F488774

General Info

Members Datasets Scaffolds Average Seq Length
1038 484 972 251

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0028821|Ga0496122_0028821_1239_2069
Length 276
Sequence VGAPPQARHDTGRRAGPGGVIAMNAAVPGALTSSLLYLDGVSVSFDGFKAIRGLSLTIEPGEMRAIIGPNGAGKTTMMDIITGKTKPDVGTVMFGGSVDLTKLDEAAIANLGIGRKFQKPTVFDFHTIEDNILLALKSKRTVGRTLFWKTEEPQQKRIDDILGIVKLADKRDRLAGSLSHGQKQWLEIGMLLAQDPKLLLVDEPAAGMTDGETAQTAVLLKEIARDHSVIVVEHDMGFIRELGVKVTVLHEGSVLAEGPLDQVSANERVVEVYLGR

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
3 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
4 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
5 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
6 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
7 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
8 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
9 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
10 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
11 2643221651 Afipia sp. Root123D2 Isolate Unclassified
12 2643221733 Bosea sp. Root381 Isolate Unclassified
13 2643221734 Bosea sp. Root670 Isolate Unclassified
14 2643221736 Bosea sp. Root483D1 Isolate Unclassified
15 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
16 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
17 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
18 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
19 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
20 2818991467 Bosea vestrisii 3192 Isolate Unclassified
21 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
22 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
23 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
24 2841760612 Bosea sp. Tri-49 Isolate Nodule
25 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
26 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
27 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
28 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
29 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
30 2844104063 Bosea sp. Tri-39 Isolate Nodule
31 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
32 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
33 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
34 2851182111 Bosea sp. Tri-44 Isolate Nodule
35 2851246043 Bosea sp. Tri-54 Isolate Nodule
36 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
37 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
38 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
39 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
40 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
41 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
42 2904699407
43 2906610324
44 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
45 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
46 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
47 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
48 2909042592 Labrys sp. LIt4 Isolate Nodule
49 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
50 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
51 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
52 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
53 2922425934
54 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
55 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
56 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
57 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
58 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
59 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
60 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
61 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
62 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
63 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
64 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
66 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
67 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
68 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
70 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
71 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
72 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
73 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
74 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
75 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
76 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
77 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
78 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
79 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
80 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
81 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
82 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
83 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
84 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
85 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
86 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
87 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
88 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
89 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
90 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
91 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
92 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
93 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
94 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
95 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
96 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
97 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
98 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
99 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
100 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
101 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
102 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
103 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
104 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
105 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
106 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
107 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
108 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
109 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
110 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
111 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
112 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
113 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
114 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
115 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
116 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
117 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
118 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
119 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
120 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
121 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
122 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
123 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
124 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
125 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
126 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
127 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
128 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
129 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
130 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
131 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
132 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
133 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
134 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
135 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
136 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
137 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
138 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
139 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
140 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
141 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
142 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
143 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
144 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
145 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
146 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
147 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
148 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
149 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
150 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
151 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
152 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
153 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
154 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
155 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
156 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
157 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
158 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
159 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
160 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
161 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
162 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
163 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
164 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
165 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
166 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
167 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
168 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
169 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
170 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
171 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
172 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
173 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
174 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
175 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
176 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
177 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
178 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
179 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
180 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
181 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
182 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
183 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
184 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
185 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
186 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
187 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
188 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
189 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
190 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
191 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
192 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
193 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
194 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
195 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
196 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
197 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
198 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
200 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
203 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
205 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
207 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
208 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
209 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
262 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
263 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
264 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
268 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
269 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
270 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
271 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
272 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
273 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
274 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
275 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
276 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
277 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
278 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
279 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
280 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
281 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
282 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
283 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
284 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
285 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
286 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
287 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
288 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
289 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
290 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
291 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
292 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
293 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
294 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
295 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
296 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
297 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
298 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
299 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
300 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
301 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
302 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
303 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
304 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
305 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
306 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
307 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
308 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
309 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
310 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
311 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
312 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
313 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
314 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
315 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
316 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
317 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
318 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
319 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
320 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
321 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
322 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
323 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
324 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
325 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
326 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
327 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
328 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
329 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
330 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
331 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
332 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
333 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
334 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
335 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
336 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
337 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
338 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
339 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
340 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
341 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
342 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
343 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
344 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
345 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
346 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
347 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
348 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
349 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
350 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
351 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
352 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
353 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
354 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
355 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
356 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
357 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
358 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
359 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
360 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
361 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
362 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
363 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
364 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
365 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
366 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
367 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
368 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
369 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
370 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
371 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
372 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
373 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
374 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
375 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
376 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
377 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
378 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
379 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
380 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
381 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
382 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
383 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
384 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
385 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
386 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
387 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
388 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
389 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
390 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
391 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
392 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
393 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
394 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
395 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
396 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
397 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
398 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
399 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
400 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
401 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
402 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
403 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
404 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
405 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
406 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
407 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
408 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
409 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
410 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
424 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
425 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
426 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
427 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
428 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
429 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
430 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
431 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
432 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
433 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
434 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
435 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
436 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
437 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
438 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
441 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
442 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
443 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
444 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
445 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
446 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
447 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
448 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
449 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
450 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
451 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
452 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
453 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
454 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
455 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
456 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
457 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
458 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
459 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
460 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
461 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
462 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
463 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
464 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
465 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
466 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
467 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
468 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
469 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
470 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
471 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
472 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
473 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
474 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
475 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
476 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
477 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
478 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
479 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
480 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
481 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
482 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
483 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
484 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.91
Metatranscriptomes 0
Isolates 6.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.83
Nodule 3.18
Rhizoplane 7.51
Rhizosphere 72.16
Stem 0
Stem Tuber 0
Unclassified 7.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1002271 3300002773 Bacteria 7414
2 JGI25150J39212_1000091 3300002774 Bacteria 52487
3 JGI25159J45721_1006205 3300002987 Bacteria 3615
4 JGI25159J45721_1029362 3300002987 Bacteria 906
5 JGI25151J46595_10000027 3300003187 Bacteria 208739
6 JGI25151J46595_10000079 3300003187 Bacteria 132415
7 JGI25151J46595_10000166 3300003187 Bacteria 85475
8 JGI25406J46586_10001744 3300003203 Bacteria 10229
9 JGI25406J46586_10099659 3300003203 Bacteria 868
10 JGI25153J46596_10023417 3300003215 Bacteria 2253
11 rootH1_10001360 3300003323 Bacteria 3136
12 JGI25160J50197_1008772 3300003354 Bacteria 3823
13 JGI25404J52841_10025863 3300003659 Bacteria 1264
14 Ga0055526_1001798 3300003771 Bacteria 14849
15 Ga0055526_1004200 3300003771 Bacteria 8750
16 Ga0055524_1000147 3300003775 Bacteria 83426
17 Ga0065165_1000359 3300005262 Bacteria 74914
18 Ga0065715_10409333 3300005293 Bacteria 872
19 Ga0070658_10250365 3300005327 Bacteria 1503
20 Ga0070676_10264661 3300005328 Bacteria 1153
21 Ga0070676_10361287 3300005328 Bacteria 1001
22 Ga0070683_100529884 3300005329 Bacteria 1126
23 Ga0070670_100000279 3300005331 Bacteria 44846
24 Ga0070670_100023610 3300005331 Bacteria 5293
25 Ga0070670_100084216 3300005331 Bacteria 2732
26 Ga0068869_100350047 3300005334 Bacteria 1204
27 Ga0070666_10208641 3300005335 Bacteria 1375
28 Ga0070680_100023161 3300005336 Bacteria 4951
29 Ga0070660_100435979 3300005339 Bacteria 1086
30 Ga0070689_100009551 3300005340 Bacteria 6879
31 Ga0070689_100122295 3300005340 Bacteria 2080
32 Ga0070689_100177604 3300005340 Bacteria 1728
33 Ga0070689_100243838 3300005340 Bacteria 1481
34 Ga0070689_100348901 3300005340 Bacteria 1241
35 Ga0070691_10005254 3300005341 Bacteria 5883
36 Ga0070691_10015821 3300005341 Bacteria 3467
37 Ga0070661_100080243 3300005344 Bacteria 2408
38 Ga0070692_10233535 3300005345 Bacteria 1093
39 Ga0070668_100085337 3300005347 Bacteria 2481
40 Ga0070668_100487865 3300005347 Bacteria 1065
41 Ga0070669_100461875 3300005353 Bacteria 1048
42 Ga0070675_100052858 3300005354 Bacteria 3341
43 Ga0070675_100181614 3300005354 Bacteria 1819
44 Ga0070675_100392747 3300005354 Bacteria 1236
45 Ga0070671_100018362 3300005355 Bacteria 5680
46 Ga0070671_100088490 3300005355 Bacteria 2592
47 Ga0070674_100017992 3300005356 Bacteria 4458
48 Ga0070674_100084622 3300005356 Bacteria 2274
49 Ga0070673_100027881 3300005364 Bacteria 4192
50 Ga0070673_100121720 3300005364 Bacteria 2178
51 Ga0070673_100159919 3300005364 Bacteria 1915
52 Ga0070673_100285515 3300005364 Bacteria 1449
53 Ga0070673_100404278 3300005364 Bacteria 1221
54 Ga0070688_100216810 3300005365 Bacteria 1347
55 Ga0070688_100323241 3300005365 Bacteria 1122
56 Ga0070667_100089336 3300005367 Bacteria 2646
57 Ga0070667_100100209 3300005367 Bacteria 2501
58 Ga0070667_100390358 3300005367 Bacteria 1266
59 Ga0070703_10015829 3300005406 Bacteria 2161
60 Ga0070709_10011341 3300005434 Bacteria 4963
61 Ga0070709_10068928 3300005434 Bacteria 2276
62 Ga0070714_100017392 3300005435 Bacteria 5824
63 Ga0070713_100007558 3300005436 Bacteria 7639
64 Ga0070713_100015955 3300005436 Bacteria 5636
65 Ga0070713_100078485 3300005436 Bacteria 2810
66 Ga0070713_100169172 3300005436 Bacteria 1957
67 Ga0070713_100236946 3300005436 Bacteria 1660
68 Ga0070713_100504704 3300005436 Bacteria 1142
69 Ga0070713_100636344 3300005436 Bacteria 1015
70 Ga0070710_10007309 3300005437 Bacteria 5343
71 Ga0070711_100041309 3300005439 Bacteria 3114
72 Ga0070711_100120718 3300005439 Bacteria 1938
73 Ga0070711_100243353 3300005439 Bacteria 1407
74 Ga0070705_100000010 3300005440 Bacteria 102079
75 Ga0070700_100012029 3300005441 Bacteria 4811
76 Ga0070700_100036015 3300005441 Bacteria 2999
77 Ga0070700_100100414 3300005441 Bacteria 1905
78 Ga0070694_100007490 3300005444 Bacteria 6658
79 Ga0070694_100301901 3300005444 Bacteria 1227
80 Ga0070708_100031895 3300005445 Bacteria 4565
81 Ga0070708_100319002 3300005445 Bacteria 1464
82 Ga0070708_100432891 3300005445 Bacteria 1241
83 Ga0070678_100139537 3300005456 Bacteria 1938
84 Ga0070678_100145528 3300005456 Bacteria 1902
85 Ga0070681_10037097 3300005458 Bacteria 4892
86 Ga0068867_100140308 3300005459 Bacteria 1888
87 Ga0068867_100370305 3300005459 Bacteria 1201
88 Ga0070706_100083039 3300005467 Bacteria 2968
89 Ga0070707_100008667 3300005468 Bacteria 9437
90 Ga0070707_100180491 3300005468 Bacteria 2058
91 Ga0070707_100473022 3300005468 Bacteria 1214
92 Ga0070698_100001583 3300005471 Bacteria 25310
93 Ga0070698_100081261 3300005471 Bacteria 3236
94 Ga0070698_100143789 3300005471 Bacteria 2335
95 Ga0070699_100001267 3300005518 Bacteria 23288
96 Ga0070699_100032052 3300005518 Bacteria 4538
97 Ga0070699_100097779 3300005518 Bacteria 2572
98 Ga0070699_100133004 3300005518 Bacteria 2193
99 Ga0070699_100156092 3300005518 Bacteria 2019
100 Ga0070679_100069394 3300005530 Bacteria 3515
101 Ga0070697_100019537 3300005536 Bacteria 5353
102 Ga0070697_100123050 3300005536 Bacteria 2171
103 Ga0070672_100080702 3300005543 Bacteria 2606
104 Ga0070672_100729529 3300005543 Bacteria 869
105 Ga0070686_100081658 3300005544 Bacteria 2142
106 Ga0070686_100206694 3300005544 Bacteria 1411
107 Ga0070695_100001386 3300005545 Bacteria 13460
108 Ga0070695_100015958 3300005545 Bacteria 4541
109 Ga0070696_100000088 3300005546 Bacteria 45502
110 Ga0070665_100164933 3300005548 Bacteria 2218
111 Ga0070665_100303739 3300005548 Bacteria 1599
112 Ga0070665_100424985 3300005548 Bacteria 1337
113 Ga0070704_100007022 3300005549 Bacteria 6679
114 Ga0070704_100174015 3300005549 Bacteria 1715
115 Ga0070704_100242386 3300005549 Bacteria 1476
116 Ga0068855_100014613 3300005563 Bacteria 9455
117 Ga0068855_100335274 3300005563 Bacteria 1669
118 Ga0070664_100091744 3300005564 Bacteria 2629
119 Ga0068857_100025585 3300005577 Bacteria 5196
120 Ga0068857_100085007 3300005577 Bacteria 2827
121 Ga0068854_100131782 3300005578 Bacteria 1909
122 Ga0068856_100874584 3300005614 Bacteria 918
123 Ga0068852_100164725 3300005616 Bacteria 2073
124 Ga0068859_100029774 3300005617 Bacteria 5478
125 Ga0068859_101024518 3300005617 Bacteria 907
126 Ga0068864_100393132 3300005618 Bacteria 1316
127 Ga0068864_100414815 3300005618 Bacteria 1282
128 Ga0068861_100086515 3300005719 Bacteria 2464
129 Ga0068861_100175826 3300005719 Bacteria 1778
130 Ga0068863_100108341 3300005841 Bacteria 2644
131 Ga0068858_100317367 3300005842 Bacteria 1489
132 Ga0068860_100023745 3300005843 Bacteria 5928
133 Ga0068860_100032520 3300005843 Bacteria 5012
134 Ga0068860_100090932 3300005843 Bacteria 2908
135 Ga0068862_100000484 3300005844 Bacteria 42509
136 Ga0068862_100145573 3300005844 Bacteria 2105
137 Ga0081455_10000142 3300005937 Bacteria 84680
138 Ga0081455_10003539 3300005937 Bacteria 17922
139 Ga0081455_10022523 3300005937 Bacteria 5888
140 Ga0081455_10028348 3300005937 Bacteria 5117
141 Ga0081455_10092343 3300005937 Bacteria 2449
142 Ga0081455_10107042 3300005937 Bacteria 2230
143 Ga0081455_10132533 3300005937 Bacteria 1947
144 Ga0081455_10206962 3300005937 Bacteria 1465
145 Ga0081455_10299363 3300005937 Bacteria 1155
146 Ga0081538_10019181 3300005981 Bacteria 5098
147 Ga0081538_10025164 3300005981 Bacteria 4209
148 Ga0081540_1006595 3300005983 Bacteria 8425
149 Ga0081540_1009132 3300005983 Bacteria 6843
150 Ga0081540_1012474 3300005983 Bacteria 5589
151 Ga0081540_1029277 3300005983 Bacteria 3071
152 Ga0081540_1030263 3300005983 Bacteria 3001
153 Ga0081539_10000598 3300005985 Bacteria 73470
154 Ga0081539_10003011 3300005985 Bacteria 21952
155 Ga0081539_10016306 3300005985 Bacteria 5319
156 Ga0081539_10016697 3300005985 Bacteria 5217
157 Ga0081539_10024885 3300005985 Bacteria 3870
158 Ga0081539_10036208 3300005985 Bacteria 2956
159 Ga0081539_10168260 3300005985 Bacteria 1039
160 Ga0070717_10006086 3300006028 Bacteria 8856
161 Ga0070717_10014983 3300006028 Bacteria 5972
162 Ga0070717_10037023 3300006028 Bacteria 3960
163 Ga0070717_10244127 3300006028 Bacteria 1584
164 Ga0075365_10164699 3300006038 Bacteria 1546
165 Ga0075368_10018439 3300006042 Bacteria 2622
166 Ga0075368_10120999 3300006042 Bacteria 1084
167 Ga0075363_100063912 3300006048 Bacteria 1988
168 Ga0075364_10162832 3300006051 Bacteria 1506
169 Ga0075364_10319755 3300006051 Bacteria 1057
170 Ga0075432_10023298 3300006058 Bacteria 2120
171 Ga0070715_10001945 3300006163 Bacteria 6220
172 Ga0070716_100003460 3300006173 Bacteria 7432
173 Ga0070712_100015104 3300006175 Bacteria 4964
174 Ga0070712_100133119 3300006175 Bacteria 1887
175 Ga0070712_100137693 3300006175 Bacteria 1859
176 Ga0070712_100264860 3300006175 Bacteria 1378
177 Ga0070712_100594810 3300006175 Bacteria 936
178 Ga0075362_10002893 3300006177 Bacteria 5879
179 Ga0075362_10009224 3300006177 Bacteria 3806
180 Ga0075362_10013500 3300006177 Bacteria 3271
181 Ga0075362_10031084 3300006177 Bacteria 2309
182 Ga0075362_10098682 3300006177 Bacteria 1363
183 Ga0075367_10002514 3300006178 Bacteria 8403
184 Ga0075367_10016000 3300006178 Bacteria 4090
185 Ga0075367_10153996 3300006178 Bacteria 1427
186 Ga0075367_10196933 3300006178 Bacteria 1258
187 Ga0075367_10229795 3300006178 Bacteria 1162
188 Ga0075369_10012084 3300006186 Bacteria 3406
189 Ga0075369_10041829 3300006186 Bacteria 1962
190 Ga0075369_10117757 3300006186 Bacteria 1201
191 Ga0075369_10202814 3300006186 Bacteria 915
192 Ga0075366_10086007 3300006195 Bacteria 1881
193 Ga0097621_100207379 3300006237 Bacteria 1703
194 Ga0075370_10100700 3300006353 Bacteria 1672
195 Ga0075370_10191072 3300006353 Bacteria 1207
196 Ga0075370_10208135 3300006353 Bacteria 1155
197 Ga0075370_10312911 3300006353 Bacteria 935
198 Ga0075428_100028809 3300006844 Bacteria 6145
199 Ga0075428_100105515 3300006844 Bacteria 3073
200 Ga0075428_100440420 3300006844 Bacteria 1396
201 Ga0075430_100296789 3300006846 Bacteria 1337
202 Ga0075431_100000021 3300006847 Bacteria 82774
203 Ga0075431_100004278 3300006847 Bacteria 13986
204 Ga0075431_100013599 3300006847 Bacteria 8223
205 Ga0075431_100157342 3300006847 Bacteria 2338
206 Ga0075431_100186346 3300006847 Bacteria 2128
207 Ga0075431_100225890 3300006847 Bacteria 1909
208 Ga0075431_100329007 3300006847 Bacteria 1539
209 Ga0075431_100627653 3300006847 Bacteria 1056
210 Ga0075433_10098961 3300006852 Bacteria 2582
211 Ga0075434_100003287 3300006871 Bacteria 14450
212 Ga0075434_100039117 3300006871 Bacteria 4699
213 Ga0075434_100041218 3300006871 Bacteria 4574
214 Ga0075434_100077231 3300006871 Bacteria 3325
215 Ga0075434_100361856 3300006871 Bacteria 1472
216 Ga0075429_100044422 3300006880 Bacteria 3865
217 Ga0075429_100382333 3300006880 Bacteria 1233
218 Ga0068865_100230699 3300006881 Bacteria 1452
219 Ga0075436_100151402 3300006914 Bacteria 1633
220 Ga0075436_100189908 3300006914 Bacteria 1453
221 Ga0097620_100029774 3300006931 Bacteria 5478
222 Ga0097620_101024563 3300006931 Bacteria 907
223 Ga0079104_1000015 3300006946 Bacteria 321803
224 Ga0075435_100005120 3300007076 Bacteria 9111
225 Ga0075435_100146468 3300007076 Bacteria 1984
226 Ga0099794_10013033 3300007265 Bacteria 3609
227 Ga0099795_10008633 3300007788 Bacteria 2916
228 Ga0099795_10019938 3300007788 Bacteria 2177
229 Ga0105240_10270653 3300009093 Bacteria 1956
230 Ga0111539_10000144 3300009094 Bacteria 81842
231 Ga0111539_10002369 3300009094 Bacteria 25039
232 Ga0111539_10031200 3300009094 Bacteria 6477
233 Ga0111539_10403564 3300009094 Bacteria 1592
234 Ga0111539_11073817 3300009094 Bacteria 936
235 Ga0105245_10125795 3300009098 Bacteria 2399
236 Ga0105245_10229000 3300009098 Bacteria 1797
237 Ga0105245_10380909 3300009098 Bacteria 1405
238 Ga0114129_10000068 3300009147 Bacteria 93579
239 Ga0114129_10021135 3300009147 Bacteria 9241
240 Ga0114129_10189744 3300009147 Bacteria 2792
241 Ga0114129_10414122 3300009147 Bacteria 1774
242 Ga0114129_10743083 3300009147 Bacteria 1257
243 Ga0114129_10872792 3300009147 Bacteria 1142
244 Ga0114129_10884235 3300009147 Bacteria 1133
245 Ga0114129_10902828 3300009147 Bacteria 1119
246 Ga0114129_10902838 3300009147 Bacteria 1119
247 Ga0105243_10376761 3300009148 Bacteria 1311
248 Ga0105243_10738458 3300009148 Bacteria 964
249 Ga0105241_10467356 3300009174 Bacteria 1119
250 Ga0105242_10093354 3300009176 Bacteria 2537
251 Ga0105242_10960898 3300009176 Bacteria 859
252 Ga0105248_10002224 3300009177 Bacteria 21448
253 Ga0105248_10044373 3300009177 Bacteria 4986
254 Ga0105248_10157928 3300009177 Bacteria 2559
255 Ga0105237_10069708 3300009545 Bacteria 3512
256 Ga0105238_10048111 3300009551 Bacteria 4299
257 Ga0105249_10229647 3300009553 Bacteria 1830
258 Ga0105249_10387069 3300009553 Bacteria 1426
259 Ga0105033_102692 3300009986 Bacteria 1473
260 Ga0099796_10022692 3300010159 Bacteria 1950
261 Ga0105239_10297453 3300010375 Bacteria 1818
262 Ga0105239_10471574 3300010375 Bacteria 1425
263 Ga0105246_10038956 3300011119 Bacteria 3199
264 Ga0105246_10095777 3300011119 Bacteria 2149
265 Ga0105246_10216201 3300011119 Bacteria 1499
266 Ga0157370_10077887 3300013104 Bacteria 3122
267 Ga0157370_10235815 3300013104 Bacteria 1693
268 Ga0171462_1033 3300013250 Bacteria 90238
269 Ga0157378_10483374 3300013297 Bacteria 1234
270 Ga0163162_10353761 3300013306 Bacteria 1601
271 Ga0163162_10681032 3300013306 Bacteria 1151
272 Ga0157372_10492060 3300013307 Bacteria 1430
273 Ga0157375_10826313 3300013308 Bacteria 1074
274 Ga0157375_10979236 3300013308 Bacteria 986
275 Ga0163163_10013174 3300014325 Bacteria 7556
276 Ga0163163_10054559 3300014325 Bacteria 3949
277 Ga0163163_10103655 3300014325 Bacteria 2869
278 Ga0157380_10013643 3300014326 Bacteria 5931
279 Ga0157380_10083652 3300014326 Bacteria 2615
280 Ga0182008_10240141 3300014497 Bacteria 932
281 Ga0157379_10255654 3300014968 Bacteria 1591
282 Ga0157376_10267225 3300014969 Bacteria 1605
283 Ga0157376_10544235 3300014969 Bacteria 1148
284 Ga0163161_10127281 3300017792 Bacteria 1919
285 Ga0213872_10022142 3300021361 Bacteria 2927
286 Ga0213874_10048881 3300021377 Bacteria 1291
287 Ga0213874_10102494 3300021377 Bacteria 953
288 Ga0213876_10069114 3300021384 Bacteria 1866
289 Ga0213875_10000003 3300021388 Bacteria 719367
290 Ga0213875_10024691 3300021388 Bacteria 2865
291 Ga0213871_10034354 3300021441 Bacteria 1336
292 Ga0224572_1002024 3300024225 Bacteria 3183
293 Ga0224572_1014579 3300024225 Bacteria 1503
294 Ga0228598_1000419 3300024227 Bacteria 8618
295 Ga0207425_1000043 3300025245 Bacteria 208791
296 Ga0209148_1000409 3300025254 Bacteria 49427
297 Ga0209129_1000072 3300025258 Bacteria 208805
298 Ga0209455_1003530 3300025272 Bacteria 5489
299 Ga0209673_1008478 3300025273 Bacteria 4568
300 Ga0209130_1000062 3300025284 Bacteria 200367
301 Ga0209130_1000709 3300025284 Bacteria 29714
302 Ga0209675_1001144 3300025291 Bacteria 16175
303 Ga0209025_1000014 3300025294 Bacteria 865448
304 Ga0209025_1000053 3300025294 Bacteria 317600
305 Ga0209025_1000120 3300025294 Bacteria 208791
306 Ga0209025_1001382 3300025294 Bacteria 32401
307 Ga0209025_1083642 3300025294 Bacteria 1073
308 Ga0209564_1000017 3300025295 Bacteria 594063
309 Ga0209564_1000179 3300025295 Bacteria 151032
310 Ga0209758_1000111 3300025297 Bacteria 208790
311 Ga0209758_1013103 3300025297 Bacteria 4558
312 Ga0209758_1033923 3300025297 Bacteria 2040
313 Ga0209256_1000055 3300025299 Bacteria 295530
314 Ga0209256_1000338 3300025299 Bacteria 78064
315 Ga0207426_1000198 3300025302 Bacteria 146241
316 Ga0207653_10000769 3300025885 Bacteria 10875
317 Ga0207653_10018899 3300025885 Bacteria 2170
318 Ga0207682_10005803 3300025893 Bacteria 5003
319 Ga0207692_10073342 3300025898 Bacteria 1811
320 Ga0207692_10087619 3300025898 Bacteria 1680
321 Ga0207680_10069321 3300025903 Bacteria 2179
322 Ga0207685_10023843 3300025905 Bacteria 2089
323 Ga0207699_10042426 3300025906 Bacteria 2635
324 Ga0207699_10060836 3300025906 Bacteria 2270
325 Ga0207645_10022003 3300025907 Bacteria 4152
326 Ga0207645_10023566 3300025907 Bacteria 4000
327 Ga0207645_10310123 3300025907 Bacteria 1051
328 Ga0207705_10073083 3300025909 Bacteria 2488
329 Ga0207684_10012764 3300025910 Bacteria 7286
330 Ga0207684_10064422 3300025910 Bacteria 3111
331 Ga0207684_10628330 3300025910 Bacteria 916
332 Ga0207654_10213948 3300025911 Bacteria 1275
333 Ga0207707_10028651 3300025912 Bacteria 4867
334 Ga0207707_10043901 3300025912 Bacteria 3898
335 Ga0207671_10463348 3300025914 Bacteria 1010
336 Ga0207693_10008787 3300025915 Bacteria 8257
337 Ga0207693_10011224 3300025915 Bacteria 7252
338 Ga0207693_10038993 3300025915 Bacteria 3740
339 Ga0207693_10051541 3300025915 Bacteria 3229
340 Ga0207663_10121066 3300025916 Bacteria 1792
341 Ga0207660_10067897 3300025917 Bacteria 2584
342 Ga0207660_10148505 3300025917 Bacteria 1799
343 Ga0207662_10030972 3300025918 Bacteria 3108
344 Ga0207662_10149530 3300025918 Bacteria 1484
345 Ga0207657_10426457 3300025919 Bacteria 1042
346 Ga0207652_10062321 3300025921 Bacteria 3222
347 Ga0207646_10080961 3300025922 Bacteria 2903
348 Ga0207646_10172631 3300025922 Bacteria 1952
349 Ga0207646_10277428 3300025922 Bacteria 1515
350 Ga0207694_10084760 3300025924 Bacteria 2493
351 Ga0207694_10162699 3300025924 Bacteria 1803
352 Ga0207650_10001249 3300025925 Bacteria 18464
353 Ga0207650_10014724 3300025925 Bacteria 5436
354 Ga0207650_10056311 3300025925 Bacteria 2921
355 Ga0207659_10141312 3300025926 Bacteria 1869
356 Ga0207659_10299453 3300025926 Bacteria 1320
357 Ga0207700_10295286 3300025928 Bacteria 1398
358 Ga0207700_10391472 3300025928 Bacteria 1217
359 Ga0207700_10615847 3300025928 Bacteria 967
360 Ga0207700_10712926 3300025928 Bacteria 896
361 Ga0207664_10053126 3300025929 Bacteria 3206
362 Ga0207664_10173182 3300025929 Bacteria 1848
363 Ga0207664_10214617 3300025929 Bacteria 1666
364 Ga0207644_10109029 3300025931 Bacteria 2091
365 Ga0207644_10141114 3300025931 Bacteria 1855
366 Ga0207644_10308945 3300025931 Bacteria 1276
367 Ga0207690_10416850 3300025932 Bacteria 1074
368 Ga0207706_10074009 3300025933 Bacteria 2995
369 Ga0207706_10113277 3300025933 Bacteria 2386
370 Ga0207686_10039863 3300025934 Bacteria 2852
371 Ga0207670_10007806 3300025936 Bacteria 6003
372 Ga0207670_10117725 3300025936 Bacteria 1926
373 Ga0207670_10243787 3300025936 Bacteria 1386
374 Ga0207669_10117172 3300025937 Bacteria 1799
375 Ga0207669_10312823 3300025937 Bacteria 1198
376 Ga0207704_10041999 3300025938 Bacteria 2688
377 Ga0207704_10086786 3300025938 Bacteria 2042
378 Ga0207665_10001158 3300025939 Bacteria 17723
379 Ga0207665_10282026 3300025939 Bacteria 1237
380 Ga0207691_10013601 3300025940 Bacteria 7779
381 Ga0207691_10429730 3300025940 Bacteria 1125
382 Ga0207711_10026007 3300025941 Bacteria 4909
383 Ga0207711_10353912 3300025941 Bacteria 1360
384 Ga0207689_10044976 3300025942 Bacteria 3651
385 Ga0207689_10099359 3300025942 Bacteria 2391
386 Ga0207661_10224689 3300025944 Bacteria 1661
387 Ga0207679_10085271 3300025945 Bacteria 2426
388 Ga0207679_10089941 3300025945 Bacteria 2371
389 Ga0207667_10031391 3300025949 Bacteria 5735
390 Ga0207667_10092398 3300025949 Bacteria 3125
391 Ga0207651_10169012 3300025960 Bacteria 1722
392 Ga0207651_10340736 3300025960 Bacteria 1259
393 Ga0207651_10386343 3300025960 Bacteria 1187
394 Ga0207712_10002216 3300025961 Bacteria 12663
395 Ga0207668_10190943 3300025972 Bacteria 1623
396 Ga0207640_10339542 3300025981 Bacteria 1203
397 Ga0207658_10435541 3300025986 Bacteria 1158
398 Ga0207678_10023593 3300026067 Bacteria 5380
399 Ga0207678_10439656 3300026067 Bacteria 1133
400 Ga0207708_10017542 3300026075 Bacteria 5388
401 Ga0207708_10048742 3300026075 Bacteria 3225
402 Ga0207641_10014731 3300026088 Bacteria 6411
403 Ga0207641_10204658 3300026088 Bacteria 1822
404 Ga0207648_10082512 3300026089 Bacteria 2803
405 Ga0207676_10027399 3300026095 Bacteria 4244
406 Ga0207676_10064821 3300026095 Bacteria 2907
407 Ga0207676_10178642 3300026095 Bacteria 1856
408 Ga0207676_10601388 3300026095 Bacteria 1056
409 Ga0207674_10030214 3300026116 Bacteria 5699
410 Ga0207674_10199602 3300026116 Bacteria 1950
411 Ga0207675_100007776 3300026118 Bacteria 10112
412 Ga0207675_100065357 3300026118 Bacteria 3400
413 Ga0207675_100344822 3300026118 Bacteria 1458
414 Ga0207683_10028550 3300026121 Bacteria 4824
415 Ga0207683_10175736 3300026121 Bacteria 1940
416 Ga0207698_10109983 3300026142 Bacteria 2307
417 Ga0209281_1000068 3300027111 Bacteria 280238
418 Ga0209813_10014359 3300027866 Bacteria 2132
419 Ga0207428_10017003 3300027907 Bacteria 6248
420 Ga0207428_10065916 3300027907 Bacteria 2854
421 Ga0207428_10105752 3300027907 Bacteria 2170
422 Ga0268266_10131354 3300028379 Bacteria 2240
423 Ga0268265_10002000 3300028380 Bacteria 16092
424 Ga0268264_10010737 3300028381 Bacteria 7568
425 Ga0268264_10139049 3300028381 Bacteria 2163
426 Ga0268264_10180670 3300028381 Bacteria 1916
427 Ga0268264_10333435 3300028381 Bacteria 1438
428 Ga0265334_10021574 3300028573 Bacteria 2630
429 Ga0265332_10007414 3300031238 Bacteria 4958
430 Ga0265325_10073043 3300031241 Bacteria 1718
431 Ga0265329_10012383 3300031242 Bacteria 3066
432 Ga0265340_10006482 3300031247 Bacteria 6439
433 Ga0265340_10046962 3300031247 Bacteria 2105
434 Ga0265340_10048202 3300031247 Bacteria 2072
435 Ga0265340_10074224 3300031247 Bacteria 1609
436 Ga0265340_10167322 3300031247 Bacteria 997
437 Ga0265339_10000228 3300031249 Bacteria 45435
438 Ga0265339_10000979 3300031249 Bacteria 21883
439 Ga0265316_10138840 3300031344 Bacteria 1827
440 Ga0307408_100091887 3300031548 Bacteria 2293
441 Ga0265313_10000203 3300031595 Bacteria 63977
442 Ga0265313_10065718 3300031595 Bacteria 1683
443 Ga0265314_10059523 3300031711 Bacteria 2613
444 Ga0265314_10085870 3300031711 Bacteria 2062
445 Ga0265342_10000031 3300031712 Bacteria 152577
446 Ga0265342_10052343 3300031712 Bacteria 2434
447 Ga0265342_10063046 3300031712 Bacteria 2180
448 Ga0265342_10149924 3300031712 Bacteria 1295
449 Ga0307405_10001622 3300031731 Bacteria 9573
450 Ga0307405_10139289 3300031731 Bacteria 1689
451 Ga0316577_10135820 3300031733 Bacteria 1385
452 Ga0307412_10811041 3300031911 Bacteria 813
453 Ga0307409_100126626 3300031995 Bacteria 2174
454 Ga0307409_100146055 3300031995 Bacteria 2046
455 Ga0307416_100586609 3300032002 Bacteria 1193
456 Ga0307416_100613816 3300032002 Bacteria 1169
457 Ga0307414_10578075 3300032004 Bacteria 1005
458 Ga0307411_10633182 3300032005 Bacteria 924
459 Ga0307510_10264577 3300033180 Bacteria 1199
460 Ga0373926_0072478 3300035083 Bacteria 1267
461 Ga0373926_0106287 3300035083 Bacteria 1052
462 Ga0373944_0002788 3300035089 Bacteria 4470
463 Ga0373923_0002956 3300035111 Bacteria 5356
464 Ga0373923_0075736 3300035111 Bacteria 1452
465 Ga0373932_0091684 3300035112 Bacteria 976
466 Ga0373936_0035197 3300035113 Bacteria 1993
467 Ga0373941_0007246 3300035115 Bacteria 2708
468 Ga0373941_0232525 3300035115 Bacteria 713
469 Ga0373945_0036567 3300035116 Bacteria 1759
470 Ga0373953_0001366 3300035117 Bacteria 7020
471 Ga0373953_0006528 3300035117 Bacteria 3850
472 Ga0373954_0002877 3300035118 Bacteria 7267
473 Ga0373954_0100018 3300035118 Bacteria 1398
474 Ga0373956_0040275 3300035119 Bacteria 2072
475 Ga0373956_0047793 3300035119 Bacteria 1915
476 Ga0373943_0047398 3300035170 Bacteria 2101
477 Ga0373943_0069017 3300035170 Bacteria 1786
478 Ga0373943_0096100 3300035170 Bacteria 1542
479 Ga0373946_0007164 3300035171 Bacteria 4073
480 Ga0373946_0127361 3300035171 Bacteria 1168
481 Ga0373955_0000220 3300035172 Bacteria 24057
482 Ga0373955_0118078 3300035172 Bacteria 1539
483 Ga0373924_0058990 3300035410 Bacteria 1602
484 Ga0373931_0113163 3300035691 Bacteria 1542
485 Ga0373931_0131277 3300035691 Bacteria 1442
486 Ga0373931_0449716 3300035691 Bacteria 824
487 Ga0373935_0000227 3300035692 Bacteria 27455
488 Ga0373935_0186763 3300035692 Bacteria 1425
489 Ga0373935_0203394 3300035692 Bacteria 1369
490 Ga0373927_0076509 3300035695 Bacteria 2167
491 Ga0373933_0005475 3300035724 Bacteria 6915
492 Ga0373947_0000216 3300035725 Bacteria 32290
493 Ga0373947_0090952 3300035725 Bacteria 1903
494 Ga0373947_0191222 3300035725 Bacteria 1336
495 Ga0373937_0000003 3300036401 Bacteria 235408
496 Ga0373937_0036084 3300036401 Bacteria 4504
497 Ga0373925_0000118 3300037068 Bacteria 85072
498 Ga0373925_0101412 3300037068 Bacteria 2213
499 Ga0373925_0109802 3300037068 Bacteria 2129
500 Ga0373925_0241631 3300037068 Bacteria 1446
501 Ga0395899_0050936 3300037312 Bacteria 3073
502 Ga0395900_0016637 3300037418 Bacteria 7501
503 Ga0395900_0109235 3300037418 Bacteria 2841
504 Ga0395900_0254397 3300037418 Bacteria 1756
505 Ga0395898_0009907 3300037466 Bacteria 9983
506 Ga0395898_0031164 3300037466 Bacteria 5331
507 Ga0436364_0023609 3300037853 Bacteria 2234
508 Ga0436364_0772610 3300037853 Bacteria 3196
509 Ga0436364_0935904 3300037853 Bacteria 1323
510 Ga0436364_0960990 3300037853 Bacteria 25250
511 Ga0436364_1074351 3300037853 Bacteria 12199
512 Ga0436364_1359778 3300037853 Bacteria 2689
513 Ga0436364_1363918 3300037853 Bacteria 7515
514 Ga0436364_1377062 3300037853 Bacteria 4584
515 Ga0436364_1406972 3300037853 Bacteria 1678
516 Ga0395901_0084030 3300038443 Bacteria 3327
517 Ga0395901_0114185 3300038443 Bacteria 2836
518 Ga0395901_0688391 3300038443 Bacteria 1021
519 Ga0436365_0699198 3300039437 Bacteria 2999
520 Ga0436365_0992290 3300039437 Bacteria 833
521 Ga0436365_1269647 3300039437 Bacteria 1201
522 Ga0436365_1438404 3300039437 Bacteria 5322
523 Ga0436365_1619444 3300039437 Bacteria 1413
524 Ga0436365_1620720 3300039437 Bacteria 959
525 Ga0436365_1753369 3300039437 Bacteria 1845
526 Ga0436365_1788190 3300039437 Bacteria 2119
527 Ga0436360_0309149 3300039438 Bacteria 981
528 Ga0436360_0413491 3300039438 Bacteria 1342
529 Ga0436360_1133561 3300039438 Bacteria 1766
530 Ga0436360_1234148 3300039438 Bacteria 2137
531 Ga0436361_0185672 3300039447 Bacteria 1420
532 Ga0436361_0914590 3300039447 Bacteria 1011
533 Ga0436361_1014188 3300039447 Bacteria 2081
534 Ga0436363_0578409 3300039450 Bacteria 1256
535 Ga0436363_0769764 3300039450 Bacteria 1595
536 Ga0436363_1140198 3300039450 Bacteria 1462
537 Ga0436363_1200244 3300039450 Bacteria 2773
538 Ga0436363_1623736 3300039450 Bacteria 1306
539 Ga0436362_0257423 3300039453 Bacteria 968
540 Ga0436362_0546702 3300039453 Bacteria 1122
541 Ga0436362_1178242 3300039453 Bacteria 1011
542 Ga0439453_0001364 3300041408 Bacteria 3115
543 Ga0439431_0017193 3300041997 Bacteria 1698
544 Ga0439441_019221 3300042001 Bacteria 1241
545 Ga0439445_0071863 3300042004 Bacteria 958
546 Ga0439459_0030659 3300042438 Bacteria 1092
547 Ga0439460_0057115 3300042461 Bacteria 1183
548 Ga0466966_0112780 3300044684 Bacteria 1675
549 Ga0466963_0007515 3300044694 Bacteria 6503
550 Ga0451576_0061854 3300045051 Bacteria 3904
551 Ga0451576_0097441 3300045051 Bacteria 3058
552 Ga0451576_0224973 3300045051 Bacteria 1959
553 Ga0495617_106859 3300046452 Bacteria 907
554 Ga0495592_0000215 3300046454 Bacteria 49510
555 Ga0495592_0079791 3300046454 Bacteria 2368
556 Ga0495629_0219132 3300046459 Bacteria 1313
557 Ga0495629_0221345 3300046459 Bacteria 1305
558 Ga0495638_0129382 3300046460 Bacteria 1484
559 Ga0495641_0054103 3300046461 Bacteria 1824
560 Ga0495651_0000583 3300046462 Bacteria 28302
561 Ga0495651_0022639 3300046462 Bacteria 4884
562 Ga0495653_0000039 3300046463 Bacteria 119840
563 Ga0495582_0112097 3300046473 Bacteria 1532
564 Ga0495582_0267745 3300046473 Bacteria 980
565 Ga0495605_0123897 3300046474 Bacteria 1170
566 Ga0495639_0061719 3300046475 Bacteria 1719
567 Ga0495639_0228782 3300046475 Bacteria 916
568 Ga0495639_0271074 3300046475 Bacteria 842
569 Ga0495662_0011969 3300046476 Bacteria 4240
570 Ga0495662_0028292 3300046476 Bacteria 2706
571 Ga0495664_0000015 3300046477 Bacteria 192569
572 Ga0495594_0187710 3300046499 Bacteria 1177
573 Ga0495606_0008343 3300046507 Bacteria 9021
574 Ga0495606_0178162 3300046507 Bacteria 1228
575 Ga0495608_0000025 3300046511 Bacteria 158132
576 Ga0495608_0147782 3300046511 Bacteria 1498
577 Ga0495618_0000040 3300046514 Bacteria 98012
578 Ga0495628_0000011 3300046516 Bacteria 225267
579 Ga0495628_0021104 3300046516 Bacteria 5363
580 Ga0495630_0004483 3300046517 Bacteria 9789
581 Ga0495630_0073286 3300046517 Bacteria 2579
582 Ga0495630_0233462 3300046517 Bacteria 1406
583 Ga0495630_0381058 3300046517 Bacteria 1080
584 Ga0495644_0017579 3300046523 Bacteria 2734
585 Ga0495666_0024276 3300046526 Bacteria 2996
586 Ga0495652_0000014 3300046529 Bacteria 225484
587 Ga0495652_0212140 3300046529 Bacteria 1461
588 Ga0495652_0335705 3300046529 Bacteria 1087
589 Ga0495654_0003262 3300046530 Bacteria 10009
590 Ga0495640_0000008 3300046533 Bacteria 220320
591 Ga0495640_0009352 3300046533 Bacteria 7632
592 Ga0495640_0092168 3300046533 Bacteria 1999
593 Ga0495640_0325577 3300046533 Bacteria 951
594 Ga0495587_0000015 3300046536 Bacteria 187415
595 Ga0495587_0015850 3300046536 Bacteria 4698
596 Ga0495598_0000520 3300046537 Bacteria 7141
597 Ga0495598_0022216 3300046537 Bacteria 1696
598 Ga0495609_0120191 3300046538 Bacteria 1130
599 Ga0495621_0008029 3300046539 Bacteria 3147
600 Ga0495621_0042198 3300046539 Bacteria 1605
601 Ga0495645_0000020 3300046543 Bacteria 143867
602 Ga0495622_0092691 3300046557 Bacteria 1387
603 Ga0495633_0098707 3300046558 Bacteria 1356
604 Ga0495667_0000013 3300046559 Bacteria 220294
605 Ga0495656_0039320 3300046615 Bacteria 1964
606 Ga0495668_0091139 3300046616 Bacteria 1670
607 Ga0495634_0000415 3300046642 Bacteria 42260
608 Ga0495634_0028352 3300046642 Bacteria 3887
609 Ga0495611_0096668 3300046648 Bacteria 1368
610 Ga0495635_0000012 3300046663 Bacteria 225271
611 Ga0495635_0134781 3300046663 Bacteria 1683
612 Ga0495657_0000815 3300046675 Bacteria 27667
613 Ga0495657_0146719 3300046675 Bacteria 1467
614 Ga0495599_0000008 3300046678 Bacteria 225534
615 Ga0495599_0078357 3300046678 Bacteria 2063
616 Ga0495623_0000002 3300046679 Bacteria 166669
617 Ga0495646_0000004 3300046680 Bacteria 268993
618 Ga0495646_0049482 3300046680 Bacteria 2551
619 Ga0495647_0086365 3300046681 Bacteria 1280
620 Ga0495658_0155499 3300046683 Bacteria 1407
621 Ga0495613_0048557 3300046689 Bacteria 3134
622 Ga0495613_0078769 3300046689 Bacteria 2397
623 Ga0495624_0104410 3300046690 Bacteria 1744
624 Ga0495589_0052547 3300046794 Bacteria 2013
625 Ga0495600_0000024 3300046809 Bacteria 92414
626 Ga0495600_0097235 3300046809 Bacteria 1919
627 Ga0495581_0039756 3300047315 Bacteria 2723
628 Ga0495604_0000001 3300047317 Bacteria 708627
629 Ga0495604_0154591 3300047317 Bacteria 1626
630 Ga0495674_0000023 3300047319 Bacteria 157443
631 Ga0495676_0065149 3300047321 Bacteria 2829
632 Ga0495680_0003698 3300047322 Bacteria 14944
633 Ga0495675_0000392 3300047444 Bacteria 30250
634 Ga0495685_048693 3300047447 Bacteria 1441
635 Ga0495684_0000007 3300047471 Bacteria 225614
636 Ga0495684_0012287 3300047471 Bacteria 6605
637 Ga0495684_0181351 3300047471 Bacteria 1560
638 Ga0495686_0008971 3300047472 Bacteria 7259
639 Ga0495686_0010433 3300047472 Bacteria 6609
640 Ga0495593_0001189 3300047673 Bacteria 15218
641 Ga0495602_0000045 3300048088 Bacteria 118132
642 Ga0495602_0095585 3300048088 Bacteria 2452
643 Ga0495602_0375550 3300048088 Bacteria 1020
644 Ga0495614_0101363 3300048089 Bacteria 1259
645 Ga0495615_0024701 3300048090 Bacteria 1389
646 Ga0496100_0001068 3300048903 Bacteria 13197
647 Ga0496100_0020431 3300048903 Bacteria 3970
648 Ga0496100_0048326 3300048903 Bacteria 2746
649 Ga0496100_0404162 3300048903 Bacteria 1041
650 Ga0496101_0023314 3300048904 Bacteria 4274
651 Ga0496101_0048287 3300048904 Bacteria 3058
652 Ga0496101_0071082 3300048904 Bacteria 2550
653 Ga0496101_0147205 3300048904 Bacteria 1799
654 Ga0496102_0004311 3300048905 Bacteria 12031
655 Ga0496102_0006570 3300048905 Bacteria 9931
656 Ga0496102_0013773 3300048905 Bacteria 7015
657 Ga0496102_0027078 3300048905 Bacteria 5119
658 Ga0496102_0412539 3300048905 Bacteria 1269
659 Ga0496103_0018475 3300048906 Bacteria 4181
660 Ga0496103_0090265 3300048906 Bacteria 1933
661 Ga0496104_0000661 3300048907 Bacteria 29545
662 Ga0496104_0046961 3300048907 Bacteria 4069
663 Ga0496104_0051105 3300048907 Bacteria 3900
664 Ga0496104_0122314 3300048907 Bacteria 2498
665 Ga0496104_0135135 3300048907 Bacteria 2369
666 Ga0496104_0261587 3300048907 Bacteria 1643
667 Ga0496104_0604805 3300048907 Bacteria 1006
668 Ga0496104_0786924 3300048907 Bacteria 857
669 Ga0496105_0019801 3300048908 Bacteria 5429
670 Ga0496105_0032101 3300048908 Bacteria 4307
671 Ga0496105_0062086 3300048908 Bacteria 3084
672 Ga0496105_0168858 3300048908 Bacteria 1794
673 Ga0496105_0389394 3300048908 Bacteria 1108
674 Ga0496106_0006097 3300048909 Bacteria 8917
675 Ga0496106_0027107 3300048909 Bacteria 4267
676 Ga0496106_0055368 3300048909 Bacteria 2998
677 Ga0496106_0286275 3300048909 Bacteria 1321
678 Ga0496106_0454912 3300048909 Bacteria 1028
679 Ga0496107_0001451 3300048910 Bacteria 14662
680 Ga0496107_0094639 3300048910 Bacteria 2185
681 Ga0496107_0149933 3300048910 Bacteria 1724
682 Ga0496108_0002614 3300048911 Bacteria 14425
683 Ga0496108_0005866 3300048911 Bacteria 9956
684 Ga0496108_0016291 3300048911 Bacteria 6062
685 Ga0496108_0018324 3300048911 Bacteria 5733
686 Ga0496108_0209676 3300048911 Bacteria 1691
687 Ga0496108_0403308 3300048911 Bacteria 1194
688 Ga0496109_0000402 3300048912 Bacteria 39063
689 Ga0496109_0000629 3300048912 Bacteria 29391
690 Ga0496109_0002222 3300048912 Bacteria 16104
691 Ga0496109_0010095 3300048912 Bacteria 8056
692 Ga0496109_0250342 3300048912 Bacteria 1668
693 Ga0496110_0002519 3300048913 Bacteria 13766
694 Ga0496110_0235985 3300048913 Bacteria 1664
695 Ga0496110_0358056 3300048913 Bacteria 1329
696 Ga0496110_0689514 3300048913 Bacteria 922
697 Ga0496111_0004762 3300048914 Bacteria 8612
698 Ga0496111_0006001 3300048914 Bacteria 7845
699 Ga0496111_0014388 3300048914 Bacteria 5403
700 Ga0496111_0022216 3300048914 Bacteria 4438
701 Ga0496111_0076489 3300048914 Bacteria 2440
702 Ga0496112_0009347 3300048915 Bacteria 8824
703 Ga0496112_0059114 3300048915 Bacteria 3777
704 Ga0496112_0159660 3300048915 Bacteria 2221
705 Ga0496112_0361917 3300048915 Bacteria 1392
706 Ga0496112_0470126 3300048915 Bacteria 1195
707 Ga0496113_0002450 3300048916 Bacteria 10802
708 Ga0496113_0010086 3300048916 Bacteria 6231
709 Ga0496113_0012160 3300048916 Bacteria 5776
710 Ga0496114_0033372 3300048917 Bacteria 4241
711 Ga0496114_0074669 3300048917 Bacteria 2854
712 Ga0496114_0096431 3300048917 Bacteria 2518
713 Ga0496115_0054392 3300048918 Bacteria 3214
714 Ga0496115_0076213 3300048918 Bacteria 2725
715 Ga0496115_0105507 3300048918 Bacteria 2313
716 Ga0496115_0185614 3300048918 Bacteria 1718
717 Ga0496115_0335641 3300048918 Bacteria 1234
718 Ga0496115_0343695 3300048918 Bacteria 1217
719 Ga0496115_0483745 3300048918 Bacteria 996
720 Ga0496115_0498829 3300048918 Bacteria 978
721 Ga0496116_0015598 3300048919 Bacteria 5999
722 Ga0496116_0044773 3300048919 Bacteria 3002
723 Ga0496117_0091104 3300048920 Bacteria 1962
724 Ga0496117_0191181 3300048920 Bacteria 1166
725 Ga0496119_0182568 3300048922 Bacteria 1099
726 Ga0496121_0007746 3300048924 Bacteria 12872
727 Ga0496121_0064321 3300048924 Bacteria 2991
728 Ga0496121_0180521 3300048924 Bacteria 1524
729 Ga0496121_0246921 3300048924 Bacteria 1240
730 Ga0496122_0000042 3300048925 Bacteria 280482
731 Ga0496122_0028821 3300048925 Bacteria 4698
732 Ga0496122_0035502 3300048925 Bacteria 4053
733 Ga0496123_0000030 3300048926 Bacteria 291764
734 Ga0496123_0004716 3300048926 Bacteria 14106
735 Ga0496123_0061708 3300048926 Bacteria 2406
736 Ga0496123_0110070 3300048926 Bacteria 1577
737 Ga0496124_0006891 3300048927 Bacteria 12213
738 Ga0496124_0144274 3300048927 Bacteria 1875
739 Ga0496124_0202090 3300048927 Bacteria 1510
740 Ga0496125_0018305 3300048928 Bacteria 6656
741 Ga0496126_0198157 3300048929 Bacteria 1697
742 Ga0501032_0029001 3300049569 Bacteria 3800
743 Ga0501032_0070411 3300049569 Bacteria 2332
744 Ga0501032_0118701 3300049569 Bacteria 1749
745 Ga0501033_0047501 3300049570 Bacteria 3191
746 Ga0501033_0053683 3300049570 Bacteria 2984
747 Ga0501033_0067066 3300049570 Bacteria 2639
748 Ga0501033_0111625 3300049570 Bacteria 1989
749 Ga0501033_0302774 3300049570 Bacteria 1125
750 Ga0501033_0463084 3300049570 Bacteria 880
751 Ga0501034_0010534 3300049571 Bacteria 9626
752 Ga0501034_0019606 3300049571 Bacteria 6915
753 Ga0501034_0096730 3300049571 Bacteria 2948
754 Ga0501034_0308485 3300049571 Bacteria 1518
755 Ga0501034_0313185 3300049571 Bacteria 1503
756 Ga0501034_0386195 3300049571 Bacteria 1324
757 Ga0501034_0420347 3300049571 Bacteria 1258
758 Ga0501034_0581451 3300049571 Bacteria 1027
759 Ga0501036_0003133 3300049572 Bacteria 13193
760 Ga0501036_0089064 3300049572 Bacteria 2607
761 Ga0501036_0386004 3300049572 Bacteria 1169
762 Ga0501037_0123244 3300049573 Bacteria 1862
763 Ga0501037_0165182 3300049573 Bacteria 1576
764 Ga0501037_0171955 3300049573 Bacteria 1539
765 Ga0501037_0264759 3300049573 Bacteria 1201
766 Ga0501037_0342647 3300049573 Bacteria 1032
767 Ga0501038_0018550 3300049574 Bacteria 6283
768 Ga0501038_0084361 3300049574 Bacteria 2673
769 Ga0501038_0087949 3300049574 Bacteria 2608
770 Ga0501038_0140975 3300049574 Bacteria 1972
771 Ga0501039_0038499 3300049575 Bacteria 3693
772 Ga0501039_0097174 3300049575 Bacteria 2297
773 Ga0501039_0097449 3300049575 Bacteria 2293
774 Ga0501039_0222933 3300049575 Bacteria 1482
775 Ga0501039_0642138 3300049575 Bacteria 831
776 Ga0501041_0067566 3300049577 Bacteria 2191
777 Ga0501042_0214649 3300049578 Bacteria 1388
778 Ga0501043_0002174 3300049579 Bacteria 16722
779 Ga0501043_0102192 3300049579 Bacteria 2253
780 Ga0501043_0120873 3300049579 Bacteria 2054
781 Ga0501046_0016092 3300049580 Bacteria 6272
782 Ga0501046_0090574 3300049580 Bacteria 2353
783 Ga0501047_0003356 3300049581 Bacteria 15165
784 Ga0501047_0036939 3300049581 Bacteria 4721
785 Ga0501047_0083623 3300049581 Bacteria 3067
786 Ga0501047_0167765 3300049581 Bacteria 2065
787 Ga0501048_0029604 3300049582 Bacteria 3969
788 Ga0501048_0074327 3300049582 Bacteria 2398
789 Ga0501067_0356555 3300049583 Bacteria 815
790 Ga0501068_0166386 3300049584 Bacteria 1391
791 Ga0501069_0081524 3300049585 Bacteria 1822
792 Ga0501070_0021600 3300049586 Bacteria 5398
793 Ga0501070_0028481 3300049586 Bacteria 4685
794 Ga0501070_0035001 3300049586 Bacteria 4197
795 Ga0501070_0117977 3300049586 Bacteria 2192
796 Ga0501070_0119685 3300049586 Bacteria 2176
797 Ga0501071_0022628 3300049587 Bacteria 4383
798 Ga0501071_0167416 3300049587 Bacteria 1645
799 Ga0501072_0021583 3300049588 Bacteria 4995
800 Ga0501072_0061204 3300049588 Bacteria 2968
801 Ga0501072_0064161 3300049588 Bacteria 2897
802 Ga0501072_0100980 3300049588 Bacteria 2293
803 Ga0501072_0128656 3300049588 Bacteria 2018
804 Ga0501073_0004247 3300049589 Bacteria 10743
805 Ga0501073_0066245 3300049589 Bacteria 2518
806 Ga0501073_0066345 3300049589 Bacteria 2516
807 Ga0501073_0121744 3300049589 Bacteria 1808
808 Ga0501074_0074802 3300049590 Bacteria 2432
809 Ga0501074_0114296 3300049590 Bacteria 1931
810 Ga0501074_0275379 3300049590 Bacteria 1196
811 Ga0501075_0012911 3300049591 Bacteria 5950
812 Ga0501075_0019474 3300049591 Bacteria 4923
813 Ga0501075_0068181 3300049591 Bacteria 2687
814 Ga0501075_0153807 3300049591 Bacteria 1754
815 Ga0501075_0292397 3300049591 Bacteria 1241
816 Ga0501076_0007181 3300049592 Bacteria 8098
817 Ga0501076_0042884 3300049592 Bacteria 3564
818 Ga0501076_0190723 3300049592 Bacteria 1672
819 Ga0501076_0316375 3300049592 Bacteria 1280
820 Ga0501077_0005783 3300049593 Bacteria 7533
821 Ga0501077_0372365 3300049593 Bacteria 912
822 Ga0501079_0006499 3300049741 Bacteria 8781
823 Ga0501079_0098973 3300049741 Bacteria 2260
824 Ga0501079_0120829 3300049741 Bacteria 2037
825 Ga0501079_0122792 3300049741 Bacteria 2020
826 Ga0501079_0138006 3300049741 Bacteria 1899
827 Ga0501080_0015977 3300049742 Bacteria 6925
828 Ga0501080_0037519 3300049742 Bacteria 4527
829 Ga0501080_0147220 3300049742 Bacteria 2177
830 Ga0501080_0222919 3300049742 Bacteria 1725
831 Ga0501080_0241733 3300049742 Bacteria 1648
832 Ga0501080_0286991 3300049742 Bacteria 1495
833 Ga0501080_0401704 3300049742 Bacteria 1233
834 Ga0501081_0010912 3300049743 Bacteria 5938
835 Ga0501081_0063673 3300049743 Bacteria 2560
836 Ga0501081_0209760 3300049743 Bacteria 1414
837 Ga0501083_0041219 3300049744 Bacteria 3131
838 Ga0501083_0044636 3300049744 Bacteria 3000
839 Ga0501083_0056277 3300049744 Bacteria 2636
840 Ga0501083_0089133 3300049744 Bacteria 2039
841 Ga0501083_0121900 3300049744 Bacteria 1710
842 Ga0501083_0182695 3300049744 Bacteria 1369
843 Ga0501035_0018680 3300049822 Bacteria 6386
844 Ga0501035_0059223 3300049822 Bacteria 3410
845 Ga0501035_0096264 3300049822 Bacteria 2601
846 Ga0501044_0012550 3300049823 Bacteria 9177
847 Ga0501044_0026844 3300049823 Bacteria 6095
848 Ga0501044_0138273 3300049823 Bacteria 2425
849 Ga0501044_0186254 3300049823 Bacteria 2040
850 Ga0501044_0202811 3300049823 Bacteria 1941
851 Ga0501044_0231594 3300049823 Bacteria 1794
852 Ga0501044_0397934 3300049823 Bacteria 1290
853 Ga0501044_0466509 3300049823 Bacteria 1167
854 Ga0501045_0067577 3300049824 Bacteria 2625
855 Ga0501045_0482668 3300049824 Bacteria 921
856 nmdc:mga03683_230033_c1 3300050489 Bacteria 857
857 nmdc:mga03683_24008_c1 3300050489 Bacteria 2382
858 nmdc:mga03683_30505_c1 3300050489 Bacteria 2158
859 nmdc:mga03683_9239_c1 3300050489 Bacteria 3498
860 nmdc:mga00v17_164611_c1 3300050491 Bacteria 1429
861 nmdc:mga00v17_272282_c1 3300050491 Bacteria 1099
862 nmdc:mga00v17_499337_c1 3300050491 Bacteria 789
863 nmdc:mga00v17_73809_c1 3300050491 Bacteria 2119
864 nmdc:mga0k408_36688_c1 3300050493 Bacteria 2814
865 nmdc:mga06z11_193676_c1 3300050494 Bacteria 1178
866 nmdc:mga06z11_313107_c1 3300050494 Bacteria 935
867 nmdc:mga06z11_624_c1 3300050494 Bacteria 12880
868 nmdc:mga06z11_6651_c1 3300050494 Bacteria 4723
869 nmdc:mga07m45_112183_c1 3300050496 Bacteria 1571
870 nmdc:mga07m45_226293_c1 3300050496 Bacteria 1088
871 nmdc:mga05p37_138365_c1 3300050507 Bacteria 2984
872 nmdc:mga05p37_14344_c1 3300050507 Bacteria 9514
873 nmdc:mga05p37_236590_c1 3300050507 Bacteria 2198
874 nmdc:mga05p37_336128_c1 3300050507 Bacteria 1782
875 nmdc:mga05p37_464861_c1 3300050507 Bacteria 1461
876 nmdc:mga05p37_52_c1 3300050507 Bacteria 102932
877 nmdc:mga05p37_79819_c1 3300050507 Bacteria 4029
878 nmdc:mga09592_467986_c1 3300050508 Bacteria 1087
879 nmdc:mga09592_473848_c1 3300050508 Bacteria 1079
880 nmdc:mga09592_58183_c1 3300050508 Bacteria 3269
881 nmdc:mga0qj67_212290_c1 3300050509 Bacteria 1572
882 nmdc:mga0qj67_277289_c1 3300050509 Bacteria 1359
883 nmdc:mga0qj67_29384_c1 3300050509 Bacteria 4270
884 nmdc:mga0qj67_96526_c1 3300050509 Bacteria 2379
885 nmdc:mga06r32_128381_c1 3300050510 Bacteria 2505
886 nmdc:mga06r32_141034_c1 3300050510 Bacteria 2386
887 nmdc:mga06r32_19837_c1 3300050510 Bacteria 6178
888 nmdc:mga06r32_33635_c1 3300050510 Bacteria 4829
889 nmdc:mga06r32_4_c1 3300050510 Bacteria 144637
890 nmdc:mga06r32_53650_c1 3300050510 Bacteria 3863
891 nmdc:mga06r32_54301_c1 3300050510 Bacteria 3841
892 nmdc:mga06r32_70968_c1 3300050510 Bacteria 3370
893 nmdc:mga08y16_104210_c1 3300050511 Bacteria 2953
894 nmdc:mga08y16_12764_c1 3300050511 Bacteria 8840
895 nmdc:mga08y16_23571_c1 3300050511 Bacteria 6501
896 nmdc:mga08y16_343388_c2 3300050511 Bacteria 1239
897 nmdc:mga08y16_60153_c1 3300050511 Bacteria 3968
898 nmdc:mga08y16_822_c1 3300050511 Bacteria 29788
899 nmdc:mga0n895_159895_c1 3300050512 Bacteria 2284
900 nmdc:mga0n895_20493_c1 3300050512 Bacteria 6168
901 nmdc:mga0n895_374941_c1 3300050512 Bacteria 1440
902 nmdc:mga0n895_39420_c1 3300050512 Bacteria 4583
903 nmdc:mga0n895_479195_c1 3300050512 Bacteria 1255
904 nmdc:mga0n895_66950_c1 3300050512 Bacteria 3556
905 nmdc:mga0rr50_35335_c1 3300050513 Bacteria 3588
906 nmdc:mga0rr50_58880_c2 3300050513 Bacteria 2232
907 nmdc:mga0rr50_8215_c1 3300050513 Bacteria 6485
908 nmdc:mga08x19_7802_c1 3300050514 Bacteria 6358
909 nmdc:mga08x19_96665_c1 3300050514 Bacteria 1955
910 nmdc:mga0a205_100676_c1 3300050515 Bacteria 2788
911 nmdc:mga0a205_149514_c1 3300050515 Bacteria 2236
912 nmdc:mga0a205_423703_c1 3300050515 Bacteria 1193
913 nmdc:mga0sz30_111115_c1 3300050516 Bacteria 1201
914 nmdc:mga0sz30_1180_c1 3300050516 Bacteria 9356
915 nmdc:mga0sz30_15974_c1 3300050516 Bacteria 2972
916 Ga0495601_0000014 3300053077 Bacteria 220318
917 Ga0495601_0064093 3300053077 Bacteria 2336
918 Ga0495601_0093164 3300053077 Bacteria 1940
919 Ga0495601_0134966 3300053077 Bacteria 1608
920 Ga0495601_0225789 3300053077 Bacteria 1223
921 Ga0495612_0000014 3300053078 Bacteria 187444
922 Ga0495595_0000038 3300053084 Bacteria 70955
923 Ga0495595_0004030 3300053084 Bacteria 5878
924 Ga0495595_0010247 3300053084 Bacteria 3892
925 Ga0495595_0074538 3300053084 Bacteria 1609
926 Ga0495619_0000006 3300053085 Bacteria 384835
927 Ga0495619_0075710 3300053085 Bacteria 2259
928 Ga0495619_0077125 3300053085 Bacteria 2238
929 Ga0495619_0180958 3300053085 Bacteria 1458
930 Ga0495619_0231760 3300053085 Bacteria 1279
931 Ga0500643_010040 3300053087 Bacteria 3562
932 Ga0500644_0004361 3300053088 Bacteria 3538
933 Ga0500651_0066125 3300053093 Bacteria 2252
934 Ga0500566_0008714 3300053094 Bacteria 6001
935 Ga0500641_0001762 3300053096 Bacteria 7667
936 Ga0500641_0008450 3300053096 Bacteria 3674
937 Ga0500562_006316 3300053108 Bacteria 2989
938 Ga0500593_029191 3300053117 Bacteria 2464
939 Ga0500595_000029 3300053119 Bacteria 122318
940 Ga0500618_001534 3300053125 Bacteria 10130
941 Ga0500618_004196 3300053125 Bacteria 4687
942 Ga0500652_005799 3300053131 Bacteria 3924
943 Ga0500568_0037136 3300053139 Bacteria 1978
944 Ga0500568_0039564 3300053139 Bacteria 1903
945 Ga0500616_0000006 3300053153 Bacteria 944738
946 Ga0500616_0001264 3300053153 Bacteria 25261
947 Ga0500616_0005830 3300053153 Bacteria 8254
948 Ga0500616_0058602 3300053153 Bacteria 2003
949 Ga0500616_0061300 3300053153 Bacteria 1948
950 Ga0500622_0013242 3300053156 Bacteria 4451
951 Ga0500622_0039088 3300053156 Bacteria 2474
952 Ga0500627_0183364 3300053158 Bacteria 941
953 Ga0500645_000290 3300053730 Bacteria 36019
954 Ga0500645_030286 3300053730 Bacteria 1629
955 Ga0501084_0003507 3300054114 Bacteria 12748
956 Ga0501084_0074174 3300054114 Bacteria 2849
957 Ga0501084_0124559 3300054114 Bacteria 2168
958 Ga0501084_0196063 3300054114 Bacteria 1704
959 Ga0501084_0254920 3300054114 Bacteria 1481
960 Ga0501084_0285121 3300054114 Bacteria 1395
961 Ga0501084_0321559 3300054114 Bacteria 1307
962 Ga0501084_0758671 3300054114 Bacteria 817
963 Ga0501082_0017594 3300060353 Bacteria 6156
964 Ga0501082_0064266 3300060353 Bacteria 3161
965 Ga0501082_0087994 3300060353 Bacteria 2680
966 Ga0501082_0123907 3300060353 Bacteria 2241
967 Ga0501082_0195979 3300060353 Bacteria 1757
968 Ga0501082_0633011 3300060353 Bacteria 936
969 Ga0530510_0038632 3300061734 Bacteria 3446
970 Ga0530510_0073482 3300061734 Bacteria 2482
971 Ga0530510_0223769 3300061734 Bacteria 1399
972 Ga0530510_0451419 3300061734 Bacteria 972

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035083 Ga0373926_0072478 Ga0373926_0072478_11_655 214
2 3300035115 Ga0373941_0232525 Ga0373941_0232525_17_661 214
3 3300048918 Ga0496115_0498829 Ga0496115_0498829_306_950 214
4 3300049583 Ga0501067_0356555 Ga0501067_0356555_133_798 215
5 3300025932 Ga0207690_10416850 Ga0207690_104168501 221
6 3300039450 Ga0436363_1140198 Ga0436363_1140198_64_813 224
7 3300054114 Ga0501084_0196063 Ga0501084_0196063_378_1058 226
8 3300042001 Ga0439441_019221 Ga0439441_019221_345_1121 227
9 3300042461 Ga0439460_0057115 Ga0439460_0057115_255_1031 227
10 3300005468 Ga0070707_100473022 Ga0070707_1004730222 232
11 3300005471 Ga0070698_100143789 Ga0070698_1001437893 232
12 3300005518 Ga0070699_100156092 Ga0070699_1001560921 232
13 3300037853 Ga0436364_0772610 Ga0436364_0772610_1950_2696 234
14 3300021384 Ga0213876_10069114 Ga0213876_100691142 237
15 3300039437 Ga0436365_0699198 Ga0436365_0699198_2147_2899 237
16 3300021388 Ga0213875_10024691 Ga0213875_100246912 238
17 3300037853 Ga0436364_1074351 Ga0436364_1074351_3883_4650 238
18 3300037853 Ga0436364_1359778 Ga0436364_1359778_45_815 238
19 3300031711 Ga0265314_10059523 Ga0265314_100595232 239
20 3300039437 Ga0436365_1619444 Ga0436365_1619444_495_1259 239
21 3300005937 Ga0081455_10092343 Ga0081455_100923432 240
22 3300048907 Ga0496104_0046961 Ga0496104_0046961_309_1061 240
23 3300048913 Ga0496110_0689514 Ga0496110_0689514_130_882 240
24 3300048918 Ga0496115_0105507 Ga0496115_0105507_678_1430 240
25 iso_pu_bacteria 2894772417 2894773702 241
26 3300006051 Ga0075364_10319755 Ga0075364_103197551 242
27 3300006847 Ga0075431_100225890 Ga0075431_1002258902 242
28 3300007788 Ga0099795_10019938 Ga0099795_100199382 242
29 3300009093 Ga0105240_10270653 Ga0105240_102706532 242
30 3300037418 Ga0395900_0016637 Ga0395900_0016637_2382_3131 242
31 3300037466 Ga0395898_0009907 Ga0395898_0009907_2464_3213 242
32 3300039438 Ga0436360_1133561 Ga0436360_1133561_686_1414 242
33 3300039450 Ga0436363_0769764 Ga0436363_0769764_833_1561 242
34 3300046475 Ga0495639_0228782 Ga0495639_0228782_105_833 242
35 3300046476 Ga0495662_0011969 Ga0495662_0011969_2412_3140 242
36 3300046533 Ga0495640_0092168 Ga0495640_0092168_211_939 242
37 3300048903 Ga0496100_0404162 Ga0496100_0404162_150_905 242
38 3300048907 Ga0496104_0604805 Ga0496104_0604805_11_739 242
39 3300048924 Ga0496121_0180521 Ga0496121_0180521_65_829 242
40 3300050491 nmdc:mga00v17_499337_c1 nmdc:mga00v17_499337_c1_51_779 242
41 3300050509 nmdc:mga0qj67_96526_c1 nmdc:mga0qj67_96526_c1_568_1389 242
42 3300053077 Ga0495601_0064093 Ga0495601_0064093_954_1682 242
43 3300053084 Ga0495595_0004030 Ga0495595_0004030_1840_2568 242
44 3300053730 Ga0500645_030286 Ga0500645_030286_726_1490 242
45 3300054114 Ga0501084_0254920 Ga0501084_0254920_742_1470 242
46 3300031733 Ga0316577_10135820 Ga0316577_101358202 243
47 3300005549 Ga0070704_100174015 Ga0070704_1001740151 244
48 3300005841 Ga0068863_100108341 Ga0068863_1001083413 244
49 3300005843 Ga0068860_100090932 Ga0068860_1000909322 244
50 3300005983 Ga0081540_1029277 Ga0081540_10292774 244
51 3300006175 Ga0070712_100015104 Ga0070712_1000151043 244
52 3300006847 Ga0075431_100004278 Ga0075431_1000042788 244
53 3300006847 Ga0075431_100013599 Ga0075431_1000135998 244
54 3300006871 Ga0075434_100003287 Ga0075434_1000032878 244
55 3300006880 Ga0075429_100382333 Ga0075429_1003823332 244
56 3300006914 Ga0075436_100151402 Ga0075436_1001514021 244
57 3300007076 Ga0075435_100005120 Ga0075435_1000051208 244
58 3300025910 Ga0207684_10628330 Ga0207684_106283301 244
59 3300025915 Ga0207693_10008787 Ga0207693_100087874 244
60 3300025922 Ga0207646_10277428 Ga0207646_102774282 244
61 3300031995 Ga0307409_100126626 Ga0307409_1001266262 244
62 3300045051 Ga0451576_0224973 Ga0451576_0224973_251_997 244
63 3300048907 Ga0496104_0122314 Ga0496104_0122314_591_1385 244
64 3300048908 Ga0496105_0389394 Ga0496105_0389394_17_790 244
65 3300048909 Ga0496106_0027107 Ga0496106_0027107_3435_4208 244
66 3300048911 Ga0496108_0209676 Ga0496108_0209676_350_1144 244
67 3300048915 Ga0496112_0059114 Ga0496112_0059114_2655_3449 244
68 3300049575 Ga0501039_0222933 Ga0501039_0222933_450_1217 244
69 3300049577 Ga0501041_0067566 Ga0501041_0067566_425_1195 244
70 3300049582 Ga0501048_0029604 Ga0501048_0029604_1851_2618 244
71 3300049588 Ga0501072_0100980 Ga0501072_0100980_1092_1859 244
72 3300049588 Ga0501072_0128656 Ga0501072_0128656_875_1651 244
73 3300049591 Ga0501075_0068181 Ga0501075_0068181_1656_2423 244
74 3300049591 Ga0501075_0292397 Ga0501075_0292397_177_947 244
75 3300049741 Ga0501079_0122792 Ga0501079_0122792_1003_1779 244
76 3300049743 Ga0501081_0010912 Ga0501081_0010912_3632_4408 244
77 3300049743 Ga0501081_0063673 Ga0501081_0063673_278_1045 244
78 3300049744 Ga0501083_0041219 Ga0501083_0041219_911_1663 244
79 3300050507 nmdc:mga05p37_138365_c1 nmdc:mga05p37_138365_c1_1081_1857 244
80 3300050508 nmdc:mga09592_473848_c1 nmdc:mga09592_473848_c1_213_989 244
81 3300050510 nmdc:mga06r32_19837_c1 nmdc:mga06r32_19837_c1_3212_3988 244
82 3300050510 nmdc:mga06r32_70968_c1 nmdc:mga06r32_70968_c1_299_1075 244
83 3300050513 nmdc:mga0rr50_8215_c1 nmdc:mga0rr50_8215_c1_1490_2236 244
84 3300054114 Ga0501084_0124559 Ga0501084_0124559_867_1643 244
85 3300054114 Ga0501084_0321559 Ga0501084_0321559_61_813 244
86 3300054114 Ga0501084_0758671 Ga0501084_0758671_30_782 244
87 3300060353 Ga0501082_0064266 Ga0501082_0064266_1696_2466 244
88 3300060353 Ga0501082_0123907 Ga0501082_0123907_1349_2101 244
89 3300061734 Ga0530510_0073482 Ga0530510_0073482_889_1665 244
90 3300061734 Ga0530510_0451419 Ga0530510_0451419_70_846 244
91 iso_pu_bacteria 2597490356 2599105567 244
92 iso_pu_bacteria 2846952575 2846954747 244
93 iso_pu_bacteria 2848858292 2848858985 244
94 iso_pu_bacteria 2883354860 2883354942 244
95 3300006186 Ga0075369_10117757 Ga0075369_101177572 245
96 3300021441 Ga0213871_10034354 Ga0213871_100343542 245
97 3300031995 Ga0307409_100146055 Ga0307409_1001460552 245
98 3300032002 Ga0307416_100613816 Ga0307416_1006138162 245
99 3300039438 Ga0436360_0413491 Ga0436360_0413491_426_1163 245
100 3300039453 Ga0436362_0546702 Ga0436362_0546702_84_821 245
101 3300049571 Ga0501034_0386195 Ga0501034_0386195_402_1157 245
102 3300049573 Ga0501037_0171955 Ga0501037_0171955_522_1277 245
103 3300049574 Ga0501038_0140975 Ga0501038_0140975_651_1406 245
104 3300050516 nmdc:mga0sz30_111115_c1 nmdc:mga0sz30_111115_c1_143_922 245
105 iso_pu_bacteria 2821443989 2821444341 245
106 iso_pu_bacteria 2844533157 2844538193 245
107 iso_pu_bacteria 2909042592 2909046292 245
108 3300005336 Ga0070680_100023161 Ga0070680_1000231613 246
109 3300005341 Ga0070691_10015821 Ga0070691_100158212 246
110 3300005436 Ga0070713_100504704 Ga0070713_1005047042 246
111 3300005441 Ga0070700_100036015 Ga0070700_1000360152 246
112 3300005458 Ga0070681_10037097 Ga0070681_100370974 246
113 3300005468 Ga0070707_100180491 Ga0070707_1001804912 246
114 3300005471 Ga0070698_100001583 Ga0070698_10000158310 246
115 3300005530 Ga0070679_100069394 Ga0070679_1000693943 246
116 3300005536 Ga0070697_100123050 Ga0070697_1001230502 246
117 3300005545 Ga0070695_100015958 Ga0070695_1000159583 246
118 3300005563 Ga0068855_100014613 Ga0068855_1000146133 246
119 3300005719 Ga0068861_100086515 Ga0068861_1000865153 246
120 3300005985 Ga0081539_10000598 Ga0081539_1000059854 246
121 3300005985 Ga0081539_10016306 Ga0081539_100163063 246
122 3300006177 Ga0075362_10098682 Ga0075362_100986822 246
123 3300006186 Ga0075369_10012084 Ga0075369_100120844 246
124 3300006847 Ga0075431_100186346 Ga0075431_1001863463 246
125 3300009147 Ga0114129_10189744 Ga0114129_101897443 246
126 3300009147 Ga0114129_10884235 Ga0114129_108842352 246
127 3300009176 Ga0105242_10960898 Ga0105242_109608981 246
128 3300017792 Ga0163161_10127281 Ga0163161_101272812 246
129 3300025912 Ga0207707_10028651 Ga0207707_100286513 246
130 3300025917 Ga0207660_10067897 Ga0207660_100678972 246
131 3300025921 Ga0207652_10062321 Ga0207652_100623212 246
132 3300025949 Ga0207667_10031391 Ga0207667_100313913 246
133 3300026075 Ga0207708_10048742 Ga0207708_100487423 246
134 3300026088 Ga0207641_10014731 Ga0207641_100147312 246
135 3300026118 Ga0207675_100065357 Ga0207675_1000653573 246
136 3300027907 Ga0207428_10017003 Ga0207428_100170033 246
137 3300031548 Ga0307408_100091887 Ga0307408_1000918872 246
138 3300032005 Ga0307411_10633182 Ga0307411_106331821 246
139 3300048929 Ga0496126_0198157 Ga0496126_0198157_747_1508 246
140 3300049570 Ga0501033_0302774 Ga0501033_0302774_16_798 246
141 3300049575 Ga0501039_0642138 Ga0501039_0642138_20_802 246
142 3300049582 Ga0501048_0074327 Ga0501048_0074327_1070_1852 246
143 3300049587 Ga0501071_0022628 Ga0501071_0022628_804_1586 246
144 3300049588 Ga0501072_0021583 Ga0501072_0021583_3616_4398 246
145 3300049592 Ga0501076_0007181 Ga0501076_0007181_3233_4015 246
146 3300049741 Ga0501079_0006499 Ga0501079_0006499_2492_3274 246
147 3300049742 Ga0501080_0037519 Ga0501080_0037519_3417_4199 246
148 3300049742 Ga0501080_0286991 Ga0501080_0286991_118_906 246
149 3300049744 Ga0501083_0044636 Ga0501083_0044636_920_1702 246
150 3300049824 Ga0501045_0067577 Ga0501045_0067577_557_1339 246
151 3300050489 nmdc:mga03683_9239_c1 nmdc:mga03683_9239_c1_89_850 246
152 3300050508 nmdc:mga09592_58183_c1 nmdc:mga09592_58183_c1_506_1276 246
153 3300050509 nmdc:mga0qj67_29384_c1 nmdc:mga0qj67_29384_c1_2618_3388 246
154 3300050510 nmdc:mga06r32_141034_c1 nmdc:mga06r32_141034_c1_1253_2008 246
155 3300050510 nmdc:mga06r32_33635_c1 nmdc:mga06r32_33635_c1_3162_3932 246
156 3300050510 nmdc:mga06r32_53650_c1 nmdc:mga06r32_53650_c1_898_1668 246
157 3300050511 nmdc:mga08y16_12764_c1 nmdc:mga08y16_12764_c1_7494_8264 246
158 3300050511 nmdc:mga08y16_343388_c2 nmdc:mga08y16_343388_c2_431_1192 246
159 3300053096 Ga0500641_0001762 Ga0500641_0001762_1267_2028 246
160 3300054114 Ga0501084_0003507 Ga0501084_0003507_1074_1856 246
161 3300061734 Ga0530510_0038632 Ga0530510_0038632_169_951 246
162 iso_pu_bacteria 2523231067 2523468588 246
163 iso_pu_bacteria 2671180139 2671695228 246
164 iso_pu_bacteria 2738543031 2739352064 246
165 iso_pu_bacteria 2917554339 2917556169 246
166 3300003187 JGI25151J46595_10000166 JGI25151J46595_1000016641 247
167 3300003323 rootH1_10001360 rootH1_100013603 247
168 3300005334 Ga0068869_100350047 Ga0068869_1003500472 247
169 3300005340 Ga0070689_100348901 Ga0070689_1003489012 247
170 3300005341 Ga0070691_10005254 Ga0070691_100052543 247
171 3300005345 Ga0070692_10233535 Ga0070692_102335352 247
172 3300005406 Ga0070703_10015829 Ga0070703_100158291 247
173 3300005440 Ga0070705_100000010 Ga0070705_10000001015 247
174 3300005441 Ga0070700_100012029 Ga0070700_1000120293 247
175 3300005444 Ga0070694_100007490 Ga0070694_1000074902 247
176 3300005445 Ga0070708_100432891 Ga0070708_1004328912 247
177 3300005467 Ga0070706_100083039 Ga0070706_1000830392 247
178 3300005518 Ga0070699_100001267 Ga0070699_1000012678 247
179 3300005536 Ga0070697_100019537 Ga0070697_1000195372 247
180 3300005544 Ga0070686_100206694 Ga0070686_1002066942 247
181 3300005545 Ga0070695_100001386 Ga0070695_1000013867 247
182 3300005546 Ga0070696_100000088 Ga0070696_10000008827 247
183 3300005549 Ga0070704_100007022 Ga0070704_1000070229 247
184 3300005577 Ga0068857_100025585 Ga0068857_1000255853 247
185 3300005617 Ga0068859_100029774 Ga0068859_1000297747 247
186 3300005843 Ga0068860_100032520 Ga0068860_1000325206 247
187 3300005844 Ga0068862_100000484 Ga0068862_10000048424 247
188 3300005983 Ga0081540_1012474 Ga0081540_10124745 247
189 3300005983 Ga0081540_1030263 Ga0081540_10302632 247
190 3300006931 Ga0097620_100029774 Ga0097620_1000297747 247
191 3300009094 Ga0111539_11073817 Ga0111539_110738172 247
192 3300009147 Ga0114129_10902828 Ga0114129_109028282 247
193 3300009148 Ga0105243_10738458 Ga0105243_107384581 247
194 3300009553 Ga0105249_10229647 Ga0105249_102296471 247
195 3300009986 Ga0105033_102692 Ga0105033_1026922 247
196 3300010375 Ga0105239_10471574 Ga0105239_104715742 247
197 3300011119 Ga0105246_10038956 Ga0105246_100389563 247
198 3300011119 Ga0105246_10095777 Ga0105246_100957771 247
199 3300021377 Ga0213874_10102494 Ga0213874_101024941 247
200 3300025294 Ga0209025_1000053 Ga0209025_1000053159 247
201 3300025885 Ga0207653_10000769 Ga0207653_100007696 247
202 3300025910 Ga0207684_10064422 Ga0207684_100644222 247
203 3300025912 Ga0207707_10043901 Ga0207707_100439013 247
204 3300025917 Ga0207660_10148505 Ga0207660_101485052 247
205 3300025933 Ga0207706_10113277 Ga0207706_101132772 247
206 3300025936 Ga0207670_10243787 Ga0207670_102437871 247
207 3300025942 Ga0207689_10099359 Ga0207689_100993593 247
208 3300025944 Ga0207661_10224689 Ga0207661_102246891 247
209 3300025961 Ga0207712_10002216 Ga0207712_100022165 247
210 3300026067 Ga0207678_10023593 Ga0207678_100235937 247
211 3300026075 Ga0207708_10017542 Ga0207708_100175423 247
212 3300026095 Ga0207676_10064821 Ga0207676_100648213 247
213 3300026116 Ga0207674_10030214 Ga0207674_100302146 247
214 3300028380 Ga0268265_10002000 Ga0268265_100020005 247
215 3300028381 Ga0268264_10010737 Ga0268264_100107374 247
216 3300042004 Ga0439445_0071863 Ga0439445_0071863_161_913 247
217 3300045051 Ga0451576_0061854 Ga0451576_0061854_2880_3632 247
218 3300048905 Ga0496102_0027078 Ga0496102_0027078_321_1106 247
219 3300048906 Ga0496103_0090265 Ga0496103_0090265_734_1519 247
220 3300048910 Ga0496107_0149933 Ga0496107_0149933_863_1648 247
221 3300048918 Ga0496115_0185614 Ga0496115_0185614_905_1690 247
222 3300049741 Ga0501079_0138006 Ga0501079_0138006_771_1556 247
223 3300049824 Ga0501045_0482668 Ga0501045_0482668_30_815 247
224 3300050507 nmdc:mga05p37_464861_c1 nmdc:mga05p37_464861_c1_481_1266 247
225 iso_pu_bacteria 2534681796 2535518249 247
226 iso_pu_bacteria 2582581304 2585259155 247
227 iso_pu_bacteria 2643221733 2644729330 247
228 iso_pu_bacteria 2643221734 2644737238 247
229 iso_pu_bacteria 2643221736 2644747621 247
230 iso_pu_bacteria 2818991467 2819718035 247
231 iso_pu_bacteria 2841760612 2841761508 247
232 iso_pu_bacteria 2842311132 2842314201 247
233 iso_pu_bacteria 2844104063 2844104533 247
234 iso_pu_bacteria 2851182111 2851184567 247
235 iso_pu_bacteria 2851246043 2851247521 247
236 iso_pu_bacteria 2917699015 2917700501 247
237 iso_pu_bacteria 8005542996 8005549139 247
238 iso_pu_bacteria 8057529695 8057530309 247
239 3300002987 JGI25159J45721_1029362 JGI25159J45721_10293621 248
240 3300003354 JGI25160J50197_1008772 JGI25160J50197_10087722 248
241 3300005328 Ga0070676_10264661 Ga0070676_102646612 248
242 3300005329 Ga0070683_100529884 Ga0070683_1005298841 248
243 3300005331 Ga0070670_100023610 Ga0070670_1000236106 248
244 3300005339 Ga0070660_100435979 Ga0070660_1004359792 248
245 3300005340 Ga0070689_100177604 Ga0070689_1001776042 248
246 3300005340 Ga0070689_100243838 Ga0070689_1002438382 248
247 3300005347 Ga0070668_100085337 Ga0070668_1000853372 248
248 3300005353 Ga0070669_100461875 Ga0070669_1004618752 248
249 3300005354 Ga0070675_100052858 Ga0070675_1000528584 248
250 3300005355 Ga0070671_100018362 Ga0070671_1000183623 248
251 3300005356 Ga0070674_100017992 Ga0070674_1000179926 248
252 3300005364 Ga0070673_100121720 Ga0070673_1001217202 248
253 3300005364 Ga0070673_100404278 Ga0070673_1004042782 248
254 3300005365 Ga0070688_100216810 Ga0070688_1002168102 248
255 3300005365 Ga0070688_100323241 Ga0070688_1003232412 248
256 3300005367 Ga0070667_100089336 Ga0070667_1000893362 248
257 3300005434 Ga0070709_10068928 Ga0070709_100689282 248
258 3300005436 Ga0070713_100169172 Ga0070713_1001691722 248
259 3300005436 Ga0070713_100236946 Ga0070713_1002369461 248
260 3300005436 Ga0070713_100636344 Ga0070713_1006363441 248
261 3300005439 Ga0070711_100120718 Ga0070711_1001207181 248
262 3300005439 Ga0070711_100243353 Ga0070711_1002433532 248
263 3300005445 Ga0070708_100319002 Ga0070708_1003190022 248
264 3300005459 Ga0068867_100370305 Ga0068867_1003703052 248
265 3300005468 Ga0070707_100008667 Ga0070707_1000086677 248
266 3300005471 Ga0070698_100081261 Ga0070698_1000812613 248
267 3300005518 Ga0070699_100097779 Ga0070699_1000977794 248
268 3300005548 Ga0070665_100424985 Ga0070665_1004249851 248
269 3300005563 Ga0068855_100335274 Ga0068855_1003352742 248
270 3300005564 Ga0070664_100091744 Ga0070664_1000917443 248
271 3300005614 Ga0068856_100874584 Ga0068856_1008745842 248
272 3300005618 Ga0068864_100414815 Ga0068864_1004148152 248
273 3300005719 Ga0068861_100175826 Ga0068861_1001758262 248
274 3300005844 Ga0068862_100145573 Ga0068862_1001455732 248
275 3300005937 Ga0081455_10299363 Ga0081455_102993632 248
276 3300006028 Ga0070717_10244127 Ga0070717_102441272 248
277 3300006042 Ga0075368_10120999 Ga0075368_101209992 248
278 3300006175 Ga0070712_100264860 Ga0070712_1002648602 248
279 3300006881 Ga0068865_100230699 Ga0068865_1002306992 248
280 3300009094 Ga0111539_10002369 Ga0111539_1000236921 248
281 3300009098 Ga0105245_10125795 Ga0105245_101257952 248
282 3300009098 Ga0105245_10380909 Ga0105245_103809091 248
283 3300009147 Ga0114129_10902838 Ga0114129_109028381 248
284 3300009148 Ga0105243_10376761 Ga0105243_103767612 248
285 3300009176 Ga0105242_10093354 Ga0105242_100933542 248
286 3300009177 Ga0105248_10044373 Ga0105248_100443732 248
287 3300009177 Ga0105248_10157928 Ga0105248_101579282 248
288 3300009553 Ga0105249_10387069 Ga0105249_103870692 248
289 3300011119 Ga0105246_10216201 Ga0105246_102162012 248
290 3300013297 Ga0157378_10483374 Ga0157378_104833742 248
291 3300013306 Ga0163162_10353761 Ga0163162_103537612 248
292 3300013306 Ga0163162_10681032 Ga0163162_106810321 248
293 3300014325 Ga0163163_10103655 Ga0163163_101036555 248
294 3300014326 Ga0157380_10013643 Ga0157380_100136434 248
295 3300014326 Ga0157380_10083652 Ga0157380_100836521 248
296 3300014497 Ga0182008_10240141 Ga0182008_102401411 248
297 3300014968 Ga0157379_10255654 Ga0157379_102556542 248
298 3300014969 Ga0157376_10267225 Ga0157376_102672252 248
299 3300014969 Ga0157376_10544235 Ga0157376_105442352 248
300 3300024225 Ga0224572_1002024 Ga0224572_10020243 248
301 3300024227 Ga0228598_1000419 Ga0228598_10004197 248
302 3300025254 Ga0209148_1000409 Ga0209148_100040936 248
303 3300025272 Ga0209455_1003530 Ga0209455_10035303 248
304 3300025284 Ga0209130_1000709 Ga0209130_100070917 248
305 3300025297 Ga0209758_1013103 Ga0209758_10131032 248
306 3300025302 Ga0207426_1000198 Ga0207426_100019853 248
307 3300025906 Ga0207699_10042426 Ga0207699_100424262 248
308 3300025907 Ga0207645_10310123 Ga0207645_103101232 248
309 3300025915 Ga0207693_10038993 Ga0207693_100389932 248
310 3300025919 Ga0207657_10426457 Ga0207657_104264572 248
311 3300025922 Ga0207646_10080961 Ga0207646_100809613 248
312 3300025925 Ga0207650_10014724 Ga0207650_100147246 248
313 3300025926 Ga0207659_10299453 Ga0207659_102994532 248
314 3300025928 Ga0207700_10391472 Ga0207700_103914722 248
315 3300025928 Ga0207700_10615847 Ga0207700_106158471 248
316 3300025928 Ga0207700_10712926 Ga0207700_107129262 248
317 3300025929 Ga0207664_10214617 Ga0207664_102146172 248
318 3300025931 Ga0207644_10141114 Ga0207644_101411142 248
319 3300025931 Ga0207644_10308945 Ga0207644_103089452 248
320 3300025934 Ga0207686_10039863 Ga0207686_100398634 248
321 3300025936 Ga0207670_10007806 Ga0207670_100078064 248
322 3300025936 Ga0207670_10117725 Ga0207670_101177252 248
323 3300025937 Ga0207669_10117172 Ga0207669_101171722 248
324 3300025938 Ga0207704_10041999 Ga0207704_100419992 248
325 3300025940 Ga0207691_10429730 Ga0207691_104297302 248
326 3300025941 Ga0207711_10026007 Ga0207711_100260072 248
327 3300025945 Ga0207679_10085271 Ga0207679_100852712 248
328 3300025960 Ga0207651_10340736 Ga0207651_103407361 248
329 3300025960 Ga0207651_10386343 Ga0207651_103863431 248
330 3300025972 Ga0207668_10190943 Ga0207668_101909432 248
331 3300026088 Ga0207641_10204658 Ga0207641_102046582 248
332 3300026095 Ga0207676_10027399 Ga0207676_100273992 248
333 3300026118 Ga0207675_100007776 Ga0207675_1000077767 248
334 3300026118 Ga0207675_100344822 Ga0207675_1003448222 248
335 3300028381 Ga0268264_10180670 Ga0268264_101806702 248
336 3300028381 Ga0268264_10333435 Ga0268264_103334352 248
337 3300031247 Ga0265340_10046962 Ga0265340_100469622 248
338 3300032004 Ga0307414_10578075 Ga0307414_105780752 248
339 3300035111 Ga0373923_0075736 Ga0373923_0075736_219_968 248
340 3300035113 Ga0373936_0035197 Ga0373936_0035197_680_1429 248
341 3300035117 Ga0373953_0006528 Ga0373953_0006528_1610_2359 248
342 3300035118 Ga0373954_0100018 Ga0373954_0100018_453_1202 248
343 3300035119 Ga0373956_0047793 Ga0373956_0047793_1134_1883 248
344 3300035170 Ga0373943_0047398 Ga0373943_0047398_804_1553 248
345 3300035170 Ga0373943_0069017 Ga0373943_0069017_355_1125 248
346 3300035725 Ga0373947_0191222 Ga0373947_0191222_387_1157 248
347 3300037853 Ga0436364_1363918 Ga0436364_1363918_5383_6141 248
348 3300037853 Ga0436364_1377062 Ga0436364_1377062_3717_4478 248
349 3300039438 Ga0436360_1234148 Ga0436360_1234148_919_1680 248
350 3300039453 Ga0436362_0257423 Ga0436362_0257423_52_804 248
351 3300041997 Ga0439431_0017193 Ga0439431_0017193_498_1256 248
352 3300042438 Ga0439459_0030659 Ga0439459_0030659_333_1082 248
353 3300046454 Ga0495592_0079791 Ga0495592_0079791_1247_1996 248
354 3300046462 Ga0495651_0022639 Ga0495651_0022639_1106_1855 248
355 3300046473 Ga0495582_0267745 Ga0495582_0267745_67_816 248
356 3300046511 Ga0495608_0147782 Ga0495608_0147782_124_873 248
357 3300046516 Ga0495628_0021104 Ga0495628_0021104_605_1354 248
358 3300046529 Ga0495652_0212140 Ga0495652_0212140_202_951 248
359 3300046529 Ga0495652_0335705 Ga0495652_0335705_304_1053 248
360 3300046533 Ga0495640_0009352 Ga0495640_0009352_5335_6084 248
361 3300046533 Ga0495640_0325577 Ga0495640_0325577_167_916 248
362 3300046536 Ga0495587_0015850 Ga0495587_0015850_3482_4231 248
363 3300046663 Ga0495635_0134781 Ga0495635_0134781_614_1363 248
364 3300046675 Ga0495657_0146719 Ga0495657_0146719_246_995 248
365 3300046678 Ga0495599_0078357 Ga0495599_0078357_131_880 248
366 3300046680 Ga0495646_0049482 Ga0495646_0049482_1186_1935 248
367 3300046689 Ga0495613_0078769 Ga0495613_0078769_542_1291 248
368 3300046690 Ga0495624_0104410 Ga0495624_0104410_560_1309 248
369 3300046809 Ga0495600_0097235 Ga0495600_0097235_517_1266 248
370 3300047315 Ga0495581_0039756 Ga0495581_0039756_232_981 248
371 3300047317 Ga0495604_0154591 Ga0495604_0154591_119_868 248
372 3300047471 Ga0495684_0012287 Ga0495684_0012287_3032_3781 248
373 3300047471 Ga0495684_0181351 Ga0495684_0181351_26_775 248
374 3300048088 Ga0495602_0095585 Ga0495602_0095585_249_998 248
375 3300048089 Ga0495614_0101363 Ga0495614_0101363_370_1119 248
376 3300048903 Ga0496100_0020431 Ga0496100_0020431_2313_3062 248
377 3300048904 Ga0496101_0023314 Ga0496101_0023314_642_1391 248
378 3300048904 Ga0496101_0147205 Ga0496101_0147205_678_1427 248
379 3300048905 Ga0496102_0412539 Ga0496102_0412539_43_813 248
380 3300048907 Ga0496104_0261587 Ga0496104_0261587_534_1283 248
381 3300048908 Ga0496105_0062086 Ga0496105_0062086_380_1129 248
382 3300048909 Ga0496106_0055368 Ga0496106_0055368_841_1590 248
383 3300048911 Ga0496108_0403308 Ga0496108_0403308_285_1034 248
384 3300048912 Ga0496109_0250342 Ga0496109_0250342_907_1656 248
385 3300048913 Ga0496110_0358056 Ga0496110_0358056_70_840 248
386 3300048914 Ga0496111_0076489 Ga0496111_0076489_648_1397 248
387 3300048915 Ga0496112_0159660 Ga0496112_0159660_789_1538 248
388 3300048915 Ga0496112_0361917 Ga0496112_0361917_252_1001 248
389 3300048917 Ga0496114_0074669 Ga0496114_0074669_858_1607 248
390 3300048918 Ga0496115_0335641 Ga0496115_0335641_112_861 248
391 3300048918 Ga0496115_0343695 Ga0496115_0343695_435_1184 248
392 3300049570 Ga0501033_0053683 Ga0501033_0053683_508_1254 248
393 3300049570 Ga0501033_0067066 Ga0501033_0067066_868_1614 248
394 3300049571 Ga0501034_0420347 Ga0501034_0420347_377_1138 248
395 3300049573 Ga0501037_0123244 Ga0501037_0123244_966_1712 248
396 3300049579 Ga0501043_0120873 Ga0501043_0120873_381_1127 248
397 3300049580 Ga0501046_0090574 Ga0501046_0090574_489_1235 248
398 3300049581 Ga0501047_0003356 Ga0501047_0003356_3062_3808 248
399 3300049581 Ga0501047_0167765 Ga0501047_0167765_697_1443 248
400 3300049584 Ga0501068_0166386 Ga0501068_0166386_584_1330 248
401 3300049585 Ga0501069_0081524 Ga0501069_0081524_555_1301 248
402 3300049586 Ga0501070_0028481 Ga0501070_0028481_877_1623 248
403 3300049589 Ga0501073_0066345 Ga0501073_0066345_1197_1943 248
404 3300049590 Ga0501074_0074802 Ga0501074_0074802_1109_1855 248
405 3300049591 Ga0501075_0019474 Ga0501075_0019474_2840_3589 248
406 3300049592 Ga0501076_0190723 Ga0501076_0190723_828_1577 248
407 3300049593 Ga0501077_0005783 Ga0501077_0005783_6118_6867 248
408 3300049741 Ga0501079_0098973 Ga0501079_0098973_870_1619 248
409 3300049743 Ga0501081_0209760 Ga0501081_0209760_13_762 248
410 3300049744 Ga0501083_0056277 Ga0501083_0056277_1109_1855 248
411 3300049744 Ga0501083_0182695 Ga0501083_0182695_293_1054 248
412 3300049822 Ga0501035_0059223 Ga0501035_0059223_586_1332 248
413 3300049823 Ga0501044_0012550 Ga0501044_0012550_2160_2906 248
414 3300049823 Ga0501044_0138273 Ga0501044_0138273_151_897 248
415 3300050493 nmdc:mga0k408_36688_c1 nmdc:mga0k408_36688_c1_324_1073 248
416 3300050494 nmdc:mga06z11_313107_c1 nmdc:mga06z11_313107_c1_164_913 248
417 3300050507 nmdc:mga05p37_236590_c1 nmdc:mga05p37_236590_c1_876_1661 248
418 3300050509 nmdc:mga0qj67_277289_c1 nmdc:mga0qj67_277289_c1_279_1088 248
419 3300050511 nmdc:mga08y16_104210_c1 nmdc:mga08y16_104210_c1_40_849 248
420 3300050512 nmdc:mga0n895_374941_c1 nmdc:mga0n895_374941_c1_432_1202 248
421 3300050514 nmdc:mga08x19_7802_c1 nmdc:mga08x19_7802_c1_3557_4306 248
422 3300050515 nmdc:mga0a205_423703_c1 nmdc:mga0a205_423703_c1_29_799 248
423 3300053077 Ga0495601_0093164 Ga0495601_0093164_806_1555 248
424 3300053077 Ga0495601_0134966 Ga0495601_0134966_77_826 248
425 3300053077 Ga0495601_0225789 Ga0495601_0225789_89_838 248
426 3300053084 Ga0495595_0010247 Ga0495595_0010247_1608_2357 248
427 3300053084 Ga0495595_0074538 Ga0495595_0074538_459_1208 248
428 3300053085 Ga0495619_0180958 Ga0495619_0180958_508_1257 248
429 3300053085 Ga0495619_0231760 Ga0495619_0231760_369_1118 248
430 3300053139 Ga0500568_0037136 Ga0500568_0037136_477_1241 248
431 3300054114 Ga0501084_0074174 Ga0501084_0074174_1193_1942 248
432 3300054114 Ga0501084_0285121 Ga0501084_0285121_598_1347 248
433 3300060353 Ga0501082_0195979 Ga0501082_0195979_82_831 248
434 3300061734 Ga0530510_0223769 Ga0530510_0223769_495_1244 248
435 iso_pu_bacteria 2513237096 2513657505 248
436 iso_pu_bacteria 2513237137 2513861167 248
437 iso_pu_bacteria 2513237145 2513916758 248
438 iso_pu_bacteria 2517572143 2517889666 248
439 iso_pu_bacteria 2643221651 2644290457 248
440 iso_pu_bacteria 2667528175 2671119517 248
441 iso_pu_bacteria 2791355197 2793070354 248
442 iso_pu_bacteria 2885374607 2885380853 248
443 iso_pu_bacteria 2903748898 2903754701 248
444 iso_pu_bacteria 2904690495 2904692036 248
445 iso_pu_bacteria 2904699407 2904707577 248
446 iso_pu_bacteria 2906610324 2906614643 248
447 iso_pu_bacteria 2906635258 2906641948 248
448 iso_pu_bacteria 2906660503 2906660966 248
449 iso_pu_bacteria 2908739725 2908746534 248
450 iso_pu_bacteria 2908756301 2908757315 248
451 iso_pu_bacteria 2922425934 2922426504 248
452 iso_pu_bacteria 2935630451 2935632846 248
453 iso_pu_bacteria 2941507105 2941508489 248
454 iso_pu_bacteria 2941515067 2941516320 248
455 iso_pu_bacteria 2941523033 2941524664 248
456 iso_pu_bacteria 3005474847 3005475847 248
457 iso_pu_bacteria 8006933436 8006937164 248
458 iso_pu_bacteria 8006973647 8006977174 248
459 iso_pu_bacteria 8019555841 8019561494 248
460 iso_pu_bacteria 8019565922 8019571569 248
461 iso_pu_bacteria 8056689827 8056690782 248
462 3300003203 JGI25406J46586_10099659 JGI25406J46586_100996591 249
463 3300005328 Ga0070676_10361287 Ga0070676_103612871 249
464 3300005331 Ga0070670_100084216 Ga0070670_1000842162 249
465 3300005335 Ga0070666_10208641 Ga0070666_102086412 249
466 3300005340 Ga0070689_100009551 Ga0070689_1000095512 249
467 3300005340 Ga0070689_100122295 Ga0070689_1001222952 249
468 3300005344 Ga0070661_100080243 Ga0070661_1000802432 249
469 3300005347 Ga0070668_100487865 Ga0070668_1004878652 249
470 3300005354 Ga0070675_100181614 Ga0070675_1001816142 249
471 3300005354 Ga0070675_100392747 Ga0070675_1003927471 249
472 3300005355 Ga0070671_100088490 Ga0070671_1000884902 249
473 3300005356 Ga0070674_100084622 Ga0070674_1000846222 249
474 3300005364 Ga0070673_100027881 Ga0070673_1000278812 249
475 3300005364 Ga0070673_100159919 Ga0070673_1001599192 249
476 3300005364 Ga0070673_100285515 Ga0070673_1002855151 249
477 3300005367 Ga0070667_100100209 Ga0070667_1001002092 249
478 3300005367 Ga0070667_100390358 Ga0070667_1003903582 249
479 3300005434 Ga0070709_10011341 Ga0070709_100113413 249
480 3300005435 Ga0070714_100017392 Ga0070714_1000173924 249
481 3300005436 Ga0070713_100007558 Ga0070713_1000075584 249
482 3300005436 Ga0070713_100078485 Ga0070713_1000784852 249
483 3300005437 Ga0070710_10007309 Ga0070710_100073097 249
484 3300005439 Ga0070711_100041309 Ga0070711_1000413093 249
485 3300005441 Ga0070700_100100414 Ga0070700_1001004142 249
486 3300005444 Ga0070694_100301901 Ga0070694_1003019012 249
487 3300005445 Ga0070708_100031895 Ga0070708_1000318952 249
488 3300005456 Ga0070678_100139537 Ga0070678_1001395372 249
489 3300005456 Ga0070678_100145528 Ga0070678_1001455282 249
490 3300005459 Ga0068867_100140308 Ga0068867_1001403082 249
491 3300005518 Ga0070699_100032052 Ga0070699_1000320524 249
492 3300005518 Ga0070699_100133004 Ga0070699_1001330042 249
493 3300005543 Ga0070672_100080702 Ga0070672_1000807022 249
494 3300005543 Ga0070672_100729529 Ga0070672_1007295291 249
495 3300005544 Ga0070686_100081658 Ga0070686_1000816582 249
496 3300005549 Ga0070704_100242386 Ga0070704_1002423862 249
497 3300005578 Ga0068854_100131782 Ga0068854_1001317822 249
498 3300005616 Ga0068852_100164725 Ga0068852_1001647252 249
499 3300005618 Ga0068864_100393132 Ga0068864_1003931322 249
500 3300005842 Ga0068858_100317367 Ga0068858_1003173671 249
501 3300005843 Ga0068860_100023745 Ga0068860_1000237452 249
502 3300005937 Ga0081455_10000142 Ga0081455_1000014247 249
503 3300005937 Ga0081455_10003539 Ga0081455_1000353922 249
504 3300005937 Ga0081455_10028348 Ga0081455_100283483 249
505 3300005937 Ga0081455_10107042 Ga0081455_101070423 249
506 3300005937 Ga0081455_10132533 Ga0081455_101325332 249
507 3300005981 Ga0081538_10025164 Ga0081538_100251643 249
508 3300005985 Ga0081539_10024885 Ga0081539_100248853 249
509 3300005985 Ga0081539_10036208 Ga0081539_100362084 249
510 3300005985 Ga0081539_10168260 Ga0081539_101682602 249
511 3300006028 Ga0070717_10014983 Ga0070717_100149834 249
512 3300006028 Ga0070717_10037023 Ga0070717_100370233 249
513 3300006038 Ga0075365_10164699 Ga0075365_101646992 249
514 3300006042 Ga0075368_10018439 Ga0075368_100184393 249
515 3300006048 Ga0075363_100063912 Ga0075363_1000639122 249
516 3300006051 Ga0075364_10162832 Ga0075364_101628322 249
517 3300006058 Ga0075432_10023298 Ga0075432_100232982 249
518 3300006163 Ga0070715_10001945 Ga0070715_100019457 249
519 3300006173 Ga0070716_100003460 Ga0070716_1000034603 249
520 3300006175 Ga0070712_100133119 Ga0070712_1001331192 249
521 3300006175 Ga0070712_100137693 Ga0070712_1001376932 249
522 3300006177 Ga0075362_10002893 Ga0075362_100028934 249
523 3300006177 Ga0075362_10013500 Ga0075362_100135002 249
524 3300006177 Ga0075362_10031084 Ga0075362_100310842 249
525 3300006178 Ga0075367_10002514 Ga0075367_1000251414 249
526 3300006178 Ga0075367_10153996 Ga0075367_101539962 249
527 3300006178 Ga0075367_10196933 Ga0075367_101969332 249
528 3300006178 Ga0075367_10229795 Ga0075367_102297952 249
529 3300006186 Ga0075369_10041829 Ga0075369_100418292 249
530 3300006186 Ga0075369_10202814 Ga0075369_102028141 249
531 3300006237 Ga0097621_100207379 Ga0097621_1002073792 249
532 3300006353 Ga0075370_10100700 Ga0075370_101007002 249
533 3300006353 Ga0075370_10191072 Ga0075370_101910722 249
534 3300006353 Ga0075370_10208135 Ga0075370_102081352 249
535 3300006353 Ga0075370_10312911 Ga0075370_103129111 249
536 3300006844 Ga0075428_100028809 Ga0075428_1000288093 249
537 3300006844 Ga0075428_100105515 Ga0075428_1001055152 249
538 3300006844 Ga0075428_100440420 Ga0075428_1004404202 249
539 3300006846 Ga0075430_100296789 Ga0075430_1002967892 249
540 3300006847 Ga0075431_100000021 Ga0075431_10000002140 249
541 3300006847 Ga0075431_100157342 Ga0075431_1001573422 249
542 3300006847 Ga0075431_100329007 Ga0075431_1003290072 249
543 3300006847 Ga0075431_100627653 Ga0075431_1006276532 249
544 3300006852 Ga0075433_10098961 Ga0075433_100989613 249
545 3300006871 Ga0075434_100039117 Ga0075434_1000391176 249
546 3300006871 Ga0075434_100077231 Ga0075434_1000772313 249
547 3300006871 Ga0075434_100361856 Ga0075434_1003618562 249
548 3300006880 Ga0075429_100044422 Ga0075429_1000444225 249
549 3300007076 Ga0075435_100146468 Ga0075435_1001464682 249
550 3300007265 Ga0099794_10013033 Ga0099794_100130333 249
551 3300009094 Ga0111539_10000144 Ga0111539_1000014423 249
552 3300009094 Ga0111539_10031200 Ga0111539_100312003 249
553 3300009094 Ga0111539_10403564 Ga0111539_104035642 249
554 3300009098 Ga0105245_10229000 Ga0105245_102290002 249
555 3300009147 Ga0114129_10000068 Ga0114129_1000006823 249
556 3300009147 Ga0114129_10021135 Ga0114129_100211353 249
557 3300009147 Ga0114129_10414122 Ga0114129_104141222 249
558 3300009147 Ga0114129_10743083 Ga0114129_107430832 249
559 3300009147 Ga0114129_10872792 Ga0114129_108727922 249
560 3300009174 Ga0105241_10467356 Ga0105241_104673561 249
561 3300009177 Ga0105248_10002224 Ga0105248_1000222411 249
562 3300009545 Ga0105237_10069708 Ga0105237_100697083 249
563 3300009551 Ga0105238_10048111 Ga0105238_100481112 249
564 3300010159 Ga0099796_10022692 Ga0099796_100226922 249
565 3300010375 Ga0105239_10297453 Ga0105239_102974532 249
566 3300013307 Ga0157372_10492060 Ga0157372_104920602 249
567 3300013308 Ga0157375_10826313 Ga0157375_108263132 249
568 3300013308 Ga0157375_10979236 Ga0157375_109792361 249
569 3300014325 Ga0163163_10013174 Ga0163163_100131742 249
570 3300014325 Ga0163163_10054559 Ga0163163_100545593 249
571 3300021361 Ga0213872_10022142 Ga0213872_100221422 249
572 3300021377 Ga0213874_10048881 Ga0213874_100488812 249
573 3300021388 Ga0213875_10000003 Ga0213875_10000003610 249
574 3300025294 Ga0209025_1083642 Ga0209025_10836421 249
575 3300025885 Ga0207653_10018899 Ga0207653_100188992 249
576 3300025893 Ga0207682_10005803 Ga0207682_100058032 249
577 3300025898 Ga0207692_10073342 Ga0207692_100733422 249
578 3300025898 Ga0207692_10087619 Ga0207692_100876192 249
579 3300025903 Ga0207680_10069321 Ga0207680_100693213 249
580 3300025905 Ga0207685_10023843 Ga0207685_100238432 249
581 3300025906 Ga0207699_10060836 Ga0207699_100608363 249
582 3300025907 Ga0207645_10022003 Ga0207645_100220032 249
583 3300025907 Ga0207645_10023566 Ga0207645_100235663 249
584 3300025910 Ga0207684_10012764 Ga0207684_100127646 249
585 3300025911 Ga0207654_10213948 Ga0207654_102139482 249
586 3300025914 Ga0207671_10463348 Ga0207671_104633482 249
587 3300025915 Ga0207693_10011224 Ga0207693_100112248 249
588 3300025915 Ga0207693_10051541 Ga0207693_100515413 249
589 3300025916 Ga0207663_10121066 Ga0207663_101210662 249
590 3300025918 Ga0207662_10030972 Ga0207662_100309724 249
591 3300025918 Ga0207662_10149530 Ga0207662_101495302 249
592 3300025922 Ga0207646_10172631 Ga0207646_101726312 249
593 3300025924 Ga0207694_10084760 Ga0207694_100847601 249
594 3300025924 Ga0207694_10162699 Ga0207694_101626992 249
595 3300025925 Ga0207650_10056311 Ga0207650_100563113 249
596 3300025926 Ga0207659_10141312 Ga0207659_101413122 249
597 3300025928 Ga0207700_10295286 Ga0207700_102952862 249
598 3300025929 Ga0207664_10053126 Ga0207664_100531263 249
599 3300025929 Ga0207664_10173182 Ga0207664_101731822 249
600 3300025931 Ga0207644_10109029 Ga0207644_101090292 249
601 3300025933 Ga0207706_10074009 Ga0207706_100740094 249
602 3300025937 Ga0207669_10312823 Ga0207669_103128232 249
603 3300025938 Ga0207704_10086786 Ga0207704_100867862 249
604 3300025939 Ga0207665_10001158 Ga0207665_1000115818 249
605 3300025939 Ga0207665_10282026 Ga0207665_102820262 249
606 3300025940 Ga0207691_10013601 Ga0207691_100136018 249
607 3300025941 Ga0207711_10353912 Ga0207711_103539122 249
608 3300025945 Ga0207679_10089941 Ga0207679_100899413 249
609 3300025949 Ga0207667_10092398 Ga0207667_100923982 249
610 3300025960 Ga0207651_10169012 Ga0207651_101690122 249
611 3300025981 Ga0207640_10339542 Ga0207640_103395422 249
612 3300025986 Ga0207658_10435541 Ga0207658_104355412 249
613 3300026067 Ga0207678_10439656 Ga0207678_104396562 249
614 3300026089 Ga0207648_10082512 Ga0207648_100825122 249
615 3300026095 Ga0207676_10601388 Ga0207676_106013882 249
616 3300026121 Ga0207683_10028550 Ga0207683_100285504 249
617 3300026121 Ga0207683_10175736 Ga0207683_101757362 249
618 3300026142 Ga0207698_10109983 Ga0207698_101099832 249
619 3300027866 Ga0209813_10014359 Ga0209813_100143592 249
620 3300027907 Ga0207428_10065916 Ga0207428_100659162 249
621 3300027907 Ga0207428_10105752 Ga0207428_101057523 249
622 3300028381 Ga0268264_10139049 Ga0268264_101390492 249
623 3300028573 Ga0265334_10021574 Ga0265334_100215743 249
624 3300031238 Ga0265332_10007414 Ga0265332_100074142 249
625 3300031242 Ga0265329_10012383 Ga0265329_100123833 249
626 3300031247 Ga0265340_10006482 Ga0265340_100064823 249
627 3300031247 Ga0265340_10074224 Ga0265340_100742242 249
628 3300031247 Ga0265340_10167322 Ga0265340_101673222 249
629 3300031249 Ga0265339_10000228 Ga0265339_100002288 249
630 3300031249 Ga0265339_10000979 Ga0265339_100009799 249
631 3300031344 Ga0265316_10138840 Ga0265316_101388402 249
632 3300031595 Ga0265313_10000203 Ga0265313_100002033 249
633 3300031711 Ga0265314_10085870 Ga0265314_100858702 249
634 3300031712 Ga0265342_10000031 Ga0265342_10000031139 249
635 3300031712 Ga0265342_10052343 Ga0265342_100523432 249
636 3300031712 Ga0265342_10063046 Ga0265342_100630462 249
637 3300031911 Ga0307412_10811041 Ga0307412_108110411 249
638 3300032002 Ga0307416_100586609 Ga0307416_1005866092 249
639 3300033180 Ga0307510_10264577 Ga0307510_102645772 249
640 3300035083 Ga0373926_0106287 Ga0373926_0106287_266_1018 249
641 3300035089 Ga0373944_0002788 Ga0373944_0002788_2151_2903 249
642 3300035111 Ga0373923_0002956 Ga0373923_0002956_2047_2799 249
643 3300035112 Ga0373932_0091684 Ga0373932_0091684_38_808 249
644 3300035116 Ga0373945_0036567 Ga0373945_0036567_605_1357 249
645 3300035117 Ga0373953_0001366 Ga0373953_0001366_3166_3918 249
646 3300035118 Ga0373954_0002877 Ga0373954_0002877_716_1468 249
647 3300035119 Ga0373956_0040275 Ga0373956_0040275_1257_2009 249
648 3300035170 Ga0373943_0096100 Ga0373943_0096100_753_1505 249
649 3300035171 Ga0373946_0007164 Ga0373946_0007164_792_1544 249
650 3300035171 Ga0373946_0127361 Ga0373946_0127361_26_778 249
651 3300035172 Ga0373955_0000220 Ga0373955_0000220_3076_3828 249
652 3300035172 Ga0373955_0118078 Ga0373955_0118078_75_827 249
653 3300035410 Ga0373924_0058990 Ga0373924_0058990_660_1412 249
654 3300035691 Ga0373931_0113163 Ga0373931_0113163_735_1505 249
655 3300035691 Ga0373931_0131277 Ga0373931_0131277_477_1232 249
656 3300035691 Ga0373931_0449716 Ga0373931_0449716_47_802 249
657 3300035692 Ga0373935_0000227 Ga0373935_0000227_2077_2829 249
658 3300035692 Ga0373935_0186763 Ga0373935_0186763_378_1130 249
659 3300035692 Ga0373935_0203394 Ga0373935_0203394_155_907 249
660 3300035695 Ga0373927_0076509 Ga0373927_0076509_583_1335 249
661 3300035724 Ga0373933_0005475 Ga0373933_0005475_4946_5698 249
662 3300035725 Ga0373947_0000216 Ga0373947_0000216_25975_26727 249
663 3300035725 Ga0373947_0090952 Ga0373947_0090952_1050_1802 249
664 3300036401 Ga0373937_0000003 Ga0373937_0000003_82773_83525 249
665 3300036401 Ga0373937_0036084 Ga0373937_0036084_1317_2069 249
666 3300037068 Ga0373925_0000118 Ga0373925_0000118_59038_59790 249
667 3300037068 Ga0373925_0101412 Ga0373925_0101412_264_1016 249
668 3300037068 Ga0373925_0109802 Ga0373925_0109802_347_1099 249
669 3300037068 Ga0373925_0241631 Ga0373925_0241631_370_1125 249
670 3300037312 Ga0395899_0050936 Ga0395899_0050936_1428_2183 249
671 3300037418 Ga0395900_0109235 Ga0395900_0109235_903_1658 249
672 3300037418 Ga0395900_0254397 Ga0395900_0254397_82_837 249
673 3300037466 Ga0395898_0031164 Ga0395898_0031164_40_795 249
674 3300037853 Ga0436364_0935904 Ga0436364_0935904_138_893 249
675 3300037853 Ga0436364_0960990 Ga0436364_0960990_2276_3028 249
676 3300037853 Ga0436364_1406972 Ga0436364_1406972_196_948 249
677 3300038443 Ga0395901_0084030 Ga0395901_0084030_115_870 249
678 3300038443 Ga0395901_0114185 Ga0395901_0114185_898_1653 249
679 3300038443 Ga0395901_0688391 Ga0395901_0688391_165_920 249
680 3300039437 Ga0436365_0992290 Ga0436365_0992290_61_816 249
681 3300039437 Ga0436365_1269647 Ga0436365_1269647_11_766 249
682 3300039437 Ga0436365_1438404 Ga0436365_1438404_1032_1787 249
683 3300039438 Ga0436360_0309149 Ga0436360_0309149_61_813 249
684 3300039447 Ga0436361_0185672 Ga0436361_0185672_53_808 249
685 3300039450 Ga0436363_1200244 Ga0436363_1200244_458_1210 249
686 3300039450 Ga0436363_1623736 Ga0436363_1623736_332_1084 249
687 3300039453 Ga0436362_1178242 Ga0436362_1178242_169_921 249
688 3300041408 Ga0439453_0001364 Ga0439453_0001364_1608_2360 249
689 3300044694 Ga0466963_0007515 Ga0466963_0007515_4886_5641 249
690 3300045051 Ga0451576_0097441 Ga0451576_0097441_1255_2016 249
691 3300046452 Ga0495617_106859 Ga0495617_106859_134_886 249
692 3300046454 Ga0495592_0000215 Ga0495592_0000215_1216_1968 249
693 3300046459 Ga0495629_0219132 Ga0495629_0219132_220_972 249
694 3300046459 Ga0495629_0221345 Ga0495629_0221345_259_1011 249
695 3300046461 Ga0495641_0054103 Ga0495641_0054103_896_1648 249
696 3300046462 Ga0495651_0000583 Ga0495651_0000583_1530_2282 249
697 3300046463 Ga0495653_0000039 Ga0495653_0000039_67682_68434 249
698 3300046473 Ga0495582_0112097 Ga0495582_0112097_83_835 249
699 3300046474 Ga0495605_0123897 Ga0495605_0123897_128_880 249
700 3300046475 Ga0495639_0061719 Ga0495639_0061719_628_1383 249
701 3300046475 Ga0495639_0271074 Ga0495639_0271074_56_808 249
702 3300046476 Ga0495662_0028292 Ga0495662_0028292_781_1533 249
703 3300046477 Ga0495664_0000015 Ga0495664_0000015_119137_119889 249
704 3300046499 Ga0495594_0187710 Ga0495594_0187710_227_979 249
705 3300046511 Ga0495608_0000025 Ga0495608_0000025_112662_113414 249
706 3300046514 Ga0495618_0000040 Ga0495618_0000040_24489_25241 249
707 3300046516 Ga0495628_0000011 Ga0495628_0000011_151884_152636 249
708 3300046517 Ga0495630_0004483 Ga0495630_0004483_2154_2906 249
709 3300046517 Ga0495630_0073286 Ga0495630_0073286_590_1342 249
710 3300046517 Ga0495630_0233462 Ga0495630_0233462_196_966 249
711 3300046517 Ga0495630_0381058 Ga0495630_0381058_266_1018 249
712 3300046523 Ga0495644_0017579 Ga0495644_0017579_933_1685 249
713 3300046526 Ga0495666_0024276 Ga0495666_0024276_2155_2907 249
714 3300046529 Ga0495652_0000014 Ga0495652_0000014_72849_73601 249
715 3300046533 Ga0495640_0000008 Ga0495640_0000008_151884_152636 249
716 3300046536 Ga0495587_0000015 Ga0495587_0000015_67655_68407 249
717 3300046537 Ga0495598_0000520 Ga0495598_0000520_1760_2512 249
718 3300046537 Ga0495598_0022216 Ga0495598_0022216_311_1063 249
719 3300046538 Ga0495609_0120191 Ga0495609_0120191_266_1018 249
720 3300046539 Ga0495621_0008029 Ga0495621_0008029_1692_2444 249
721 3300046539 Ga0495621_0042198 Ga0495621_0042198_189_941 249
722 3300046543 Ga0495645_0000020 Ga0495645_0000020_112536_113288 249
723 3300046557 Ga0495622_0092691 Ga0495622_0092691_344_1096 249
724 3300046558 Ga0495633_0098707 Ga0495633_0098707_148_900 249
725 3300046559 Ga0495667_0000013 Ga0495667_0000013_151870_152622 249
726 3300046615 Ga0495656_0039320 Ga0495656_0039320_87_839 249
727 3300046616 Ga0495668_0091139 Ga0495668_0091139_798_1550 249
728 3300046642 Ga0495634_0000415 Ga0495634_0000415_15501_16253 249
729 3300046642 Ga0495634_0028352 Ga0495634_0028352_1691_2443 249
730 3300046648 Ga0495611_0096668 Ga0495611_0096668_422_1174 249
731 3300046663 Ga0495635_0000012 Ga0495635_0000012_72636_73388 249
732 3300046675 Ga0495657_0000815 Ga0495657_0000815_21667_22419 249
733 3300046678 Ga0495599_0000008 Ga0495599_0000008_72899_73651 249
734 3300046679 Ga0495623_0000002 Ga0495623_0000002_126068_126820 249
735 3300046680 Ga0495646_0000004 Ga0495646_0000004_200538_201290 249
736 3300046681 Ga0495647_0086365 Ga0495647_0086365_252_1022 249
737 3300046683 Ga0495658_0155499 Ga0495658_0155499_439_1191 249
738 3300046689 Ga0495613_0048557 Ga0495613_0048557_1225_1977 249
739 3300046794 Ga0495589_0052547 Ga0495589_0052547_512_1264 249
740 3300046809 Ga0495600_0000024 Ga0495600_0000024_81566_82318 249
741 3300047317 Ga0495604_0000001 Ga0495604_0000001_436477_437229 249
742 3300047319 Ga0495674_0000023 Ga0495674_0000023_88926_89678 249
743 3300047321 Ga0495676_0065149 Ga0495676_0065149_214_966 249
744 3300047322 Ga0495680_0003698 Ga0495680_0003698_13089_13841 249
745 3300047444 Ga0495675_0000392 Ga0495675_0000392_2086_2838 249
746 3300047471 Ga0495684_0000007 Ga0495684_0000007_72709_73461 249
747 3300047673 Ga0495593_0001189 Ga0495593_0001189_3569_4321 249
748 3300048088 Ga0495602_0000045 Ga0495602_0000045_112545_113297 249
749 3300048090 Ga0495615_0024701 Ga0495615_0024701_611_1363 249
750 3300048903 Ga0496100_0001068 Ga0496100_0001068_9587_10339 249
751 3300048903 Ga0496100_0048326 Ga0496100_0048326_848_1603 249
752 3300048904 Ga0496101_0048287 Ga0496101_0048287_1703_2455 249
753 3300048904 Ga0496101_0071082 Ga0496101_0071082_1059_1811 249
754 3300048905 Ga0496102_0004311 Ga0496102_0004311_8513_9265 249
755 3300048905 Ga0496102_0006570 Ga0496102_0006570_8645_9397 249
756 3300048905 Ga0496102_0013773 Ga0496102_0013773_3284_4039 249
757 3300048906 Ga0496103_0018475 Ga0496103_0018475_2572_3324 249
758 3300048907 Ga0496104_0000661 Ga0496104_0000661_8667_9419 249
759 3300048907 Ga0496104_0051105 Ga0496104_0051105_1798_2550 249
760 3300048907 Ga0496104_0135135 Ga0496104_0135135_1458_2213 249
761 3300048907 Ga0496104_0786924 Ga0496104_0786924_84_839 249
762 3300048908 Ga0496105_0019801 Ga0496105_0019801_1648_2400 249
763 3300048908 Ga0496105_0032101 Ga0496105_0032101_35_790 249
764 3300048908 Ga0496105_0168858 Ga0496105_0168858_657_1412 249
765 3300048909 Ga0496106_0006097 Ga0496106_0006097_1703_2455 249
766 3300048909 Ga0496106_0286275 Ga0496106_0286275_447_1202 249
767 3300048909 Ga0496106_0454912 Ga0496106_0454912_20_772 249
768 3300048910 Ga0496107_0001451 Ga0496107_0001451_3157_3909 249
769 3300048910 Ga0496107_0094639 Ga0496107_0094639_1281_2036 249
770 3300048911 Ga0496108_0002614 Ga0496108_0002614_3202_3954 249
771 3300048911 Ga0496108_0005866 Ga0496108_0005866_5951_6703 249
772 3300048911 Ga0496108_0016291 Ga0496108_0016291_541_1296 249
773 3300048911 Ga0496108_0018324 Ga0496108_0018324_2532_3287 249
774 3300048912 Ga0496109_0000402 Ga0496109_0000402_2196_2948 249
775 3300048912 Ga0496109_0000629 Ga0496109_0000629_18842_19597 249
776 3300048912 Ga0496109_0002222 Ga0496109_0002222_10090_10842 249
777 3300048912 Ga0496109_0010095 Ga0496109_0010095_4566_5321 249
778 3300048913 Ga0496110_0002519 Ga0496110_0002519_9153_9905 249
779 3300048913 Ga0496110_0235985 Ga0496110_0235985_445_1197 249
780 3300048914 Ga0496111_0006001 Ga0496111_0006001_6318_7070 249
781 3300048914 Ga0496111_0014388 Ga0496111_0014388_4100_4852 249
782 3300048914 Ga0496111_0022216 Ga0496111_0022216_2177_2929 249
783 3300048915 Ga0496112_0009347 Ga0496112_0009347_5363_6115 249
784 3300048915 Ga0496112_0470126 Ga0496112_0470126_369_1124 249
785 3300048916 Ga0496113_0002450 Ga0496113_0002450_5463_6218 249
786 3300048916 Ga0496113_0010086 Ga0496113_0010086_4721_5476 249
787 3300048916 Ga0496113_0012160 Ga0496113_0012160_3145_3897 249
788 3300048917 Ga0496114_0033372 Ga0496114_0033372_642_1394 249
789 3300048918 Ga0496115_0054392 Ga0496115_0054392_1825_2577 249
790 3300048918 Ga0496115_0076213 Ga0496115_0076213_716_1471 249
791 3300048918 Ga0496115_0483745 Ga0496115_0483745_209_961 249
792 3300049570 Ga0501033_0111625 Ga0501033_0111625_903_1655 249
793 3300049571 Ga0501034_0010534 Ga0501034_0010534_5298_6053 249
794 3300049571 Ga0501034_0581451 Ga0501034_0581451_168_920 249
795 3300049572 Ga0501036_0386004 Ga0501036_0386004_210_977 249
796 3300049574 Ga0501038_0084361 Ga0501038_0084361_1871_2623 249
797 3300049578 Ga0501042_0214649 Ga0501042_0214649_151_903 249
798 3300049579 Ga0501043_0102192 Ga0501043_0102192_1231_1980 249
799 3300049586 Ga0501070_0035001 Ga0501070_0035001_2330_3079 249
800 3300049591 Ga0501075_0153807 Ga0501075_0153807_644_1396 249
801 3300049592 Ga0501076_0316375 Ga0501076_0316375_197_949 249
802 3300049593 Ga0501077_0372365 Ga0501077_0372365_57_809 249
803 3300049742 Ga0501080_0147220 Ga0501080_0147220_743_1492 249
804 3300049742 Ga0501080_0241733 Ga0501080_0241733_686_1441 249
805 3300049744 Ga0501083_0089133 Ga0501083_0089133_646_1398 249
806 3300049744 Ga0501083_0121900 Ga0501083_0121900_686_1438 249
807 3300049823 Ga0501044_0026844 Ga0501044_0026844_2961_3713 249
808 3300049823 Ga0501044_0397934 Ga0501044_0397934_77_847 249
809 3300050489 nmdc:mga03683_230033_c1 nmdc:mga03683_230033_c1_68_820 249
810 3300050489 nmdc:mga03683_24008_c1 nmdc:mga03683_24008_c1_1241_1993 249
811 3300050489 nmdc:mga03683_30505_c1 nmdc:mga03683_30505_c1_1066_1815 249
812 3300050491 nmdc:mga00v17_164611_c1 nmdc:mga00v17_164611_c1_243_1007 249
813 3300050491 nmdc:mga00v17_73809_c1 nmdc:mga00v17_73809_c1_320_1093 249
814 3300050494 nmdc:mga06z11_193676_c1 nmdc:mga06z11_193676_c1_172_945 249
815 3300050494 nmdc:mga06z11_624_c1 nmdc:mga06z11_624_c1_4030_4803 249
816 3300050494 nmdc:mga06z11_6651_c1 nmdc:mga06z11_6651_c1_2307_3098 249
817 3300050496 nmdc:mga07m45_112183_c1 nmdc:mga07m45_112183_c1_71_820 249
818 3300050496 nmdc:mga07m45_226293_c1 nmdc:mga07m45_226293_c1_235_987 249
819 3300050507 nmdc:mga05p37_14344_c1 nmdc:mga05p37_14344_c1_6328_7080 249
820 3300050507 nmdc:mga05p37_336128_c1 nmdc:mga05p37_336128_c1_851_1603 249
821 3300050507 nmdc:mga05p37_52_c1 nmdc:mga05p37_52_c1_67820_68572 249
822 3300050507 nmdc:mga05p37_79819_c1 nmdc:mga05p37_79819_c1_358_1110 249
823 3300050508 nmdc:mga09592_467986_c1 nmdc:mga09592_467986_c1_34_786 249
824 3300050509 nmdc:mga0qj67_212290_c1 nmdc:mga0qj67_212290_c1_751_1506 249
825 3300050510 nmdc:mga06r32_4_c1 nmdc:mga06r32_4_c1_17125_17877 249
826 3300050510 nmdc:mga06r32_54301_c1 nmdc:mga06r32_54301_c1_1335_2090 249
827 3300050511 nmdc:mga08y16_23571_c1 nmdc:mga08y16_23571_c1_4264_5016 249
828 3300050511 nmdc:mga08y16_60153_c1 nmdc:mga08y16_60153_c1_1192_1944 249
829 3300050511 nmdc:mga08y16_822_c1 nmdc:mga08y16_822_c1_11996_12748 249
830 3300050512 nmdc:mga0n895_159895_c1 nmdc:mga0n895_159895_c1_755_1507 249
831 3300050512 nmdc:mga0n895_20493_c1 nmdc:mga0n895_20493_c1_2574_3326 249
832 3300050512 nmdc:mga0n895_479195_c1 nmdc:mga0n895_479195_c1_490_1242 249
833 3300050512 nmdc:mga0n895_66950_c1 nmdc:mga0n895_66950_c1_2550_3302 249
834 3300050513 nmdc:mga0rr50_35335_c1 nmdc:mga0rr50_35335_c1_826_1578 249
835 3300050515 nmdc:mga0a205_100676_c1 nmdc:mga0a205_100676_c1_1134_1886 249
836 3300050515 nmdc:mga0a205_149514_c1 nmdc:mga0a205_149514_c1_786_1538 249
837 3300053077 Ga0495601_0000014 Ga0495601_0000014_67683_68435 249
838 3300053078 Ga0495612_0000014 Ga0495612_0000014_67661_68413 249
839 3300053084 Ga0495595_0000038 Ga0495595_0000038_51783_52535 249
840 3300053085 Ga0495619_0000006 Ga0495619_0000006_151884_152636 249
841 3300053085 Ga0495619_0075710 Ga0495619_0075710_678_1430 249
842 3300053087 Ga0500643_010040 Ga0500643_010040_663_1460 249
843 3300053093 Ga0500651_0066125 Ga0500651_0066125_541_1311 249
844 3300053094 Ga0500566_0008714 Ga0500566_0008714_3464_4261 249
845 3300053096 Ga0500641_0008450 Ga0500641_0008450_1995_2756 249
846 3300053108 Ga0500562_006316 Ga0500562_006316_1568_2329 249
847 3300053117 Ga0500593_029191 Ga0500593_029191_671_1423 249
848 3300053119 Ga0500595_000029 Ga0500595_000029_46696_47493 249
849 3300053131 Ga0500652_005799 Ga0500652_005799_1553_2362 249
850 3300053153 Ga0500616_0001264 Ga0500616_0001264_7316_8068 249
851 3300053153 Ga0500616_0005830 Ga0500616_0005830_7177_7929 249
852 3300053153 Ga0500616_0058602 Ga0500616_0058602_669_1430 249
853 3300053158 Ga0500627_0183364 Ga0500627_0183364_143_895 249
854 3300053730 Ga0500645_000290 Ga0500645_000290_4373_5182 249
855 3300060353 Ga0501082_0017594 Ga0501082_0017594_3416_4168 249
856 iso_pu_bacteria 2599185236 2599722274 249
857 iso_pu_bacteria 2600254933 2600373981 249
858 iso_pu_bacteria 2821123053 2821125926 249
859 iso_pu_bacteria 2838736955 2838737597 249
860 iso_pu_bacteria 2841840854 2841842034 249
861 iso_pu_bacteria 2841911363 2841913491 249
862 iso_pu_bacteria 2841917233 2841919238 249
863 iso_pu_bacteria 2842140634 2842141813 249
864 iso_pu_bacteria 2857531043 2857532488 249
865 3300005293 Ga0065715_10409333 Ga0065715_104093331 250
866 3300005577 Ga0068857_100085007 Ga0068857_1000850073 250
867 3300005617 Ga0068859_101024518 Ga0068859_1010245181 250
868 3300005981 Ga0081538_10019181 Ga0081538_100191813 250
869 3300006177 Ga0075362_10009224 Ga0075362_100092243 250
870 3300006195 Ga0075366_10086007 Ga0075366_100860072 250
871 3300006931 Ga0097620_101024563 Ga0097620_1010245631 250
872 3300025942 Ga0207689_10044976 Ga0207689_100449763 250
873 3300026095 Ga0207676_10178642 Ga0207676_101786422 250
874 3300026116 Ga0207674_10199602 Ga0207674_101996022 250
875 3300031247 Ga0265340_10048202 Ga0265340_100482022 250
876 3300031595 Ga0265313_10065718 Ga0265313_100657182 250
877 3300031712 Ga0265342_10149924 Ga0265342_101499242 250
878 3300039437 Ga0436365_1620720 Ga0436365_1620720_192_947 250
879 3300039437 Ga0436365_1753369 Ga0436365_1753369_663_1421 250
880 3300039437 Ga0436365_1788190 Ga0436365_1788190_593_1351 250
881 3300039450 Ga0436363_0578409 Ga0436363_0578409_67_834 250
882 3300047447 Ga0495685_048693 Ga0495685_048693_365_1120 250
883 3300048917 Ga0496114_0096431 Ga0496114_0096431_1624_2385 250
884 3300049573 Ga0501037_0264759 Ga0501037_0264759_353_1108 250
885 3300049586 Ga0501070_0119685 Ga0501070_0119685_964_1716 250
886 3300049588 Ga0501072_0061204 Ga0501072_0061204_1559_2314 250
887 3300049589 Ga0501073_0004247 Ga0501073_0004247_2527_3279 250
888 3300049591 Ga0501075_0012911 Ga0501075_0012911_877_1632 250
889 3300049592 Ga0501076_0042884 Ga0501076_0042884_1299_2054 250
890 3300049741 Ga0501079_0120829 Ga0501079_0120829_807_1562 250
891 3300049742 Ga0501080_0222919 Ga0501080_0222919_783_1538 250
892 3300049742 Ga0501080_0401704 Ga0501080_0401704_331_1083 250
893 3300049823 Ga0501044_0202811 Ga0501044_0202811_96_848 250
894 3300050491 nmdc:mga00v17_272282_c1 nmdc:mga00v17_272282_c1_72_827 250
895 3300050510 nmdc:mga06r32_128381_c1 nmdc:mga06r32_128381_c1_1176_1934 250
896 3300053085 Ga0495619_0077125 Ga0495619_0077125_224_979 250
897 3300053139 Ga0500568_0039564 Ga0500568_0039564_268_1023 250
898 3300053156 Ga0500622_0013242 Ga0500622_0013242_159_911 250
899 3300060353 Ga0501082_0087994 Ga0501082_0087994_1874_2629 250
900 3300060353 Ga0501082_0633011 Ga0501082_0633011_173_925 250
901 iso_pu_bacteria 2920822456 2920827904 250
902 3300002773 JGI25152J39213_1002271 JGI25152J39213_10022714 251
903 3300002774 JGI25150J39212_1000091 JGI25150J39212_100009151 251
904 3300002987 JGI25159J45721_1006205 JGI25159J45721_10062052 251
905 3300003187 JGI25151J46595_10000027 JGI25151J46595_1000002764 251
906 3300003187 JGI25151J46595_10000079 JGI25151J46595_1000007957 251
907 3300003203 JGI25406J46586_10001744 JGI25406J46586_100017447 251
908 3300003215 JGI25153J46596_10023417 JGI25153J46596_100234172 251
909 3300003659 JGI25404J52841_10025863 JGI25404J52841_100258632 251
910 3300003771 Ga0055526_1001798 Ga0055526_10017989 251
911 3300003771 Ga0055526_1004200 Ga0055526_10042002 251
912 3300003775 Ga0055524_1000147 Ga0055524_100014736 251
913 3300005262 Ga0065165_1000359 Ga0065165_10003599 251
914 3300005327 Ga0070658_10250365 Ga0070658_102503652 251
915 3300005331 Ga0070670_100000279 Ga0070670_10000027937 251
916 3300005436 Ga0070713_100015955 Ga0070713_1000159557 251
917 3300005548 Ga0070665_100164933 Ga0070665_1001649332 251
918 3300005548 Ga0070665_100303739 Ga0070665_1003037392 251
919 3300005937 Ga0081455_10022523 Ga0081455_100225233 251
920 3300005937 Ga0081455_10206962 Ga0081455_102069622 251
921 3300005983 Ga0081540_1006595 Ga0081540_10065957 251
922 3300005983 Ga0081540_1009132 Ga0081540_10091326 251
923 3300005985 Ga0081539_10003011 Ga0081539_1000301120 251
924 3300005985 Ga0081539_10016697 Ga0081539_100166973 251
925 3300006028 Ga0070717_10006086 Ga0070717_100060864 251
926 3300006175 Ga0070712_100594810 Ga0070712_1005948102 251
927 3300006178 Ga0075367_10016000 Ga0075367_100160004 251
928 3300006871 Ga0075434_100041218 Ga0075434_1000412186 251
929 3300006914 Ga0075436_100189908 Ga0075436_1001899082 251
930 3300006946 Ga0079104_1000015 Ga0079104_1000015181 251
931 3300007788 Ga0099795_10008633 Ga0099795_100086333 251
932 3300013104 Ga0157370_10077887 Ga0157370_100778872 251
933 3300013104 Ga0157370_10235815 Ga0157370_102358152 251
934 3300013250 Ga0171462_1033 Ga0171462_103347 251
935 3300024225 Ga0224572_1014579 Ga0224572_10145792 251
936 3300025245 Ga0207425_1000043 Ga0207425_100004362 251
937 3300025258 Ga0209129_1000072 Ga0209129_1000072132 251
938 3300025273 Ga0209673_1008478 Ga0209673_10084783 251
939 3300025284 Ga0209130_1000062 Ga0209130_1000062132 251
940 3300025291 Ga0209675_1001144 Ga0209675_10011444 251
941 3300025294 Ga0209025_1000014 Ga0209025_1000014773 251
942 3300025294 Ga0209025_1000120 Ga0209025_1000120132 251
943 3300025294 Ga0209025_1001382 Ga0209025_100138224 251
944 3300025295 Ga0209564_1000017 Ga0209564_1000017477 251
945 3300025295 Ga0209564_1000179 Ga0209564_1000179112 251
946 3300025297 Ga0209758_1000111 Ga0209758_1000111132 251
947 3300025297 Ga0209758_1033923 Ga0209758_10339232 251
948 3300025299 Ga0209256_1000055 Ga0209256_100005537 251
949 3300025299 Ga0209256_1000338 Ga0209256_100033869 251
950 3300025909 Ga0207705_10073083 Ga0207705_100730832 251
951 3300025925 Ga0207650_10001249 Ga0207650_1000124922 251
952 3300027111 Ga0209281_1000068 Ga0209281_1000068208 251
953 3300028379 Ga0268266_10131354 Ga0268266_101313542 251
954 3300031241 Ga0265325_10073043 Ga0265325_100730432 251
955 3300031731 Ga0307405_10001622 Ga0307405_1000162211 251
956 3300031731 Ga0307405_10139289 Ga0307405_101392892 251
957 3300035115 Ga0373941_0007246 Ga0373941_0007246_1255_2016 251
958 3300037853 Ga0436364_0023609 Ga0436364_0023609_1425_2216 251
959 3300039447 Ga0436361_0914590 Ga0436361_0914590_53_817 251
960 3300039447 Ga0436361_1014188 Ga0436361_1014188_957_1721 251
961 3300044684 Ga0466966_0112780 Ga0466966_0112780_883_1647 251
962 3300046460 Ga0495638_0129382 Ga0495638_0129382_476_1285 251
963 3300046507 Ga0495606_0008343 Ga0495606_0008343_4661_5416 251
964 3300046507 Ga0495606_0178162 Ga0495606_0178162_169_924 251
965 3300046530 Ga0495654_0003262 Ga0495654_0003262_3307_4062 251
966 3300047472 Ga0495686_0008971 Ga0495686_0008971_3430_4185 251
967 3300047472 Ga0495686_0010433 Ga0495686_0010433_972_1727 251
968 3300048088 Ga0495602_0375550 Ga0495602_0375550_26_793 251
969 3300048914 Ga0496111_0004762 Ga0496111_0004762_6329_7090 251
970 3300048919 Ga0496116_0015598 Ga0496116_0015598_1262_2017 251
971 3300048919 Ga0496116_0044773 Ga0496116_0044773_1097_1852 251
972 3300048920 Ga0496117_0091104 Ga0496117_0091104_754_1518 251
973 3300048920 Ga0496117_0191181 Ga0496117_0191181_36_800 251
974 3300048922 Ga0496119_0182568 Ga0496119_0182568_150_911 251
975 3300048924 Ga0496121_0007746 Ga0496121_0007746_3657_4418 251
976 3300048924 Ga0496121_0064321 Ga0496121_0064321_1097_1852 251
977 3300048924 Ga0496121_0246921 Ga0496121_0246921_148_909 251
978 3300048925 Ga0496122_0000042 Ga0496122_0000042_182291_183052 251
979 3300048925 Ga0496122_0028821 Ga0496122_0028821_1239_2069 251
980 3300048925 Ga0496122_0035502 Ga0496122_0035502_1254_2009 251
981 3300048926 Ga0496123_0000030 Ga0496123_0000030_108708_109469 251
982 3300048926 Ga0496123_0004716 Ga0496123_0004716_10222_10977 251
983 3300048926 Ga0496123_0061708 Ga0496123_0061708_391_1155 251
984 3300048926 Ga0496123_0110070 Ga0496123_0110070_733_1497 251
985 3300048927 Ga0496124_0006891 Ga0496124_0006891_1140_1895 251
986 3300048927 Ga0496124_0144274 Ga0496124_0144274_658_1413 251
987 3300048927 Ga0496124_0202090 Ga0496124_0202090_630_1442 251
988 3300048928 Ga0496125_0018305 Ga0496125_0018305_1274_2029 251
989 3300049569 Ga0501032_0029001 Ga0501032_0029001_541_1302 251
990 3300049569 Ga0501032_0070411 Ga0501032_0070411_603_1364 251
991 3300049569 Ga0501032_0118701 Ga0501032_0118701_593_1354 251
992 3300049570 Ga0501033_0047501 Ga0501033_0047501_290_1051 251
993 3300049570 Ga0501033_0463084 Ga0501033_0463084_73_837 251
994 3300049571 Ga0501034_0019606 Ga0501034_0019606_1707_2468 251
995 3300049571 Ga0501034_0096730 Ga0501034_0096730_1766_2521 251
996 3300049571 Ga0501034_0308485 Ga0501034_0308485_386_1147 251
997 3300049571 Ga0501034_0313185 Ga0501034_0313185_366_1127 251
998 3300049572 Ga0501036_0003133 Ga0501036_0003133_9745_10506 251
999 3300049572 Ga0501036_0089064 Ga0501036_0089064_390_1151 251
1000 3300049573 Ga0501037_0165182 Ga0501037_0165182_357_1118 251
1001 3300049573 Ga0501037_0342647 Ga0501037_0342647_169_924 251
1002 3300049574 Ga0501038_0018550 Ga0501038_0018550_1039_1800 251
1003 3300049574 Ga0501038_0087949 Ga0501038_0087949_653_1414 251
1004 3300049575 Ga0501039_0038499 Ga0501039_0038499_1992_2753 251
1005 3300049575 Ga0501039_0097174 Ga0501039_0097174_796_1551 251
1006 3300049575 Ga0501039_0097449 Ga0501039_0097449_1071_1832 251
1007 3300049579 Ga0501043_0002174 Ga0501043_0002174_6499_7260 251
1008 3300049580 Ga0501046_0016092 Ga0501046_0016092_3796_4557 251
1009 3300049581 Ga0501047_0036939 Ga0501047_0036939_1635_2390 251
1010 3300049581 Ga0501047_0083623 Ga0501047_0083623_1713_2474 251
1011 3300049586 Ga0501070_0021600 Ga0501070_0021600_638_1399 251
1012 3300049586 Ga0501070_0117977 Ga0501070_0117977_742_1503 251
1013 3300049587 Ga0501071_0167416 Ga0501071_0167416_148_951 251
1014 3300049588 Ga0501072_0064161 Ga0501072_0064161_1032_1835 251
1015 3300049589 Ga0501073_0066245 Ga0501073_0066245_780_1541 251
1016 3300049589 Ga0501073_0121744 Ga0501073_0121744_275_1036 251
1017 3300049590 Ga0501074_0114296 Ga0501074_0114296_448_1209 251
1018 3300049590 Ga0501074_0275379 Ga0501074_0275379_390_1151 251
1019 3300049742 Ga0501080_0015977 Ga0501080_0015977_5412_6173 251
1020 3300049822 Ga0501035_0018680 Ga0501035_0018680_3785_4546 251
1021 3300049822 Ga0501035_0096264 Ga0501035_0096264_234_995 251
1022 3300049823 Ga0501044_0186254 Ga0501044_0186254_571_1335 251
1023 3300049823 Ga0501044_0231594 Ga0501044_0231594_144_905 251
1024 3300049823 Ga0501044_0466509 Ga0501044_0466509_293_1054 251
1025 3300050512 nmdc:mga0n895_39420_c1 nmdc:mga0n895_39420_c1_2558_3319 251
1026 3300050513 nmdc:mga0rr50_58880_c2 nmdc:mga0rr50_58880_c2_947_1708 251
1027 3300050514 nmdc:mga08x19_96665_c1 nmdc:mga08x19_96665_c1_213_974 251
1028 3300050516 nmdc:mga0sz30_1180_c1 nmdc:mga0sz30_1180_c1_5051_5863 251
1029 3300050516 nmdc:mga0sz30_15974_c1 nmdc:mga0sz30_15974_c1_114_875 251
1030 3300053088 Ga0500644_0004361 Ga0500644_0004361_921_1730 251
1031 3300053125 Ga0500618_001534 Ga0500618_001534_5948_6709 251
1032 3300053125 Ga0500618_004196 Ga0500618_004196_3427_4188 251
1033 3300053153 Ga0500616_0000006 Ga0500616_0000006_160965_161774 251
1034 3300053153 Ga0500616_0061300 Ga0500616_0061300_740_1504 251
1035 3300053156 Ga0500622_0039088 Ga0500622_0039088_1059_1823 251
1036 iso_pu_bacteria 2738541317 2738944237 251
1037 iso_pu_bacteria 2913308742 2913308857 251
1038 iso_pu_bacteria 2939669807 2939672806 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

51

206

0.96

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

253

276

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9034 11 238
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9004 9 235
5x5y-assembly1.cif.gz_A a membrane protein complex 0.8955 11 250
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.895 9 235
2ihy-assembly1.cif.gz_A structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.8938 9 249
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.923 10 251 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9096 11 233 3.40.50.300
af_P77257_8_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8975 9 247 3.40.50.300
2awnA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8938 11 233 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8936 6 74 3.40.50.300
ID Description Score Start End GO Terms
AF-U7UQ99-F1-model_v4 Branched-chain amino acid ABC transporter 0.9211 8 250 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A8A6JF79-F1-model_v4 deleted 0.9172 52 217
AF-A0A3N6MLS5-F1-model_v4 ABC transporter ATP-binding protein 0.916 9 250 GO:0005524
GO:0005886
GO:0016887
AF-A0A377GXA8-F1-model_v4 Lipopolysaccharide export system ATP-binding protein LptB (EC 3.6.3.-) 0.9156 8 250 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A1I2K4U1-F1-model_v4 Lipopolysaccharide export system ATP-binding protein LptB 0.9107 8 251 GO:0005524
GO:0005737
GO:0016887
GO:0043190
GO:0055085

Feature Viewer

pLDDT pTM Quality
89.28 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map