F488830

General Info

Members Datasets Scaffolds Average Seq Length
1041 534 868 462

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1000334|JGI25159J45721_10003346
Length 518
Sequence MAFRARDAPVSAECMSWRDTPRTASARQERKPAPEGPEYPCADNRCMSIPSKTPAPGAANTDFASLSLNPAMLANLQQLGYLSMTPIQAASLPVALLGKDLIAQAKTGSGKTAAFAIPLLANLNPRRFAVQAMVLCPTRELADQVTTEIRRLARAEENIKVVTLCGGVALRGQTASLEHGAHIVVGTPGRIMDHLERGNLNLEALNTLVLDEADRMLDMGFFDDIATVAKQCPKERQTLLFSATYPEGIAKLSQQFMKAPQTITVQAQHEKSKIRQRWYEVKDSERLHAVSLVLNHYRPASTLAFCNTKVQCRDLVAVLRAQGFSALALYGELEQRERDQVLVQFANRSCSVLVATDVAARGLDISQLEMVINVDVTPDPEVHIHRIGRTGRADEEGWAISLASMDEMGSVGKIEQLQKTESDWHKVAELTAASKEPLQPPMATLQIVGGRKEKIRAGDVLGALTGEAGFTREQVGKINVNEFSTYVAVDRRIANEALHKLSTGRVKGKSVKVRLLED

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
10 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
11 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
12 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
13 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
14 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
15 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
16 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
17 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
18 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
19 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
20 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
21 2519103095 Burkholderia sp. KJ006 Isolate Nodule
22 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
23 2547132374 Acidovorax radicis N35 Isolate Unclassified
24 2547132512 Azospira oryzae 6a3 Isolate Unclassified
25 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
26 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
27 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
28 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
29 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
30 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
31 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
32 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
33 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
34 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
35 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
36 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
37 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
38 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
39 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
40 2643221569 Achromobacter sp. Root565 Isolate Unclassified
41 2643221570 Acidovorax sp. Root568 Isolate Unclassified
42 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
43 2643221594 Achromobacter sp. Root170 Isolate Unclassified
44 2643221596 Acidovorax sp. Root70 Isolate Unclassified
45 2643221609 Acidovorax sp. Root217 Isolate Unclassified
46 2643221611 Acidovorax sp. Root219 Isolate Unclassified
47 2643221621 Achromobacter sp. Root83 Isolate Unclassified
48 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
49 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
50 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
51 2643221652 Acidovorax sp. Root402 Isolate Unclassified
52 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
53 2643221658 Variovorax sp. Root411 Isolate Unclassified
54 2643221660 Methylibium sp. Root1272 Isolate Unclassified
55 2643221672 Variovorax sp. Root434 Isolate Unclassified
56 2643221683 Variovorax sp. Root473 Isolate Unclassified
57 2643221717 Acidovorax sp. Root267 Isolate Unclassified
58 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
59 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
60 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
61 2721755523 Delftia sp. HK171 Isolate Unclassified
62 2738541277 Variovorax sp. GV051 Isolate Unclassified
63 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
64 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
65 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
66 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
67 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
68 2738543012 Acidovorax sp. CF301 Isolate Unclassified
69 2738543013 Variovorax sp. BT01 Isolate Unclassified
70 2738543019 Variovorax sp. GV040 Isolate Unclassified
71 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
72 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
73 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
74 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
75 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
76 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
77 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
78 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
79 2816332133 Acidovorax radicis 2721A Isolate Unclassified
80 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
81 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
82 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
83 2818991446 Variovorax sp. 1180 Isolate Unclassified
84 2818991450 Burkholderia sp. 604 Isolate Unclassified
85 2818991452 Burkholderia cepacia 561 Isolate Unclassified
86 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
87 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
88 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
89 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
90 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
91 2842677519 Variovorax sp. R-72495 Isolate Unclassified
92 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
93 2842733646 Variovorax sp. R-72446 Isolate Unclassified
94 2842747753 Variovorax sp. R-72060 Isolate Unclassified
95 2855730933 Achromobacter sp. HZ28 Isolate Nodule
96 2855767633 Achromobacter sp. HZ34 Isolate Nodule
97 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
98 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
99 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
100 2858950400 Achromobacter sp. K91 Isolate Unclassified
101 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
102 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
103 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
104 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
105 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
106 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
107 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
108 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
109 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
110 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
111 2885198086 Variovorax sp. 679 Isolate Unclassified
112 2885211737 Variovorax sp. 553 Isolate Unclassified
113 2885266251 Ralstonia sp. SET104 Isolate Nodule
114 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
115 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
116 2899924645 Variovorax sp. 369 Isolate Unclassified
117 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
118 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
119 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
120 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
121 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
122 2904456579 Variovorax sp. 2002 Isolate Unclassified
123 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
124 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
125 2904564687 Burkholderia sp. 571 Isolate Unclassified
126 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
127 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
128 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
129 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
130 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
131 2928037797 Variovorax sp. 1126 Isolate Unclassified
132 2928044640 Variovorax sp. 1128 Isolate Unclassified
133 2928051484 Variovorax sp. 1133 Isolate Unclassified
134 2928058823 Ralstonia sp. 1138 Isolate Unclassified
135 2928070936 Variovorax gossypii 1167 Isolate Unclassified
136 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
137 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
138 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
139 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
140 2928163908 Burkholderia sp. 567 Isolate Unclassified
141 2928170801 Burkholderia sp. 572 Isolate Unclassified
142 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
143 2928536128 Burkholderia sola 565 Isolate Unclassified
144 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
145 2929520902 Variovorax beijingensis 502 Isolate Unclassified
146 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
147 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
148 2941479691
149 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
150 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
151 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
152 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
153 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
154 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
155 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
156 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
157 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
158 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
159 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
160 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
161 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
162 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
163 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
164 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
165 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
166 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
167 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
168 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
169 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
170 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
171 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
172 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
173 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
174 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
175 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
176 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
177 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
178 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
179 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
180 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
181 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
182 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
183 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
184 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
185 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
186 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
187 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
188 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
189 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
190 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
191 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
192 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
193 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
194 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
195 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
196 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
197 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
198 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
199 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
200 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
201 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
202 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
203 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
204 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
205 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
206 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
207 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
208 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
209 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
210 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
211 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
212 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
213 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
214 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
215 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
216 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
217 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
218 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
219 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
220 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
221 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
222 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
223 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
224 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
225 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
226 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
227 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
228 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
229 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
230 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
231 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
232 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
233 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
234 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
235 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
236 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
237 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
238 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
239 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
240 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
241 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
242 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
243 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
244 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
245 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
246 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
247 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
248 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
249 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
250 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
251 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
252 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
253 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
254 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
255 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
256 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
257 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
258 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
259 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
260 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
261 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
262 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
263 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
264 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
265 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
266 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
267 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
268 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
276 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
277 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
278 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
281 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
282 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
283 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
284 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
286 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
287 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
288 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
290 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
291 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
292 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
294 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
295 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
329 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
330 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
331 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
332 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
333 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
336 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
337 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
338 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
339 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
340 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
341 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
342 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
343 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
344 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
345 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
346 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
347 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
348 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
349 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
350 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
351 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
352 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
353 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
354 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
355 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
356 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
357 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
358 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
359 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
360 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
361 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
362 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
363 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
364 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
365 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
366 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
367 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
368 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
369 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
370 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
371 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
372 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
373 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
374 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
375 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
376 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
377 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
378 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
379 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
380 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
381 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
382 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
383 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
384 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
385 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
386 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
387 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
388 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
389 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
390 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
391 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
392 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
393 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
394 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
395 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
396 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
397 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
398 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
399 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
400 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
401 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
402 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
403 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
404 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
405 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
406 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
407 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
408 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
409 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
410 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
411 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
412 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
413 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
414 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
415 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
416 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
417 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
418 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
419 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
420 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
421 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
422 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
423 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
424 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
425 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
426 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
427 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
428 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
429 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
430 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
431 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
432 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
433 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
434 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
435 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
436 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
437 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
438 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
439 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
440 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
441 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
442 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
443 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
444 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
445 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
446 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
447 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
448 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
449 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
450 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
451 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
452 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
453 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
454 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
455 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
456 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
457 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
458 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
459 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
460 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
461 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
462 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
463 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
464 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
465 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
466 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
467 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
468 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
469 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
470 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
471 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
472 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
473 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
474 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
475 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
476 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
477 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
478 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
479 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
480 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
481 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
482 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
483 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
484 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
485 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
486 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
487 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
488 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
489 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
490 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
491 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
492 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
493 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
494 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
495 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
496 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
497 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
499 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
500 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
501 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
502 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
503 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
504 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
505 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
506 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
507 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
508 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
509 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
510 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
511 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
512 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
513 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
514 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
515 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
516 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
517 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
518 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
519 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
520 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
521 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
522 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
523 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
524 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
525 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
526 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
527 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
528 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
529 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
530 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
531 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
532 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
533 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
534 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.8
Metatranscriptomes 0.58
Isolates 16.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.67
Nodule 3.07
Rhizoplane 3.27
Rhizosphere 53.03
Stem 0
Stem Tuber 0
Unclassified 17.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002402 3300001904 Bacteria 3304
2 JGI24740J21852_10000036 3300001979 Bacteria 44619
3 JGI24740J21852_10000047 3300001979 Bacteria 39298
4 JGI24740J21852_10002551 3300001979 Bacteria 8213
5 JGI24740J21852_10013384 3300001979 Bacteria 3061
6 JGI24740J21852_10013997 3300001979 Bacteria 2972
7 JGI24739J22299_10000410 3300001989 Bacteria 14789
8 JGI24737J22298_10010218 3300001990 Bacteria 3103
9 JGI24735J21928_10000217 3300002067 Bacteria 20187
10 JGI24735J21928_10000289 3300002067 Bacteria 17537
11 JGI24735J21928_10004692 3300002067 Bacteria 4567
12 JGI24738J21930_10005003 3300002075 Bacteria 3206
13 JGI25155J39150_1000028 3300002704 Bacteria 120158
14 JGI25155J39150_1000677 3300002704 Bacteria 6462
15 JGI25156J39149_1000013 3300002705 Bacteria 189553
16 JGI25156J39149_1000219 3300002705 Bacteria 39858
17 JGI25156J39149_1000455 3300002705 Bacteria 24934
18 JGI25156J39149_1002526 3300002705 Bacteria 6514
19 JGI25156J39149_1003946 3300002705 Bacteria 4689
20 JGI25154J39366_1000032 3300002738 Bacteria 189265
21 JGI25154J39366_1001220 3300002738 Bacteria 9721
22 JGI25154J39366_1002379 3300002738 Bacteria 4941
23 JGI25157J39369_1000017 3300002741 Bacteria 189553
24 JGI25152J39213_1006998 3300002773 Bacteria 2972
25 JGI25159J45721_1000334 3300002987 Bacteria 21726
26 JGI25151J46595_10001147 3300003187 Bacteria 19200
27 JGI25151J46595_10001862 3300003187 Bacteria 13516
28 JGI25151J46595_10003195 3300003187 Bacteria 9177
29 JGI25151J46595_10003969 3300003187 Bacteria 7958
30 JGI25151J46595_10006981 3300003187 Bacteria 5592
31 JGI25165J46597_1001256 3300003214 Bacteria 14945
32 JGI25153J46596_10001180 3300003215 Bacteria 15796
33 rootH2_10011155 3300003320 Bacteria 2655
34 JGI25160J50197_1000016 3300003354 Bacteria 247819
35 JGI25160J50197_1000303 3300003354 Bacteria 34764
36 JGI25161J50226_1000094 3300003374 Bacteria 72451
37 Ga0006562J51391_1059273 3300003578 Bacteria 12330
38 Ga0006562J51391_1059275 3300003578 Bacteria 9120
39 Ga0055539_1000203 3300003752 Bacteria 46893
40 Ga0055533_1000204 3300003756 Bacteria 46854
41 Ga0055533_1001300 3300003756 Bacteria 6784
42 Ga0055533_1002168 3300003756 Bacteria 4681
43 Ga0055532_1000022 3300003758 Bacteria 248737
44 Ga0055532_1000037 3300003758 Bacteria 205054
45 Ga0055532_1000630 3300003758 Bacteria 13768
46 Ga0055532_1000666 3300003758 Bacteria 13052
47 Ga0055532_1003080 3300003758 Bacteria 3048
48 Ga0055525_1000453 3300003759 Bacteria 23530
49 Ga0055527_1000016 3300003760 Bacteria 248736
50 Ga0055527_1000220 3300003760 Bacteria 37160
51 Ga0055527_1001376 3300003760 Bacteria 5189
52 Ga0055535_1000017 3300003761 Bacteria 248735
53 Ga0055535_1000018 3300003761 Bacteria 243804
54 Ga0055535_1000185 3300003761 Bacteria 66514
55 Ga0055535_1000465 3300003761 Bacteria 37160
56 Ga0055535_1000739 3300003761 Bacteria 24478
57 Ga0055542_1000003 3300003762 Bacteria 582721
58 Ga0055542_1000030 3300003762 Bacteria 248717
59 Ga0055542_1000759 3300003762 Bacteria 24523
60 Ga0055542_1001377 3300003762 Bacteria 12348
61 Ga0055542_1001919 3300003762 Bacteria 8193
62 Ga0055529_1000033 3300003763 Bacteria 248734
63 Ga0055529_1000041 3300003763 Bacteria 226495
64 Ga0055529_1000115 3300003763 Bacteria 118392
65 Ga0055529_1002814 3300003763 Bacteria 3146
66 Ga0055529_1003887 3300003763 Bacteria 2366
67 Ga0055526_1000434 3300003771 Bacteria 33544
68 Ga0055526_1000451 3300003771 Bacteria 32769
69 Ga0055526_1000854 3300003771 Bacteria 22695
70 Ga0055526_1005727 3300003771 Bacteria 7021
71 Ga0055526_1006685 3300003771 Bacteria 6185
72 Ga0055537_1000557 3300003773 Bacteria 21127
73 Ga0055537_1000960 3300003773 Bacteria 13191
74 Ga0055537_1004858 3300003773 Bacteria 3728
75 Ga0055524_1000157 3300003775 Bacteria 79002
76 Ga0055524_1000220 3300003775 Bacteria 60522
77 Ga0055524_1000306 3300003775 Bacteria 46611
78 Ga0055524_1022480 3300003775 Bacteria 2059
79 Ga0055536_1000195 3300003781 Bacteria 49966
80 Ga0055534_1000567 3300003784 Bacteria 19415
81 Ga0055534_1002972 3300003784 Bacteria 5597
82 Ga0055528_1000480 3300003790 Bacteria 31747
83 Ga0055528_1000993 3300003790 Bacteria 18842
84 Ga0055530_10000780 3300003791 Bacteria 26542
85 Ga0055540_1000449 3300003792 Bacteria 32166
86 Ga0055540_1005291 3300003792 Bacteria 5489
87 Ga0055531_10002019 3300003794 Bacteria 14056
88 Ga0055531_10002654 3300003794 Bacteria 11796
89 Ga0055531_10003358 3300003794 Bacteria 10232
90 Ga0055541_1000264 3300003841 Bacteria 18463
91 Ga0058692_1002447 3300003856 Bacteria 6221
92 Ga0055543_1000814 3300004625 Bacteria 15326
93 Ga0055543_1005219 3300004625 Bacteria 3359
94 Ga0055543_1011113 3300004625 Bacteria 1857
95 Ga0065165_1000154 3300005262 Bacteria 119863
96 Ga0065165_1002614 3300005262 Bacteria 14715
97 Ga0065165_1003847 3300005262 Bacteria 9983
98 Ga0065165_1011569 3300005262 Bacteria 3661
99 Ga0070658_10013898 3300005327 Bacteria 6462
100 Ga0070658_10164391 3300005327 Bacteria 1863
101 Ga0070676_10003078 3300005328 Bacteria 8614
102 Ga0070690_100008031 3300005330 Bacteria 6059
103 Ga0070670_100016113 3300005331 Bacteria 6415
104 Ga0070666_10018556 3300005335 Bacteria 4476
105 Ga0068868_100015331 3300005338 Bacteria 5666
106 Ga0070660_100000020 3300005339 Bacteria 98286
107 Ga0070660_100143284 3300005339 Bacteria 1918
108 Ga0070661_100000131 3300005344 Bacteria 62870
109 Ga0070675_100018801 3300005354 Bacteria 5500
110 Ga0070671_100017996 3300005355 Bacteria 5734
111 Ga0070674_100053208 3300005356 Bacteria 2794
112 Ga0070673_100005052 3300005364 Bacteria 8415
113 Ga0070673_100020752 3300005364 Bacteria 4744
114 Ga0070659_100000047 3300005366 Bacteria 98286
115 Ga0070659_100004673 3300005366 Bacteria 9775
116 Ga0070667_100000872 3300005367 Bacteria 27983
117 Ga0070667_100002289 3300005367 Bacteria 16856
118 Ga0070667_100008659 3300005367 Bacteria 8430
119 Ga0070667_100025187 3300005367 Bacteria 4945
120 Ga0070663_100000018 3300005455 Bacteria 115228
121 Ga0070663_100000151 3300005455 Bacteria 34179
122 Ga0070663_100002714 3300005455 Bacteria 10015
123 Ga0068867_100004043 3300005459 Bacteria 10319
124 Ga0068853_100077956 3300005539 Bacteria 2895
125 Ga0070672_100008667 3300005543 Bacteria 6972
126 Ga0070672_100046580 3300005543 Bacteria 3360
127 Ga0070665_100116011 3300005548 Bacteria 2680
128 Ga0068855_100007372 3300005563 Bacteria 13319
129 Ga0068855_100062109 3300005563 Bacteria 4363
130 Ga0068855_100083905 3300005563 Bacteria 3690
131 Ga0070664_100000040 3300005564 Bacteria 78303
132 Ga0068857_100052799 3300005577 Bacteria 3605
133 Ga0068854_100000050 3300005578 Bacteria 87277
134 Ga0068856_100000115 3300005614 Bacteria 79608
135 Ga0068852_100105043 3300005616 Bacteria 2558
136 Ga0068862_100228863 3300005844 Bacteria 1686
137 Ga0075365_10041768 3300006038 Bacteria 2997
138 Ga0075363_100057489 3300006048 Bacteria 2088
139 Ga0075432_10008080 3300006058 Bacteria 3590
140 Ga0075362_10017330 3300006177 Bacteria 2966
141 Ga0075367_10018282 3300006178 Bacteria 3865
142 Ga0075366_10001317 3300006195 Bacteria 12388
143 Ga0075366_10025660 3300006195 Bacteria 3445
144 Ga0075370_10053416 3300006353 Bacteria 2293
145 Ga0075430_100097066 3300006846 Bacteria 2463
146 Ga0068865_100027745 3300006881 Bacteria 3743
147 Ga0099823_1000021 3300006944 Bacteria 76133
148 Ga0079104_1000026 3300006946 Bacteria 216566
149 Ga0099826_10000007 3300006948 Bacteria 393518
150 Ga0105251_10000211 3300009011 Bacteria 59154
151 Ga0105251_10001269 3300009011 Bacteria 21840
152 Ga0105244_10063374 3300009036 Bacteria 1856
153 Ga0105240_10014985 3300009093 Bacteria 10561
154 Ga0105240_10112665 3300009093 Bacteria 3288
155 Ga0105243_10016453 3300009148 Bacteria 5592
156 Ga0105243_10097804 3300009148 Bacteria 2430
157 Ga0105242_10000557 3300009176 Bacteria 29513
158 Ga0105242_10152684 3300009176 Bacteria 2015
159 Ga0105248_10015163 3300009177 Bacteria 8491
160 Ga0105248_10074259 3300009177 Bacteria 3822
161 Ga0105248_10312744 3300009177 Bacteria 1769
162 Ga0105237_10054967 3300009545 Bacteria 3988
163 Ga0105237_10109363 3300009545 Bacteria 2756
164 Ga0105238_10028412 3300009551 Bacteria 5698
165 Ga0105239_10001422 3300010375 Bacteria 31955
166 Ga0105246_10023999 3300011119 Bacteria 3954
167 Ga0157319_1000005 3300012497 Bacteria 372810
168 Ga0157373_10001431 3300013100 Bacteria 18205
169 Ga0157373_10031577 3300013100 Bacteria 3812
170 Ga0157370_10000558 3300013104 Bacteria 46503
171 Ga0157370_10000852 3300013104 Bacteria 38700
172 Ga0157370_10001866 3300013104 Bacteria 25990
173 Ga0157369_10001453 3300013105 Bacteria 29072
174 Ga0157369_10007420 3300013105 Bacteria 12626
175 Ga0157369_10018204 3300013105 Bacteria 7878
176 Ga0157369_10049046 3300013105 Bacteria 4579
177 Ga0157374_10000155 3300013296 Bacteria 63063
178 Ga0163162_10003869 3300013306 Bacteria 14366
179 Ga0163162_10080651 3300013306 Bacteria 3323
180 Ga0157372_10000637 3300013307 Bacteria 38480
181 Ga0157372_10242132 3300013307 Bacteria 2093
182 Ga0157375_10010111 3300013308 Bacteria 8296
183 Ga0157375_10051063 3300013308 Bacteria 4059
184 Ga0157375_10129342 3300013308 Bacteria 2643
185 Ga0182008_10012611 3300014497 Bacteria 4459
186 Ga0157376_10000626 3300014969 Bacteria 22915
187 Ga0182006_1001960 3300015261 Bacteria 11667
188 Ga0182006_1007161 3300015261 Bacteria 5128
189 Ga0182007_10001922 3300015262 Bacteria 10775
190 Ga0182007_10005226 3300015262 Bacteria 5737
191 Ga0182005_1005667 3300015265 Bacteria 3885
192 Ga0183362_10004 3300015683 Bacteria 569303
193 Ga0183361_10001 3300016635 Bacteria 908583
194 Ga0163161_10093203 3300017792 Bacteria 2231
195 Ga0206351_10909753 3300020077 Bacteria 2237
196 Ga0206353_10214114 3300020082 Bacteria 4507
197 Ga0213872_10000055 3300021361 Bacteria 101489
198 Ga0213872_10000124 3300021361 Bacteria 72197
199 Ga0213872_10002121 3300021361 Bacteria 11927
200 Ga0213872_10020295 3300021361 Bacteria 3062
201 Ga0224712_10000078 3300022467 Bacteria 15198
202 Ga0209435_100003 3300025206 Bacteria 669534
203 Ga0209435_100153 3300025206 Bacteria 22460
204 Ga0209436_108826 3300025208 Bacteria 1970
205 Ga0209784_100434 3300025224 Bacteria 18227
206 Ga0209784_100450 3300025224 Bacteria 17514
207 Ga0209566_100136 3300025225 Bacteria 90096
208 Ga0209566_100329 3300025225 Bacteria 42615
209 Ga0209674_100017 3300025226 Bacteria 689087
210 Ga0209674_100081 3300025226 Bacteria 201146
211 Ga0209674_100089 3300025226 Bacteria 178751
212 Ga0209674_100211 3300025226 Bacteria 58106
213 Ga0209674_100238 3300025226 Bacteria 46947
214 Ga0209674_102156 3300025226 Bacteria 4430
215 Ga0209674_102342 3300025226 Bacteria 4142
216 Ga0209672_100001 3300025228 Bacteria 2828210
217 Ga0209672_100012 3300025228 Bacteria 795742
218 Ga0209672_100086 3300025228 Bacteria 128901
219 Ga0209672_100429 3300025228 Bacteria 24360
220 Ga0209672_100708 3300025228 Bacteria 16597
221 Ga0209672_102247 3300025228 Bacteria 4976
222 Ga0209147_100005 3300025229 Bacteria 1036530
223 Ga0209147_100007 3300025229 Bacteria 795684
224 Ga0209147_100022 3300025229 Bacteria 443906
225 Ga0209147_100064 3300025229 Bacteria 234181
226 Ga0209147_100174 3300025229 Bacteria 82828
227 Ga0209147_101724 3300025229 Bacteria 7082
228 Ga0209563_100170 3300025230 Bacteria 46947
229 Ga0209563_101684 3300025230 Bacteria 5604
230 Ga0209563_103374 3300025230 Bacteria 3322
231 Ga0209258_100007 3300025242 Bacteria 1036530
232 Ga0209258_100014 3300025242 Bacteria 720132
233 Ga0209258_100015 3300025242 Bacteria 706310
234 Ga0209258_100033 3300025242 Bacteria 443845
235 Ga0209258_100114 3300025242 Bacteria 191036
236 Ga0209258_100341 3300025242 Bacteria 68437
237 Ga0207425_1000582 3300025245 Bacteria 21337
238 Ga0207425_1001460 3300025245 Bacteria 9874
239 Ga0207425_1002114 3300025245 Bacteria 7314
240 Ga0209646_1000008 3300025246 Bacteria 669534
241 Ga0209646_1000021 3300025246 Bacteria 461083
242 Ga0209646_1000065 3300025246 Bacteria 245452
243 Ga0209026_1000007 3300025250 Bacteria 669534
244 Ga0209026_1001840 3300025250 Bacteria 8689
245 Ga0209026_1003235 3300025250 Bacteria 5486
246 Ga0209677_100206 3300025253 Bacteria 46947
247 Ga0209677_104243 3300025253 Bacteria 4227
248 Ga0209148_1000028 3300025254 Bacteria 582773
249 Ga0209148_1000046 3300025254 Bacteria 443881
250 Ga0209148_1000113 3300025254 Bacteria 195646
251 Ga0209148_1000115 3300025254 Bacteria 191036
252 Ga0209148_1000337 3300025254 Bacteria 63295
253 Ga0209759_1000026 3300025256 Bacteria 311743
254 Ga0209759_1000100 3300025256 Bacteria 156294
255 Ga0209759_1000331 3300025256 Bacteria 62167
256 Ga0209759_1000366 3300025256 Bacteria 56702
257 Ga0209759_1001291 3300025256 Bacteria 14906
258 Ga0209759_1001403 3300025256 Bacteria 13795
259 Ga0209759_1003003 3300025256 Bacteria 6987
260 Ga0209759_1003786 3300025256 Bacteria 5893
261 Ga0209759_1009553 3300025256 Bacteria 2923
262 Ga0209759_1017330 3300025256 Bacteria 1780
263 Ga0209129_1002293 3300025258 Bacteria 9525
264 Ga0209129_1002553 3300025258 Bacteria 8798
265 Ga0209233_1000050 3300025261 Bacteria 450736
266 Ga0209565_1000026 3300025263 Bacteria 365910
267 Ga0209565_1000077 3300025263 Bacteria 161163
268 Ga0209565_1000236 3300025263 Bacteria 60311
269 Ga0209565_1001226 3300025263 Bacteria 12079
270 Ga0209455_1000011 3300025272 Bacteria 947242
271 Ga0209455_1000038 3300025272 Bacteria 443899
272 Ga0209455_1000109 3300025272 Bacteria 191036
273 Ga0209455_1000138 3300025272 Bacteria 141021
274 Ga0209455_1000556 3300025272 Bacteria 25238
275 Ga0209673_1000009 3300025273 Bacteria 620735
276 Ga0209673_1000012 3300025273 Bacteria 579480
277 Ga0209673_1000101 3300025273 Bacteria 190230
278 Ga0209673_1000556 3300025273 Bacteria 59978
279 Ga0209673_1011693 3300025273 Bacteria 3598
280 Ga0209130_1000183 3300025284 Bacteria 87887
281 Ga0209130_1000644 3300025284 Bacteria 32528
282 Ga0209130_1007065 3300025284 Bacteria 3526
283 Ga0209130_1007848 3300025284 Bacteria 3233
284 Ga0209675_1000065 3300025291 Bacteria 174791
285 Ga0209675_1000308 3300025291 Bacteria 44127
286 Ga0209675_1000937 3300025291 Bacteria 18583
287 Ga0209675_1001825 3300025291 Bacteria 11622
288 Ga0209675_1001932 3300025291 Bacteria 11197
289 Ga0209675_1006350 3300025291 Bacteria 4759
290 Ga0209676_1000013 3300025292 Bacteria 816080
291 Ga0209676_1000044 3300025292 Bacteria 416215
292 Ga0209676_1000074 3300025292 Bacteria 305770
293 Ga0209676_1000660 3300025292 Bacteria 49420
294 Ga0209676_1004352 3300025292 Bacteria 7934
295 Ga0209676_1020227 3300025292 Bacteria 2267
296 Ga0209025_1000040 3300025294 Bacteria 376228
297 Ga0209025_1000147 3300025294 Bacteria 180008
298 Ga0209025_1000231 3300025294 Bacteria 130671
299 Ga0209025_1000269 3300025294 Bacteria 121642
300 Ga0209025_1000349 3300025294 Bacteria 100055
301 Ga0209025_1000535 3300025294 Bacteria 72165
302 Ga0209025_1000846 3300025294 Bacteria 48468
303 Ga0209025_1002545 3300025294 Bacteria 19021
304 Ga0209025_1006282 3300025294 Bacteria 9291
305 Ga0209025_1008503 3300025294 Bacteria 7377
306 Ga0209025_1008734 3300025294 Bacteria 7216
307 Ga0209025_1012984 3300025294 Bacteria 5277
308 Ga0209025_1024516 3300025294 Bacteria 3108
309 Ga0209564_1000021 3300025295 Bacteria 571316
310 Ga0209564_1000080 3300025295 Bacteria 263547
311 Ga0209564_1000274 3300025295 Bacteria 107980
312 Ga0209564_1000294 3300025295 Bacteria 100958
313 Ga0209564_1000404 3300025295 Bacteria 76827
314 Ga0209564_1001177 3300025295 Bacteria 30362
315 Ga0209564_1001304 3300025295 Bacteria 26859
316 Ga0209564_1005169 3300025295 Bacteria 7574
317 Ga0209564_1005804 3300025295 Bacteria 6886
318 Ga0209758_1000039 3300025297 Bacteria 428951
319 Ga0209758_1000167 3300025297 Bacteria 151074
320 Ga0209758_1012180 3300025297 Bacteria 4851
321 Ga0209758_1023905 3300025297 Bacteria 2744
322 Ga0209050_1000008 3300025298 Bacteria 1144179
323 Ga0209050_1000015 3300025298 Bacteria 759102
324 Ga0209050_1000467 3300025298 Bacteria 71711
325 Ga0209050_1001799 3300025298 Bacteria 21017
326 Ga0209050_1001933 3300025298 Bacteria 19735
327 Ga0209050_1002141 3300025298 Bacteria 17978
328 Ga0209050_1016647 3300025298 Bacteria 2990
329 Ga0209256_1000003 3300025299 Bacteria 1661127
330 Ga0209256_1000119 3300025299 Bacteria 168215
331 Ga0209256_1000136 3300025299 Bacteria 159047
332 Ga0209256_1000177 3300025299 Bacteria 125603
333 Ga0209256_1000230 3300025299 Bacteria 100958
334 Ga0209256_1000483 3300025299 Bacteria 59193
335 Ga0207426_1000007 3300025302 Bacteria 971011
336 Ga0207426_1000062 3300025302 Bacteria 362040
337 Ga0207426_1000108 3300025302 Bacteria 242257
338 Ga0207426_1000130 3300025302 Bacteria 210271
339 Ga0209051_1000005 3300025303 Bacteria 1142353
340 Ga0209051_1000010 3300025303 Bacteria 641298
341 Ga0209051_1000059 3300025303 Bacteria 260307
342 Ga0209051_1000175 3300025303 Bacteria 116040
343 Ga0209051_1000508 3300025303 Bacteria 49345
344 Ga0209051_1001292 3300025303 Bacteria 22087
345 Ga0209051_1012436 3300025303 Bacteria 4117
346 Ga0209257_1000022 3300025304 Bacteria 765258
347 Ga0209257_1000026 3300025304 Bacteria 723225
348 Ga0209257_1000048 3300025304 Bacteria 455536
349 Ga0209257_1000347 3300025304 Bacteria 95122
350 Ga0209257_1001823 3300025304 Bacteria 23327
351 Ga0209257_1006940 3300025304 Bacteria 7064
352 Ga0209257_1008844 3300025304 Bacteria 5566
353 Ga0209257_1021842 3300025304 Bacteria 2306
354 Ga0207656_10003939 3300025321 Bacteria 5141
355 Ga0207696_1014443 3300025711 Bacteria 2709
356 Ga0207713_1000137 3300025735 Bacteria 111281
357 Ga0207713_1021513 3300025735 Bacteria 3089
358 Ga0207680_10006279 3300025903 Bacteria 5733
359 Ga0207647_10000378 3300025904 Bacteria 36270
360 Ga0207647_10000478 3300025904 Bacteria 32300
361 Ga0207647_10004890 3300025904 Bacteria 9886
362 Ga0207647_10004914 3300025904 Bacteria 9865
363 Ga0207647_10008405 3300025904 Bacteria 7404
364 Ga0207645_10003670 3300025907 Bacteria 11587
365 Ga0207705_10001740 3300025909 Bacteria 17254
366 Ga0207705_10107138 3300025909 Bacteria 2062
367 Ga0207705_10177841 3300025909 Bacteria 1605
368 Ga0207695_10005348 3300025913 Bacteria 17077
369 Ga0207695_10007510 3300025913 Bacteria 13831
370 Ga0207695_10011994 3300025913 Bacteria 10427
371 Ga0207695_10148420 3300025913 Bacteria 2286
372 Ga0207695_10156468 3300025913 Bacteria 2214
373 Ga0207657_10000310 3300025919 Bacteria 51679
374 Ga0207649_10000315 3300025920 Bacteria 36740
375 Ga0207681_10005024 3300025923 Bacteria 8131
376 Ga0207694_10120435 3300025924 Bacteria 2095
377 Ga0207650_10015835 3300025925 Bacteria 5259
378 Ga0207687_10078249 3300025927 Bacteria 2381
379 Ga0207644_10030954 3300025931 Bacteria 3726
380 Ga0207644_10083920 3300025931 Bacteria 2361
381 Ga0207690_10000037 3300025932 Bacteria 142658
382 Ga0207690_10003232 3300025932 Bacteria 9782
383 Ga0207709_10000079 3300025935 Bacteria 166220
384 Ga0207709_10000196 3300025935 Bacteria 80952
385 Ga0207709_10053965 3300025935 Bacteria 2476
386 Ga0207691_10025039 3300025940 Bacteria 5608
387 Ga0207691_10217061 3300025940 Bacteria 1659
388 Ga0207711_10012824 3300025941 Bacteria 6964
389 Ga0207711_10090936 3300025941 Bacteria 2684
390 Ga0207711_10148180 3300025941 Bacteria 2116
391 Ga0207689_10034789 3300025942 Bacteria 4183
392 Ga0207689_10155514 3300025942 Bacteria 1885
393 Ga0207679_10000041 3300025945 Bacteria 127201
394 Ga0207667_10001765 3300025949 Bacteria 27224
395 Ga0207667_10004066 3300025949 Bacteria 17973
396 Ga0207667_10006421 3300025949 Bacteria 14242
397 Ga0207651_10001106 3300025960 Bacteria 11995
398 Ga0207640_10000060 3300025981 Bacteria 89734
399 Ga0207658_10013545 3300025986 Bacteria 5575
400 Ga0207658_10035774 3300025986 Bacteria 3558
401 Ga0207677_10135653 3300026023 Bacteria 1876
402 Ga0207678_10000027 3300026067 Bacteria 115784
403 Ga0207678_10000339 3300026067 Bacteria 42134
404 Ga0207678_10006418 3300026067 Bacteria 10434
405 Ga0207678_10007014 3300026067 Bacteria 10001
406 Ga0207678_10047760 3300026067 Bacteria 3701
407 Ga0207678_10063289 3300026067 Bacteria 3179
408 Ga0207702_10000059 3300026078 Bacteria 127076
409 Ga0207648_10024543 3300026089 Bacteria 5379
410 Ga0207683_10092772 3300026121 Bacteria 2690
411 Ga0207698_10079191 3300026142 Bacteria 2642
412 Ga0209281_1000067 3300027111 Bacteria 284517
413 Ga0209389_1003139 3300027296 Bacteria 13151
414 Ga0209371_1000080 3300027312 Bacteria 185771
415 Ga0209371_1005628 3300027312 Bacteria 4918
416 Ga0209371_1013832 3300027312 Bacteria 2242
417 Ga0209282_1000059 3300027666 Bacteria 97821
418 Ga0209282_1003188 3300027666 Bacteria 9701
419 Ga0209974_10004452 3300027876 Bacteria 4986
420 Ga0268266_10084656 3300028379 Bacteria 2769
421 Ga0268265_10169733 3300028380 Bacteria 1863
422 Ga0265336_10000808 3300028666 Bacteria 16515
423 Ga0307517_10001469 3300028786 Bacteria 39464
424 Ga0307517_10137654 3300028786 Bacteria 1729
425 Ga0307515_10000034 3300028794 Bacteria 344640
426 Ga0307515_10000131 3300028794 Bacteria 178919
427 Ga0307515_10002916 3300028794 Bacteria 36334
428 Ga0307515_10052598 3300028794 Bacteria 6035
429 Ga0265338_10000355 3300028800 Bacteria 83040
430 Ga0265338_10000644 3300028800 Bacteria 60398
431 Ga0265324_10000023 3300029957 Bacteria 164128
432 Ga0265324_10000120 3300029957 Bacteria 61840
433 Ga0268256_1000336 3300030500 Bacteria 46023
434 Ga0268256_1009570 3300030500 Bacteria 3199
435 Ga0268256_1015329 3300030500 Bacteria 2242
436 Ga0307512_10029212 3300030522 Bacteria 4821
437 Ga0265330_10000267 3300031235 Bacteria 38266
438 Ga0265332_10000022 3300031238 Bacteria 213072
439 Ga0265332_10000031 3300031238 Bacteria 162330
440 Ga0265328_10022877 3300031239 Bacteria 2373
441 Ga0265325_10000553 3300031241 Bacteria 27118
442 Ga0265325_10026159 3300031241 Bacteria 3164
443 Ga0265340_10015502 3300031247 Bacteria 3960
444 Ga0265331_10000030 3300031250 Bacteria 215032
445 Ga0265331_10002656 3300031250 Bacteria 11974
446 Ga0265331_10012909 3300031250 Bacteria 4505
447 Ga0265331_10035423 3300031250 Bacteria 2456
448 Ga0265331_10052966 3300031250 Bacteria 1937
449 Ga0265327_10000072 3300031251 Bacteria 215055
450 Ga0265327_10000158 3300031251 Bacteria 145905
451 Ga0265327_10001640 3300031251 Bacteria 26985
452 Ga0265327_10017441 3300031251 Bacteria 4504
453 Ga0265327_10051167 3300031251 Bacteria 2157
454 Ga0265316_10035203 3300031344 Bacteria 4060
455 Ga0265316_10129367 3300031344 Bacteria 1903
456 Ga0307513_10000034 3300031456 Bacteria 185012
457 Ga0307513_10000057 3300031456 Bacteria 146564
458 Ga0307513_10045470 3300031456 Bacteria 4798
459 Ga0307513_10068643 3300031456 Bacteria 3712
460 Ga0307513_10151271 3300031456 Bacteria 2229
461 Ga0307509_10002265 3300031507 Bacteria 31503
462 Ga0307509_10002881 3300031507 Bacteria 27220
463 Ga0307408_100000133 3300031548 Bacteria 82744
464 Ga0307408_100000210 3300031548 Bacteria 62386
465 Ga0307408_100001861 3300031548 Bacteria 15388
466 Ga0307408_100019250 3300031548 Bacteria 4594
467 Ga0307508_10001483 3300031616 Bacteria 26326
468 Ga0307508_10004164 3300031616 Bacteria 14228
469 Ga0307514_10001425 3300031649 Bacteria 29406
470 Ga0265314_10000095 3300031711 Bacteria 134372
471 Ga0265314_10000371 3300031711 Bacteria 61424
472 Ga0265314_10009731 3300031711 Bacteria 8085
473 Ga0265314_10020485 3300031711 Bacteria 5105
474 Ga0265314_10024895 3300031711 Bacteria 4527
475 Ga0307516_10005084 3300031730 Bacteria 15902
476 Ga0307516_10007800 3300031730 Bacteria 12221
477 Ga0307405_10089876 3300031731 Bacteria 2030
478 Ga0307406_10000109 3300031901 Bacteria 47812
479 Ga0307412_10000011 3300031911 Bacteria 405842
480 Ga0307412_10003062 3300031911 Bacteria 9273
481 Ga0307416_100004394 3300032002 Bacteria 8494
482 Ga0307414_10068124 3300032004 Bacteria 2552
483 Ga0307411_10160995 3300032005 Bacteria 1681
484 Ga0307510_10000311 3300033180 Bacteria 44908
485 Ga0307510_10008623 3300033180 Bacteria 12150
486 Ga0373931_0040471 3300035691 Bacteria 2446
487 Ga0395899_0000035 3300037312 Bacteria 295584
488 Ga0395899_0010162 3300037312 Bacteria 7216
489 Ga0395899_0010439 3300037312 Bacteria 7114
490 Ga0395899_0127064 3300037312 Bacteria 1823
491 Ga0395900_0000113 3300037418 Bacteria 139979
492 Ga0395900_0000260 3300037418 Bacteria 82477
493 Ga0395900_0000482 3300037418 Bacteria 56524
494 Ga0395900_0001358 3300037418 Bacteria 29449
495 Ga0395900_0028686 3300037418 Bacteria 5704
496 Ga0395900_0029177 3300037418 Bacteria 5658
497 Ga0395900_0049273 3300037418 Bacteria 4339
498 Ga0395900_0074939 3300037418 Bacteria 3478
499 Ga0395900_0113933 3300037418 Bacteria 2775
500 Ga0395898_0000437 3300037466 Bacteria 87616
501 Ga0395898_0000444 3300037466 Bacteria 85520
502 Ga0395898_0001019 3300037466 Bacteria 43659
503 Ga0395898_0001191 3300037466 Bacteria 39411
504 Ga0395898_0008451 3300037466 Bacteria 10881
505 Ga0395898_0009056 3300037466 Bacteria 10481
506 Ga0395898_0027395 3300037466 Bacteria 5722
507 Ga0395898_0044760 3300037466 Bacteria 4354
508 Ga0395898_0062959 3300037466 Bacteria 3601
509 Ga0395898_0093869 3300037466 Bacteria 2883
510 Ga0395905_0000079 3300037471 Bacteria 160663
511 Ga0395905_0000110 3300037471 Bacteria 137078
512 Ga0395905_0000353 3300037471 Bacteria 65228
513 Ga0395905_0004513 3300037471 Bacteria 14422
514 Ga0395905_0051133 3300037471 Bacteria 3870
515 Ga0395905_0053222 3300037471 Bacteria 3788
516 Ga0395905_0092688 3300037471 Bacteria 2833
517 Ga0395905_0100862 3300037471 Bacteria 2710
518 Ga0395901_0000062 3300038443 Bacteria 150171
519 Ga0395901_0000118 3300038443 Bacteria 105036
520 Ga0395901_0006622 3300038443 Bacteria 11705
521 Ga0395901_0022229 3300038443 Bacteria 6497
522 Ga0395901_0023747 3300038443 Bacteria 6287
523 Ga0395901_0037378 3300038443 Bacteria 5021
524 Ga0395901_0064492 3300038443 Bacteria 3813
525 Ga0395901_0091577 3300038443 Bacteria 3183
526 Ga0395901_0097756 3300038443 Bacteria 3078
527 Ga0436361_0128108 3300039447 Bacteria 47918
528 Ga0436361_0311269 3300039447 Bacteria 1415
529 Ga0436361_0550115 3300039447 Bacteria 3114
530 Ga0436361_0749269 3300039447 Bacteria 121408
531 Ga0436361_0844713 3300039447 Bacteria 12707
532 Ga0436361_1106610 3300039447 Bacteria 4589
533 Ga0439436_0003337 3300041404 Bacteria 4870
534 Ga0439436_0003353 3300041404 Bacteria 4859
535 Ga0439466_0006939 3300041411 Bacteria 4294
536 Ga0439465_0000253 3300041413 Bacteria 14685
537 Ga0439432_006256 3300042006 Bacteria 4258
538 Ga0439449_0001123 3300042007 Bacteria 10530
539 Ga0439449_0001401 3300042007 Bacteria 9429
540 Ga0439449_0004682 3300042007 Bacteria 5284
541 Ga0439452_005634 3300042010 Bacteria 4010
542 Ga0439462_0003556 3300042015 Bacteria 3748
543 Ga0450890_002728 3300042127 Bacteria 2398
544 Ga0450898_000063 3300042134 Bacteria 9276
545 Ga0450899_002836 3300042135 Bacteria 1874
546 Ga0439446_0007621 3300042156 Bacteria 2851
547 Ga0439458_0010152 3300042157 Bacteria 2097
548 Ga0451577_0000002 3300042876 Bacteria 1731375
549 Ga0451577_0000058 3300042876 Bacteria 272673
550 Ga0451577_0001786 3300042876 Bacteria 27587
551 Ga0451577_0002552 3300042876 Bacteria 21488
552 Ga0451577_0007815 3300042876 Bacteria 10465
553 Ga0451577_0018723 3300042876 Bacteria 6372
554 Ga0451577_0095863 3300042876 Bacteria 2649
555 Ga0466969_0000039 3300044656 Bacteria 71961
556 Ga0466969_0000129 3300044656 Bacteria 41023
557 Ga0466969_0036600 3300044656 Bacteria 2478
558 Ga0466969_0046169 3300044656 Bacteria 2160
559 Ga0466972_0005428 3300044658 Bacteria 6385
560 Ga0453683_0000003 3300044673 Bacteria 942572
561 Ga0453683_0001302 3300044673 Bacteria 22014
562 Ga0466965_0001157 3300044683 Bacteria 10373
563 Ga0466965_0011205 3300044683 Bacteria 4197
564 Ga0466965_0032378 3300044683 Bacteria 2553
565 Ga0466966_0000092 3300044684 Bacteria 55643
566 Ga0466966_0007009 3300044684 Bacteria 7463
567 Ga0466966_0037443 3300044684 Bacteria 3128
568 Ga0466961_0000519 3300044693 Bacteria 24528
569 Ga0466961_0004756 3300044693 Bacteria 8547
570 Ga0466961_0013805 3300044693 Bacteria 5176
571 Ga0466961_0064450 3300044693 Bacteria 2328
572 Ga0466961_0076148 3300044693 Bacteria 2126
573 Ga0466963_0005173 3300044694 Bacteria 7616
574 Ga0466963_0005609 3300044694 Bacteria 7362
575 Ga0466963_0010986 3300044694 Bacteria 5504
576 Ga0466963_0049067 3300044694 Bacteria 2791
577 Ga0466964_0061061 3300044706 Bacteria 1569
578 Ga0453684_0000002 3300044712 Bacteria 1731375
579 Ga0453684_0000029 3300044712 Bacteria 757969
580 Ga0453684_0000279 3300044712 Bacteria 220016
581 Ga0453684_0003391 3300044712 Bacteria 36040
582 Ga0453684_0006506 3300044712 Bacteria 22148
583 Ga0453684_0011162 3300044712 Bacteria 15134
584 Ga0453684_0027288 3300044712 Bacteria 8196
585 Ga0453684_0028762 3300044712 Bacteria 7913
586 Ga0466971_0003946 3300044719 Bacteria 6372
587 Ga0466971_0005253 3300044719 Bacteria 5608
588 Ga0466971_0026340 3300044719 Bacteria 2598
589 Ga0466957_0011043 3300044842 Bacteria 5196
590 Ga0466957_0138094 3300044842 Bacteria 1568
591 Ga0466959_0000517 3300045049 Bacteria 22405
592 Ga0466959_0002541 3300045049 Bacteria 11705
593 Ga0466959_0007412 3300045049 Bacteria 7697
594 Ga0466959_0012243 3300045049 Bacteria 6190
595 Ga0466959_0012783 3300045049 Bacteria 6074
596 Ga0466959_0031447 3300045049 Bacteria 3926
597 Ga0451576_0000004 3300045051 Bacteria 1312238
598 Ga0451576_0000029 3300045051 Bacteria 404449
599 Ga0451576_0000237 3300045051 Bacteria 134538
600 Ga0451576_0000320 3300045051 Bacteria 116612
601 Ga0451576_0001456 3300045051 Bacteria 40244
602 Ga0451576_0001981 3300045051 Bacteria 32534
603 Ga0451576_0007943 3300045051 Bacteria 12552
604 Ga0451576_0029727 3300045051 Bacteria 5846
605 Ga0451576_0068705 3300045051 Bacteria 3687
606 Ga0466958_0004396 3300045836 Bacteria 7436
607 Ga0466958_0052106 3300045836 Bacteria 2479
608 Ga0466967_0193441 3300045976 Bacteria 1923
609 Ga0495592_0011067 3300046454 Bacteria 6810
610 Ga0495603_0005536 3300046455 Bacteria 7538
611 Ga0495603_0020719 3300046455 Bacteria 3982
612 Ga0495590_0003669 3300046457 Bacteria 6248
613 Ga0495590_0017538 3300046457 Bacteria 2576
614 Ga0495591_001172 3300046458 Bacteria 17117
615 Ga0495629_0000207 3300046459 Bacteria 52553
616 Ga0495629_0000352 3300046459 Bacteria 39148
617 Ga0495629_0011888 3300046459 Bacteria 6312
618 Ga0495638_0002429 3300046460 Bacteria 15231
619 Ga0495638_0003598 3300046460 Bacteria 12123
620 Ga0495651_0035986 3300046462 Bacteria 3853
621 Ga0495653_0000303 3300046463 Bacteria 40033
622 Ga0495653_0024465 3300046463 Bacteria 4866
623 Ga0495653_0027961 3300046463 Bacteria 4514
624 Ga0495653_0032598 3300046463 Bacteria 4134
625 Ga0495653_0049484 3300046463 Bacteria 3237
626 Ga0495650_0002414 3300046471 Bacteria 15203
627 Ga0495650_0004007 3300046471 Bacteria 10342
628 Ga0495650_0011359 3300046471 Bacteria 4886
629 Ga0495650_0033061 3300046471 Bacteria 2306
630 Ga0495650_0038063 3300046471 Bacteria 2087
631 Ga0495580_0000001 3300046472 Bacteria 180598
632 Ga0495580_0000234 3300046472 Bacteria 43681
633 Ga0495580_0003741 3300046472 Bacteria 12882
634 Ga0495580_0006821 3300046472 Bacteria 9248
635 Ga0495580_0010049 3300046472 Bacteria 7397
636 Ga0495580_0039883 3300046472 Bacteria 3359
637 Ga0495582_0004069 3300046473 Bacteria 8211
638 Ga0495582_0004224 3300046473 Bacteria 8083
639 Ga0495582_0011994 3300046473 Bacteria 4774
640 Ga0495605_0004526 3300046474 Bacteria 8142
641 Ga0495639_0011555 3300046475 Bacteria 3809
642 Ga0495664_0001870 3300046477 Bacteria 11187
643 Ga0495664_0006906 3300046477 Bacteria 6282
644 Ga0495664_0009274 3300046477 Bacteria 5503
645 Ga0495585_0013006 3300046492 Bacteria 4884
646 Ga0495585_0037449 3300046492 Bacteria 2732
647 Ga0495596_0000057 3300046500 Bacteria 81281
648 Ga0495596_0002113 3300046500 Bacteria 10891
649 Ga0495607_0002727 3300046501 Bacteria 14083
650 Ga0495607_0042857 3300046501 Bacteria 2680
651 Ga0495583_0000524 3300046506 Bacteria 54376
652 Ga0495606_0002526 3300046507 Bacteria 21043
653 Ga0495606_0007354 3300046507 Bacteria 9885
654 Ga0495606_0018342 3300046507 Bacteria 5252
655 Ga0495606_0057595 3300046507 Bacteria 2502
656 Ga0495606_0060690 3300046507 Bacteria 2421
657 Ga0495606_0108290 3300046507 Bacteria 1680
658 Ga0495608_0001528 3300046511 Bacteria 16473
659 Ga0495608_0004976 3300046511 Bacteria 9510
660 Ga0495608_0098216 3300046511 Bacteria 1890
661 Ga0495610_0000543 3300046512 Bacteria 37709
662 Ga0495616_0002644 3300046513 Bacteria 11778
663 Ga0495616_0004159 3300046513 Bacteria 9171
664 Ga0495618_0006278 3300046514 Bacteria 7212
665 Ga0495620_0007766 3300046515 Bacteria 5795
666 Ga0495620_0017698 3300046515 Bacteria 3545
667 Ga0495628_0000262 3300046516 Bacteria 46877
668 Ga0495628_0004434 3300046516 Bacteria 12450
669 Ga0495628_0024206 3300046516 Bacteria 4971
670 Ga0495630_0024959 3300046517 Bacteria 4418
671 Ga0495630_0026618 3300046517 Bacteria 4284
672 Ga0495630_0058426 3300046517 Bacteria 2891
673 Ga0495631_0000256 3300046518 Bacteria 36913
674 Ga0495637_0007267 3300046520 Bacteria 5507
675 Ga0495648_0002441 3300046524 Bacteria 17177
676 Ga0495648_0007860 3300046524 Bacteria 8481
677 Ga0495648_0041457 3300046524 Bacteria 2906
678 Ga0495648_0044233 3300046524 Bacteria 2781
679 Ga0495666_0000501 3300046526 Bacteria 17355
680 Ga0495666_0002018 3300046526 Bacteria 10039
681 Ga0495666_0006273 3300046526 Bacteria 5986
682 Ga0495642_0011115 3300046528 Bacteria 3452
683 Ga0495652_0045442 3300046529 Bacteria 3775
684 Ga0495652_0051632 3300046529 Bacteria 3510
685 Ga0495654_0000361 3300046530 Bacteria 39467
686 Ga0495654_0050446 3300046530 Bacteria 2034
687 Ga0495665_0013488 3300046531 Bacteria 4416
688 Ga0495640_0014822 3300046533 Bacteria 5884
689 Ga0495586_0010655 3300046535 Bacteria 4889
690 Ga0495586_0043853 3300046535 Bacteria 2408
691 Ga0495609_0001051 3300046538 Bacteria 19356
692 Ga0495621_0008834 3300046539 Bacteria 3036
693 Ga0495597_0000256 3300046542 Bacteria 48492
694 Ga0495645_0000718 3300046543 Bacteria 22772
695 Ga0495645_0040006 3300046543 Bacteria 3419
696 Ga0495622_0000993 3300046557 Bacteria 15191
697 Ga0495633_0000235 3300046558 Bacteria 67807
698 Ga0495656_0010482 3300046615 Bacteria 3372
699 Ga0495634_0009155 3300046642 Bacteria 7313
700 Ga0495634_0011252 3300046642 Bacteria 6521
701 Ga0495634_0070722 3300046642 Bacteria 2299
702 Ga0495635_0002817 3300046663 Bacteria 11936
703 Ga0495635_0023607 3300046663 Bacteria 4284
704 Ga0495635_0036429 3300046663 Bacteria 3410
705 Ga0495661_0000792 3300046665 Bacteria 30007
706 Ga0495661_0012043 3300046665 Bacteria 5852
707 Ga0495599_0040438 3300046678 Bacteria 2928
708 Ga0495623_0006363 3300046679 Bacteria 7678
709 Ga0495646_0005259 3300046680 Bacteria 8165
710 Ga0495646_0005282 3300046680 Bacteria 8151
711 Ga0495669_0031019 3300046684 Bacteria 2346
712 Ga0495613_0006702 3300046689 Bacteria 8598
713 Ga0495613_0014369 3300046689 Bacteria 5877
714 Ga0495613_0037105 3300046689 Bacteria 3614
715 Ga0495624_0001006 3300046690 Bacteria 22320
716 Ga0495624_0006778 3300046690 Bacteria 8094
717 Ga0495624_0021155 3300046690 Bacteria 4317
718 Ga0495624_0068422 3300046690 Bacteria 2213
719 Ga0495671_0000364 3300046692 Bacteria 37524
720 Ga0495671_0007453 3300046692 Bacteria 6235
721 Ga0495671_0016921 3300046692 Bacteria 3886
722 Ga0495649_0002157 3300046694 Bacteria 14078
723 Ga0495649_0003434 3300046694 Bacteria 10695
724 Ga0495649_0007698 3300046694 Bacteria 6542
725 Ga0495649_0009237 3300046694 Bacteria 5874
726 Ga0495589_0006539 3300046794 Bacteria 6145
727 Ga0495589_0009446 3300046794 Bacteria 5073
728 Ga0495589_0011666 3300046794 Bacteria 4561
729 Ga0495589_0021747 3300046794 Bacteria 3277
730 Ga0495600_0009370 3300046809 Bacteria 6049
731 Ga0495581_0000793 3300047315 Bacteria 16784
732 Ga0495581_0002658 3300047315 Bacteria 10165
733 Ga0495581_0019216 3300047315 Bacteria 3965
734 Ga0495604_0007498 3300047317 Bacteria 8634
735 Ga0495604_0029410 3300047317 Bacteria 4370
736 Ga0495674_0010029 3300047319 Bacteria 8979
737 Ga0495674_0016580 3300047319 Bacteria 6874
738 Ga0495674_0017631 3300047319 Bacteria 6648
739 Ga0495674_0062328 3300047319 Bacteria 3247
740 Ga0495674_0151209 3300047319 Bacteria 1946
741 Ga0495672_0005275 3300047320 Bacteria 10286
742 Ga0495672_0025905 3300047320 Bacteria 3748
743 Ga0495676_0011001 3300047321 Bacteria 8182
744 Ga0495676_0035497 3300047321 Bacteria 4168
745 Ga0495680_0009524 3300047322 Bacteria 8729
746 Ga0495680_0013681 3300047322 Bacteria 7066
747 Ga0495683_0002705 3300047323 Bacteria 10577
748 Ga0495683_0050278 3300047323 Bacteria 2086
749 Ga0495683_0058648 3300047323 Bacteria 1911
750 Ga0495687_000053 3300047443 Bacteria 195897
751 Ga0495687_003681 3300047443 Bacteria 10915
752 Ga0495687_006704 3300047443 Bacteria 6983
753 Ga0495687_015803 3300047443 Bacteria 3821
754 Ga0495675_0012698 3300047444 Bacteria 5301
755 Ga0495675_0050860 3300047444 Bacteria 2633
756 Ga0495679_000068 3300047446 Bacteria 99593
757 Ga0495679_001889 3300047446 Bacteria 11257
758 Ga0495679_005094 3300047446 Bacteria 5895
759 Ga0495685_001200 3300047447 Bacteria 7938
760 Ga0495673_0003701 3300047469 Bacteria 9952
761 Ga0495673_0007022 3300047469 Bacteria 6539
762 Ga0495686_0000374 3300047472 Bacteria 71938
763 Ga0495593_0001562 3300047673 Bacteria 13504
764 Ga0495593_0007890 3300047673 Bacteria 6198
765 Ga0495593_0008192 3300047673 Bacteria 6080
766 Ga0495602_0044750 3300048088 Bacteria 4011
767 Ga0495602_0087340 3300048088 Bacteria 2599
768 Ga0495602_0123309 3300048088 Bacteria 2080
769 Ga0495614_0001650 3300048089 Bacteria 9735
770 Ga0495626_0012469 3300048091 Bacteria 4455
771 Ga0496100_0008418 3300048903 Bacteria 5751
772 Ga0496100_0016373 3300048903 Bacteria 4353
773 Ga0496101_0005299 3300048904 Bacteria 8214
774 Ga0496101_0020034 3300048904 Bacteria 4573
775 Ga0496102_0003139 3300048905 Bacteria 14015
776 Ga0496102_0005686 3300048905 Bacteria 10585
777 Ga0496102_0033647 3300048905 Bacteria 4607
778 Ga0496102_0037471 3300048905 Bacteria 4374
779 Ga0496103_0002330 3300048906 Bacteria 12001
780 Ga0496103_0035729 3300048906 Bacteria 3042
781 Ga0496104_0002921 3300048907 Bacteria 14722
782 Ga0496104_0082870 3300048907 Bacteria 3059
783 Ga0496104_0088883 3300048907 Bacteria 2951
784 Ga0496105_0004864 3300048908 Bacteria 10143
785 Ga0496105_0005792 3300048908 Bacteria 9423
786 Ga0496105_0095766 3300048908 Bacteria 2451
787 Ga0496106_0000051 3300048909 Bacteria 95750
788 Ga0496106_0013696 3300048909 Bacteria 5989
789 Ga0496106_0018968 3300048909 Bacteria 5097
790 Ga0496106_0036529 3300048909 Bacteria 3675
791 Ga0496107_0003723 3300048910 Bacteria 10249
792 Ga0496110_0035252 3300048913 Bacteria 4340
793 Ga0496112_0024010 3300048915 Bacteria 5834
794 Ga0496115_0139227 3300048918 Bacteria 2002
795 Ga0496116_0000963 3300048919 Bacteria 35538
796 Ga0496116_0004563 3300048919 Bacteria 13137
797 Ga0496117_0000903 3300048920 Bacteria 45688
798 Ga0496117_0005311 3300048920 Bacteria 13615
799 Ga0496117_0013817 3300048920 Bacteria 7009
800 Ga0496117_0028930 3300048920 Bacteria 4281
801 Ga0496117_0081038 3300048920 Bacteria 2132
802 Ga0496118_0006087 3300048921 Bacteria 13417
803 Ga0496118_0006113 3300048921 Bacteria 13383
804 Ga0496118_0011051 3300048921 Bacteria 8861
805 Ga0496118_0022146 3300048921 Bacteria 5567
806 Ga0496118_0038666 3300048921 Bacteria 3820
807 Ga0496119_0013369 3300048922 Bacteria 6550
808 Ga0496120_0001845 3300048923 Bacteria 23584
809 Ga0496121_0000124 3300048924 Bacteria 170427
810 Ga0496121_0002256 3300048924 Bacteria 30050
811 Ga0496121_0002981 3300048924 Bacteria 24617
812 Ga0496121_0010596 3300048924 Bacteria 10359
813 Ga0496121_0012023 3300048924 Bacteria 9511
814 Ga0496121_0027162 3300048924 Bacteria 5364
815 Ga0496121_0100302 3300048924 Bacteria 2235
816 Ga0496122_0000316 3300048925 Bacteria 106100
817 Ga0496122_0001659 3300048925 Bacteria 34509
818 Ga0496122_0004040 3300048925 Bacteria 18651
819 Ga0496122_0070368 3300048925 Bacteria 2500
820 Ga0496123_0000297 3300048926 Bacteria 97340
821 Ga0496123_0000299 3300048926 Bacteria 96749
822 Ga0496123_0000648 3300048926 Bacteria 57922
823 Ga0496123_0032562 3300048926 Bacteria 3771
824 Ga0496123_0034133 3300048926 Bacteria 3649
825 Ga0496124_0000125 3300048927 Bacteria 159942
826 Ga0496124_0020886 3300048927 Bacteria 6041
827 Ga0496124_0109089 3300048927 Bacteria 2231
828 Ga0496125_0000116 3300048928 Bacteria 180492
829 Ga0496125_0003797 3300048928 Bacteria 17966
830 Ga0496125_0003822 3300048928 Bacteria 17891
831 Ga0496126_0000506 3300048929 Bacteria 76527
832 Ga0496126_0001414 3300048929 Bacteria 37976
833 Ga0496126_0046904 3300048929 Bacteria 3959
834 Ga0496126_0048700 3300048929 Bacteria 3871
835 Ga0496126_0056042 3300048929 Bacteria 3564
836 Ga0496126_0242339 3300048929 Bacteria 1506
837 Ga0495682_0004254 3300049460 Bacteria 6188
838 Ga0501037_0026522 3300049573 Bacteria 4283
839 Ga0501209_004721 3300049656 Bacteria 2395
840 Ga0501035_0163035 3300049822 Bacteria 1929
841 Ga0501044_0000174 3300049823 Bacteria 79875
842 Ga0501044_0124333 3300049823 Bacteria 2578
843 nmdc:mga0k408_4596_c1 3300050493 Bacteria 7322
844 nmdc:mga0k408_47872_c1 3300050493 Bacteria 2472
845 nmdc:mga07m45_4909_c1 3300050496 Bacteria 6590
846 Ga0500578_0019879 3300053086 Bacteria 4315
847 Ga0500644_0003048 3300053088 Bacteria 4153
848 Ga0500651_0000224 3300053093 Bacteria 35276
849 Ga0500571_000057 3300053110 Bacteria 34612
850 Ga0500607_001420 3300053121 Bacteria 21673
851 Ga0500608_030466 3300053122 Bacteria 2557
852 Ga0500559_0000954 3300053136 Bacteria 18188
853 Ga0500559_0007017 3300053136 Bacteria 5035
854 Ga0500568_0003223 3300053139 Bacteria 9235
855 Ga0500616_0029537 3300053153 Bacteria 3015
856 Ga0500622_0000128 3300053156 Bacteria 79659
857 Ga0500622_0003490 3300053156 Bacteria 10437
858 Ga0500627_0000581 3300053158 Bacteria 9800
859 Ga0500634_0029905 3300053161 Bacteria 2969
860 Ga0500636_0008509 3300053177 Bacteria 5948
861 Ga0500636_0011574 3300053177 Bacteria 5165
862 Ga0500637_0047113 3300053178 Bacteria 2448
863 Ga0500625_055483 3300053729 Bacteria 1816
864 Ga0500645_001312 3300053730 Bacteria 12902
865 Ga0500645_002176 3300053730 Bacteria 8975
866 Ga0587072_001466 3300059643 Bacteria 2928
867 Ga0466962_0014327 3300061719 Bacteria 3820
868 Ga0466962_0014793 3300061719 Bacteria 3760

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044656 Ga0466969_0036600 Ga0466969_0036600_20_1210 357
2 3300025242 Ga0209258_100341 Ga0209258_10034150 402
3 3300032004 Ga0307414_10068124 Ga0307414_100681242 404
4 3300017792 Ga0163161_10093203 Ga0163161_100932032 413
5 3300042876 Ga0451577_0000058 Ga0451577_0000058_10825_12321 413
6 3300044712 Ga0453684_0000279 Ga0453684_0000279_107482_108978 413
7 3300025295 Ga0209564_1000404 Ga0209564_100040438 415
8 3300048927 Ga0496124_0020886 Ga0496124_0020886_1079_2419 415
9 3300053121 Ga0500607_001420 Ga0500607_001420_10650_12080 415
10 3300037471 Ga0395905_0053222 Ga0395905_0053222_1732_3171 416
11 3300038443 Ga0395901_0091577 Ga0395901_0091577_119_1558 416
12 3300003187 JGI25151J46595_10001147 JGI25151J46595_100011474 420
13 3300003187 JGI25151J46595_10003195 JGI25151J46595_100031953 420
14 3300003771 Ga0055526_1000434 Ga0055526_10004343 420
15 3300003771 Ga0055526_1000451 Ga0055526_10004518 420
16 3300003773 Ga0055537_1000960 Ga0055537_10009604 420
17 3300003775 Ga0055524_1000220 Ga0055524_100022018 420
18 3300003781 Ga0055536_1000195 Ga0055536_100019517 420
19 3300025263 Ga0209565_1000077 Ga0209565_100007750 420
20 3300025294 Ga0209025_1000231 Ga0209025_100023177 420
21 3300025294 Ga0209025_1000846 Ga0209025_100084635 420
22 3300025295 Ga0209564_1000274 Ga0209564_100027450 420
23 3300025298 Ga0209050_1016647 Ga0209050_10166472 420
24 3300025299 Ga0209256_1000119 Ga0209256_100011950 420
25 3300025294 Ga0209025_1012984 Ga0209025_10129842 421
26 3300021361 Ga0213872_10000055 Ga0213872_1000005540 423
27 3300039447 Ga0436361_0749269 Ga0436361_0749269_68313_69761 423
28 3300026067 Ga0207678_10063289 Ga0207678_100632894 424
29 3300027666 Ga0209282_1003188 Ga0209282_100318810 424
30 3300025935 Ga0207709_10000196 Ga0207709_1000019639 425
31 3300050496 nmdc:mga07m45_4909_c1 nmdc:mga07m45_4909_c1_4764_6194 425
32 3300025292 Ga0209676_1000660 Ga0209676_100066027 426
33 3300025303 Ga0209051_1000508 Ga0209051_100050828 426
34 3300025304 Ga0209257_1006940 Ga0209257_10069406 426
35 3300005844 Ga0068862_100228863 Ga0068862_1002288631 427
36 3300031731 Ga0307405_10089876 Ga0307405_100898761 427
37 3300041413 Ga0439465_0000253 Ga0439465_0000253_12653_14050 427
38 3300042006 Ga0439432_006256 Ga0439432_006256_1660_3057 427
39 3300042010 Ga0439452_005634 Ga0439452_005634_2577_3974 427
40 3300042156 Ga0439446_0007621 Ga0439446_0007621_389_1786 427
41 3300003187 JGI25151J46595_10003969 JGI25151J46595_100039695 428
42 3300025258 Ga0209129_1002553 Ga0209129_10025534 428
43 3300025294 Ga0209025_1000269 Ga0209025_100026916 428
44 3300025927 Ga0207687_10078249 Ga0207687_100782491 428
45 3300041404 Ga0439436_0003353 Ga0439436_0003353_2083_3486 428
46 3300044842 Ga0466957_0138094 Ga0466957_0138094_110_1492 428
47 3300046520 Ga0495637_0007267 Ga0495637_0007267_631_2061 428
48 3300046530 Ga0495654_0050446 Ga0495654_0050446_299_1729 428
49 3300046692 Ga0495671_0007453 Ga0495671_0007453_2349_3779 428
50 3300047443 Ga0495687_000053 Ga0495687_000053_187932_189314 428
51 3300053158 Ga0500627_0000581 Ga0500627_0000581_5237_6667 428
52 3300005328 Ga0070676_10003078 Ga0070676_100030786 429
53 3300005331 Ga0070670_100016113 Ga0070670_1000161134 429
54 3300005338 Ga0068868_100015331 Ga0068868_1000153312 429
55 3300005354 Ga0070675_100018801 Ga0070675_1000188015 429
56 3300005355 Ga0070671_100017996 Ga0070671_1000179961 429
57 3300005364 Ga0070673_100020752 Ga0070673_1000207524 429
58 3300005367 Ga0070667_100025187 Ga0070667_1000251874 429
59 3300005459 Ga0068867_100004043 Ga0068867_1000040439 429
60 3300005543 Ga0070672_100008667 Ga0070672_1000086675 429
61 3300006881 Ga0068865_100027745 Ga0068865_1000277452 429
62 3300011119 Ga0105246_10023999 Ga0105246_100239992 429
63 3300013308 Ga0157375_10051063 Ga0157375_100510632 429
64 3300025907 Ga0207645_10003670 Ga0207645_100036704 429
65 3300025925 Ga0207650_10015835 Ga0207650_100158354 429
66 3300025931 Ga0207644_10030954 Ga0207644_100309544 429
67 3300025940 Ga0207691_10025039 Ga0207691_100250395 429
68 3300025942 Ga0207689_10034789 Ga0207689_100347895 429
69 3300026089 Ga0207648_10024543 Ga0207648_100245434 429
70 3300028380 Ga0268265_10169733 Ga0268265_101697331 429
71 3300039447 Ga0436361_0550115 Ga0436361_0550115_93_1517 429
72 3300042007 Ga0439449_0001123 Ga0439449_0001123_8796_10199 429
73 3300042134 Ga0450898_000063 Ga0450898_000063_7716_9119 429
74 3300044656 Ga0466969_0000039 Ga0466969_0000039_33553_34935 429
75 3300044693 Ga0466961_0013805 Ga0466961_0013805_457_1839 429
76 3300045049 Ga0466959_0012783 Ga0466959_0012783_591_1973 429
77 3300049823 Ga0501044_0124333 Ga0501044_0124333_106_1497 429
78 3300053093 Ga0500651_0000224 Ga0500651_0000224_20208_21647 429
79 3300053110 Ga0500571_000057 Ga0500571_000057_13108_14547 429
80 3300025941 Ga0207711_10090936 Ga0207711_100909363 430
81 3300037418 Ga0395900_0074939 Ga0395900_0074939_1641_3035 430
82 3300037466 Ga0395898_0093869 Ga0395898_0093869_447_1841 430
83 3300041411 Ga0439466_0006939 Ga0439466_0006939_826_2229 430
84 3300046518 Ga0495631_0000256 Ga0495631_0000256_13317_14768 430
85 3300046539 Ga0495621_0008834 Ga0495621_0008834_1398_2849 430
86 3300053139 Ga0500568_0003223 Ga0500568_0003223_6514_7965 430
87 3300053153 Ga0500616_0029537 Ga0500616_0029537_622_2073 430
88 3300003775 Ga0055524_1000157 Ga0055524_100015717 431
89 3300012497 Ga0157319_1000005 Ga0157319_1000005208 431
90 3300025299 Ga0209256_1000177 Ga0209256_100017737 431
91 3300025304 Ga0209257_1000347 Ga0209257_100034757 431
92 3300027312 Ga0209371_1013832 Ga0209371_10138322 431
93 3300030500 Ga0268256_1015329 Ga0268256_10153292 431
94 3300031548 Ga0307408_100019250 Ga0307408_1000192502 431
95 3300042015 Ga0439462_0003556 Ga0439462_0003556_2235_3623 431
96 3300042127 Ga0450890_002728 Ga0450890_002728_548_1984 431
97 3300042135 Ga0450899_002836 Ga0450899_002836_422_1822 431
98 3300046492 Ga0495585_0013006 Ga0495585_0013006_2073_3470 431
99 3300046513 Ga0495616_0002644 Ga0495616_0002644_9462_10913 431
100 3300031238 Ga0265332_10000022 Ga0265332_1000002281 432
101 3300037312 Ga0395899_0010162 Ga0395899_0010162_293_1687 432
102 3300037418 Ga0395900_0001358 Ga0395900_0001358_27263_28657 432
103 3300037466 Ga0395898_0001019 Ga0395898_0001019_13159_14553 432
104 3300038443 Ga0395901_0037378 Ga0395901_0037378_3174_4568 432
105 3300042007 Ga0439449_0001401 Ga0439449_0001401_796_2184 432
106 3300044693 Ga0466961_0076148 Ga0466961_0076148_267_1700 432
107 3300044694 Ga0466963_0049067 Ga0466963_0049067_1127_2557 432
108 3300045049 Ga0466959_0012243 Ga0466959_0012243_3216_4649 432
109 3300003775 Ga0055524_1022480 Ga0055524_10224801 433
110 3300003794 Ga0055531_10002654 Ga0055531_1000265410 433
111 3300006944 Ga0099823_1000021 Ga0099823_10000213 433
112 3300014969 Ga0157376_10000626 Ga0157376_1000062630 433
113 3300025273 Ga0209673_1011693 Ga0209673_10116932 433
114 3300025298 Ga0209050_1002141 Ga0209050_100214111 433
115 3300025303 Ga0209051_1001292 Ga0209051_100129214 433
116 3300025304 Ga0209257_1001823 Ga0209257_100182313 433
117 3300027296 Ga0209389_1003139 Ga0209389_10031393 433
118 3300037471 Ga0395905_0092688 Ga0395905_0092688_768_2162 433
119 3300038443 Ga0395901_0097756 Ga0395901_0097756_901_2292 433
120 3300042876 Ga0451577_0007815 Ga0451577_0007815_4382_5770 433
121 3300044673 Ga0453683_0001302 Ga0453683_0001302_1300_2742 433
122 3300044683 Ga0466965_0011205 Ga0466965_0011205_204_1769 433
123 3300044684 Ga0466966_0037443 Ga0466966_0037443_710_2275 433
124 3300044693 Ga0466961_0064450 Ga0466961_0064450_171_1736 433
125 3300044694 Ga0466963_0010986 Ga0466963_0010986_3447_5012 433
126 3300044712 Ga0453684_0028762 Ga0453684_0028762_4696_6084 433
127 3300045049 Ga0466959_0000517 Ga0466959_0000517_15118_16527 433
128 3300045051 Ga0451576_0001456 Ga0451576_0001456_35918_37306 433
129 3300045051 Ga0451576_0007943 Ga0451576_0007943_8343_9785 433
130 3300045976 Ga0466967_0193441 Ga0466967_0193441_283_1848 433
131 3300025291 Ga0209675_1000065 Ga0209675_100006534 434
132 3300025292 Ga0209676_1000044 Ga0209676_100004434 434
133 3300025294 Ga0209025_1000147 Ga0209025_1000147165 434
134 3300025295 Ga0209564_1000080 Ga0209564_100008034 434
135 3300003792 Ga0055540_1005291 Ga0055540_10052915 435
136 3300003794 Ga0055531_10002019 Ga0055531_100020197 435
137 3300005364 Ga0070673_100005052 Ga0070673_1000050526 435
138 3300005367 Ga0070667_100008659 Ga0070667_1000086595 435
139 3300005563 Ga0068855_100062109 Ga0068855_1000621095 435
140 3300006846 Ga0075430_100097066 Ga0075430_1000970662 435
141 3300009177 Ga0105248_10312744 Ga0105248_103127442 435
142 3300025303 Ga0209051_1000059 Ga0209051_100005945 435
143 3300025304 Ga0209257_1000022 Ga0209257_1000022355 435
144 3300025960 Ga0207651_10001106 Ga0207651_1000110611 435
145 3300025986 Ga0207658_10035774 Ga0207658_100357745 435
146 3300026121 Ga0207683_10092772 Ga0207683_100927724 435
147 3300039447 Ga0436361_0311269 Ga0436361_0311269_97_1404 435
148 3300046471 Ga0495650_0038063 Ga0495650_0038063_673_2070 435
149 3300048903 Ga0496100_0016373 Ga0496100_0016373_2147_3544 435
150 3300048904 Ga0496101_0020034 Ga0496101_0020034_2901_4298 435
151 3300048905 Ga0496102_0037471 Ga0496102_0037471_1274_2671 435
152 3300048907 Ga0496104_0082870 Ga0496104_0082870_834_2141 435
153 3300048907 Ga0496104_0088883 Ga0496104_0088883_129_1526 435
154 3300048908 Ga0496105_0005792 Ga0496105_0005792_2112_3509 435
155 3300009148 Ga0105243_10097804 Ga0105243_100978042 436
156 3300021361 Ga0213872_10002121 Ga0213872_100021213 436
157 3300025256 Ga0209759_1003786 Ga0209759_10037864 436
158 3300025294 Ga0209025_1000535 Ga0209025_10005352 436
159 3300025299 Ga0209256_1000483 Ga0209256_100048325 436
160 3300025303 Ga0209051_1012436 Ga0209051_10124363 436
161 3300031730 Ga0307516_10007800 Ga0307516_100078004 436
162 3300037312 Ga0395899_0010439 Ga0395899_0010439_4671_6062 436
163 3300037418 Ga0395900_0029177 Ga0395900_0029177_2297_3688 436
164 3300037466 Ga0395898_0009056 Ga0395898_0009056_5643_7034 436
165 3300038443 Ga0395901_0022229 Ga0395901_0022229_4278_5669 436
166 3300039447 Ga0436361_0128108 Ga0436361_0128108_9199_10587 436
167 3300042876 Ga0451577_0001786 Ga0451577_0001786_1502_3079 436
168 3300046475 Ga0495639_0011555 Ga0495639_0011555_1219_2625 436
169 3300047444 Ga0495675_0050860 Ga0495675_0050860_1307_2617 436
170 3300053136 Ga0500559_0007017 Ga0500559_0007017_1141_2547 436
171 3300003758 Ga0055532_1000666 Ga0055532_100066614 437
172 3300003760 Ga0055527_1000220 Ga0055527_10002203 437
173 3300003761 Ga0055535_1000465 Ga0055535_10004653 437
174 3300003762 Ga0055542_1001377 Ga0055542_10013773 437
175 3300003763 Ga0055529_1003887 Ga0055529_10038871 437
176 3300006038 Ga0075365_10041768 Ga0075365_100417682 437
177 3300006195 Ga0075366_10025660 Ga0075366_100256603 437
178 3300009176 Ga0105242_10152684 Ga0105242_101526842 437
179 3300025228 Ga0209672_100012 Ga0209672_100012362 437
180 3300025229 Ga0209147_100007 Ga0209147_100007410 437
181 3300025242 Ga0209258_100014 Ga0209258_100014294 437
182 3300025254 Ga0209148_1000337 Ga0209148_100033770 437
183 3300025256 Ga0209759_1017330 Ga0209759_10173302 437
184 3300025272 Ga0209455_1000138 Ga0209455_100013875 437
185 3300025935 Ga0207709_10053965 Ga0207709_100539652 437
186 3300037466 Ga0395898_0044760 Ga0395898_0044760_341_1747 437
187 3300037471 Ga0395905_0051133 Ga0395905_0051133_287_1681 437
188 3300038443 Ga0395901_0006622 Ga0395901_0006622_2719_4125 437
189 3300046506 Ga0495583_0000524 Ga0495583_0000524_7591_9009 437
190 3300046507 Ga0495606_0002526 Ga0495606_0002526_17449_18867 437
191 3300046684 Ga0495669_0031019 Ga0495669_0031019_892_2310 437
192 3300046694 Ga0495649_0003434 Ga0495649_0003434_7622_9040 437
193 3300046794 Ga0495589_0006539 Ga0495589_0006539_2353_3771 437
194 3300050493 nmdc:mga0k408_47872_c1 nmdc:mga0k408_47872_c1_968_2416 437
195 3300053177 Ga0500636_0008509 Ga0500636_0008509_3367_4785 437
196 3300005262 Ga0065165_1011569 Ga0065165_10115693 438
197 3300005327 Ga0070658_10164391 Ga0070658_101643912 438
198 3300025909 Ga0207705_10177841 Ga0207705_101778412 438
199 3300025942 Ga0207689_10155514 Ga0207689_101555142 438
200 3300005330 Ga0070690_100008031 Ga0070690_1000080317 439
201 3300025913 Ga0207695_10007510 Ga0207695_1000751015 439
202 3300028794 Ga0307515_10052598 Ga0307515_100525985 439
203 3300037418 Ga0395900_0028686 Ga0395900_0028686_366_1760 439
204 3300037466 Ga0395898_0062959 Ga0395898_0062959_184_1578 439
205 3300038443 Ga0395901_0023747 Ga0395901_0023747_2897_4318 439
206 3300038443 Ga0395901_0064492 Ga0395901_0064492_79_1473 439
207 3300042157 Ga0439458_0010152 Ga0439458_0010152_640_2043 439
208 3300025294 Ga0209025_1006282 Ga0209025_10062827 440
209 3300037471 Ga0395905_0000353 Ga0395905_0000353_28012_29415 440
210 3300041404 Ga0439436_0003337 Ga0439436_0003337_2739_4136 441
211 3300045051 Ga0451576_0068705 Ga0451576_0068705_727_2127 441
212 3300044712 Ga0453684_0011162 Ga0453684_0011162_13792_15123 443
213 3300028800 Ga0265338_10000355 Ga0265338_1000035553 444
214 3300053177 Ga0500636_0011574 Ga0500636_0011574_3556_4929 444
215 3300031548 Ga0307408_100000210 Ga0307408_10000021011 445
216 3300046459 Ga0495629_0000352 Ga0495629_0000352_26431_27768 445
217 3300048920 Ga0496117_0000903 Ga0496117_0000903_36798_38135 445
218 3300048929 Ga0496126_0242339 Ga0496126_0242339_133_1470 445
219 3300001979 JGI24740J21852_10013997 JGI24740J21852_100139973 446
220 3300028800 Ga0265338_10000644 Ga0265338_1000064426 446
221 3300031901 Ga0307406_10000109 Ga0307406_1000010945 446
222 3300053122 Ga0500608_030466 Ga0500608_030466_950_2380 446
223 3300003771 Ga0055526_1005727 Ga0055526_10057272 447
224 3300022467 Ga0224712_10000078 Ga0224712_1000007813 447
225 3300025263 Ga0209565_1000026 Ga0209565_1000026215 447
226 3300025284 Ga0209130_1000644 Ga0209130_100064419 447
227 3300025291 Ga0209675_1000308 Ga0209675_100030815 447
228 3300025295 Ga0209564_1000021 Ga0209564_1000021157 447
229 3300025295 Ga0209564_1001304 Ga0209564_10013046 447
230 3300025297 Ga0209758_1023905 Ga0209758_10239052 447
231 3300031344 Ga0265316_10035203 Ga0265316_100352032 447
232 3300031344 Ga0265316_10129367 Ga0265316_101293671 447
233 3300039447 Ga0436361_0844713 Ga0436361_0844713_8554_9897 447
234 3300035691 Ga0373931_0040471 Ga0373931_0040471_631_2031 449
235 3300044656 Ga0466969_0046169 Ga0466969_0046169_729_2111 450
236 3300044683 Ga0466965_0032378 Ga0466965_0032378_473_1855 450
237 3300044693 Ga0466961_0000519 Ga0466961_0000519_955_2337 450
238 3300044706 Ga0466964_0061061 Ga0466964_0061061_36_1418 450
239 3300045049 Ga0466959_0002541 Ga0466959_0002541_9975_11357 450
240 3300026023 Ga0207677_10135653 Ga0207677_101356532 451
241 3300048924 Ga0496121_0100302 Ga0496121_0100302_348_1703 451
242 3300049822 Ga0501035_0163035 Ga0501035_0163035_406_1812 452
243 3300053729 Ga0500625_055483 Ga0500625_055483_206_1603 452
244 3300001979 JGI24740J21852_10013384 JGI24740J21852_100133843 453
245 3300003761 Ga0055535_1000185 Ga0055535_100018538 453
246 3300003762 Ga0055542_1000003 Ga0055542_1000003250 453
247 3300004625 Ga0055543_1005219 Ga0055543_10052192 453
248 3300006946 Ga0079104_1000026 Ga0079104_1000026221 453
249 3300009148 Ga0105243_10016453 Ga0105243_100164533 453
250 3300025228 Ga0209672_102247 Ga0209672_1022472 453
251 3300025229 Ga0209147_101724 Ga0209147_1017244 453
252 3300025242 Ga0209258_100015 Ga0209258_100015369 453
253 3300025245 Ga0207425_1000582 Ga0207425_100058221 453
254 3300025254 Ga0209148_1000028 Ga0209148_1000028300 453
255 3300025258 Ga0209129_1002293 Ga0209129_10022938 453
256 3300025284 Ga0209130_1007065 Ga0209130_10070652 453
257 3300025291 Ga0209675_1000937 Ga0209675_100093718 453
258 3300025294 Ga0209025_1000349 Ga0209025_100034934 453
259 3300025295 Ga0209564_1000294 Ga0209564_100029434 453
260 3300025297 Ga0209758_1000039 Ga0209758_1000039302 453
261 3300025299 Ga0209256_1000230 Ga0209256_100023034 453
262 3300025302 Ga0207426_1000108 Ga0207426_100010840 453
263 3300025321 Ga0207656_10003939 Ga0207656_100039392 453
264 3300025935 Ga0207709_10000079 Ga0207709_1000007912 453
265 3300027111 Ga0209281_1000067 Ga0209281_1000067279 453
266 3300031711 Ga0265314_10024895 Ga0265314_100248955 453
267 3300006177 Ga0075362_10017330 Ga0075362_100173302 454
268 3300002773 JGI25152J39213_1006998 JGI25152J39213_10069982 455
269 3300025263 Ga0209565_1000236 Ga0209565_100023638 455
270 3300025273 Ga0209673_1000556 Ga0209673_100055638 455
271 3300005539 Ga0068853_100077956 Ga0068853_1000779562 456
272 3300053156 Ga0500622_0000128 Ga0500622_0000128_13330_14748 456
273 3300003578 Ga0006562J51391_1059273 Ga0006562J51391_105927310 457
274 3300003578 Ga0006562J51391_1059275 Ga0006562J51391_10592754 457
275 3300003791 Ga0055530_10000780 Ga0055530_1000078015 457
276 3300004625 Ga0055543_1011113 Ga0055543_10111132 457
277 3300025284 Ga0209130_1007848 Ga0209130_10078482 457
278 3300025291 Ga0209675_1001932 Ga0209675_100193210 457
279 3300025292 Ga0209676_1000074 Ga0209676_100007489 457
280 3300025294 Ga0209025_1024516 Ga0209025_10245162 457
281 3300025295 Ga0209564_1001177 Ga0209564_10011772 457
282 3300025298 Ga0209050_1000015 Ga0209050_1000015381 457
283 3300025299 Ga0209256_1000136 Ga0209256_100013658 457
284 3300025302 Ga0207426_1000130 Ga0207426_100013020 457
285 3300025303 Ga0209051_1000010 Ga0209051_1000010381 457
286 3300025303 Ga0209051_1000175 Ga0209051_10001752 457
287 3300025304 Ga0209257_1000026 Ga0209257_1000026296 457
288 3300028794 Ga0307515_10002916 Ga0307515_1000291628 457
289 3300031649 Ga0307514_10001425 Ga0307514_100014258 457
290 3300037418 Ga0395900_0000482 Ga0395900_0000482_30478_31896 457
291 3300037466 Ga0395898_0001191 Ga0395898_0001191_12945_14363 457
292 iso_pu_bacteria 2818991446 2819597829 457
293 iso_pu_bacteria 2899924645 2899929245 457
294 iso_pu_bacteria 2928037797 2928040314 457
295 iso_pu_bacteria 2928044640 2928046937 457
296 iso_pu_bacteria 2928051484 2928057863 457
297 3300013306 Ga0163162_10080651 Ga0163162_100806513 458
298 3300027876 Ga0209974_10004452 Ga0209974_100044526 458
299 iso_pu_bacteria 2574179768 2574431245 458
300 iso_pu_bacteria 2599185292 2599907098 458
301 iso_pu_bacteria 2643221569 2643863307 458
302 iso_pu_bacteria 2643221594 2643978705 458
303 iso_pu_bacteria 2643221621 2644125118 458
304 iso_pu_bacteria 2739367655 2739612387 458
305 iso_pu_bacteria 2808606395 2809036537 458
306 iso_pu_bacteria 2857537821 2857541272 458
307 iso_pu_bacteria 2858950400 2858950437 458
308 iso_pu_bacteria 2881927736 2881930790 458
309 iso_pu_bacteria 2884811622 2884814092 458
310 iso_pu_bacteria 2884836552 2884838029 458
311 iso_pu_bacteria 2884852848 2884854322 458
312 iso_pu_bacteria 2885198086 2885204038 458
313 iso_pu_bacteria 2885211737 2885217628 458
314 iso_pu_bacteria 2896154374 2896154562 458
315 iso_pu_bacteria 2941479691 2941481152 458
316 3300025949 Ga0207667_10001765 Ga0207667_100017654 459
317 3300031730 Ga0307516_10005084 Ga0307516_100050842 459
318 iso_pu_bacteria 2513020051 2513226860 459
319 iso_pu_bacteria 2513237166 2514046802 459
320 iso_pu_bacteria 2562617112 2563055413 459
321 iso_pu_bacteria 2585428057 2587727181 459
322 iso_pu_bacteria 2588253510 2588291593 459
323 iso_pu_bacteria 2643221658 2644327168 459
324 iso_pu_bacteria 2711768613 2713478942 459
325 iso_pu_bacteria 2791355137 2792832647 459
326 iso_pu_bacteria 2904615490 2904619998 459
327 3300001990 JGI24737J22298_10010218 JGI24737J22298_100102182 460
328 3300002067 JGI24735J21928_10000217 JGI24735J21928_1000021716 460
329 3300003215 JGI25153J46596_10001180 JGI25153J46596_100011806 460
330 3300005262 Ga0065165_1002614 Ga0065165_100261412 460
331 3300005335 Ga0070666_10018556 Ga0070666_100185564 460
332 3300005356 Ga0070674_100053208 Ga0070674_1000532082 460
333 3300005367 Ga0070667_100002289 Ga0070667_1000022896 460
334 3300005455 Ga0070663_100002714 Ga0070663_1000027142 460
335 3300005543 Ga0070672_100046580 Ga0070672_1000465802 460
336 3300005548 Ga0070665_100116011 Ga0070665_1001160112 460
337 3300006048 Ga0075363_100057489 Ga0075363_1000574892 460
338 3300006178 Ga0075367_10018282 Ga0075367_100182822 460
339 3300006353 Ga0075370_10053416 Ga0075370_100534162 460
340 3300009011 Ga0105251_10000211 Ga0105251_1000021117 460
341 3300009036 Ga0105244_10063374 Ga0105244_100633741 460
342 3300009093 Ga0105240_10112665 Ga0105240_101126653 460
343 3300009177 Ga0105248_10074259 Ga0105248_100742592 460
344 3300009545 Ga0105237_10054967 Ga0105237_100549675 460
345 3300013306 Ga0163162_10003869 Ga0163162_1000386911 460
346 3300013308 Ga0157375_10129342 Ga0157375_101293422 460
347 3300025297 Ga0209758_1000167 Ga0209758_1000167116 460
348 3300025735 Ga0207713_1021513 Ga0207713_10215132 460
349 3300025903 Ga0207680_10006279 Ga0207680_100062794 460
350 3300025904 Ga0207647_10004914 Ga0207647_100049145 460
351 3300025913 Ga0207695_10156468 Ga0207695_101564683 460
352 3300025931 Ga0207644_10083920 Ga0207644_100839202 460
353 3300025940 Ga0207691_10217061 Ga0207691_102170611 460
354 3300025941 Ga0207711_10012824 Ga0207711_100128243 460
355 3300026067 Ga0207678_10006418 Ga0207678_100064186 460
356 3300030522 Ga0307512_10029212 Ga0307512_100292126 460
357 3300031507 Ga0307509_10002265 Ga0307509_1000226525 460
358 3300033180 Ga0307510_10000311 Ga0307510_1000031143 460
359 3300033180 Ga0307510_10008623 Ga0307510_1000862311 460
360 3300037471 Ga0395905_0004513 Ga0395905_0004513_12062_13444 460
361 3300046457 Ga0495590_0017538 Ga0495590_0017538_1158_2540 460
362 3300046460 Ga0495638_0002429 Ga0495638_0002429_6377_7759 460
363 3300046463 Ga0495653_0027961 Ga0495653_0027961_2180_3562 460
364 3300046463 Ga0495653_0049484 Ga0495653_0049484_1415_2797 460
365 3300046471 Ga0495650_0002414 Ga0495650_0002414_8685_10067 460
366 3300046471 Ga0495650_0033061 Ga0495650_0033061_502_1884 460
367 3300046472 Ga0495580_0010049 Ga0495580_0010049_3204_4586 460
368 3300046477 Ga0495664_0001870 Ga0495664_0001870_6886_8268 460
369 3300046492 Ga0495585_0037449 Ga0495585_0037449_1251_2633 460
370 3300046501 Ga0495607_0042857 Ga0495607_0042857_1265_2647 460
371 3300046507 Ga0495606_0057595 Ga0495606_0057595_723_2105 460
372 3300046511 Ga0495608_0098216 Ga0495608_0098216_436_1818 460
373 3300046515 Ga0495620_0007766 Ga0495620_0007766_4125_5507 460
374 3300046543 Ga0495645_0000718 Ga0495645_0000718_12455_13837 460
375 3300046543 Ga0495645_0040006 Ga0495645_0040006_713_2095 460
376 3300046615 Ga0495656_0010482 Ga0495656_0010482_1610_3004 460
377 3300046689 Ga0495613_0037105 Ga0495613_0037105_1833_3215 460
378 3300046694 Ga0495649_0002157 Ga0495649_0002157_3628_5010 460
379 3300046794 Ga0495589_0009446 Ga0495589_0009446_1504_2886 460
380 3300046794 Ga0495589_0021747 Ga0495589_0021747_1474_2856 460
381 3300047315 Ga0495581_0000793 Ga0495581_0000793_4654_6036 460
382 3300047319 Ga0495674_0010029 Ga0495674_0010029_6192_7574 460
383 3300047319 Ga0495674_0017631 Ga0495674_0017631_2347_3729 460
384 3300047323 Ga0495683_0002705 Ga0495683_0002705_6526_7908 460
385 3300047443 Ga0495687_006704 Ga0495687_006704_4280_5662 460
386 3300047472 Ga0495686_0000374 Ga0495686_0000374_15730_17112 460
387 3300047673 Ga0495593_0008192 Ga0495593_0008192_1587_2969 460
388 3300048903 Ga0496100_0008418 Ga0496100_0008418_2675_4057 460
389 3300048905 Ga0496102_0005686 Ga0496102_0005686_8099_9481 460
390 3300048905 Ga0496102_0033647 Ga0496102_0033647_1521_2903 460
391 3300048907 Ga0496104_0002921 Ga0496104_0002921_12122_13504 460
392 3300048908 Ga0496105_0004864 Ga0496105_0004864_4429_5811 460
393 3300048909 Ga0496106_0013696 Ga0496106_0013696_2523_3905 460
394 3300048910 Ga0496107_0003723 Ga0496107_0003723_6973_8355 460
395 3300048913 Ga0496110_0035252 Ga0496110_0035252_886_2268 460
396 3300048921 Ga0496118_0022146 Ga0496118_0022146_1898_3280 460
397 3300048926 Ga0496123_0034133 Ga0496123_0034133_1142_2524 460
398 3300048928 Ga0496125_0003797 Ga0496125_0003797_12827_14209 460
399 3300053088 Ga0500644_0003048 Ga0500644_0003048_2317_3720 460
400 3300053136 Ga0500559_0000954 Ga0500559_0000954_2481_3884 460
401 3300053156 Ga0500622_0003490 Ga0500622_0003490_2863_4266 460
402 iso_pu_bacteria 2547132512 2548848650 460
403 iso_pu_bacteria 2842733646 2842737021 460
404 iso_pu_bacteria 2842747753 2842750261 460
405 iso_pu_bacteria 2855730933 2855736476 460
406 iso_pu_bacteria 2855767633 2855773413 460
407 iso_pu_bacteria 2881101125 2881101410 460
408 iso_pu_bacteria 2885192300 2885194495 460
409 iso_pu_bacteria 2904541872 2904542886 460
410 iso_pu_bacteria 2919704043 2919705106 460
411 iso_pu_bacteria 2929160207 2929166302 460
412 iso_pu_bacteria 2932422444 2932423002 460
413 iso_pu_bacteria 8039098773 8039103089 460
414 3300014497 Ga0182008_10012611 Ga0182008_100126113 461
415 3300015261 Ga0182006_1007161 Ga0182006_10071615 461
416 3300015262 Ga0182007_10001922 Ga0182007_100019224 461
417 3300015683 Ga0183362_10004 Ga0183362_10004173 461
418 3300025923 Ga0207681_10005024 Ga0207681_100050247 461
419 3300028379 Ga0268266_10084656 Ga0268266_100846563 461
420 3300028794 Ga0307515_10000034 Ga0307515_10000034146 461
421 3300031250 Ga0265331_10002656 Ga0265331_100026562 461
422 3300031251 Ga0265327_10001640 Ga0265327_1000164012 461
423 3300031251 Ga0265327_10017441 Ga0265327_100174414 461
424 3300031456 Ga0307513_10151271 Ga0307513_101512712 461
425 3300042007 Ga0439449_0004682 Ga0439449_0004682_2302_3699 461
426 3300046542 Ga0495597_0000256 Ga0495597_0000256_3284_4681 461
427 3300048906 Ga0496103_0035729 Ga0496103_0035729_418_1815 461
428 3300048909 Ga0496106_0018968 Ga0496106_0018968_3430_4875 461
429 3300048925 Ga0496122_0004040 Ga0496122_0004040_12361_13758 461
430 3300048926 Ga0496123_0000299 Ga0496123_0000299_27783_29180 461
431 iso_pu_bacteria 2511231002 2511243840 461
432 iso_pu_bacteria 2519103095 2519460856 461
433 iso_pu_bacteria 2547132374 2548499447 461
434 iso_pu_bacteria 2582581311 2585293585 461
435 iso_pu_bacteria 2599185214 2599621645 461
436 iso_pu_bacteria 2599185226 2599670671 461
437 iso_pu_bacteria 2599185227 2599679161 461
438 iso_pu_bacteria 2599185229 2599691156 461
439 iso_pu_bacteria 2599185239 2599741260 461
440 iso_pu_bacteria 2599185240 2599743959 461
441 iso_pu_bacteria 2599185355 2600206974 461
442 iso_pu_bacteria 2643221609 2644057485 461
443 iso_pu_bacteria 2643221611 2644072426 461
444 iso_pu_bacteria 2643221672 2644398972 461
445 iso_pu_bacteria 2643221717 2644648111 461
446 iso_pu_bacteria 2675903129 2676742256 461
447 iso_pu_bacteria 2721755523 2722883038 461
448 iso_pu_bacteria 2738543012 2739241756 461
449 iso_pu_bacteria 2808606390 2809003731 461
450 iso_pu_bacteria 2808606391 2809011008 461
451 iso_pu_bacteria 2816332133 2816470939 461
452 iso_pu_bacteria 2816332253 2817259289 461
453 iso_pu_bacteria 2816332256 2817280299 461
454 iso_pu_bacteria 2816332286 2817456525 461
455 iso_pu_bacteria 2818991452 2819636346 461
456 iso_pu_bacteria 2831265667 2831268801 461
457 iso_pu_bacteria 2838054893 2838058227 461
458 iso_pu_bacteria 2856287931 2856290610 461
459 iso_pu_bacteria 2857357740 2857358976 461
460 iso_pu_bacteria 2863421361 2863425088 461
461 iso_pu_bacteria 2870068957 2870074322 461
462 iso_pu_bacteria 2885266251 2885268618 461
463 iso_pu_bacteria 2900577576 2900582430 461
464 iso_pu_bacteria 2904456579 2904458109 461
465 iso_pu_bacteria 2904564687 2904568143 461
466 iso_pu_bacteria 2904571731 2904575132 461
467 iso_pu_bacteria 2928058823 2928059017 461
468 iso_pu_bacteria 2928070936 2928072308 461
469 iso_pu_bacteria 2928157003 2928161115 461
470 iso_pu_bacteria 2928163908 2928165960 461
471 iso_pu_bacteria 2928170801 2928170946 461
472 iso_pu_bacteria 2928536128 2928536650 461
473 iso_pu_bacteria 2929520902 2929526285 461
474 iso_pu_bacteria 2939631187 2939634795 461
475 iso_pu_bacteria 2974320154 2974320783 461
476 iso_pu_bacteria 2981990288 2981991213 461
477 iso_pu_bacteria 641736154 642414001 461
478 iso_pu_bacteria 8018845410 8018852932 461
479 iso_pu_bacteria 8020807995 8020808663 461
480 iso_pu_bacteria 8020938398 8020943624 461
481 iso_pu_bacteria 8020945358 8020950174 461
482 iso_pu_bacteria 8020953355 8020953660 461
483 iso_pu_bacteria 8021120328 8021126455 461
484 iso_pu_bacteria 8040167225 8040171314 461
485 iso_pu_bacteria 8040173305 8040176108 461
486 3300002704 JGI25155J39150_1000677 JGI25155J39150_10006772 462
487 3300002705 JGI25156J39149_1002526 JGI25156J39149_10025265 462
488 3300002738 JGI25154J39366_1001220 JGI25154J39366_10012207 462
489 3300003187 JGI25151J46595_10001862 JGI25151J46595_100018628 462
490 3300006195 Ga0075366_10001317 Ga0075366_100013178 462
491 3300009176 Ga0105242_10000557 Ga0105242_100005579 462
492 3300025206 Ga0209435_100153 Ga0209435_10015319 462
493 3300025246 Ga0209646_1000021 Ga0209646_1000021253 462
494 3300025250 Ga0209026_1001840 Ga0209026_10018407 462
495 3300025256 Ga0209759_1000100 Ga0209759_1000100127 462
496 3300025294 Ga0209025_1000040 Ga0209025_1000040156 462
497 3300028786 Ga0307517_10001469 Ga0307517_1000146932 462
498 3300028786 Ga0307517_10137654 Ga0307517_101376542 462
499 3300031250 Ga0265331_10012909 Ga0265331_100129091 462
500 3300031456 Ga0307513_10068643 Ga0307513_100686434 462
501 3300031616 Ga0307508_10001483 Ga0307508_1000148311 462
502 3300031616 Ga0307508_10004164 Ga0307508_100041649 462
503 3300031911 Ga0307412_10003062 Ga0307412_100030623 462
504 3300045051 Ga0451576_0000320 Ga0451576_0000320_85737_87173 462
505 3300048920 Ga0496117_0005311 Ga0496117_0005311_11991_13379 462
506 3300048921 Ga0496118_0011051 Ga0496118_0011051_5314_6702 462
507 3300048922 Ga0496119_0013369 Ga0496119_0013369_1835_3223 462
508 3300048923 Ga0496120_0001845 Ga0496120_0001845_16021_17409 462
509 3300048924 Ga0496121_0000124 Ga0496121_0000124_34389_35777 462
510 3300048925 Ga0496122_0000316 Ga0496122_0000316_30831_32219 462
511 3300048925 Ga0496122_0070368 Ga0496122_0070368_371_1759 462
512 3300048926 Ga0496123_0000297 Ga0496123_0000297_30831_32219 462
513 3300048926 Ga0496123_0032562 Ga0496123_0032562_1335_2723 462
514 3300048927 Ga0496124_0109089 Ga0496124_0109089_10_1398 462
515 3300048928 Ga0496125_0000116 Ga0496125_0000116_16029_17417 462
516 3300048929 Ga0496126_0046904 Ga0496126_0046904_1050_2492 462
517 3300048929 Ga0496126_0056042 Ga0496126_0056042_2066_3454 462
518 3300049573 Ga0501037_0026522 Ga0501037_0026522_1026_2414 462
519 3300050493 nmdc:mga0k408_4596_c1 nmdc:mga0k408_4596_c1_3555_4964 462
520 iso_pu_bacteria 2501025501 2501072579 462
521 iso_pu_bacteria 2501025502 2501083197 462
522 iso_pu_bacteria 2501025504 2501412495 462
523 iso_pu_bacteria 2510917013 2511088125 462
524 iso_pu_bacteria 2510917014 2511101373 462
525 iso_pu_bacteria 2510917015 2511108024 462
526 iso_pu_bacteria 2511231003 2511248666 462
527 iso_pu_bacteria 2513237082 2513552567 462
528 iso_pu_bacteria 2513237083 2513560693 462
529 iso_pu_bacteria 2513237150 2513956272 462
530 iso_pu_bacteria 2513237165 2514042585 462
531 iso_pu_bacteria 2515154189 2516021744 462
532 iso_pu_bacteria 2643221570 2643866268 462
533 iso_pu_bacteria 2643221596 2643994258 462
534 iso_pu_bacteria 2643221652 2644293068 462
535 iso_pu_bacteria 2738541277 2738721724 462
536 iso_pu_bacteria 2738543019 2739282088 462
537 iso_pu_bacteria 2842677519 2842678174 462
538 iso_pu_bacteria 2842718218 2842718244 462
539 iso_pu_bacteria 2881412998 2881418631 462
540 iso_pu_bacteria 2883087390 2883090257 462
541 iso_pu_bacteria 2901300506 2901311323 462
542 iso_pu_bacteria 2919462493 2919465550 462
543 iso_pu_bacteria 2954767861 2954769762 462
544 iso_pu_bacteria 644736347 644746356 462
545 iso_pu_bacteria 8003955200 8003958350 462
546 3300003320 rootH2_10011155 rootH2_100111553 463
547 3300003354 JGI25160J50197_1000016 JGI25160J50197_100001669 463
548 3300003758 Ga0055532_1000630 Ga0055532_100063015 463
549 3300003758 Ga0055532_1003080 Ga0055532_10030802 463
550 3300003760 Ga0055527_1001376 Ga0055527_10013764 463
551 3300003761 Ga0055535_1000739 Ga0055535_10007393 463
552 3300003762 Ga0055542_1000759 Ga0055542_10007593 463
553 3300003763 Ga0055529_1000115 Ga0055529_10001153 463
554 3300003790 Ga0055528_1000993 Ga0055528_10009935 463
555 3300003856 Ga0058692_1002447 Ga0058692_10024476 463
556 3300005262 Ga0065165_1000154 Ga0065165_100015469 463
557 3300005339 Ga0070660_100000020 Ga0070660_10000002068 463
558 3300005366 Ga0070659_100000047 Ga0070659_10000004768 463
559 3300005455 Ga0070663_100000151 Ga0070663_10000015126 463
560 3300005563 Ga0068855_100083905 Ga0068855_1000839054 463
561 3300005616 Ga0068852_100105043 Ga0068852_1001050432 463
562 3300009093 Ga0105240_10014985 Ga0105240_1001498511 463
563 3300009551 Ga0105238_10028412 Ga0105238_100284125 463
564 3300016635 Ga0183361_10001 Ga0183361_10001554 463
565 3300025225 Ga0209566_100136 Ga0209566_1001363 463
566 3300025226 Ga0209674_102342 Ga0209674_1023422 463
567 3300025228 Ga0209672_100086 Ga0209672_10008612 463
568 3300025229 Ga0209147_100064 Ga0209147_10006497 463
569 3300025229 Ga0209147_100174 Ga0209147_10017411 463
570 3300025230 Ga0209563_103374 Ga0209563_1033742 463
571 3300025242 Ga0209258_100114 Ga0209258_100114118 463
572 3300025254 Ga0209148_1000115 Ga0209148_1000115118 463
573 3300025272 Ga0209455_1000109 Ga0209455_1000109118 463
574 3300025273 Ga0209673_1000101 Ga0209673_100010117 463
575 3300025292 Ga0209676_1004352 Ga0209676_10043524 463
576 3300025295 Ga0209564_1005804 Ga0209564_10058043 463
577 3300025298 Ga0209050_1001799 Ga0209050_100179914 463
578 3300025302 Ga0207426_1000007 Ga0207426_1000007592 463
579 3300025711 Ga0207696_1014443 Ga0207696_10144433 463
580 3300025904 Ga0207647_10008405 Ga0207647_100084053 463
581 3300025913 Ga0207695_10011994 Ga0207695_1001199411 463
582 3300025919 Ga0207657_10000310 Ga0207657_1000031018 463
583 3300025924 Ga0207694_10120435 Ga0207694_101204352 463
584 3300025932 Ga0207690_10000037 Ga0207690_1000003736 463
585 3300025949 Ga0207667_10006421 Ga0207667_1000642112 463
586 3300026067 Ga0207678_10000339 Ga0207678_1000033936 463
587 3300026142 Ga0207698_10079191 Ga0207698_100791912 463
588 3300027312 Ga0209371_1000080 Ga0209371_1000080163 463
589 3300028794 Ga0307515_10000131 Ga0307515_1000013165 463
590 3300030500 Ga0268256_1000336 Ga0268256_100033618 463
591 3300031250 Ga0265331_10035423 Ga0265331_100354232 463
592 3300031251 Ga0265327_10000158 Ga0265327_1000015811 463
593 3300031456 Ga0307513_10000057 Ga0307513_1000005782 463
594 3300037471 Ga0395905_0000079 Ga0395905_0000079_67870_69261 463
595 3300037471 Ga0395905_0100862 Ga0395905_0100862_648_2039 463
596 3300042876 Ga0451577_0095863 Ga0451577_0095863_608_2008 463
597 3300044712 Ga0453684_0006506 Ga0453684_0006506_11961_13361 463
598 3300046455 Ga0495603_0005536 Ga0495603_0005536_4092_5483 463
599 3300046472 Ga0495580_0003741 Ga0495580_0003741_4879_6270 463
600 3300046524 Ga0495648_0041457 Ga0495648_0041457_887_2278 463
601 3300046558 Ga0495633_0000235 Ga0495633_0000235_1041_2450 463
602 3300047469 Ga0495673_0007022 Ga0495673_0007022_2265_3656 463
603 3300048904 Ga0496101_0005299 Ga0496101_0005299_4770_6161 463
604 3300048905 Ga0496102_0003139 Ga0496102_0003139_4246_5637 463
605 3300048906 Ga0496103_0002330 Ga0496103_0002330_9684_11075 463
606 3300048908 Ga0496105_0095766 Ga0496105_0095766_633_2024 463
607 3300048915 Ga0496112_0024010 Ga0496112_0024010_2883_4274 463
608 3300048918 Ga0496115_0139227 Ga0496115_0139227_408_1799 463
609 3300048920 Ga0496117_0013817 Ga0496117_0013817_935_2326 463
610 3300048921 Ga0496118_0038666 Ga0496118_0038666_802_2193 463
611 3300048924 Ga0496121_0010596 Ga0496121_0010596_8830_10221 463
612 3300048924 Ga0496121_0027162 Ga0496121_0027162_914_2305 463
613 3300048928 Ga0496125_0003822 Ga0496125_0003822_14842_16251 463
614 3300048929 Ga0496126_0048700 Ga0496126_0048700_833_2242 463
615 3300049656 Ga0501209_004721 Ga0501209_004721_803_2257 463
616 3300049823 Ga0501044_0000174 Ga0501044_0000174_60978_62417 463
617 3300053730 Ga0500645_001312 Ga0500645_001312_6271_7692 463
618 iso_pu_bacteria 2508501125 2509131789 463
619 iso_pu_bacteria 2510065045 2510252898 463
620 iso_pu_bacteria 2512047030 2512346869 463
621 iso_pu_bacteria 2513237151 2513959461 463
622 iso_pu_bacteria 2515154122 2515681941 463
623 iso_pu_bacteria 2526164713 2527079556 463
624 iso_pu_bacteria 2585428058 2587731872 463
625 iso_pu_bacteria 2643221592 2643970734 463
626 iso_pu_bacteria 2643221625 2644138994 463
627 iso_pu_bacteria 2643221628 2644163606 463
628 iso_pu_bacteria 2643221648 2644274604 463
629 iso_pu_bacteria 2643221654 2644302409 463
630 iso_pu_bacteria 2643221683 2644465798 463
631 iso_pu_bacteria 2718217991 2719638698 463
632 iso_pu_bacteria 2738541296 2738822248 463
633 iso_pu_bacteria 2738541298 2738836616 463
634 iso_pu_bacteria 2738541306 2738875934 463
635 iso_pu_bacteria 2738543002 2739187886 463
636 iso_pu_bacteria 2738543008 2739222532 463
637 iso_pu_bacteria 2738543013 2739247686 463
638 iso_pu_bacteria 2744054900 2746086631 463
639 iso_pu_bacteria 2744054901 2746094030 463
640 iso_pu_bacteria 2751185846 2753568500 463
641 iso_pu_bacteria 2818991450 2819624127 463
642 iso_pu_bacteria 2842324504 2842328988 463
643 iso_pu_bacteria 2842348783 2842353593 463
644 iso_pu_bacteria 2842454564 2842462307 463
645 iso_pu_bacteria 2885270888 2885276250 463
646 iso_pu_bacteria 2900634093 2900636695 463
647 iso_pu_bacteria 2902682994 2902688822 463
648 iso_pu_bacteria 2904483920 2904488232 463
649 iso_pu_bacteria 2919527303 2919531005 463
650 iso_pu_bacteria 2928084124 2928085514 463
651 iso_pu_bacteria 2928108538 2928112767 463
652 iso_pu_bacteria 2928135762 2928141784 463
653 iso_pu_bacteria 2928503688 2928508382 463
654 iso_pu_bacteria 2945934425 2945934956 463
655 iso_pu_bacteria 2945945610 2945950841 463
656 iso_pu_bacteria 2945972063 2945974533 463
657 iso_pu_bacteria 2945984333 2945989445 463
658 iso_pu_bacteria 2990703756 2990704487 463
659 iso_pu_bacteria 641736151 642424875 463
660 iso_pu_bacteria 642555113 642619617 463
661 iso_pu_bacteria 8055301274 8055304387 463
662 3300001979 JGI24740J21852_10000036 JGI24740J21852_100000365 464
663 3300006058 Ga0075432_10008080 Ga0075432_100080802 464
664 3300021361 Ga0213872_10000124 Ga0213872_100001242 464
665 3300021361 Ga0213872_10020295 Ga0213872_100202952 464
666 3300025298 Ga0209050_1000467 Ga0209050_100046742 464
667 3300028666 Ga0265336_10000808 Ga0265336_1000080814 464
668 3300029957 Ga0265324_10000023 Ga0265324_10000023127 464
669 3300031235 Ga0265330_10000267 Ga0265330_100002675 464
670 3300031238 Ga0265332_10000031 Ga0265332_100000315 464
671 3300031241 Ga0265325_10000553 Ga0265325_1000055320 464
672 3300031247 Ga0265340_10015502 Ga0265340_100155023 464
673 3300031250 Ga0265331_10052966 Ga0265331_100529662 464
674 3300031251 Ga0265327_10051167 Ga0265327_100511671 464
675 3300031456 Ga0307513_10000034 Ga0307513_1000003477 464
676 3300031711 Ga0265314_10000095 Ga0265314_10000095123 464
677 3300031711 Ga0265314_10009731 Ga0265314_100097318 464
678 3300037418 Ga0395900_0000260 Ga0395900_0000260_1838_3232 464
679 3300037418 Ga0395900_0113933 Ga0395900_0113933_635_2083 464
680 3300037466 Ga0395898_0000437 Ga0395898_0000437_20482_21930 464
681 3300039447 Ga0436361_1106610 Ga0436361_1106610_2992_4401 464
682 3300042876 Ga0451577_0002552 Ga0451577_0002552_12263_13681 464
683 3300042876 Ga0451577_0018723 Ga0451577_0018723_1146_2564 464
684 3300044658 Ga0466972_0005428 Ga0466972_0005428_4280_5674 464
685 3300044684 Ga0466966_0007009 Ga0466966_0007009_3731_5125 464
686 3300044694 Ga0466963_0005609 Ga0466963_0005609_795_2189 464
687 3300044712 Ga0453684_0003391 Ga0453684_0003391_3339_4739 464
688 3300044712 Ga0453684_0027288 Ga0453684_0027288_331_1752 464
689 3300044719 Ga0466971_0003946 Ga0466971_0003946_118_1512 464
690 3300045051 Ga0451576_0000029 Ga0451576_0000029_124027_125427 464
691 3300045051 Ga0451576_0029727 Ga0451576_0029727_3867_5285 464
692 3300048919 Ga0496116_0000963 Ga0496116_0000963_29317_30786 464
693 3300061719 Ga0466962_0014327 Ga0466962_0014327_2199_3593 464
694 iso_pu_bacteria 2643221660 2644337419 464
695 iso_pu_bacteria 2990710928 2990714320 464
696 iso_pu_bacteria 8055266321 8055267884 464
697 3300001979 JGI24740J21852_10000047 JGI24740J21852_100000475 465
698 3300002067 JGI24735J21928_10000289 JGI24735J21928_1000028914 465
699 3300002704 JGI25155J39150_1000028 JGI25155J39150_100002825 465
700 3300002705 JGI25156J39149_1000013 JGI25156J39149_100001388 465
701 3300002705 JGI25156J39149_1003946 JGI25156J39149_10039464 465
702 3300002738 JGI25154J39366_1000032 JGI25154J39366_100003288 465
703 3300002738 JGI25154J39366_1002379 JGI25154J39366_10023792 465
704 3300002741 JGI25157J39369_1000017 JGI25157J39369_100001788 465
705 3300002987 JGI25159J45721_1000334 JGI25159J45721_10003346 465
706 3300003187 JGI25151J46595_10006981 JGI25151J46595_100069811 465
707 3300003354 JGI25160J50197_1000303 JGI25160J50197_10003035 465
708 3300003374 JGI25161J50226_1000094 JGI25161J50226_100009455 465
709 3300003752 Ga0055539_1000203 Ga0055539_100020310 465
710 3300003756 Ga0055533_1002168 Ga0055533_10021684 465
711 3300003758 Ga0055532_1000037 Ga0055532_100003732 465
712 3300003759 Ga0055525_1000453 Ga0055525_10004538 465
713 3300003761 Ga0055535_1000018 Ga0055535_100001832 465
714 3300003762 Ga0055542_1001919 Ga0055542_10019193 465
715 3300003763 Ga0055529_1000041 Ga0055529_100004132 465
716 3300003771 Ga0055526_1000854 Ga0055526_100085412 465
717 3300003771 Ga0055526_1006685 Ga0055526_10066853 465
718 3300003773 Ga0055537_1000557 Ga0055537_10005579 465
719 3300003773 Ga0055537_1004858 Ga0055537_10048583 465
720 3300003775 Ga0055524_1000306 Ga0055524_100030635 465
721 3300003784 Ga0055534_1000567 Ga0055534_10005676 465
722 3300003784 Ga0055534_1002972 Ga0055534_10029724 465
723 3300003790 Ga0055528_1000480 Ga0055528_100048019 465
724 3300003792 Ga0055540_1000449 Ga0055540_10004496 465
725 3300003794 Ga0055531_10003358 Ga0055531_100033585 465
726 3300003841 Ga0055541_1000264 Ga0055541_100026413 465
727 3300004625 Ga0055543_1000814 Ga0055543_10008146 465
728 3300005262 Ga0065165_1003847 Ga0065165_10038472 465
729 3300005327 Ga0070658_10013898 Ga0070658_100138982 465
730 3300005339 Ga0070660_100143284 Ga0070660_1001432842 465
731 3300005344 Ga0070661_100000131 Ga0070661_10000013119 465
732 3300005366 Ga0070659_100004673 Ga0070659_10000467310 465
733 3300005367 Ga0070667_100000872 Ga0070667_1000008724 465
734 3300005455 Ga0070663_100000018 Ga0070663_10000001831 465
735 3300005563 Ga0068855_100007372 Ga0068855_1000073728 465
736 3300005564 Ga0070664_100000040 Ga0070664_10000004037 465
737 3300005577 Ga0068857_100052799 Ga0068857_1000527992 465
738 3300005578 Ga0068854_100000050 Ga0068854_10000005081 465
739 3300005614 Ga0068856_100000115 Ga0068856_10000011532 465
740 3300009177 Ga0105248_10015163 Ga0105248_100151632 465
741 3300009545 Ga0105237_10109363 Ga0105237_101093631 465
742 3300010375 Ga0105239_10001422 Ga0105239_1000142223 465
743 3300013100 Ga0157373_10001431 Ga0157373_1000143110 465
744 3300013100 Ga0157373_10031577 Ga0157373_100315774 465
745 3300013104 Ga0157370_10000558 Ga0157370_1000055832 465
746 3300013104 Ga0157370_10000852 Ga0157370_1000085226 465
747 3300013104 Ga0157370_10001866 Ga0157370_1000186621 465
748 3300013105 Ga0157369_10001453 Ga0157369_1000145316 465
749 3300013105 Ga0157369_10007420 Ga0157369_100074209 465
750 3300013296 Ga0157374_10000155 Ga0157374_1000015554 465
751 3300013307 Ga0157372_10000637 Ga0157372_1000063732 465
752 3300013307 Ga0157372_10242132 Ga0157372_102421322 465
753 3300013308 Ga0157375_10010111 Ga0157375_100101118 465
754 3300015261 Ga0182006_1001960 Ga0182006_10019605 465
755 3300015262 Ga0182007_10005226 Ga0182007_100052263 465
756 3300020077 Ga0206351_10909753 Ga0206351_109097532 465
757 3300025206 Ga0209435_100003 Ga0209435_10000383 465
758 3300025208 Ga0209436_108826 Ga0209436_1088262 465
759 3300025224 Ga0209784_100434 Ga0209784_10043415 465
760 3300025224 Ga0209784_100450 Ga0209784_10045011 465
761 3300025225 Ga0209566_100329 Ga0209566_10032911 465
762 3300025226 Ga0209674_100081 Ga0209674_10008119 465
763 3300025226 Ga0209674_100089 Ga0209674_10008987 465
764 3300025226 Ga0209674_100238 Ga0209674_10023811 465
765 3300025226 Ga0209674_102156 Ga0209674_1021563 465
766 3300025228 Ga0209672_100429 Ga0209672_10042910 465
767 3300025228 Ga0209672_100708 Ga0209672_10070813 465
768 3300025229 Ga0209147_100005 Ga0209147_100005726 465
769 3300025230 Ga0209563_100170 Ga0209563_10017011 465
770 3300025242 Ga0209258_100007 Ga0209258_100007726 465
771 3300025245 Ga0207425_1001460 Ga0207425_10014605 465
772 3300025245 Ga0207425_1002114 Ga0207425_10021142 465
773 3300025246 Ga0209646_1000008 Ga0209646_100000883 465
774 3300025246 Ga0209646_1000065 Ga0209646_100006557 465
775 3300025250 Ga0209026_1000007 Ga0209026_100000783 465
776 3300025250 Ga0209026_1003235 Ga0209026_10032353 465
777 3300025253 Ga0209677_100206 Ga0209677_10020611 465
778 3300025253 Ga0209677_104243 Ga0209677_1042433 465
779 3300025254 Ga0209148_1000113 Ga0209148_1000113168 465
780 3300025256 Ga0209759_1000026 Ga0209759_1000026196 465
781 3300025256 Ga0209759_1001403 Ga0209759_10014037 465
782 3300025256 Ga0209759_1003003 Ga0209759_10030032 465
783 3300025256 Ga0209759_1009553 Ga0209759_10095532 465
784 3300025263 Ga0209565_1001226 Ga0209565_10012267 465
785 3300025272 Ga0209455_1000011 Ga0209455_1000011651 465
786 3300025273 Ga0209673_1000009 Ga0209673_1000009222 465
787 3300025273 Ga0209673_1000012 Ga0209673_1000012123 465
788 3300025284 Ga0209130_1000183 Ga0209130_100018323 465
789 3300025291 Ga0209675_1001825 Ga0209675_10018258 465
790 3300025291 Ga0209675_1006350 Ga0209675_10063504 465
791 3300025292 Ga0209676_1000013 Ga0209676_100001319 465
792 3300025292 Ga0209676_1020227 Ga0209676_10202271 465
793 3300025294 Ga0209025_1002545 Ga0209025_10025456 465
794 3300025294 Ga0209025_1008503 Ga0209025_10085033 465
795 3300025294 Ga0209025_1008734 Ga0209025_10087344 465
796 3300025295 Ga0209564_1005169 Ga0209564_10051693 465
797 3300025297 Ga0209758_1012180 Ga0209758_10121804 465
798 3300025298 Ga0209050_1000008 Ga0209050_100000819 465
799 3300025298 Ga0209050_1001933 Ga0209050_10019334 465
800 3300025299 Ga0209256_1000003 Ga0209256_1000003377 465
801 3300025302 Ga0207426_1000062 Ga0207426_1000062111 465
802 3300025303 Ga0209051_1000005 Ga0209051_100000519 465
803 3300025304 Ga0209257_1000048 Ga0209257_100004819 465
804 3300025304 Ga0209257_1008844 Ga0209257_10088445 465
805 3300025304 Ga0209257_1021842 Ga0209257_10218422 465
806 3300025904 Ga0207647_10000378 Ga0207647_1000037822 465
807 3300025909 Ga0207705_10001740 Ga0207705_100017408 465
808 3300025913 Ga0207695_10005348 Ga0207695_100053483 465
809 3300025913 Ga0207695_10148420 Ga0207695_101484202 465
810 3300025920 Ga0207649_10000315 Ga0207649_1000031514 465
811 3300025932 Ga0207690_10003232 Ga0207690_100032323 465
812 3300025941 Ga0207711_10148180 Ga0207711_101481802 465
813 3300025945 Ga0207679_10000041 Ga0207679_1000004133 465
814 3300025949 Ga0207667_10004066 Ga0207667_100040666 465
815 3300025981 Ga0207640_10000060 Ga0207640_100000607 465
816 3300025986 Ga0207658_10013545 Ga0207658_100135452 465
817 3300026067 Ga0207678_10000027 Ga0207678_1000002733 465
818 3300026078 Ga0207702_10000059 Ga0207702_1000005991 465
819 3300029957 Ga0265324_10000120 Ga0265324_1000012035 465
820 3300031239 Ga0265328_10022877 Ga0265328_100228771 465
821 3300031241 Ga0265325_10026159 Ga0265325_100261592 465
822 3300031250 Ga0265331_10000030 Ga0265331_1000003059 465
823 3300031251 Ga0265327_10000072 Ga0265327_1000007260 465
824 3300031548 Ga0307408_100001861 Ga0307408_1000018614 465
825 3300031711 Ga0265314_10000371 Ga0265314_1000037127 465
826 3300031711 Ga0265314_10020485 Ga0265314_100204852 465
827 3300037312 Ga0395899_0000035 Ga0395899_0000035_11820_13253 465
828 3300037312 Ga0395899_0127064 Ga0395899_0127064_308_1723 465
829 3300037418 Ga0395900_0000113 Ga0395900_0000113_11820_13253 465
830 3300037418 Ga0395900_0049273 Ga0395900_0049273_934_2349 465
831 3300037466 Ga0395898_0000444 Ga0395898_0000444_8644_10077 465
832 3300037466 Ga0395898_0008451 Ga0395898_0008451_8355_9752 465
833 3300038443 Ga0395901_0000062 Ga0395901_0000062_116587_117984 465
834 3300042876 Ga0451577_0000002 Ga0451577_0000002_734955_736382 465
835 3300044673 Ga0453683_0000003 Ga0453683_0000003_734955_736382 465
836 3300044684 Ga0466966_0000092 Ga0466966_0000092_1504_2901 465
837 3300044693 Ga0466961_0004756 Ga0466961_0004756_5166_6563 465
838 3300044712 Ga0453684_0000002 Ga0453684_0000002_994994_996421 465
839 3300044712 Ga0453684_0000029 Ga0453684_0000029_489446_490873 465
840 3300044719 Ga0466971_0026340 Ga0466971_0026340_529_1926 465
841 3300045049 Ga0466959_0007412 Ga0466959_0007412_1504_2901 465
842 3300045051 Ga0451576_0000004 Ga0451576_0000004_621634_623061 465
843 3300045051 Ga0451576_0000237 Ga0451576_0000237_22557_24017 465
844 3300045051 Ga0451576_0001981 Ga0451576_0001981_14509_15933 465
845 3300045836 Ga0466958_0004396 Ga0466958_0004396_4795_6192 465
846 3300045836 Ga0466958_0052106 Ga0466958_0052106_921_2318 465
847 3300046530 Ga0495654_0000361 Ga0495654_0000361_32612_34030 465
848 3300048909 Ga0496106_0000051 Ga0496106_0000051_55955_57358 465
849 3300048924 Ga0496121_0002256 Ga0496121_0002256_18641_20044 465
850 3300048929 Ga0496126_0000506 Ga0496126_0000506_41588_42985 465
851 3300059643 Ga0587072_001466 Ga0587072_001466_321_1736 465
852 3300061719 Ga0466962_0014793 Ga0466962_0014793_1942_3339 465
853 iso_pu_bacteria 2599185178 2599448181 465
854 iso_pu_bacteria 2904434214 2904437361 465
855 3300006948 Ga0099826_10000007 Ga0099826_1000000744 466
856 3300015265 Ga0182005_1005667 Ga0182005_10056672 466
857 3300020082 Ga0206353_10214114 Ga0206353_102141142 466
858 3300026067 Ga0207678_10047760 Ga0207678_100477602 466
859 3300027666 Ga0209282_1000059 Ga0209282_100005943 466
860 3300031456 Ga0307513_10045470 Ga0307513_100454702 466
861 3300037466 Ga0395898_0027395 Ga0395898_0027395_1461_2864 466
862 3300038443 Ga0395901_0000118 Ga0395901_0000118_86192_87595 466
863 3300044656 Ga0466969_0000129 Ga0466969_0000129_33478_34887 466
864 3300044683 Ga0466965_0001157 Ga0466965_0001157_7340_8749 466
865 3300044694 Ga0466963_0005173 Ga0466963_0005173_1406_2815 466
866 3300044719 Ga0466971_0005253 Ga0466971_0005253_2253_3662 466
867 3300044842 Ga0466957_0011043 Ga0466957_0011043_2998_4407 466
868 3300045049 Ga0466959_0031447 Ga0466959_0031447_263_1672 466
869 3300046474 Ga0495605_0004526 Ga0495605_0004526_41_1471 466
870 3300046500 Ga0495596_0000057 Ga0495596_0000057_45746_47176 466
871 3300046501 Ga0495607_0002727 Ga0495607_0002727_251_1681 466
872 3300046507 Ga0495606_0060690 Ga0495606_0060690_779_2209 466
873 3300046507 Ga0495606_0108290 Ga0495606_0108290_178_1608 466
874 3300046512 Ga0495610_0000543 Ga0495610_0000543_5694_7124 466
875 3300046513 Ga0495616_0004159 Ga0495616_0004159_2019_3449 466
876 3300046538 Ga0495609_0001051 Ga0495609_0001051_5385_6815 466
877 3300046665 Ga0495661_0012043 Ga0495661_0012043_1238_2668 466
878 3300046692 Ga0495671_0000364 Ga0495671_0000364_15735_17165 466
879 3300046694 Ga0495649_0007698 Ga0495649_0007698_315_1745 466
880 3300047320 Ga0495672_0005275 Ga0495672_0005275_2458_3888 466
881 3300047447 Ga0495685_001200 Ga0495685_001200_1208_2638 466
882 3300048909 Ga0496106_0036529 Ga0496106_0036529_1325_2755 466
883 3300048919 Ga0496116_0004563 Ga0496116_0004563_9587_11017 466
884 3300048924 Ga0496121_0012023 Ga0496121_0012023_3235_4665 466
885 3300048925 Ga0496122_0001659 Ga0496122_0001659_17407_18837 466
886 3300048926 Ga0496123_0000648 Ga0496123_0000648_16016_17446 466
887 3300048927 Ga0496124_0000125 Ga0496124_0000125_84830_86230 466
888 3300053086 Ga0500578_0019879 Ga0500578_0019879_358_1788 466
889 3300053161 Ga0500634_0029905 Ga0500634_0029905_1144_2568 466
890 3300053730 Ga0500645_002176 Ga0500645_002176_4400_5830 466
891 3300001904 JGI24736J21556_1002402 JGI24736J21556_10024024 467
892 3300001979 JGI24740J21852_10002551 JGI24740J21852_100025515 467
893 3300001989 JGI24739J22299_10000410 JGI24739J22299_100004105 467
894 3300002067 JGI24735J21928_10004692 JGI24735J21928_100046923 467
895 3300002075 JGI24738J21930_10005003 JGI24738J21930_100050034 467
896 3300002705 JGI25156J39149_1000219 JGI25156J39149_10002197 467
897 3300002705 JGI25156J39149_1000455 JGI25156J39149_100045520 467
898 3300003214 JGI25165J46597_1001256 JGI25165J46597_100125611 467
899 3300003756 Ga0055533_1000204 Ga0055533_100020427 467
900 3300003756 Ga0055533_1001300 Ga0055533_10013004 467
901 3300003758 Ga0055532_1000022 Ga0055532_1000022114 467
902 3300003760 Ga0055527_1000016 Ga0055527_1000016114 467
903 3300003761 Ga0055535_1000017 Ga0055535_1000017114 467
904 3300003762 Ga0055542_1000030 Ga0055542_1000030126 467
905 3300003763 Ga0055529_1000033 Ga0055529_1000033126 467
906 3300003763 Ga0055529_1002814 Ga0055529_10028143 467
907 3300009011 Ga0105251_10001269 Ga0105251_1000126910 467
908 3300013105 Ga0157369_10018204 Ga0157369_100182046 467
909 3300013105 Ga0157369_10049046 Ga0157369_100490463 467
910 3300025226 Ga0209674_100017 Ga0209674_100017280 467
911 3300025226 Ga0209674_100211 Ga0209674_10021123 467
912 3300025228 Ga0209672_100001 Ga0209672_1000012220 467
913 3300025229 Ga0209147_100022 Ga0209147_100022288 467
914 3300025230 Ga0209563_101684 Ga0209563_1016844 467
915 3300025242 Ga0209258_100033 Ga0209258_100033125 467
916 3300025254 Ga0209148_1000046 Ga0209148_1000046289 467
917 3300025256 Ga0209759_1000331 Ga0209759_100033125 467
918 3300025256 Ga0209759_1000366 Ga0209759_100036627 467
919 3300025256 Ga0209759_1001291 Ga0209759_100129111 467
920 3300025261 Ga0209233_1000050 Ga0209233_1000050278 467
921 3300025272 Ga0209455_1000038 Ga0209455_1000038289 467
922 3300025272 Ga0209455_1000556 Ga0209455_100055617 467
923 3300025735 Ga0207713_1000137 Ga0207713_100013711 467
924 3300025904 Ga0207647_10000478 Ga0207647_1000047820 467
925 3300025904 Ga0207647_10004890 Ga0207647_100048906 467
926 3300025909 Ga0207705_10107138 Ga0207705_101071381 467
927 3300026067 Ga0207678_10007014 Ga0207678_100070147 467
928 3300027312 Ga0209371_1005628 Ga0209371_10056284 467
929 3300030500 Ga0268256_1009570 Ga0268256_10095702 467
930 3300031507 Ga0307509_10002881 Ga0307509_100028811 467
931 3300031548 Ga0307408_100000133 Ga0307408_10000013373 467
932 3300031911 Ga0307412_10000011 Ga0307412_10000011276 467
933 3300032002 Ga0307416_100004394 Ga0307416_1000043944 467
934 3300032005 Ga0307411_10160995 Ga0307411_101609952 467
935 3300037471 Ga0395905_0000110 Ga0395905_0000110_38071_39513 467
936 3300046454 Ga0495592_0011067 Ga0495592_0011067_1087_2490 467
937 3300046455 Ga0495603_0020719 Ga0495603_0020719_311_1714 467
938 3300046457 Ga0495590_0003669 Ga0495590_0003669_4628_6031 467
939 3300046458 Ga0495591_001172 Ga0495591_001172_2245_3648 467
940 3300046459 Ga0495629_0000207 Ga0495629_0000207_18827_20230 467
941 3300046459 Ga0495629_0011888 Ga0495629_0011888_205_1608 467
942 3300046460 Ga0495638_0003598 Ga0495638_0003598_10276_11679 467
943 3300046462 Ga0495651_0035986 Ga0495651_0035986_1426_2829 467
944 3300046463 Ga0495653_0000303 Ga0495653_0000303_19813_21216 467
945 3300046463 Ga0495653_0024465 Ga0495653_0024465_1195_2598 467
946 3300046463 Ga0495653_0032598 Ga0495653_0032598_133_1536 467
947 3300046471 Ga0495650_0004007 Ga0495650_0004007_8067_9470 467
948 3300046471 Ga0495650_0011359 Ga0495650_0011359_367_1770 467
949 3300046472 Ga0495580_0000001 Ga0495580_0000001_91546_92949 467
950 3300046472 Ga0495580_0000234 Ga0495580_0000234_20835_22238 467
951 3300046472 Ga0495580_0006821 Ga0495580_0006821_7247_8650 467
952 3300046472 Ga0495580_0039883 Ga0495580_0039883_845_2248 467
953 3300046473 Ga0495582_0004069 Ga0495582_0004069_439_1842 467
954 3300046473 Ga0495582_0004224 Ga0495582_0004224_715_2118 467
955 3300046473 Ga0495582_0011994 Ga0495582_0011994_1255_2658 467
956 3300046477 Ga0495664_0006906 Ga0495664_0006906_195_1598 467
957 3300046477 Ga0495664_0009274 Ga0495664_0009274_3243_4646 467
958 3300046500 Ga0495596_0002113 Ga0495596_0002113_5189_6592 467
959 3300046507 Ga0495606_0007354 Ga0495606_0007354_6321_7724 467
960 3300046507 Ga0495606_0018342 Ga0495606_0018342_2545_3948 467
961 3300046511 Ga0495608_0001528 Ga0495608_0001528_2019_3422 467
962 3300046511 Ga0495608_0004976 Ga0495608_0004976_891_2294 467
963 3300046514 Ga0495618_0006278 Ga0495618_0006278_2273_3676 467
964 3300046515 Ga0495620_0017698 Ga0495620_0017698_692_2095 467
965 3300046516 Ga0495628_0000262 Ga0495628_0000262_5613_7016 467
966 3300046516 Ga0495628_0004434 Ga0495628_0004434_4987_6390 467
967 3300046516 Ga0495628_0024206 Ga0495628_0024206_1300_2703 467
968 3300046517 Ga0495630_0024959 Ga0495630_0024959_1592_2995 467
969 3300046517 Ga0495630_0026618 Ga0495630_0026618_2750_4153 467
970 3300046517 Ga0495630_0058426 Ga0495630_0058426_1411_2814 467
971 3300046524 Ga0495648_0002441 Ga0495648_0002441_14974_16377 467
972 3300046524 Ga0495648_0007860 Ga0495648_0007860_5949_7352 467
973 3300046524 Ga0495648_0044233 Ga0495648_0044233_1367_2770 467
974 3300046526 Ga0495666_0000501 Ga0495666_0000501_1588_2991 467
975 3300046526 Ga0495666_0002018 Ga0495666_0002018_3813_5216 467
976 3300046526 Ga0495666_0006273 Ga0495666_0006273_1231_2634 467
977 3300046528 Ga0495642_0011115 Ga0495642_0011115_432_1835 467
978 3300046529 Ga0495652_0045442 Ga0495652_0045442_764_2167 467
979 3300046529 Ga0495652_0051632 Ga0495652_0051632_439_1842 467
980 3300046531 Ga0495665_0013488 Ga0495665_0013488_1476_2879 467
981 3300046533 Ga0495640_0014822 Ga0495640_0014822_253_1656 467
982 3300046535 Ga0495586_0010655 Ga0495586_0010655_780_2183 467
983 3300046535 Ga0495586_0043853 Ga0495586_0043853_132_1535 467
984 3300046557 Ga0495622_0000993 Ga0495622_0000993_5262_6665 467
985 3300046642 Ga0495634_0009155 Ga0495634_0009155_3829_5232 467
986 3300046642 Ga0495634_0011252 Ga0495634_0011252_5058_6461 467
987 3300046642 Ga0495634_0070722 Ga0495634_0070722_133_1536 467
988 3300046663 Ga0495635_0002817 Ga0495635_0002817_8811_10214 467
989 3300046663 Ga0495635_0023607 Ga0495635_0023607_1158_2561 467
990 3300046663 Ga0495635_0036429 Ga0495635_0036429_983_2386 467
991 3300046665 Ga0495661_0000792 Ga0495661_0000792_14120_15523 467
992 3300046678 Ga0495599_0040438 Ga0495599_0040438_1274_2677 467
993 3300046679 Ga0495623_0006363 Ga0495623_0006363_3569_4972 467
994 3300046680 Ga0495646_0005259 Ga0495646_0005259_6224_7627 467
995 3300046680 Ga0495646_0005282 Ga0495646_0005282_1171_2574 467
996 3300046689 Ga0495613_0006702 Ga0495613_0006702_2858_4261 467
997 3300046689 Ga0495613_0014369 Ga0495613_0014369_3569_4972 467
998 3300046690 Ga0495624_0001006 Ga0495624_0001006_10593_11996 467
999 3300046690 Ga0495624_0006778 Ga0495624_0006778_5776_7179 467
1000 3300046690 Ga0495624_0021155 Ga0495624_0021155_780_2183 467
1001 3300046690 Ga0495624_0068422 Ga0495624_0068422_481_1884 467
1002 3300046692 Ga0495671_0016921 Ga0495671_0016921_1021_2424 467
1003 3300046694 Ga0495649_0009237 Ga0495649_0009237_3230_4633 467
1004 3300046794 Ga0495589_0011666 Ga0495589_0011666_1798_3201 467
1005 3300046809 Ga0495600_0009370 Ga0495600_0009370_338_1741 467
1006 3300047315 Ga0495581_0002658 Ga0495581_0002658_4143_5546 467
1007 3300047315 Ga0495581_0019216 Ga0495581_0019216_1221_2624 467
1008 3300047317 Ga0495604_0007498 Ga0495604_0007498_2054_3457 467
1009 3300047317 Ga0495604_0029410 Ga0495604_0029410_1492_2895 467
1010 3300047319 Ga0495674_0016580 Ga0495674_0016580_3617_5020 467
1011 3300047319 Ga0495674_0062328 Ga0495674_0062328_1364_2767 467
1012 3300047319 Ga0495674_0151209 Ga0495674_0151209_286_1689 467
1013 3300047320 Ga0495672_0025905 Ga0495672_0025905_668_2071 467
1014 3300047321 Ga0495676_0011001 Ga0495676_0011001_6322_7725 467
1015 3300047321 Ga0495676_0035497 Ga0495676_0035497_1549_2952 467
1016 3300047322 Ga0495680_0009524 Ga0495680_0009524_4620_6023 467
1017 3300047322 Ga0495680_0013681 Ga0495680_0013681_3395_4798 467
1018 3300047323 Ga0495683_0050278 Ga0495683_0050278_466_1869 467
1019 3300047323 Ga0495683_0058648 Ga0495683_0058648_350_1753 467
1020 3300047443 Ga0495687_003681 Ga0495687_003681_7706_9109 467
1021 3300047443 Ga0495687_015803 Ga0495687_015803_2078_3481 467
1022 3300047444 Ga0495675_0012698 Ga0495675_0012698_458_1861 467
1023 3300047446 Ga0495679_000068 Ga0495679_000068_69793_71196 467
1024 3300047446 Ga0495679_001889 Ga0495679_001889_5564_6967 467
1025 3300047446 Ga0495679_005094 Ga0495679_005094_2087_3490 467
1026 3300047469 Ga0495673_0003701 Ga0495673_0003701_5238_6641 467
1027 3300047673 Ga0495593_0001562 Ga0495593_0001562_7384_8787 467
1028 3300047673 Ga0495593_0007890 Ga0495593_0007890_3570_4973 467
1029 3300048088 Ga0495602_0044750 Ga0495602_0044750_1829_3232 467
1030 3300048088 Ga0495602_0087340 Ga0495602_0087340_716_2119 467
1031 3300048088 Ga0495602_0123309 Ga0495602_0123309_463_1866 467
1032 3300048089 Ga0495614_0001650 Ga0495614_0001650_6478_7881 467
1033 3300048091 Ga0495626_0012469 Ga0495626_0012469_1595_2998 467
1034 3300048920 Ga0496117_0028930 Ga0496117_0028930_1821_3224 467
1035 3300048920 Ga0496117_0081038 Ga0496117_0081038_491_1894 467
1036 3300048921 Ga0496118_0006087 Ga0496118_0006087_3842_5245 467
1037 3300048921 Ga0496118_0006113 Ga0496118_0006113_5904_7307 467
1038 3300048924 Ga0496121_0002981 Ga0496121_0002981_13780_15195 467
1039 3300048929 Ga0496126_0001414 Ga0496126_0001414_10268_11671 467
1040 3300049460 Ga0495682_0004254 Ga0495682_0004254_3029_4432 467
1041 3300053178 Ga0500637_0047113 Ga0500637_0047113_239_1744 467

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03880

DbpA

DbpA RNA binding domain

444

515

0.98

PF00270

DEAD

DEAD/DEAH box helicase

85

252

0.95

PF00271

Helicase_C

Helicase conserved C-terminal domain

285

394

0.9

PF04851

ResIII

Type III restriction enzyme, res subunit

93

247

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gju-assembly1.cif.gz_A dead-box rna helicase 0.9782 9 213
5gju-assembly1.cif.gz_A dead-box rna helicase 0.9734 9 213
7dtk-assembly1.cif.gz_A crystal structure of the reca1 domain of rna helicase cgh-1 in c. elegans 0.9698 9 211
2oxc-assembly2.cif.gz_B human dead-box rna helicase ddx20, dead domain in complex with adp 0.965 9 213
1vec-assembly1.cif.gz_A crystal structure of the n-terminal domain of rck/p54, a human dead-box protein 0.9633 8 211
ID Description Score Start End Superfamily
af_P21693_384_456_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 1.001 393 464 3.30.70.330
af_P21693_1_208_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9937 9 213 3.40.50.300
5gjuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9782 9 213 3.40.50.300
af_Q4DIE1_12_238_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9768 9 215 3.40.50.300
af_P21693_1_208_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9748 9 213 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3B0YFC1-F1-model_v4 ATP-dependent 23S rRNA helicase DbpA 0.9818 62 464 GO:0003676
GO:0003724
GO:0005524
GO:0005829
GO:0016787
AF-A0A392SM19-F1-model_v4 DEAD-box ATP-dependent RNA helicase 53-like 0.9792 123 205 GO:0003676
GO:0003724
GO:0005524
GO:0005829
AF-A0A3A9SVZ3-F1-model_v4 DEAD/DEAH box helicase 0.9782 8 375 GO:0003676
GO:0003724
GO:0005524
GO:0005829
GO:0016787
AF-A0A1R0Y205-F1-model_v4 RNA helicase 0.977 9 374 GO:0003676
GO:0003724
GO:0005524
GO:0005829
GO:0016787
AF-A0A561JSR7-F1-model_v4 deleted 0.9768 2 467

Feature Viewer

pLDDT pTM Quality
89.66 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map