | 138 |
| 126 | 3300002774 | JGI25150J39212_1007812 | JGI25150J39212_10078124 | 138 |
| 127 | 3300002987 | JGI25159J45721_1000359 | JGI25159J45721_100035914 | 138 |
| 128 | 3300002987 | JGI25159J45721_1002098 | JGI25159J45721_10020987 | 138 |
| 129 | 3300003187 | JGI25151J46595_10002668 | JGI25151J46595_100026685 | 138 |
| 130 | 3300003187 | JGI25151J46595_10006726 | JGI25151J46595_100067266 | 138 |
| 131 | 3300003215 | JGI25153J46596_10105088 | JGI25153J46596_101050882 | 138 |
| 132 | 3300003322 | rootL2_10093470 | rootL2_100934702 | 138 |
| 133 | 3300003354 | JGI25160J50197_1000158 | JGI25160J50197_100015841 | 138 |
| 134 | 3300003374 | JGI25161J50226_1000040 | JGI25161J50226_100004084 | 138 |
| 135 | 3300003763 | Ga0055529_1001082 | Ga0055529_10010827 | 138 |
| 136 | 3300003771 | Ga0055526_1001296 | Ga0055526_100129614 | 138 |
| 137 | 3300003771 | Ga0055526_1050947 | Ga0055526_10509472 | 138 |
| 138 | 3300003773 | Ga0055537_1000257 | Ga0055537_100025716 | 138 |
| 139 | 3300003773 | Ga0055537_1004524 | Ga0055537_10045242 | 138 |
| 140 | 3300003775 | Ga0055524_1000077 | Ga0055524_100007735 | 138 |
| 141 | 3300003781 | Ga0055536_1001365 | Ga0055536_10013658 | 138 |
| 142 | 3300003784 | Ga0055534_1004892 | Ga0055534_10048925 | 138 |
| 143 | 3300003790 | Ga0055528_1002253 | Ga0055528_10022539 | 138 |
| 144 | 3300003791 | Ga0055530_10000354 | Ga0055530_1000035435 | 138 |
| 145 | 3300003791 | Ga0055530_10019470 | Ga0055530_100194703 | 138 |
| 146 | 3300003792 | Ga0055540_1000010 | Ga0055540_1000010147 | 138 |
| 147 | 3300003794 | Ga0055531_10000298 | Ga0055531_1000029843 | 138 |
| 148 | 3300003794 | Ga0055531_10000405 | Ga0055531_1000040519 | 138 |
| 149 | 3300004625 | Ga0055543_1000167 | Ga0055543_100016732 | 138 |
| 150 | 3300005262 | Ga0065165_1001298 | Ga0065165_100129815 | 138 |
| 151 | 3300005262 | Ga0065165_1003807 | Ga0065165_10038077 | 138 |
| 152 | 3300005539 | Ga0068853_100288225 | Ga0068853_1002882251 | 138 |
| 153 | 3300006051 | Ga0075364_10151141 | Ga0075364_101511413 | 138 |
| 154 | 3300006177 | Ga0075362_10053876 | Ga0075362_100538762 | 138 |
| 155 | 3300006177 | Ga0075362_10075856 | Ga0075362_100758564 | 138 |
| 156 | 3300006195 | Ga0075366_10288409 | Ga0075366_102884091 | 138 |
| 157 | 3300006353 | Ga0075370_10150516 | Ga0075370_101505162 | 138 |
| 158 | 3300006946 | Ga0079104_1037099 | Ga0079104_10370993 | 138 |
| 159 | 3300006948 | Ga0099826_10264683 | Ga0099826_102646832 | 138 |
| 160 | 3300013104 | Ga0157370_10775583 | Ga0157370_107755831 | 138 |
| 161 | 3300013307 | Ga0157372_10037972 | Ga0157372_100379724 | 138 |
| 162 | 3300014497 | Ga0182008_10004423 | Ga0182008_1000442312 | 138 |
| 163 | 3300025208 | Ga0209436_100323 | Ga0209436_1003235 | 138 |
| 164 | 3300025208 | Ga0209436_100621 | Ga0209436_10062110 | 138 |
| 165 | 3300025245 | Ga0207425_1000171 | Ga0207425_100017146 | 138 |
| 166 | 3300025245 | Ga0207425_1001472 | Ga0207425_10014729 | 138 |
| 167 | 3300025258 | Ga0209129_1007442 | Ga0209129_10074424 | 138 |
| 168 | 3300025263 | Ga0209565_1000036 | Ga0209565_1000036210 | 138 |
| 169 | 3300025263 | Ga0209565_1000655 | Ga0209565_100065516 | 138 |
| 170 | 3300025263 | Ga0209565_1000793 | Ga0209565_100079318 | 138 |
| 171 | 3300025263 | Ga0209565_1061857 | Ga0209565_10618571 | 138 |
| 172 | 3300025272 | Ga0209455_1000044 | Ga0209455_10000447 | 138 |
| 173 | 3300025273 | Ga0209673_1000008 | Ga0209673_1000008564 | 138 |
| 174 | 3300025273 | Ga0209673_1041743 | Ga0209673_10417433 | 138 |
| 175 | 3300025284 | Ga0209130_1000042 | Ga0209130_100004236 | 138 |
| 176 | 3300025284 | Ga0209130_1000622 | Ga0209130_100062235 | 138 |
| 177 | 3300025284 | Ga0209130_1003777 | Ga0209130_10037777 | 138 |
| 178 | 3300025291 | Ga0209675_1000106 | Ga0209675_100010653 | 138 |
| 179 | 3300025291 | Ga0209675_1000969 | Ga0209675_100096913 | 138 |
| 180 | 3300025291 | Ga0209675_1001478 | Ga0209675_10014783 | 138 |
| 181 | 3300025292 | Ga0209676_1000007 | Ga0209676_1000007173 | 138 |
| 182 | 3300025292 | Ga0209676_1012742 | Ga0209676_10127424 | 138 |
| 183 | 3300025294 | Ga0209025_1002157 | Ga0209025_10021576 | 138 |
| 184 | 3300025294 | Ga0209025_1002304 | Ga0209025_10023045 | 138 |
| 185 | 3300025294 | Ga0209025_1003224 | Ga0209025_100322413 | 138 |
| 186 | 3300025294 | Ga0209025_1010607 | Ga0209025_10106072 | 138 |
| 187 | 3300025295 | Ga0209564_1000487 | Ga0209564_100048737 | 138 |
| 188 | 3300025295 | Ga0209564_1002834 | Ga0209564_100283418 | 138 |
| 189 | 3300025295 | Ga0209564_1006635 | Ga0209564_10066358 | 138 |
| 190 | 3300025297 | Ga0209758_1005683 | Ga0209758_100568313 | 138 |
| 191 | 3300025297 | Ga0209758_1043515 | Ga0209758_10435154 | 138 |
| 192 | 3300025298 | Ga0209050_1000003 | Ga0209050_10000031335 | 138 |
| 193 | 3300025298 | Ga0209050_1000078 | Ga0209050_1000078252 | 138 |
| 194 | 3300025298 | Ga0209050_1004842 | Ga0209050_10048425 | 138 |
| 195 | 3300025298 | Ga0209050_1022600 | Ga0209050_10226004 | 138 |
| 196 | 3300025299 | Ga0209256_1000001 | Ga0209256_10000011337 | 138 |
| 197 | 3300025299 | Ga0209256_1000976 | Ga0209256_10009765 | 138 |
| 198 | 3300025299 | Ga0209256_1005893 | Ga0209256_10058935 | 138 |
| 199 | 3300025302 | Ga0207426_1000097 | Ga0207426_100009742 | 138 |
| 200 | 3300025302 | Ga0207426_1000988 | Ga0207426_100098823 | 138 |
| 201 | 3300025302 | Ga0207426_1001375 | Ga0207426_100137516 | 138 |
| 202 | 3300025303 | Ga0209051_1000003 | Ga0209051_10000031335 | 138 |
| 203 | 3300025303 | Ga0209051_1028039 | Ga0209051_10280392 | 138 |
| 204 | 3300025304 | Ga0209257_1000020 | Ga0209257_1000020173 | 138 |
| 205 | 3300025304 | Ga0209257_1000097 | Ga0209257_1000097230 | 138 |
| 206 | 3300025935 | Ga0207709_11488321 | Ga0207709_114883212 | 138 |
| 207 | 3300031456 | Ga0307513_10000017 | Ga0307513_100000173 | 138 |
| 208 | 3300031548 | Ga0307408_100006468 | Ga0307408_1000064685 | 138 |
| 209 | 3300031548 | Ga0307408_100009227 | Ga0307408_1000092275 | 138 |
| 210 | 3300031730 | Ga0307516_10188670 | Ga0307516_101886704 | 138 |
| 211 | 3300032002 | Ga0307416_102957567 | Ga0307416_1029575671 | 138 |
| 212 | 3300041459 | Ga0451800_1200240 | Ga0451800_1200240_89_514 | 138 |
| 213 | 3300046492 | Ga0495585_0002914 | Ga0495585_0002914_7126_7542 | 138 |
| 214 | 3300046524 | Ga0495648_0001863 | Ga0495648_0001863_8013_8429 | 138 |
| 215 | 3300046524 | Ga0495648_0011239 | Ga0495648_0011239_2296_2712 | 138 |
| 216 | 3300046528 | Ga0495642_0046277 | Ga0495642_0046277_228_653 | 138 |
| 217 | 3300046530 | Ga0495654_0004989 | Ga0495654_0004989_3360_3776 | 138 |
| 218 | 3300046530 | Ga0495654_0021025 | Ga0495654_0021025_1257_1676 | 138 |
| 219 | 3300046542 | Ga0495597_0000567 | Ga0495597_0000567_22552_22968 | 138 |
| 220 | 3300046558 | Ga0495633_0012156 | Ga0495633_0012156_449_865 | 138 |
| 221 | 3300046558 | Ga0495633_0043104 | Ga0495633_0043104_341_757 | 138 |
| 222 | 3300046616 | Ga0495668_0006379 | Ga0495668_0006379_2874_3290 | 138 |
| 223 | 3300046660 | Ga0495625_0152615 | Ga0495625_0152615_233_649 | 138 |
| 224 | 3300046665 | Ga0495661_0020711 | Ga0495661_0020711_1676_2092 | 138 |
| 225 | 3300046692 | Ga0495671_0000002 | Ga0495671_0000002_473194_473610 | 138 |
| 226 | 3300046810 | Ga0495660_0000362 | Ga0495660_0000362_3754_4176 | 138 |
| 227 | 3300046810 | Ga0495660_0009627 | Ga0495660_0009627_3743_4159 | 138 |
| 228 | 3300047323 | Ga0495683_0017419 | Ga0495683_0017419_1097_1513 | 138 |
| 229 | 3300047469 | Ga0495673_0000026 | Ga0495673_0000026_360704_361120 | 138 |
| 230 | 3300047472 | Ga0495686_0152109 | Ga0495686_0152109_79_495 | 138 |
| 231 | 3300048921 | Ga0496118_0007993 | Ga0496118_0007993_3776_4198 | 138 |
| 232 | 3300048925 | Ga0496122_0217696 | Ga0496122_0217696_406_822 | 138 |
| 233 | 3300049573 | Ga0501037_0245662 | Ga0501037_0245662_764_1183 | 138 |
| 234 | 3300049665 | Ga0501227_056700 | Ga0501227_056700_286_702 | 138 |
| 235 | 3300049679 | Ga0501249_000898 | Ga0501249_000898_3639_4055 | 138 |
| 236 | 3300049766 | Ga0501269_000669 | Ga0501269_000669_635_1051 | 138 |
| 237 | 3300049775 | Ga0501279_007950 | Ga0501279_007950_943_1359 | 138 |
| 238 | 3300050489 | nmdc:mga03683_12306_c1 | nmdc:mga03683_12306_c1_135_551 | 138 |
| 239 | 3300050489 | nmdc:mga03683_197195_c1 | nmdc:mga03683_197195_c1_412_828 | 138 |
| 240 | 3300050493 | nmdc:mga0k408_170706_c1 | nmdc:mga0k408_170706_c1_762_1178 | 138 |
| 241 | 3300050494 | nmdc:mga06z11_979197_c1 | nmdc:mga06z11_979197_c1_78_494 | 138 |
| 242 | 3300053088 | Ga0500644_0001498 | Ga0500644_0001498_1475_1891 | 138 |
| 243 | 3300053125 | Ga0500618_004853 | Ga0500618_004853_196_612 | 138 |
| 244 | 3300053145 | Ga0500586_007349 | Ga0500586_007349_1707_2123 | 138 |
| 245 | 3300055283 | Ga0500661_006186 | Ga0500661_006186_1474_1890 | 138 |
| 246 | iso_pu_bacteria | 2919688452 | 2919690399 | 138 |
| 247 | 3300003761 | Ga0055535_1000290 | Ga0055535_100029027 | 139 |
| 248 | 3300003763 | Ga0055529_1000158 | Ga0055529_100015827 | 139 |
| 249 | 3300003791 | Ga0055530_10003781 | Ga0055530_100037816 | 139 |
| 250 | 3300003792 | Ga0055540_1000260 | Ga0055540_100026024 | 139 |
| 251 | 3300003794 | Ga0055531_10006230 | Ga0055531_100062306 | 139 |
| 252 | 3300005563 | Ga0068855_100110533 | Ga0068855_1001105333 | 139 |
| 253 | 3300005563 | Ga0068855_100346254 | Ga0068855_1003462542 | 139 |
| 254 | 3300009036 | Ga0105244_10005002 | Ga0105244_100050025 | 139 |
| 255 | 3300009176 | Ga0105242_10002379 | Ga0105242_1000237910 | 139 |
| 256 | 3300009551 | Ga0105238_12197462 | Ga0105238_121974622 | 139 |
| 257 | 3300013105 | Ga0157369_10374460 | Ga0157369_103744603 | 139 |
| 258 | 3300025233 | Ga0209437_100072 | Ga0209437_100072255 | 139 |
| 259 | 3300025242 | Ga0209258_100110 | Ga0209258_10011088 | 139 |
| 260 | 3300025254 | Ga0209148_1005633 | Ga0209148_10056332 | 139 |
| 261 | 3300025256 | Ga0209759_1006504 | Ga0209759_10065045 | 139 |
| 262 | 3300025272 | Ga0209455_1000104 | Ga0209455_100010488 | 139 |
| 263 | 3300025298 | Ga0209050_1003829 | Ga0209050_100382914 | 139 |
| 264 | 3300025303 | Ga0209051_1000247 | Ga0209051_100024724 | 139 |
| 265 | 3300025304 | Ga0209257_1000141 | Ga0209257_100014124 | 139 |
| 266 | 3300025728 | Ga0207655_1012412 | Ga0207655_10124124 | 139 |
| 267 | 3300025934 | Ga0207686_10469255 | Ga0207686_104692551 | 139 |
| 268 | 3300025939 | Ga0207665_10228535 | Ga0207665_102285352 | 139 |
| 269 | 3300025949 | Ga0207667_10044315 | Ga0207667_100443153 | 139 |
| 270 | 3300025949 | Ga0207667_10800837 | Ga0207667_108008372 | 139 |
| 271 | 3300026089 | Ga0207648_10098100 | Ga0207648_100981002 | 139 |
| 272 | 3300026142 | Ga0207698_10774636 | Ga0207698_107746362 | 139 |
| 273 | 3300037312 | Ga0395899_0194843 | Ga0395899_0194843_743_1186 | 139 |
| 274 | 3300037418 | Ga0395900_0076572 | Ga0395900_0076572_2469_2912 | 139 |
| 275 | 3300039447 | Ga0436361_0505867 | Ga0436361_0505867_230_679 | 139 |
| 276 | 3300044684 | Ga0466966_0055000 | Ga0466966_0055000_177_620 | 139 |
| 277 | 3300044693 | Ga0466961_0333227 | Ga0466961_0333227_38_481 | 139 |
| 278 | 3300044719 | Ga0466971_0315751 | Ga0466971_0315751_31_474 | 139 |
| 279 | 3300045049 | Ga0466959_0601852 | Ga0466959_0601852_265_708 | 139 |
| 280 | 3300045836 | Ga0466958_0042750 | Ga0466958_0042750_1444_1887 | 139 |
| 281 | 3300046463 | Ga0495653_0000010 | Ga0495653_0000010_261478_261897 | 139 |
| 282 | 3300046512 | Ga0495610_0021196 | Ga0495610_0021196_2271_2690 | 139 |
| 283 | 3300046512 | Ga0495610_0230884 | Ga0495610_0230884_75_584 | 139 |
| 284 | 3300048091 | Ga0495626_0001005 | Ga0495626_0001005_3273_3707 | 139 |
| 285 | 3300048923 | Ga0496120_0019391 | Ga0496120_0019391_2267_2686 | 139 |
| 286 | 3300048926 | Ga0496123_0019941 | Ga0496123_0019941_2540_2959 | 139 |
| 287 | 3300048928 | Ga0496125_0001902 | Ga0496125_0001902_20166_20585 | 139 |
| 288 | 3300002987 | JGI25159J45721_1004099 | JGI25159J45721_10040997 | 140 |
| 289 | 3300003320 | rootH2_10141630 | rootH2_101416304 | 140 |
| 290 | 3300003354 | JGI25160J50197_1030441 | JGI25160J50197_10304413 | 140 |
| 291 | 3300003760 | Ga0055527_1003663 | Ga0055527_10036634 | 140 |
| 292 | 3300003761 | Ga0055535_1000115 | Ga0055535_100011519 | 140 |
| 293 | 3300003762 | Ga0055542_1000028 | Ga0055542_1000028144 | 140 |
| 294 | 3300005262 | Ga0065165_1019460 | Ga0065165_10194604 | 140 |
| 295 | 3300005327 | Ga0070658_11054427 | Ga0070658_110544272 | 140 |
| 296 | 3300009098 | Ga0105245_11159294 | Ga0105245_111592942 | 140 |
| 297 | 3300009545 | Ga0105237_10858644 | Ga0105237_108586442 | 140 |
| 298 | 3300010375 | Ga0105239_10102223 | Ga0105239_101022231 | 140 |
| 299 | 3300013105 | Ga0157369_11479001 | Ga0157369_114790012 | 140 |
| 300 | 3300025228 | Ga0209672_102138 | Ga0209672_1021385 | 140 |
| 301 | 3300025229 | Ga0209147_100878 | Ga0209147_1008783 | 140 |
| 302 | 3300025242 | Ga0209258_100067 | Ga0209258_100067109 | 140 |
| 303 | 3300025254 | Ga0209148_1000067 | Ga0209148_1000067152 | 140 |
| 304 | 3300025284 | Ga0209130_1001507 | Ga0209130_100150715 | 140 |
| 305 | 3300025302 | Ga0207426_1002116 | Ga0207426_100211614 | 140 |
| 306 | 3300025909 | Ga0207705_10820029 | Ga0207705_108200291 | 140 |
| 307 | 3300025961 | Ga0207712_10744990 | Ga0207712_107449902 | 140 |
| 308 | 3300028794 | Ga0307515_10000282 | Ga0307515_1000028239 | 140 |
| 309 | 3300031649 | Ga0307514_10003331 | Ga0307514_1000333110 | 140 |
| 310 | 3300031727 | Ga0316576_10027203 | Ga0316576_100272034 | 140 |
| 311 | 3300031727 | Ga0316576_10029075 | Ga0316576_100290753 | 140 |
| 312 | 3300031728 | Ga0316578_10150991 | Ga0316578_101509912 | 140 |
| 313 | 3300031730 | Ga0307516_10002079 | Ga0307516_1000207911 | 140 |
| 314 | 3300031733 | Ga0316577_10310978 | Ga0316577_103109782 | 140 |
| 315 | 3300036712 | Ga0316584_0072663 | Ga0316584_0072663_1921_2373 | 140 |
| 316 | 3300042005 | Ga0439448_0182845 | Ga0439448_0182845_299_721 | 140 |
| 317 | 3300044735 | Ga0466968_0242699 | Ga0466968_0242699_258_680 | 140 |
| 318 | 3300046475 | Ga0495639_0004616 | Ga0495639_0004616_210_635 | 140 |
| 319 | 3300046492 | Ga0495585_0300215 | Ga0495585_0300215_74_517 | 140 |
| 320 | 3300046660 | Ga0495625_0001835 | Ga0495625_0001835_22343_22786 | 140 |
| 321 | 3300046683 | Ga0495658_0693474 | Ga0495658_0693474_195_620 | 140 |
| 322 | 3300049571 | Ga0501034_0223556 | Ga0501034_0223556_1037_1462 | 140 |
| 323 | 3300050489 | nmdc:mga03683_93307_c1 | nmdc:mga03683_93307_c1_334_759 | 140 |
| 324 | 3300050490 | nmdc:mga03n38_51259_c1 | nmdc:mga03n38_51259_c1_469_894 | 140 |
| 325 | 3300050493 | nmdc:mga0k408_1070_c2 | nmdc:mga0k408_1070_c2_4303_4728 | 140 |
| 326 | 3300050494 | nmdc:mga06z11_93271_c1 | nmdc:mga06z11_93271_c1_13_438 | 140 |
| 327 | 3300050496 | nmdc:mga07m45_3515_c1 | nmdc:mga07m45_3515_c1_4395_4820 | 140 |
| 328 | 3300053177 | Ga0500636_0061848 | Ga0500636_0061848_179_604 | 140 |
| 329 | 3300053730 | Ga0500645_000114 | Ga0500645_000114_16268_16690 | 140 |
| 330 | 3300005333 | Ga0070677_10515308 | Ga0070677_105153082 | 141 |
| 331 | 3300005354 | Ga0070675_100858205 | Ga0070675_1008582052 | 141 |
| 332 | 3300006846 | Ga0075430_100184105 | Ga0075430_1001841052 | 141 |
| 333 | 3300009098 | Ga0105245_10233506 | Ga0105245_102335064 | 141 |
| 334 | 3300009174 | Ga0105241_10060994 | Ga0105241_100609945 | 141 |
| 335 | 3300009176 | Ga0105242_10185050 | Ga0105242_101850502 | 141 |
| 336 | 3300009177 | Ga0105248_11252211 | Ga0105248_112522112 | 141 |
| 337 | 3300015262 | Ga0182007_10003999 | Ga0182007_100039994 | 141 |
| 338 | 3300025893 | Ga0207682_10387804 | Ga0207682_103878041 | 141 |
| 339 | 3300025926 | Ga0207659_10407822 | Ga0207659_104078223 | 141 |
| 340 | 3300026121 | Ga0207683_10327314 | Ga0207683_103273143 | 141 |
| 341 | 3300030733 | Ga0314311_1152045 | Ga0314311_11520453 | 141 |
| 342 | 3300030745 | Ga0316182_1004301 | Ga0316182_10043014 | 141 |
| 343 | 3300044656 | Ga0466969_0032822 | Ga0466969_0032822_2019_2453 | 141 |
| 344 | 3300044684 | Ga0466966_0000008 | Ga0466966_0000008_56398_56832 | 141 |
| 345 | 3300044693 | Ga0466961_0001985 | Ga0466961_0001985_5682_6116 | 141 |
| 346 | 3300044694 | Ga0466963_0015782 | Ga0466963_0015782_3474_3908 | 141 |
| 347 | 3300044842 | Ga0466957_0112276 | Ga0466957_0112276_588_1022 | 141 |
| 348 | 3300045049 | Ga0466959_0036722 | Ga0466959_0036722_1074_1508 | 141 |
| 349 | 3300050509 | nmdc:mga0qj67_43291_c1 | nmdc:mga0qj67_43291_c1_1439_1867 | 141 |
| 350 | 3300053139 | Ga0500568_0018860 | Ga0500568_0018860_1143_1586 | 141 |
| 351 | 3300061719 | Ga0466962_0011690 | Ga0466962_0011690_2532_2966 | 141 |
| 352 | iso_pu_bacteria | 2738541317 | 2738944703 | 141 |
| 353 | iso_pu_bacteria | 2913308742 | 2913309324 | 141 |
| 354 | 3300003775 | Ga0055524_1000010 | Ga0055524_100001069 | 142 |
| 355 | 3300006038 | Ga0075365_10197629 | Ga0075365_101976292 | 142 |
| 356 | 3300006042 | Ga0075368_10001280 | Ga0075368_100012806 | 142 |
| 357 | 3300006048 | Ga0075363_100007512 | Ga0075363_1000075125 | 142 |
| 358 | 3300006051 | Ga0075364_10019614 | Ga0075364_100196145 | 142 |
| 359 | 3300006177 | Ga0075362_10007618 | Ga0075362_100076185 | 142 |
| 360 | 3300006178 | Ga0075367_10015498 | Ga0075367_100154982 | 142 |
| 361 | 3300006195 | Ga0075366_10014741 | Ga0075366_100147415 | 142 |
| 362 | 3300006195 | Ga0075366_10046227 | Ga0075366_100462272 | 142 |
| 363 | 3300006353 | Ga0075370_10244660 | Ga0075370_102446602 | 142 |
| 364 | 3300006948 | Ga0099826_10000002 | Ga0099826_10000002366 | 142 |
| 365 | 3300009036 | Ga0105244_10009242 | Ga0105244_100092426 | 142 |
| 366 | 3300011119 | Ga0105246_10064976 | Ga0105246_100649764 | 142 |
| 367 | 3300013102 | Ga0157371_10004426 | Ga0157371_1000442613 | 142 |
| 368 | 3300015261 | Ga0182006_1011283 | Ga0182006_10112834 | 142 |
| 369 | 3300017792 | Ga0163161_10453474 | Ga0163161_104534742 | 142 |
| 370 | 3300021361 | Ga0213872_10000384 | Ga0213872_1000038422 | 142 |
| 371 | 3300025263 | Ga0209565_1010299 | Ga0209565_10102993 | 142 |
| 372 | 3300025299 | Ga0209256_1000007 | Ga0209256_1000007447 | 142 |
| 373 | 3300027666 | Ga0209282_1000001 | Ga0209282_1000001783 | 142 |
| 374 | 3300027866 | Ga0209813_10029137 | Ga0209813_100291372 | 142 |
| 375 | 3300028786 | Ga0307517_10255853 | Ga0307517_102558531 | 142 |
| 376 | 3300028800 | Ga0265338_10000057 | Ga0265338_1000005746 | 142 |
| 377 | 3300031344 | Ga0265316_10435577 | Ga0265316_104355771 | 142 |
| 378 | 3300039447 | Ga0436361_0816616 | Ga0436361_0816616_47_478 | 142 |
| 379 | 3300039447 | Ga0436361_1170005 | Ga0436361_1170005_15639_16067 | 142 |
| 380 | 3300042010 | Ga0439452_000004 | Ga0439452_000004_132369_132803 | 142 |
| 381 | 3300046507 | Ga0495606_0052343 | Ga0495606_0052343_1574_2020 | 142 |
| 382 | 3300046522 | Ga0495643_0113304 | Ga0495643_0113304_856_1287 | 142 |
| 383 | 3300046542 | Ga0495597_0007752 | Ga0495597_0007752_2693_3124 | 142 |
| 384 | 3300046558 | Ga0495633_0311744 | Ga0495633_0311744_47_475 | 142 |
| 385 | 3300047443 | Ga0495687_000502 | Ga0495687_000502_3333_3764 | 142 |
| 386 | 3300048091 | Ga0495626_0090173 | Ga0495626_0090173_501_932 | 142 |
| 387 | 3300048907 | Ga0496104_0416507 | Ga0496104_0416507_781_1221 | 142 |
| 388 | 3300048912 | Ga0496109_0022976 | Ga0496109_0022976_1867_2295 | 142 |
| 389 | 3300048919 | Ga0496116_0000103 | Ga0496116_0000103_60327_60761 | 142 |
| 390 | 3300048920 | Ga0496117_0000259 | Ga0496117_0000259_11139_11573 | 142 |
| 391 | 3300048927 | Ga0496124_0013961 | Ga0496124_0013961_2163_2597 | 142 |
| 392 | 3300050489 | nmdc:mga03683_7855_c1 | nmdc:mga03683_7855_c1_3174_3602 | 142 |
| 393 | 3300050490 | nmdc:mga03n38_1017_c1 | nmdc:mga03n38_1017_c1_4838_5266 | 142 |
| 394 | 3300050491 | nmdc:mga00v17_14316_c1 | nmdc:mga00v17_14316_c1_2834_3262 | 142 |
| 395 | 3300050492 | nmdc:mga0yw44_18425_c1 | nmdc:mga0yw44_18425_c1_351_779 | 142 |
| 396 | 3300050493 | nmdc:mga0k408_38300_c1 | nmdc:mga0k408_38300_c1_2155_2583 | 142 |
| 397 | 3300050493 | nmdc:mga0k408_7031_c1 | nmdc:mga0k408_7031_c1_224_655 | 142 |
| 398 | 3300050494 | nmdc:mga06z11_51325_c1 | nmdc:mga06z11_51325_c1_1034_1462 | 142 |
| 399 | 3300050495 | nmdc:mga04h51_66769_c1 | nmdc:mga04h51_66769_c1_651_1079 | 142 |
| 400 | 3300050496 | nmdc:mga07m45_18843_c1 | nmdc:mga07m45_18843_c1_2422_2850 | 142 |
| 401 | 3300050516 | nmdc:mga0sz30_154227_c1 | nmdc:mga0sz30_154227_c1_57_485 | 142 |
| 402 | iso_pu_bacteria | 2643221672 | 2644401041 | 142 |
| 403 | iso_pu_bacteria | 2919046199 | 2919046760 | 142 |
| 404 | iso_pu_bacteria | 2928070936 | 2928072673 | 142 |
| 405 | 3300001990 | JGI24737J22298_10058755 | JGI24737J22298_100587552 | 143 |
| 406 | 3300002705 | JGI25156J39149_1000502 | JGI25156J39149_100050213 | 143 |
| 407 | 3300002705 | JGI25156J39149_1038461 | JGI25156J39149_10384611 | 143 |
| 408 | 3300003187 | JGI25151J46595_10041741 | JGI25151J46595_100417413 | 143 |
| 409 | 3300003322 | rootL2_10233829 | rootL2_102338292 | 143 |
| 410 | 3300003756 | Ga0055533_1000351 | Ga0055533_10003518 | 143 |
| 411 | 3300003756 | Ga0055533_1000485 | Ga0055533_10004859 | 143 |
| 412 | 3300003781 | Ga0055536_1000286 | Ga0055536_100028634 | 143 |
| 413 | 3300003792 | Ga0055540_1037262 | Ga0055540_10372621 | 143 |
| 414 | 3300005328 | Ga0070676_10123841 | Ga0070676_101238411 | 143 |
| 415 | 3300005330 | Ga0070690_100078515 | Ga0070690_1000785153 | 143 |
| 416 | 3300005331 | Ga0070670_101493928 | Ga0070670_1014939282 | 143 |
| 417 | 3300005333 | Ga0070677_10044804 | Ga0070677_100448043 | 143 |
| 418 | 3300005334 | Ga0068869_100028125 | Ga0068869_1000281254 | 143 |
| 419 | 3300005335 | Ga0070666_10027614 | Ga0070666_100276144 | 143 |
| 420 | 3300005338 | Ga0068868_100000189 | Ga0068868_1000001894 | 143 |
| 421 | 3300005343 | Ga0070687_100478154 | Ga0070687_1004781542 | 143 |
| 422 | 3300005356 | Ga0070674_100572428 | Ga0070674_1005724282 | 143 |
| 423 | 3300005364 | Ga0070673_100001117 | Ga0070673_1000011176 | 143 |
| 424 | 3300005364 | Ga0070673_100226328 | Ga0070673_1002263282 | 143 |
| 425 | 3300005365 | Ga0070688_100027498 | Ga0070688_1000274982 | 143 |
| 426 | 3300005366 | Ga0070659_100776201 | Ga0070659_1007762012 | 143 |
| 427 | 3300005367 | Ga0070667_100001328 | Ga0070667_10000132812 | 143 |
| 428 | 3300005367 | Ga0070667_100072464 | Ga0070667_1000724643 | 143 |
| 429 | 3300005367 | Ga0070667_101141698 | Ga0070667_1011416982 | 143 |
| 430 | 3300005455 | Ga0070663_100055204 | Ga0070663_1000552042 | 143 |
| 431 | 3300005456 | Ga0070678_100001606 | Ga0070678_1000016065 | 143 |
| 432 | 3300005457 | Ga0070662_100201340 | Ga0070662_1002013402 | 143 |
| 433 | 3300005457 | Ga0070662_100371986 | Ga0070662_1003719863 | 143 |
| 434 | 3300005466 | Ga0070685_10253005 | Ga0070685_102530052 | 143 |
| 435 | 3300005539 | Ga0068853_100227595 | Ga0068853_1002275952 | 143 |
| 436 | 3300005543 | Ga0070672_100072840 | Ga0070672_1000728405 | 143 |
| 437 | 3300005564 | Ga0070664_100979455 | Ga0070664_1009794552 | 143 |
| 438 | 3300005577 | Ga0068857_100075627 | Ga0068857_1000756272 | 143 |
| 439 | 3300005578 | Ga0068854_100068921 | Ga0068854_1000689214 | 143 |
| 440 | 3300005616 | Ga0068852_100176013 | Ga0068852_1001760132 | 143 |
| 441 | 3300005617 | Ga0068859_101022405 | Ga0068859_1010224052 | 143 |
| 442 | 3300005618 | Ga0068864_100003331 | Ga0068864_1000033315 | 143 |
| 443 | 3300005840 | Ga0068870_10103237 | Ga0068870_101032371 | 143 |
| 444 | 3300005841 | Ga0068863_100035873 | Ga0068863_1000358735 | 143 |
| 445 | 3300005842 | Ga0068858_100228714 | Ga0068858_1002287144 | 143 |
| 446 | 3300005843 | Ga0068860_100157401 | Ga0068860_1001574011 | 143 |
| 447 | 3300006048 | Ga0075363_100126416 | Ga0075363_1001264162 | 143 |
| 448 | 3300006048 | Ga0075363_100387195 | Ga0075363_1003871952 | 143 |
| 449 | 3300006177 | Ga0075362_10023506 | Ga0075362_100235062 | 143 |
| 450 | 3300006178 | Ga0075367_10007127 | Ga0075367_100071275 | 143 |
| 451 | 3300006186 | Ga0075369_10091665 | Ga0075369_100916652 | 143 |
| 452 | 3300006195 | Ga0075366_10016319 | Ga0075366_100163196 | 143 |
| 453 | 3300006237 | Ga0097621_100236833 | Ga0097621_1002368333 | 143 |
| 454 | 3300006353 | Ga0075370_10000134 | Ga0075370_1000013411 | 143 |
| 455 | 3300006353 | Ga0075370_10169946 | Ga0075370_101699462 | 143 |
| 456 | 3300006358 | Ga0068871_100024161 | Ga0068871_1000241614 | 143 |
| 457 | 3300006358 | Ga0068871_100378027 | Ga0068871_1003780273 | 143 |
| 458 | 3300006931 | Ga0097620_101022410 | Ga0097620_1010224102 | 143 |
| 459 | 3300009177 | Ga0105248_10044730 | Ga0105248_100447305 | 143 |
| 460 | 3300009177 | Ga0105248_10755082 | Ga0105248_107550822 | 143 |
| 461 | 3300013296 | Ga0157374_10031619 | Ga0157374_100316195 | 143 |
| 462 | 3300013306 | Ga0163162_10063034 | Ga0163162_100630345 | 143 |
| 463 | 3300013308 | Ga0157375_11489158 | Ga0157375_114891582 | 143 |
| 464 | 3300013308 | Ga0157375_11503549 | Ga0157375_115035492 | 143 |
| 465 | 3300014325 | Ga0163163_10027737 | Ga0163163_100277375 | 143 |
| 466 | 3300014326 | Ga0157380_10655846 | Ga0157380_106558462 | 143 |
| 467 | 3300014968 | Ga0157379_10002348 | Ga0157379_100023486 | 143 |
| 468 | 3300014969 | Ga0157376_10034752 | Ga0157376_100347524 | 143 |
| 469 | 3300014969 | Ga0157376_10272567 | Ga0157376_102725673 | 143 |
| 470 | 3300015262 | Ga0182007_10001013 | Ga0182007_1000101313 | 143 |
| 471 | 3300017792 | Ga0163161_10233239 | Ga0163161_102332392 | 143 |
| 472 | 3300017792 | Ga0163161_10633617 | Ga0163161_106336172 | 143 |
| 473 | 3300025226 | Ga0209674_100048 | Ga0209674_100048263 | 143 |
| 474 | 3300025226 | Ga0209674_100167 | Ga0209674_10016757 | 143 |
| 475 | 3300025256 | Ga0209759_1000002 | Ga0209759_1000002150 | 143 |
| 476 | 3300025256 | Ga0209759_1000032 | Ga0209759_100003251 | 143 |
| 477 | 3300025256 | Ga0209759_1000096 | Ga0209759_1000096121 | 143 |
| 478 | 3300025256 | Ga0209759_1001112 | Ga0209759_10011127 | 143 |
| 479 | 3300025292 | Ga0209676_1000838 | Ga0209676_10008389 | 143 |
| 480 | 3300025294 | Ga0209025_1001118 | Ga0209025_10011189 | 143 |
| 481 | 3300025294 | Ga0209025_1006471 | Ga0209025_10064714 | 143 |
| 482 | 3300025303 | Ga0209051_1014258 | Ga0209051_10142584 | 143 |
| 483 | 3300025893 | Ga0207682_10040443 | Ga0207682_100404432 | 143 |
| 484 | 3300025901 | Ga0207688_10037434 | Ga0207688_100374345 | 143 |
| 485 | 3300025903 | Ga0207680_10017945 | Ga0207680_100179455 | 143 |
| 486 | 3300025904 | Ga0207647_10007532 | Ga0207647_100075323 | 143 |
| 487 | 3300025914 | Ga0207671_10611980 | Ga0207671_106119801 | 143 |
| 488 | 3300025926 | Ga0207659_10003012 | Ga0207659_100030122 | 143 |
| 489 | 3300025931 | Ga0207644_11867689 | Ga0207644_118676891 | 143 |
| 490 | 3300025933 | Ga0207706_10220087 | Ga0207706_102200873 | 143 |
| 491 | 3300025933 | Ga0207706_10222786 | Ga0207706_102227863 | 143 |
| 492 | 3300025933 | Ga0207706_10527960 | Ga0207706_105279602 | 143 |
| 493 | 3300025937 | Ga0207669_10413131 | Ga0207669_104131312 | 143 |
| 494 | 3300025938 | Ga0207704_10564933 | Ga0207704_105649332 | 143 |
| 495 | 3300025941 | Ga0207711_10008678 | Ga0207711_100086788 | 143 |
| 496 | 3300025942 | Ga0207689_10039143 | Ga0207689_100391434 | 143 |
| 497 | 3300025960 | Ga0207651_10058430 | Ga0207651_100584303 | 143 |
| 498 | 3300025981 | Ga0207640_10060214 | Ga0207640_100602142 | 143 |
| 499 | 3300025981 | Ga0207640_10208791 | Ga0207640_102087913 | 143 |
| 500 | 3300025986 | Ga0207658_10006229 | Ga0207658_100062295 | 143 |
| 501 | 3300025986 | Ga0207658_10186927 | Ga0207658_101869271 | 143 |
| 502 | 3300025986 | Ga0207658_10310958 | Ga0207658_103109582 | 143 |
| 503 | 3300026023 | Ga0207677_10000891 | Ga0207677_100008918 | 143 |
| 504 | 3300026067 | Ga0207678_10074895 | Ga0207678_100748952 | 143 |
| 505 | 3300026088 | Ga0207641_10016984 | Ga0207641_100169845 | 143 |
| 506 | 3300026089 | Ga0207648_10553455 | Ga0207648_105534552 | 143 |
| 507 | 3300026116 | Ga0207674_10054909 | Ga0207674_100549093 | 143 |
| 508 | 3300026121 | Ga0207683_10022854 | Ga0207683_100228545 | 143 |
| 509 | 3300026142 | Ga0207698_10209466 | Ga0207698_102094662 | 143 |
| 510 | 3300028381 | Ga0268264_10132647 | Ga0268264_101326474 | 143 |
| 511 | 3300031548 | Ga0307408_100040713 | Ga0307408_1000407135 | 143 |
| 512 | 3300031548 | Ga0307408_100051022 | Ga0307408_1000510223 | 143 |
| 513 | 3300031824 | Ga0307413_12017310 | Ga0307413_120173101 | 143 |
| 514 | 3300031995 | Ga0307409_100921698 | Ga0307409_1009216982 | 143 |
| 515 | 3300032002 | Ga0307416_100067405 | Ga0307416_1000674052 | 143 |
| 516 | 3300032004 | Ga0307414_10147406 | Ga0307414_101474061 | 143 |
| 517 | 3300032005 | Ga0307411_10287822 | Ga0307411_102878222 | 143 |
| 518 | 3300037471 | Ga0395905_0000035 | Ga0395905_0000035_45702_46133 | 143 |
| 519 | 3300041997 | Ga0439431_0213455 | Ga0439431_0213455_69_500 | 143 |
| 520 | 3300042007 | Ga0439449_0137689 | Ga0439449_0137689_100_531 | 143 |
| 521 | 3300042014 | Ga0439457_123487 | Ga0439457_123487_43_474 | 143 |
| 522 | 3300042015 | Ga0439462_0095897 | Ga0439462_0095897_13_444 | 143 |
| 523 | 3300046455 | Ga0495603_0000088 | Ga0495603_0000088_25535_25990 | 143 |
| 524 | 3300046457 | Ga0495590_0019251 | Ga0495590_0019251_1793_2248 | 143 |
| 525 | 3300046459 | Ga0495629_0001578 | Ga0495629_0001578_14715_15146 | 143 |
| 526 | 3300046459 | Ga0495629_0001651 | Ga0495629_0001651_13969_14424 | 143 |
| 527 | 3300046459 | Ga0495629_0025278 | Ga0495629_0025278_1149_1580 | 143 |
| 528 | 3300046459 | Ga0495629_0075758 | Ga0495629_0075758_546_977 | 143 |
| 529 | 3300046462 | Ga0495651_0000727 | Ga0495651_0000727_20600_21031 | 143 |
| 530 | 3300046463 | Ga0495653_0000573 | Ga0495653_0000573_25360_25791 | 143 |
| 531 | 3300046463 | Ga0495653_0029427 | Ga0495653_0029427_1864_2295 | 143 |
| 532 | 3300046463 | Ga0495653_0031645 | Ga0495653_0031645_56_487 | 143 |
| 533 | 3300046471 | Ga0495650_0075639 | Ga0495650_0075639_96_551 | 143 |
| 534 | 3300046472 | Ga0495580_0001753 | Ga0495580_0001753_16139_16570 | 143 |
| 535 | 3300046472 | Ga0495580_0005225 | Ga0495580_0005225_7293_7724 | 143 |
| 536 | 3300046472 | Ga0495580_0005577 | Ga0495580_0005577_7511_7966 | 143 |
| 537 | 3300046473 | Ga0495582_0121741 | Ga0495582_0121741_618_1049 | 143 |
| 538 | 3300046474 | Ga0495605_0007017 | Ga0495605_0007017_2721_3176 | 143 |
| 539 | 3300046476 | Ga0495662_0478163 | Ga0495662_0478163_147_578 | 143 |
| 540 | 3300046477 | Ga0495664_0107616 | Ga0495664_0107616_622_1053 | 143 |
| 541 | 3300046491 | Ga0495584_0020617 | Ga0495584_0020617_1730_2185 | 143 |
| 542 | 3300046500 | Ga0495596_0039376 | Ga0495596_0039376_1099_1530 | 143 |
| 543 | 3300046500 | Ga0495596_0066504 | Ga0495596_0066504_485_916 | 143 |
| 544 | 3300046506 | Ga0495583_0032653 | Ga0495583_0032653_1790_2221 | 143 |
| 545 | 3300046507 | Ga0495606_0164520 | Ga0495606_0164520_815_1246 | 143 |
| 546 | 3300046507 | Ga0495606_0446175 | Ga0495606_0446175_99_554 | 143 |
| 547 | 3300046511 | Ga0495608_0484735 | Ga0495608_0484735_58_489 | 143 |
| 548 | 3300046513 | Ga0495616_0007358 | Ga0495616_0007358_4799_5254 | 143 |
| 549 | 3300046514 | Ga0495618_0029802 | Ga0495618_0029802_2920_3351 | 143 |
| 550 | 3300046514 | Ga0495618_0072038 | Ga0495618_0072038_82_513 | 143 |
| 551 | 3300046514 | Ga0495618_0077661 | Ga0495618_0077661_1462_1893 | 143 |
| 552 | 3300046516 | Ga0495628_0028221 | Ga0495628_0028221_192_623 | 143 |
| 553 | 3300046516 | Ga0495628_0033309 | Ga0495628_0033309_2668_3099 | 143 |
| 554 | 3300046516 | Ga0495628_0326075 | Ga0495628_0326075_67_498 | 143 |
| 555 | 3300046517 | Ga0495630_0008911 | Ga0495630_0008911_6119_6550 | 143 |
| 556 | 3300046517 | Ga0495630_0009796 | Ga0495630_0009796_2388_2819 | 143 |
| 557 | 3300046524 | Ga0495648_0015932 | Ga0495648_0015932_4802_5233 | 143 |
| 558 | 3300046524 | Ga0495648_0172871 | Ga0495648_0172871_290_721 | 143 |
| 559 | 3300046526 | Ga0495666_0000893 | Ga0495666_0000893_2475_2906 | 143 |
| 560 | 3300046526 | Ga0495666_0001632 | Ga0495666_0001632_5289_5720 | 143 |
| 561 | 3300046526 | Ga0495666_0040451 | Ga0495666_0040451_732_1187 | 143 |
| 562 | 3300046528 | Ga0495642_0058542 | Ga0495642_0058542_509_964 | 143 |
| 563 | 3300046529 | Ga0495652_0001267 | Ga0495652_0001267_2500_2931 | 143 |
| 564 | 3300046529 | Ga0495652_0078627 | Ga0495652_0078627_1579_2010 | 143 |
| 565 | 3300046531 | Ga0495665_0000466 | Ga0495665_0000466_2494_2925 | 143 |
| 566 | 3300046531 | Ga0495665_0089082 | Ga0495665_0089082_670_1101 | 143 |
| 567 | 3300046533 | Ga0495640_0011186 | Ga0495640_0011186_4027_4458 | 143 |
| 568 | 3300046533 | Ga0495640_0098853 | Ga0495640_0098853_1351_1782 | 143 |
| 569 | 3300046535 | Ga0495586_0000626 | Ga0495586_0000626_17444_17875 | 143 |
| 570 | 3300046535 | Ga0495586_0056963 | Ga0495586_0056963_1670_2101 | 143 |
| 571 | 3300046542 | Ga0495597_0125286 | Ga0495597_0125286_552_1007 | 143 |
| 572 | 3300046543 | Ga0495645_0033419 | Ga0495645_0033419_3063_3518 | 143 |
| 573 | 3300046543 | Ga0495645_0193410 | Ga0495645_0193410_98_529 | 143 |
| 574 | 3300046543 | Ga0495645_0486291 | Ga0495645_0486291_210_641 | 143 |
| 575 | 3300046557 | Ga0495622_0012142 | Ga0495622_0012142_2992_3447 | 143 |
| 576 | 3300046642 | Ga0495634_0032866 | Ga0495634_0032866_647_1078 | 143 |
| 577 | 3300046665 | Ga0495661_0009208 | Ga0495661_0009208_3589_4020 | 143 |
| 578 | 3300046665 | Ga0495661_0046866 | Ga0495661_0046866_320_751 | 143 |
| 579 | 3300046678 | Ga0495599_0044818 | Ga0495599_0044818_1989_2420 | 143 |
| 580 | 3300046678 | Ga0495599_0298842 | Ga0495599_0298842_132_563 | 143 |
| 581 | 3300046679 | Ga0495623_0001937 | Ga0495623_0001937_5819_6250 | 143 |
| 582 | 3300046679 | Ga0495623_0016318 | Ga0495623_0016318_77_508 | 143 |
| 583 | 3300046679 | Ga0495623_0055865 | Ga0495623_0055865_1418_1849 | 143 |
| 584 | 3300046680 | Ga0495646_0026058 | Ga0495646_0026058_2163_2594 | 143 |
| 585 | 3300046689 | Ga0495613_0003365 | Ga0495613_0003365_8174_8605 | 143 |
| 586 | 3300046689 | Ga0495613_0004731 | Ga0495613_0004731_4483_4914 | 143 |
| 587 | 3300046689 | Ga0495613_0294181 | Ga0495613_0294181_236_691 | 143 |
| 588 | 3300046690 | Ga0495624_0001213 | Ga0495624_0001213_2472_2903 | 143 |
| 589 | 3300046690 | Ga0495624_0001465 | Ga0495624_0001465_1749_2180 | 143 |
| 590 | 3300046692 | Ga0495671_0102142 | Ga0495671_0102142_78_533 | 143 |
| 591 | 3300046694 | Ga0495649_0130007 | Ga0495649_0130007_326_781 | 143 |
| 592 | 3300046794 | Ga0495589_0015735 | Ga0495589_0015735_1815_2270 | 143 |
| 593 | 3300046794 | Ga0495589_0164678 | Ga0495589_0164678_428_859 | 143 |
| 594 | 3300046810 | Ga0495660_0000799 | Ga0495660_0000799_19267_19707 | 143 |
| 595 | 3300047315 | Ga0495581_0049111 | Ga0495581_0049111_1532_1963 | 143 |
| 596 | 3300047315 | Ga0495581_0233335 | Ga0495581_0233335_16_471 | 143 |
| 597 | 3300047315 | Ga0495581_0579374 | Ga0495581_0579374_23_454 | 143 |
| 598 | 3300047317 | Ga0495604_0018202 | Ga0495604_0018202_2758_3189 | 143 |
| 599 | 3300047317 | Ga0495604_0102522 | Ga0495604_0102522_981_1412 | 143 |
| 600 | 3300047319 | Ga0495674_0000653 | Ga0495674_0000653_27000_27431 | 143 |
| 601 | 3300047319 | Ga0495674_0000913 | Ga0495674_0000913_2489_2920 | 143 |
| 602 | 3300047319 | Ga0495674_0003203 | Ga0495674_0003203_13481_13936 | 143 |
| 603 | 3300047320 | Ga0495672_0009463 | Ga0495672_0009463_6078_6509 | 143 |
| 604 | 3300047320 | Ga0495672_0028450 | Ga0495672_0028450_548_1003 | 143 |
| 605 | 3300047321 | Ga0495676_0075526 | Ga0495676_0075526_1509_1940 | 143 |
| 606 | 3300047321 | Ga0495676_0118909 | Ga0495676_0118909_1057_1488 | 143 |
| 607 | 3300047322 | Ga0495680_0006739 | Ga0495680_0006739_2871_3302 | 143 |
| 608 | 3300047322 | Ga0495680_0011532 | Ga0495680_0011532_3179_3610 | 143 |
| 609 | 3300047323 | Ga0495683_0002499 | Ga0495683_0002499_7049_7480 | 143 |
| 610 | 3300047443 | Ga0495687_040005 | Ga0495687_040005_251_706 | 143 |
| 611 | 3300047444 | Ga0495675_0232502 | Ga0495675_0232502_132_563 | 143 |
| 612 | 3300047445 | Ga0495677_0246379 | Ga0495677_0246379_131_586 | 143 |
| 613 | 3300047446 | Ga0495679_000489 | Ga0495679_000489_25317_25748 | 143 |
| 614 | 3300047446 | Ga0495679_006544 | Ga0495679_006544_1968_2399 | 143 |
| 615 | 3300047446 | Ga0495679_037010 | Ga0495679_037010_239_694 | 143 |
| 616 | 3300047447 | Ga0495685_033437 | Ga0495685_033437_1265_1720 | 143 |
| 617 | 3300047469 | Ga0495673_0003513 | Ga0495673_0003513_6221_6676 | 143 |
| 618 | 3300047469 | Ga0495673_0024334 | Ga0495673_0024334_2150_2581 | 143 |
| 619 | 3300047471 | Ga0495684_0616158 | Ga0495684_0616158_243_674 | 143 |
| 620 | 3300047673 | Ga0495593_0019136 | Ga0495593_0019136_2285_2716 | 143 |
| 621 | 3300047673 | Ga0495593_0042873 | Ga0495593_0042873_186_617 | 143 |
| 622 | 3300048088 | Ga0495602_0001757 | Ga0495602_0001757_2804_3235 | 143 |
| 623 | 3300048088 | Ga0495602_0002700 | Ga0495602_0002700_11937_12368 | 143 |
| 624 | 3300048088 | Ga0495602_0006511 | Ga0495602_0006511_7121_7552 | 143 |
| 625 | 3300048088 | Ga0495602_0184440 | Ga0495602_0184440_498_929 | 143 |
| 626 | 3300048089 | Ga0495614_0000279 | Ga0495614_0000279_2472_2903 | 143 |
| 627 | 3300048089 | Ga0495614_0323001 | Ga0495614_0323001_29_460 | 143 |
| 628 | 3300048904 | Ga0496101_0073397 | Ga0496101_0073397_421_876 | 143 |
| 629 | 3300048905 | Ga0496102_0180280 | Ga0496102_0180280_698_1129 | 143 |
| 630 | 3300048906 | Ga0496103_0549463 | Ga0496103_0549463_268_699 | 143 |
| 631 | 3300048907 | Ga0496104_0042817 | Ga0496104_0042817_3450_3905 | 143 |
| 632 | 3300048908 | Ga0496105_0009938 | Ga0496105_0009938_2735_3190 | 143 |
| 633 | 3300048908 | Ga0496105_0334706 | Ga0496105_0334706_221_655 | 143 |
| 634 | 3300048909 | Ga0496106_0142179 | Ga0496106_0142179_1129_1584 | 143 |
| 635 | 3300048910 | Ga0496107_0440096 | Ga0496107_0440096_206_637 | 143 |
| 636 | 3300048913 | Ga0496110_0621542 | Ga0496110_0621542_136_591 | 143 |
| 637 | 3300048915 | Ga0496112_0012047 | Ga0496112_0012047_704_1159 | 143 |
| 638 | 3300048916 | Ga0496113_0000380 | Ga0496113_0000380_11643_12098 | 143 |
| 639 | 3300048916 | Ga0496113_1140884 | Ga0496113_1140884_121_555 | 143 |
| 640 | 3300048917 | Ga0496114_1236166 | Ga0496114_1236166_47_481 | 143 |
| 641 | 3300048919 | Ga0496116_0014154 | Ga0496116_0014154_5690_6121 | 143 |
| 642 | 3300048920 | Ga0496117_0394838 | Ga0496117_0394838_215_649 | 143 |
| 643 | 3300048921 | Ga0496118_0001478 | Ga0496118_0001478_8687_9121 | 143 |
| 644 | 3300048921 | Ga0496118_0098715 | Ga0496118_0098715_1297_1728 | 143 |
| 645 | 3300048922 | Ga0496119_0344444 | Ga0496119_0344444_257_712 | 143 |
| 646 | 3300048924 | Ga0496121_0053401 | Ga0496121_0053401_729_1181 | 143 |
| 647 | 3300048924 | Ga0496121_0144609 | Ga0496121_0144609_511_966 | 143 |
| 648 | 3300049460 | Ga0495682_0010393 | Ga0495682_0010393_2595_3050 | 143 |
| 649 | 3300050490 | nmdc:mga03n38_553999_c1 | nmdc:mga03n38_553999_c1_20_457 | 143 |
| 650 | 3300050493 | nmdc:mga0k408_4660_c1 | nmdc:mga0k408_4660_c1_3224_3661 | 143 |
| 651 | 3300050496 | nmdc:mga07m45_1404_c1 | nmdc:mga07m45_1404_c1_8696_9133 | 143 |
| 652 | 3300053136 | Ga0500559_0002116 | Ga0500559_0002116_5837_6286 | 143 |
| 653 | iso_pu_bacteria | 2562617112 | 2563056909 | 143 |
| 654 | iso_pu_bacteria | 2711768613 | 2713481070 | 143 |
| 655 | 3300003752 | Ga0055539_1000051 | Ga0055539_1000051125 | 144 |
| 656 | 3300003756 | Ga0055533_1000025 | Ga0055533_100002575 | 144 |
| 657 | 3300003759 | Ga0055525_1001177 | Ga0055525_10011774 | 144 |
| 658 | 3300003761 | Ga0055535_1009426 | Ga0055535_10094263 | 144 |
| 659 | 3300005290 | Ga0065712_10511677 | Ga0065712_105116771 | 144 |
| 660 | 3300005331 | Ga0070670_100029119 | Ga0070670_1000291195 | 144 |
| 661 | 3300005339 | Ga0070660_100515292 | Ga0070660_1005152921 | 144 |
| 662 | 3300005354 | Ga0070675_100254930 | Ga0070675_1002549302 | 144 |
| 663 | 3300005355 | Ga0070671_100104819 | Ga0070671_1001048193 | 144 |
| 664 | 3300005356 | Ga0070674_100034350 | Ga0070674_1000343504 | 144 |
| 665 | 3300005459 | Ga0068867_100027885 | Ga0068867_1000278854 | 144 |
| 666 | 3300005539 | Ga0068853_101068004 | Ga0068853_1010680041 | 144 |
| 667 | 3300005841 | Ga0068863_100189691 | Ga0068863_1001896912 | 144 |
| 668 | 3300006195 | Ga0075366_10181799 | Ga0075366_101817993 | 144 |
| 669 | 3300006195 | Ga0075366_10285626 | Ga0075366_102856261 | 144 |
| 670 | 3300006358 | Ga0068871_101874436 | Ga0068871_1018744362 | 144 |
| 671 | 3300006914 | Ga0075436_100049187 | Ga0075436_1000491872 | 144 |
| 672 | 3300007076 | Ga0075435_100558647 | Ga0075435_1005586472 | 144 |
| 673 | 3300009176 | Ga0105242_11446107 | Ga0105242_114461072 | 144 |
| 674 | 3300009177 | Ga0105248_10134284 | Ga0105248_101342845 | 144 |
| 675 | 3300009177 | Ga0105248_11281778 | Ga0105248_112817781 | 144 |
| 676 | 3300013296 | Ga0157374_10675739 | Ga0157374_106757392 | 144 |
| 677 | 3300013306 | Ga0163162_10363558 | Ga0163162_103635583 | 144 |
| 678 | 3300014969 | Ga0157376_10488341 | Ga0157376_104883411 | 144 |
| 679 | 3300017792 | Ga0163161_10265900 | Ga0163161_102659002 | 144 |
| 680 | 3300025226 | Ga0209674_100007 | Ga0209674_100007436 | 144 |
| 681 | 3300025230 | Ga0209563_100052 | Ga0209563_100052175 | 144 |
| 682 | 3300025242 | Ga0209258_100789 | Ga0209258_1007899 | 144 |
| 683 | 3300025253 | Ga0209677_100015 | Ga0209677_100015355 | 144 |
| 684 | 3300025256 | Ga0209759_1001795 | Ga0209759_10017952 | 144 |
| 685 | 3300025256 | Ga0209759_1004056 | Ga0209759_10040564 | 144 |
| 686 | 3300025919 | Ga0207657_10344044 | Ga0207657_103440442 | 144 |
| 687 | 3300025925 | Ga0207650_10204675 | Ga0207650_102046754 | 144 |
| 688 | 3300025926 | Ga0207659_10449109 | Ga0207659_104491092 | 144 |
| 689 | 3300025931 | Ga0207644_10274435 | Ga0207644_102744352 | 144 |
| 690 | 3300025932 | Ga0207690_10320659 | Ga0207690_103206592 | 144 |
| 691 | 3300025934 | Ga0207686_10885598 | Ga0207686_108855982 | 144 |
| 692 | 3300025941 | Ga0207711_10291446 | Ga0207711_102914463 | 144 |
| 693 | 3300026088 | Ga0207641_10273085 | Ga0207641_102730854 | 144 |
| 694 | 3300026088 | Ga0207641_11052935 | Ga0207641_110529351 | 144 |
| 695 | 3300026089 | Ga0207648_10096500 | Ga0207648_100965004 | 144 |
| 696 | 3300026095 | Ga0207676_10482591 | Ga0207676_104825912 | 144 |
| 697 | 3300026121 | Ga0207683_10076963 | Ga0207683_100769633 | 144 |
| 698 | 3300028379 | Ga0268266_10897411 | Ga0268266_108974111 | 144 |
| 699 | 3300034820 | Ga0373959_0066663 | Ga0373959_0066663_323_757 | 144 |
| 700 | 3300035086 | Ga0373934_0040794 | Ga0373934_0040794_144_584 | 144 |
| 701 | 3300035691 | Ga0373931_0260070 | Ga0373931_0260070_487_939 | 144 |
| 702 | 3300042004 | Ga0439445_0179493 | Ga0439445_0179493_142_576 | 144 |
| 703 | 3300046463 | Ga0495653_0253308 | Ga0495653_0253308_720_1154 | 144 |
| 704 | 3300046492 | Ga0495585_0000003 | Ga0495585_0000003_101408_101842 | 144 |
| 705 | 3300046513 | Ga0495616_0002197 | Ga0495616_0002197_11835_12269 | 144 |
| 706 | 3300046517 | Ga0495630_0145687 | Ga0495630_0145687_832_1266 | 144 |
| 707 | 3300046524 | Ga0495648_0000011 | Ga0495648_0000011_26499_26933 | 144 |
| 708 | 3300046648 | Ga0495611_0082400 | Ga0495611_0082400_983_1417 | 144 |
| 709 | 3300047673 | Ga0495593_0032816 | Ga0495593_0032816_52_486 | 144 |
| 710 | 3300048903 | Ga0496100_0475345 | Ga0496100_0475345_107_541 | 144 |
| 711 | 3300048912 | Ga0496109_0331860 | Ga0496109_0331860_896_1330 | 144 |
| 712 | 3300048918 | Ga0496115_0276047 | Ga0496115_0276047_520_954 | 144 |
| 713 | 3300049568 | Ga0501031_0480610 | Ga0501031_0480610_327_767 | 144 |
| 714 | 3300049572 | Ga0501036_0294807 | Ga0501036_0294807_644_1102 | 144 |
| 715 | 3300049572 | Ga0501036_0408233 | Ga0501036_0408233_466_903 | 144 |
| 716 | 3300049573 | Ga0501037_0924547 | Ga0501037_0924547_51_491 | 144 |
| 717 | 3300049578 | Ga0501042_0473816 | Ga0501042_0473816_378_812 | 144 |
| 718 | 3300049579 | Ga0501043_0000371 | Ga0501043_0000371_18974_19411 | 144 |
| 719 | 3300049579 | Ga0501043_0691002 | Ga0501043_0691002_77_535 | 144 |
| 720 | 3300049580 | Ga0501046_0000488 | Ga0501046_0000488_20210_20647 | 144 |
| 721 | 3300049580 | Ga0501046_0440833 | Ga0501046_0440833_348_806 | 144 |
| 722 | 3300049581 | Ga0501047_0000564 | Ga0501047_0000564_18973_19410 | 144 |
| 723 | 3300049581 | Ga0501047_0385498 | Ga0501047_0385498_160_618 | 144 |
| 724 | 3300049582 | Ga0501048_0001830 | Ga0501048_0001830_10245_10682 | 144 |
| 725 | 3300049588 | Ga0501072_0525712 | Ga0501072_0525712_210_644 | 144 |
| 726 | 3300049592 | Ga0501076_0394330 | Ga0501076_0394330_605_1039 | 144 |
| 727 | 3300049742 | Ga0501080_0698990 | Ga0501080_0698990_16_456 | 144 |
| 728 | 3300049743 | Ga0501081_0623619 | Ga0501081_0623619_276_710 | 144 |
| 729 | 3300049822 | Ga0501035_0052513 | Ga0501035_0052513_474_932 | 144 |
| 730 | 3300049823 | Ga0501044_0050386 | Ga0501044_0050386_2394_2852 | 144 |
| 731 | 3300050493 | nmdc:mga0k408_12270_c1 | nmdc:mga0k408_12270_c1_698_1132 | 144 |
| 732 | 3300050514 | nmdc:mga08x19_32067_c1 | nmdc:mga08x19_32067_c1_350_802 | 144 |
| 733 | 3300061734 | Ga0530510_0520639 | Ga0530510_0520639_90_524 | 144 |
| 734 | 3300003320 | rootH2_10003443 | rootH2_100034433 | 145 |
| 735 | 3300003781 | Ga0055536_1000891 | Ga0055536_100089112 | 145 |
| 736 | 3300003792 | Ga0055540_1001142 | Ga0055540_100114210 | 145 |
| 737 | 3300003792 | Ga0055540_1001176 | Ga0055540_100117610 | 145 |
| 738 | 3300003794 | Ga0055531_10000572 | Ga0055531_1000057225 | 145 |
| 739 | 3300005262 | Ga0065165_1020123 | Ga0065165_10201233 | 145 |
| 740 | 3300005330 | Ga0070690_100312796 | Ga0070690_1003127962 | 145 |
| 741 | 3300005331 | Ga0070670_100098633 | Ga0070670_1000986332 | 145 |
| 742 | 3300005364 | Ga0070673_100141898 | Ga0070673_1001418982 | 145 |
| 743 | 3300005367 | Ga0070667_100006773 | Ga0070667_1000067732 | 145 |
| 744 | 3300005367 | Ga0070667_100445959 | Ga0070667_1004459592 | 145 |
| 745 | 3300005445 | Ga0070708_100205972 | Ga0070708_1002059723 | 145 |
| 746 | 3300005467 | Ga0070706_100926971 | Ga0070706_1009269711 | 145 |
| 747 | 3300005543 | Ga0070672_100117953 | Ga0070672_1001179534 | 145 |
| 748 | 3300005548 | Ga0070665_100244733 | Ga0070665_1002447332 | 145 |
| 749 | 3300005617 | Ga0068859_100577050 | Ga0068859_1005770503 | 145 |
| 750 | 3300005841 | Ga0068863_100119757 | Ga0068863_1001197573 | 145 |
| 751 | 3300005841 | Ga0068863_100539022 | Ga0068863_1005390221 | 145 |
| 752 | 3300006058 | Ga0075432_10059985 | Ga0075432_100599852 | 145 |
| 753 | 3300006195 | Ga0075366_10046561 | Ga0075366_100465614 | 145 |
| 754 | 3300006237 | Ga0097621_100311606 | Ga0097621_1003116062 | 145 |
| 755 | 3300006353 | Ga0075370_10000147 | Ga0075370_1000014721 | 145 |
| 756 | 3300006353 | Ga0075370_10000900 | Ga0075370_100009004 | 145 |
| 757 | 3300006358 | Ga0068871_101577400 | Ga0068871_1015774001 | 145 |
| 758 | 3300006931 | Ga0097620_100577108 | Ga0097620_1005771083 | 145 |
| 759 | 3300007076 | Ga0075435_100355911 | Ga0075435_1003559112 | 145 |
| 760 | 3300009545 | Ga0105237_10035515 | Ga0105237_100355155 | 145 |
| 761 | 3300013306 | Ga0163162_10076553 | Ga0163162_100765535 | 145 |
| 762 | 3300013308 | Ga0157375_10391485 | Ga0157375_103914852 | 145 |
| 763 | 3300014969 | Ga0157376_10246816 | Ga0157376_102468161 | 145 |
| 764 | 3300015683 | Ga0183362_10012 | Ga0183362_1001218 | 145 |
| 765 | 3300021361 | Ga0213872_10077022 | Ga0213872_100770223 | 145 |
| 766 | 3300025292 | Ga0209676_1000385 | Ga0209676_100038517 | 145 |
| 767 | 3300025292 | Ga0209676_1000873 | Ga0209676_100087312 | 145 |
| 768 | 3300025298 | Ga0209050_1001437 | Ga0209050_100143716 | 145 |
| 769 | 3300025303 | Ga0209051_1000137 | Ga0209051_100013732 | 145 |
| 770 | 3300025303 | Ga0209051_1000773 | Ga0209051_100077313 | 145 |
| 771 | 3300025304 | Ga0209257_1000205 | Ga0209257_100020535 | 145 |
| 772 | 3300025893 | Ga0207682_10034635 | Ga0207682_100346352 | 145 |
| 773 | 3300025914 | Ga0207671_10055406 | Ga0207671_100554063 | 145 |
| 774 | 3300025925 | Ga0207650_10074960 | Ga0207650_100749604 | 145 |
| 775 | 3300025933 | Ga0207706_11013236 | Ga0207706_110132361 | 145 |
| 776 | 3300025940 | Ga0207691_10274331 | Ga0207691_102743313 | 145 |
| 777 | 3300025941 | Ga0207711_10184568 | Ga0207711_101845682 | 145 |
| 778 | 3300025960 | Ga0207651_10306146 | Ga0207651_103061462 | 145 |
| 779 | 3300025986 | Ga0207658_10058095 | Ga0207658_100580955 | 145 |
| 780 | 3300025986 | Ga0207658_10068569 | Ga0207658_100685692 | 145 |
| 781 | 3300026023 | Ga0207677_11156568 | Ga0207677_111565681 | 145 |
| 782 | 3300026088 | Ga0207641_10073571 | Ga0207641_100735713 | 145 |
| 783 | 3300026088 | Ga0207641_10583461 | Ga0207641_105834611 | 145 |
| 784 | 3300026089 | Ga0207648_10594571 | Ga0207648_105945713 | 145 |
| 785 | 3300028379 | Ga0268266_10198180 | Ga0268266_101981802 | 145 |
| 786 | 3300031251 | Ga0265327_10007098 | Ga0265327_100070988 | 145 |
| 787 | 3300031507 | Ga0307509_10066421 | Ga0307509_100664213 | 145 |
| 788 | 3300031616 | Ga0307508_10030006 | Ga0307508_100300066 | 145 |
| 789 | 3300031649 | Ga0307514_10412800 | Ga0307514_104128001 | 145 |
| 790 | 3300035088 | Ga0373940_0179290 | Ga0373940_0179290_95_535 | 145 |
| 791 | 3300035691 | Ga0373931_0074308 | Ga0373931_0074308_1264_1704 | 145 |
| 792 | 3300037312 | Ga0395899_0251771 | Ga0395899_0251771_621_1058 | 145 |
| 793 | 3300037418 | Ga0395900_0652159 | Ga0395900_0652159_160_597 | 145 |
| 794 | 3300037466 | Ga0395898_0053933 | Ga0395898_0053933_2756_3193 | 145 |
| 795 | 3300037471 | Ga0395905_0014849 | Ga0395905_0014849_2712_3149 | 145 |
| 796 | 3300037471 | Ga0395905_0219153 | Ga0395905_0219153_498_935 | 145 |
| 797 | 3300038443 | Ga0395901_0008309 | Ga0395901_0008309_4712_5149 | 145 |
| 798 | 3300038443 | Ga0395901_0069418 | Ga0395901_0069418_2895_3332 | 145 |
| 799 | 3300038443 | Ga0395901_0612107 | Ga0395901_0612107_16_453 | 145 |
| 800 | 3300039447 | Ga0436361_0024448 | Ga0436361_0024448_1462_1917 | 145 |
| 801 | 3300041405 | Ga0439438_066525 | Ga0439438_066525_348_794 | 145 |
| 802 | 3300042876 | Ga0451577_0505451 | Ga0451577_0505451_466_909 | 145 |
| 803 | 3300045051 | Ga0451576_0112109 | Ga0451576_0112109_1412_1855 | 145 |
| 804 | 3300046454 | Ga0495592_0212945 | Ga0495592_0212945_338_775 | 145 |
| 805 | 3300046459 | Ga0495629_0383771 | Ga0495629_0383771_29_466 | 145 |
| 806 | 3300046463 | Ga0495653_0163918 | Ga0495653_0163918_336_773 | 145 |
| 807 | 3300046475 | Ga0495639_0462784 | Ga0495639_0462784_37_474 | 145 |
| 808 | 3300046506 | Ga0495583_0008409 | Ga0495583_0008409_3806_4243 | 145 |
| 809 | 3300046517 | Ga0495630_1072776 | Ga0495630_1072776_77_514 | 145 |
| 810 | 3300046528 | Ga0495642_0108036 | Ga0495642_0108036_645_1082 | 145 |
| 811 | 3300046539 | Ga0495621_0520555 | Ga0495621_0520555_39_476 | 145 |
| 812 | 3300046543 | Ga0495645_0156948 | Ga0495645_0156948_948_1385 | 145 |
| 813 | 3300046615 | Ga0495656_0320817 | Ga0495656_0320817_85_522 | 145 |
| 814 | 3300046674 | Ga0495588_0066110 | Ga0495588_0066110_1270_1707 | 145 |
| 815 | 3300046675 | Ga0495657_0043528 | Ga0495657_0043528_1880_2317 | 145 |
| 816 | 3300046683 | Ga0495658_0657267 | Ga0495658_0657267_17_454 | 145 |
| 817 | 3300046694 | Ga0495649_0082834 | Ga0495649_0082834_1053_1493 | 145 |
| 818 | 3300046810 | Ga0495660_0000002 | Ga0495660_0000002_488666_489103 | 145 |
| 819 | 3300047315 | Ga0495581_0090834 | Ga0495581_0090834_367_804 | 145 |
| 820 | 3300047318 | Ga0495636_0030650 | Ga0495636_0030650_819_1256 | 145 |
| 821 | 3300047673 | Ga0495593_0074616 | Ga0495593_0074616_754_1191 | 145 |
| 822 | 3300048903 | Ga0496100_0015583 | Ga0496100_0015583_2391_2828 | 145 |
| 823 | 3300048904 | Ga0496101_0001615 | Ga0496101_0001615_2557_2994 | 145 |
| 824 | 3300048905 | Ga0496102_0018151 | Ga0496102_0018151_1937_2374 | 145 |
| 825 | 3300048905 | Ga0496102_0044897 | Ga0496102_0044897_1970_2407 | 145 |
| 826 | 3300048907 | Ga0496104_0010765 | Ga0496104_0010765_5397_5834 | 145 |
| 827 | 3300048908 | Ga0496105_0004091 | Ga0496105_0004091_2680_3117 | 145 |
| 828 | 3300048908 | Ga0496105_0326975 | Ga0496105_0326975_110_547 | 145 |
| 829 | 3300048909 | Ga0496106_0220985 | Ga0496106_0220985_922_1359 | 145 |
| 830 | 3300048912 | Ga0496109_0209700 | Ga0496109_0209700_130_567 | 145 |
| 831 | 3300048913 | Ga0496110_0028927 | Ga0496110_0028927_3957_4394 | 145 |
| 832 | 3300048913 | Ga0496110_0030436 | Ga0496110_0030436_1133_1570 | 145 |
| 833 | 3300048914 | Ga0496111_0050665 | Ga0496111_0050665_350_787 | 145 |
| 834 | 3300048917 | Ga0496114_0068915 | Ga0496114_0068915_1139_1576 | 145 |
| 835 | 3300048926 | Ga0496123_0182359 | Ga0496123_0182359_234_671 | 145 |
| 836 | 3300048927 | Ga0496124_0468261 | Ga0496124_0468261_111_557 | 145 |
| 837 | 3300048928 | Ga0496125_0178907 | Ga0496125_0178907_200_637 | 145 |
| 838 | 3300050493 | nmdc:mga0k408_137519_c1 | nmdc:mga0k408_137519_c1_395_832 | 145 |
| 839 | 3300050493 | nmdc:mga0k408_256625_c1 | nmdc:mga0k408_256625_c1_558_995 | 145 |
| 840 | 3300050496 | nmdc:mga07m45_77352_c1 | nmdc:mga07m45_77352_c1_826_1263 | 145 |
| 841 | 3300050496 | nmdc:mga07m45_81077_c1 | nmdc:mga07m45_81077_c1_265_705 | 145 |
| 842 | 3300053093 | Ga0500651_0331495 | Ga0500651_0331495_46_483 | 145 |
| 843 | 3300053111 | Ga0500572_112146 | Ga0500572_112146_48_485 | 145 |
| 844 | 3300053122 | Ga0500608_002102 | Ga0500608_002102_474_911 | 145 |
| 845 | 3300053128 | Ga0500626_053059 | Ga0500626_053059_838_1275 | 145 |
| 846 | 3300053141 | Ga0500574_006190 | Ga0500574_006190_980_1417 | 145 |
| 847 | 3300002772 | JGI25164J39214_1016866 | JGI25164J39214_10168662 | 146 |
| 848 | 3300005333 | Ga0070677_10108813 | Ga0070677_101088131 | 146 |
| 849 | 3300005355 | Ga0070671_100013764 | Ga0070671_1000137648 | 146 |
| 850 | 3300009093 | Ga0105240_10125209 | Ga0105240_101252092 | 146 |
| 851 | 3300009094 | Ga0111539_10855462 | Ga0111539_108554622 | 146 |
| 852 | 3300009177 | Ga0105248_11941450 | Ga0105248_119414501 | 146 |
| 853 | 3300013297 | Ga0157378_10533140 | Ga0157378_105331402 | 146 |
| 854 | 3300014969 | Ga0157376_10092527 | Ga0157376_100925272 | 146 |
| 855 | 3300025231 | Ga0207427_104073 | Ga0207427_1040733 | 146 |
| 856 | 3300025295 | Ga0209564_1000170 | Ga0209564_1000170141 | 146 |
| 857 | 3300025893 | Ga0207682_10010692 | Ga0207682_100106923 | 146 |
| 858 | 3300025913 | Ga0207695_10026145 | Ga0207695_100261457 | 146 |
| 859 | 3300025931 | Ga0207644_10012204 | Ga0207644_100122046 | 146 |
| 860 | 3300037312 | Ga0395899_0021488 | Ga0395899_0021488_3119_3571 | 146 |
| 861 | 3300037418 | Ga0395900_0005097 | Ga0395900_0005097_7396_7848 | 146 |
| 862 | 3300037418 | Ga0395900_0120307 | Ga0395900_0120307_780_1229 | 146 |
| 863 | 3300037466 | Ga0395898_0127607 | Ga0395898_0127607_1306_1758 | 146 |
| 864 | 3300037471 | Ga0395905_0010128 | Ga0395905_0010128_6757_7209 | 146 |
| 865 | 3300037471 | Ga0395905_0541227 | Ga0395905_0541227_128_580 | 146 |
| 866 | 3300038443 | Ga0395901_0018729 | Ga0395901_0018729_1690_2139 | 146 |
| 867 | 3300038443 | Ga0395901_0021971 | Ga0395901_0021971_5066_5518 | 146 |
| 868 | 3300038443 | Ga0395901_0489180 | Ga0395901_0489180_378_830 | 146 |
| 869 | 3300042115 | Ga0450911_002991 | Ga0450911_002991_2027_2473 | 146 |
| 870 | 3300046519 | Ga0495632_0021184 | Ga0495632_0021184_2675_3118 | 146 |
| 871 | 3300046660 | Ga0495625_0325141 | Ga0495625_0325141_206_649 | 146 |
| 872 | 3300046692 | Ga0495671_0104577 | Ga0495671_0104577_762_1205 | 146 |
| 873 | 3300046694 | Ga0495649_0263824 | Ga0495649_0263824_24_467 | 146 |
| 874 | 3300046810 | Ga0495660_0021858 | Ga0495660_0021858_1624_2067 | 146 |
| 875 | 3300047443 | Ga0495687_010372 | Ga0495687_010372_876_1319 | 146 |
| 876 | 3300047443 | Ga0495687_064447 | Ga0495687_064447_173_616 | 146 |
| 877 | 3300048903 | Ga0496100_0050912 | Ga0496100_0050912_1474_1926 | 146 |
| 878 | 3300048911 | Ga0496108_0980217 | Ga0496108_0980217_23_475 | 146 |
| 879 | 3300048912 | Ga0496109_0103772 | Ga0496109_0103772_1810_2262 | 146 |
| 880 | 3300048913 | Ga0496110_0661357 | Ga0496110_0661357_450_902 | 146 |
| 881 | 3300048916 | Ga0496113_0004924 | Ga0496113_0004924_5076_5528 | 146 |
| 882 | 3300049741 | Ga0501079_0847189 | Ga0501079_0847189_48_491 | 146 |
| 883 | 3300053093 | Ga0500651_0127353 | Ga0500651_0127353_572_1015 | 146 |
| 884 | 3300053134 | Ga0500658_0088065 | Ga0500658_0088065_777_1220 | 146 |
| 885 | 3300005327 | Ga0070658_10017253 | Ga0070658_100172531 | 147 |
| 886 | 3300005843 | Ga0068860_100116600 | Ga0068860_1001166003 | 147 |
| 887 | 3300006931 | Ga0097620_100996988 | Ga0097620_1009969882 | 147 |
| 888 | 3300009553 | Ga0105249_12041242 | Ga0105249_120412421 | 147 |
| 889 | 3300025909 | Ga0207705_10155876 | Ga0207705_101558762 | 147 |
| 890 | 3300026088 | Ga0207641_10031684 | Ga0207641_100316844 | 147 |
| 891 | 3300046462 | Ga0495651_0009143 | Ga0495651_0009143_2893_3339 | 147 |
| 892 | 3300046514 | Ga0495618_0190118 | Ga0495618_0190118_37_495 | 147 |
| 893 | 3300046516 | Ga0495628_0000366 | Ga0495628_0000366_7812_8258 | 147 |
| 894 | 3300046529 | Ga0495652_0059282 | Ga0495652_0059282_2767_3213 | 147 |
| 895 | 3300046679 | Ga0495623_0210738 | Ga0495623_0210738_362_808 | 147 |
| 896 | 3300048088 | Ga0495602_0208414 | Ga0495602_0208414_903_1349 | 147 |
| 897 | 3300005335 | Ga0070666_10472188 | Ga0070666_104721881 | 148 |
| 898 | 3300005339 | Ga0070660_100653151 | Ga0070660_1006531512 | 148 |
| 899 | 3300005365 | Ga0070688_101135734 | Ga0070688_1011357341 | 148 |
| 900 | 3300005535 | Ga0070684_100962261 | Ga0070684_1009622611 | 148 |
| 901 | 3300005618 | Ga0068864_100175589 | Ga0068864_1001755894 | 148 |
| 902 | 3300005842 | Ga0068858_100058081 | Ga0068858_1000580815 | 148 |
| 903 | 3300006358 | Ga0068871_100041999 | Ga0068871_1000419992 | 148 |
| 904 | 3300006881 | Ga0068865_100260352 | Ga0068865_1002603522 | 148 |
| 905 | 3300009553 | Ga0105249_10260392 | Ga0105249_102603922 | 148 |
| 906 | 3300013102 | Ga0157371_10176109 | Ga0157371_101761092 | 148 |
| 907 | 3300013296 | Ga0157374_11935147 | Ga0157374_119351472 | 148 |
| 908 | 3300014745 | Ga0157377_10038437 | Ga0157377_100384374 | 148 |
| 909 | 3300014968 | Ga0157379_10025884 | Ga0157379_100258847 | 148 |
| 910 | 3300025903 | Ga0207680_11011117 | Ga0207680_110111171 | 148 |
| 911 | 3300025925 | Ga0207650_10063188 | Ga0207650_100631883 | 148 |
| 912 | 3300025931 | Ga0207644_10078583 | Ga0207644_100785834 | 148 |
| 913 | 3300025933 | Ga0207706_10165800 | Ga0207706_101658001 | 148 |
| 914 | 3300025938 | Ga0207704_10104922 | Ga0207704_101049222 | 148 |
| 915 | 3300025942 | Ga0207689_10061516 | Ga0207689_100615164 | 148 |
| 916 | 3300025960 | Ga0207651_10363965 | Ga0207651_103639652 | 148 |
| 917 | 3300025981 | Ga0207640_10502747 | Ga0207640_105027472 | 148 |
| 918 | 3300026035 | Ga0207703_11089976 | Ga0207703_110899762 | 148 |
| 919 | 3300026089 | Ga0207648_10104805 | Ga0207648_101048054 | 148 |
| 920 | 3300028379 | Ga0268266_10283930 | Ga0268266_102839302 | 148 |
| 921 | 3300028380 | Ga0268265_10608404 | Ga0268265_106084042 | 148 |
| 922 | 3300028794 | Ga0307515_10530262 | Ga0307515_105302622 | 148 |
| 923 | 3300031507 | Ga0307509_10001891 | Ga0307509_1000189132 | 148 |
| 924 | 3300031616 | Ga0307508_10000041 | Ga0307508_1000004186 | 148 |
| 925 | 3300033179 | Ga0307507_10006539 | Ga0307507_1000653917 | 148 |
| 926 | 3300033180 | Ga0307510_10000560 | Ga0307510_1000056027 | 148 |
| 927 | 3300035171 | Ga0373946_0604944 | Ga0373946_0604944_92_541 | 148 |
| 928 | 3300042876 | Ga0451577_0348540 | Ga0451577_0348540_555_1064 | 148 |
| 929 | 3300046524 | Ga0495648_0080484 | Ga0495648_0080484_1033_1482 | 148 |
| 930 | 3300046660 | Ga0495625_0146479 | Ga0495625_0146479_176_625 | 148 |
| 931 | 3300048088 | Ga0495602_0422606 | Ga0495602_0422606_51_512 | 148 |
| 932 | 3300048903 | Ga0496100_0270808 | Ga0496100_0270808_677_1126 | 148 |
| 933 | 3300048907 | Ga0496104_0755556 | Ga0496104_0755556_100_549 | 148 |
| 934 | 3300005435 | Ga0070714_101043241 | Ga0070714_1010432411 | 149 |
| 935 | 3300005436 | Ga0070713_100000264 | Ga0070713_1000002647 | 149 |
| 936 | 3300006175 | Ga0070712_100178463 | Ga0070712_1001784632 | 149 |
| 937 | 3300025915 | Ga0207693_10167371 | Ga0207693_101673712 | 149 |
| 938 | 3300025928 | Ga0207700_10000519 | Ga0207700_100005196 | 149 |
| 939 | 3300025929 | Ga0207664_10690511 | Ga0207664_106905112 | 149 |
| 940 | 3300037068 | Ga0373925_0358354 | Ga0373925_0358354_552_1007 | 149 |
| 941 | 3300048927 | Ga0496124_0002244 | Ga0496124_0002244_11772_12233 | 149 |
| 942 | 3300048928 | Ga0496125_0060473 | Ga0496125_0060473_2263_2724 | 149 |
| 943 | 3300048929 | Ga0496126_0674429 | Ga0496126_0674429_62_523 | 149 |
| 944 | 3300053077 | Ga0495601_0733413 | Ga0495601_0733413_108_560 | 149 |
| 945 | 3300053079 | Ga0500610_0395265 | Ga0500610_0395265_70_528 | 149 |
| 946 | 3300005331 | Ga0070670_100491248 | Ga0070670_1004912482 | 150 |
| 947 | 3300005364 | Ga0070673_100169779 | Ga0070673_1001697792 | 150 |
| 948 | 3300005617 | Ga0068859_100443722 | Ga0068859_1004437222 | 150 |
| 949 | 3300005842 | Ga0068858_101240558 | Ga0068858_1012405582 | 150 |
| 950 | 3300006931 | Ga0097620_100443742 | Ga0097620_1004437422 | 150 |
| 951 | 3300025937 | Ga0207669_10564349 | Ga0207669_105643492 | 150 |
| 952 | 3300025940 | Ga0207691_10500415 | Ga0207691_105004152 | 150 |
| 953 | 3300025960 | Ga0207651_10043654 | Ga0207651_100436542 | 150 |
| 954 | 3300046516 | Ga0495628_0144249 | Ga0495628_0144249_579_1049 | 150 |
| 955 | 3300046543 | Ga0495645_0157631 | Ga0495645_0157631_156_626 | 150 |
| 956 | 2162886012 | MBSR1b_contig_10772937 | MBSR1b_0197.00003000 | 151 |
| 957 | 3300005293 | Ga0065715_10290991 | Ga0065715_102909912 | 151 |
| 958 | 3300005328 | Ga0070676_10001033 | Ga0070676_1000103311 | 151 |
| 959 | 3300005331 | Ga0070670_100093258 | Ga0070670_1000932582 | 151 |
| 960 | 3300005333 | Ga0070677_10003807 | Ga0070677_100038074 | 151 |
| 961 | 3300005334 | Ga0068869_100007313 | Ga0068869_1000073138 | 151 |
| 962 | 3300005335 | Ga0070666_10002326 | Ga0070666_100023268 | 151 |
| 963 | 3300005335 | Ga0070666_10421891 | Ga0070666_104218912 | 151 |
| 964 | 3300005338 | Ga0068868_100020803 | Ga0068868_1000208033 | 151 |
| 965 | 3300005339 | Ga0070660_101436403 | Ga0070660_1014364031 | 151 |
| 966 | 3300005340 | Ga0070689_100033986 | Ga0070689_1000339862 | 151 |
| 967 | 3300005347 | Ga0070668_100027232 | Ga0070668_1000272322 | 151 |
| 968 | 3300005353 | Ga0070669_100006752 | Ga0070669_1000067525 | 151 |
| 969 | 3300005354 | Ga0070675_100001259 | Ga0070675_1000012594 | 151 |
| 970 | 3300005355 | Ga0070671_100102939 | Ga0070671_1001029394 | 151 |
| 971 | 3300005355 | Ga0070671_100192151 | Ga0070671_1001921513 | 151 |
| 972 | 3300005355 | Ga0070671_100203065 | Ga0070671_1002030652 | 151 |
| 973 | 3300005356 | Ga0070674_100016852 | Ga0070674_1000168525 | 151 |
| 974 | 3300005364 | Ga0070673_100084300 | Ga0070673_1000843003 | 151 |
| 975 | 3300005365 | Ga0070688_100013717 | Ga0070688_1000137172 | 151 |
| 976 | 3300005367 | Ga0070667_100002155 | Ga0070667_10000215513 | 151 |
| 977 | 3300005455 | Ga0070663_101217542 | Ga0070663_1012175422 | 151 |
| 978 | 3300005456 | Ga0070678_100001423 | Ga0070678_1000014238 | 151 |
| 979 | 3300005457 | Ga0070662_100087642 | Ga0070662_1000876421 | 151 |
| 980 | 3300005457 | Ga0070662_100730145 | Ga0070662_1007301452 | 151 |
| 981 | 3300005459 | Ga0068867_100002318 | Ga0068867_1000023186 | 151 |
| 982 | 3300005466 | Ga0070685_10036741 | Ga0070685_100367412 | 151 |
| 983 | 3300005539 | Ga0068853_100076209 | Ga0068853_1000762094 | 151 |
| 984 | 3300005539 | Ga0068853_100272569 | Ga0068853_1002725693 | 151 |
| 985 | 3300005543 | Ga0070672_100001588 | Ga0070672_10000158816 | 151 |
| 986 | 3300005548 | Ga0070665_100005741 | Ga0070665_10000574110 | 151 |
| 987 | 3300005616 | Ga0068852_100832953 | Ga0068852_1008329531 | 151 |
| 988 | 3300005617 | Ga0068859_100074764 | Ga0068859_1000747642 | 151 |
| 989 | 3300005618 | Ga0068864_100002258 | Ga0068864_10000225816 | 151 |
| 990 | 3300005718 | Ga0068866_10063013 | Ga0068866_100630132 | 151 |
| 991 | 3300005719 | Ga0068861_100035407 | Ga0068861_1000354072 | 151 |
| 992 | 3300005834 | Ga0068851_10178112 | Ga0068851_101781122 | 151 |
| 993 | 3300005841 | Ga0068863_100032861 | Ga0068863_1000328613 | 151 |
| 994 | 3300005842 | Ga0068858_100002532 | Ga0068858_1000025322 | 151 |
| 995 | 3300005843 | Ga0068860_100004123 | Ga0068860_1000041232 | 151 |
| 996 | 3300005844 | Ga0068862_100035495 | Ga0068862_1000354955 | 151 |
| 997 | 3300006237 | Ga0097621_100001145 | Ga0097621_10000114517 | 151 |
| 998 | 3300006358 | Ga0068871_100009980 | Ga0068871_1000099805 | 151 |
| 999 | 3300006881 | Ga0068865_100005004 | Ga0068865_1000050048 | 151 |
| 1000 | 3300006931 | Ga0097620_100074767 | Ga0097620_1000747676 | 151 |
| 1001 | 3300009148 | Ga0105243_10913420 | Ga0105243_109134202 | 151 |
| 1002 | 3300009177 | Ga0105248_10018960 | Ga0105248_100189602 | 151 |
| 1003 | 3300013296 | Ga0157374_10001025 | Ga0157374_1000102523 | 151 |
| 1004 | 3300013297 | Ga0157378_10241003 | Ga0157378_102410032 | 151 |
| 1005 | 3300013306 | Ga0163162_10007526 | Ga0163162_100075266 | 151 |
| 1006 | 3300013308 | Ga0157375_10013201 | Ga0157375_100132018 | 151 |
| 1007 | 3300014968 | Ga0157379_10043701 | Ga0157379_100437013 | 151 |
| 1008 | 3300014969 | Ga0157376_10093359 | Ga0157376_100933593 | 151 |
| 1009 | 3300017792 | Ga0163161_10307694 | Ga0163161_103076943 | 151 |
| 1010 | 3300025315 | Ga0207697_10003125 | Ga0207697_100031258 | 151 |
| 1011 | 3300025893 | Ga0207682_10022645 | Ga0207682_100226455 | 151 |
| 1012 | 3300025907 | Ga0207645_10000282 | Ga0207645_100002825 | 151 |
| 1013 | 3300025923 | Ga0207681_10025353 | Ga0207681_100253532 | 151 |
| 1014 | 3300025925 | Ga0207650_10033243 | Ga0207650_100332435 | 151 |
| 1015 | 3300025926 | Ga0207659_10001500 | Ga0207659_100015009 | 151 |
| 1016 | 3300025931 | Ga0207644_10790913 | Ga0207644_107909132 | 151 |
| 1017 | 3300025935 | Ga0207709_10748401 | Ga0207709_107484012 | 151 |
| 1018 | 3300025936 | Ga0207670_10267459 | Ga0207670_102674592 | 151 |
| 1019 | 3300025937 | Ga0207669_10198054 | Ga0207669_101980542 | 151 |
| 1020 | 3300025938 | Ga0207704_10020880 | Ga0207704_100208802 | 151 |
| 1021 | 3300025940 | Ga0207691_10000577 | Ga0207691_1000057721 | 151 |
| 1022 | 3300025941 | Ga0207711_10469698 | Ga0207711_104696983 | 151 |
| 1023 | 3300025942 | Ga0207689_10001993 | Ga0207689_1000199318 | 151 |
| 1024 | 3300025960 | Ga0207651_10005847 | Ga0207651_100058472 | 151 |
| 1025 | 3300025972 | Ga0207668_10019869 | Ga0207668_100198692 | 151 |
| 1026 | 3300025972 | Ga0207668_10154940 | Ga0207668_101549402 | 151 |
| 1027 | 3300025986 | Ga0207658_10038490 | Ga0207658_100384906 | 151 |
| 1028 | 3300026023 | Ga0207677_10033260 | Ga0207677_100332606 | 151 |
| 1029 | 3300026035 | Ga0207703_10128672 | Ga0207703_101286722 | 151 |
| 1030 | 3300026041 | Ga0207639_10065074 | Ga0207639_100650742 | 151 |
| 1031 | 3300026089 | Ga0207648_10003294 | Ga0207648_1000329414 | 151 |
| 1032 | 3300026095 | Ga0207676_10071275 | Ga0207676_100712752 | 151 |
| 1033 | 3300026118 | Ga0207675_100015675 | Ga0207675_1000156754 | 151 |
| 1034 | 3300026121 | Ga0207683_10001960 | Ga0207683_1000196015 | 151 |
| 1035 | 3300026142 | Ga0207698_10103150 | Ga0207698_101031502 | 151 |
| 1036 | 3300028380 | Ga0268265_10067661 | Ga0268265_100676613 | 151 |
| 1037 | 3300028381 | Ga0268264_10016184 | Ga0268264_100161846 | 151 |
| 1038 | 3300048904 | Ga0496101_0455191 | Ga0496101_0455191_358_813 | 151 |
| 1039 | 3300048911 | Ga0496108_0174541 | Ga0496108_0174541_1381_1836 | 151 |
| 1040 | 3300048912 | Ga0496109_0046266 | Ga0496109_0046266_2322_2777 | 151 |
| 1041 | 3300048913 | Ga0496110_0583870 | Ga0496110_0583870_286_741 | 151 |
| 1042 | 3300048917 | Ga0496114_0087137 | Ga0496114_0087137_1459_1914 | 151 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MMI0_226_612_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2116 | 8 | 100 | 1.20.1250.20 |
| af_I1MMI0_226_612_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.1616 | 8 | 100 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1T2Y7J5-F1-model_v4 | deleted | 0.937 | 1 | 138 |
|
| AF-A0A7W2PSA4-F1-model_v4 | YeeE/YedE family protein | 0.9338 | 1 | 137 |
GO:0016020
|
| AF-A0A441UP52-F1-model_v4 | YeeE/YedE family protein | 0.9297 | 1 | 107 |
GO:0016020
|
| AF-D7DKH1-F1-model_v4 | Uncharacterized protein | 0.9287 | 3 | 135 |
GO:0016020
|
| AF-A0A370SG02-F1-model_v4 | YeeE/YedE family protein | 0.928 | 1 | 138 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar