F488741

General Info

Members Datasets Scaffolds Average Seq Length
1037 468 981 352

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10005792|Ga0265325_100057925
Length 394
Sequence MALEDRPRDHQTAMSGVANPPDCAALTAARSARSLRRVNATPQPQDVVPVTDRHRFDEAALARYLARHLEGYRGPLTVQQFAGGQSNPTFFLTEGGRSLVLRKKPPGELLPSAHAVDREFRVMRALGTTDFPVPRTHLLCEDAAVIGQIFYVMDWVPGRILRDPLLAGMQPAERRAIYDAMNAAMAQLHTIDPFAIGLGDFGKPGNYFARQTARWIKQYEASQTEEIESFNRLIEWLPKSIPPGDETRIAHGDFRLENMVLHPTEPRVLAVLDWELSTLGHPLADLGYNVMGYFMPPGQPGRLAGADLEALGIPSVDDYVAAYCRRTGRARVDDLEFYVVFALFRSAAIMQGIAMRAKIGTASAANAELVGKYARTIADTAWEIVQRPPSEGRE

Samples

Sample ID Description Type Environment
1 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
2 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
3 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
4 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
5 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
6 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
7 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
8 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
9 2643221651 Afipia sp. Root123D2 Isolate Unclassified
10 2643221734 Bosea sp. Root670 Isolate Unclassified
11 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
12 2738541297 Duganella sp. GV083 Isolate Unclassified
13 2738541357 Duganella sp. GV053 Isolate Unclassified
14 2738543003 Duganella sp. GV066 Isolate Unclassified
15 2738543024 Aminobacter sp. AP02 Isolate Unclassified
16 2738543026 Duganella sp. GV089 Isolate Unclassified
17 2738543029 Duganella sp. GV039 Isolate Unclassified
18 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
19 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
20 2821131069 Duganella sp. 1224 Isolate Unclassified
21 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
22 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
23 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
24 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
25 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
26 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
27 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
28 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
29 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
30 2857558681 Duganella sp. R-74565 Isolate Unclassified
31 2857564685 Duganella sp. R-74599 Isolate Unclassified
32 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
33 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
34 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
35 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
36 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
37 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
38 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
39 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
40 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
41 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
42 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
43 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
44 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
45 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
46 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
47 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
48 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
49 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
50 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
51 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
52 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
53 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
54 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
55 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
56 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
57 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
58 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
59 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
60 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
61 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
63 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
64 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
65 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
66 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
67 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
68 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
69 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
70 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
71 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
72 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
73 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
74 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
75 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
76 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
77 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
78 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
79 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
80 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
81 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
82 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
83 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
84 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
85 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
86 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
87 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
88 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
89 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
90 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
91 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
92 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
93 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
94 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
95 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
96 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
97 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
98 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
99 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
100 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
101 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
102 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
103 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
104 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
105 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
106 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
107 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
108 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
109 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
110 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
111 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
112 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
113 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
114 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
115 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
116 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
117 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
118 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
119 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
120 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
121 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
122 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
123 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
124 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
125 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
126 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
127 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
128 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
129 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
130 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
132 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
133 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
134 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
135 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
136 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
138 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
139 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
140 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
141 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
142 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
143 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
145 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
146 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
148 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
149 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
150 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
151 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
152 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
153 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
154 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
155 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
156 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
157 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
158 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
159 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
160 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
161 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
162 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
163 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
164 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
165 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
169 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
170 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
171 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
172 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
173 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
174 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
175 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
176 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
229 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
234 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
235 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
236 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
237 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
238 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
239 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
240 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
241 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
242 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
243 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
244 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
245 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
246 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
247 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
248 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
249 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
250 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
251 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
252 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
253 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
254 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
255 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
256 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
257 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
258 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
259 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
260 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
262 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
263 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
264 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
265 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
266 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
267 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
270 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
271 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
274 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
275 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
276 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
277 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
278 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
279 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
280 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
281 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
282 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
283 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
284 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
285 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
286 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
287 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
288 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
289 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
290 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
291 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
292 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
293 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
294 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
295 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
296 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
297 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
298 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
299 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
300 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
301 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
302 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
303 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
304 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
305 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
306 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
307 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
308 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
309 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
310 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
311 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
312 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
313 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
314 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
315 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
316 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
317 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
318 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
319 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
320 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
321 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
322 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
323 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
324 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
325 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
326 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
327 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
328 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
329 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
330 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
331 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
332 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
333 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
334 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
335 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
336 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
337 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
338 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
339 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
340 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
341 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
342 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
343 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
344 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
345 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
346 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
347 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
348 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
349 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
350 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
351 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
352 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
353 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
354 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
355 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
356 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
357 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
358 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
359 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
360 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
361 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
362 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
363 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
364 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
365 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
366 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
367 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
368 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
369 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
370 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
371 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
372 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
373 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
374 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
375 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
376 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
377 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
378 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
379 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
380 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
381 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
382 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
383 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
384 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
385 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
386 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
387 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
388 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
389 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
390 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
391 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
392 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
393 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
394 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
395 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
396 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
397 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
398 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
399 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
400 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
401 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
402 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
403 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
404 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
405 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
416 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
417 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
418 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
419 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
420 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
421 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
422 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
423 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
424 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
425 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
426 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
427 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
428 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
429 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
430 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
431 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
434 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
435 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
436 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
437 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
438 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
439 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
440 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
441 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
442 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
443 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
444 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
445 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
446 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
447 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
448 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
449 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
450 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
451 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
452 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
453 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
454 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
455 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
456 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
457 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
458 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
459 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
460 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
461 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
462 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
464 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
465 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
466 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
467 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
468 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.5
Metatranscriptomes 0.1
Isolates 5.4

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 7.23
Nodule 2.22
Rhizoplane 2.03
Rhizosphere 80.81
Stem 0
Stem Tuber 0
Unclassified 7.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002424 3300001904 Bacteria 3295
2 JGI24741J21665_1000034 3300001915 Bacteria 32794
3 JGI24740J21852_10000403 3300001979 Bacteria 18606
4 JGI24739J22299_10000059 3300001989 Bacteria 31070
5 JGI24737J22298_10000084 3300001990 Bacteria 27475
6 JGI24735J21928_10000109 3300002067 Bacteria 29714
7 JGI25154J39366_1001838 3300002738 Bacteria 6537
8 JGI25151J46595_10000030 3300003187 Bacteria 202084
9 JGI25406J46586_10005781 3300003203 Bacteria 5722
10 JGI25406J46586_10030970 3300003203 Bacteria 2007
11 Ga0055526_1000013 3300003771 Bacteria 233580
12 Ga0055526_1000019 3300003771 Bacteria 189698
13 Ga0055526_1000368 3300003771 Bacteria 36399
14 Ga0055526_1000502 3300003771 Bacteria 31206
15 Ga0055526_1001266 3300003771 Bacteria 18132
16 Ga0055537_1000159 3300003773 Bacteria 50407
17 Ga0055524_1000069 3300003775 Bacteria 128956
18 Ga0055524_1000469 3300003775 Bacteria 32369
19 Ga0055524_1009528 3300003775 Bacteria 3940
20 Ga0055534_1000045 3300003784 Bacteria 98659
21 Ga0055528_1000323 3300003790 Bacteria 40144
22 Ga0055530_10000160 3300003791 Bacteria 61095
23 Ga0055530_10000630 3300003791 Bacteria 30400
24 Ga0055540_1000173 3300003792 Bacteria 63434
25 Ga0055531_10005811 3300003794 Bacteria 7140
26 Ga0055543_1006928 3300004625 Bacteria 2677
27 Ga0065165_1000243 3300005262 Bacteria 93455
28 Ga0065707_10119488 3300005295 Bacteria 2158
29 Ga0070658_10049172 3300005327 Bacteria 3415
30 Ga0070676_10002512 3300005328 Bacteria 9416
31 Ga0070676_10002638 3300005328 Bacteria 9234
32 Ga0070676_10120668 3300005328 Bacteria 1645
33 Ga0070690_100164033 3300005330 Bacteria 1525
34 Ga0070670_100000052 3300005331 Bacteria 129346
35 Ga0070677_10000311 3300005333 Bacteria 16974
36 Ga0070666_10007951 3300005335 Bacteria 6556
37 Ga0070666_10009376 3300005335 Bacteria 6100
38 Ga0070666_10012511 3300005335 Bacteria 5357
39 Ga0070666_10027544 3300005335 Bacteria 3723
40 Ga0070682_100017170 3300005337 Bacteria 4216
41 Ga0068868_100003668 3300005338 Bacteria 10719
42 Ga0068868_100201892 3300005338 Bacteria 1658
43 Ga0070661_100004880 3300005344 Bacteria 9235
44 Ga0070668_100002357 3300005347 Bacteria 13887
45 Ga0070668_100049834 3300005347 Bacteria 3222
46 Ga0070669_100006210 3300005353 Bacteria 8626
47 Ga0070675_100063964 3300005354 Bacteria 3041
48 Ga0070671_100000043 3300005355 Bacteria 89426
49 Ga0070671_100021300 3300005355 Bacteria 5295
50 Ga0070671_100230895 3300005355 Bacteria 1570
51 Ga0070674_100007399 3300005356 Bacteria 6476
52 Ga0070667_100000021 3300005367 Bacteria 205662
53 Ga0070667_100005451 3300005367 Bacteria 10627
54 Ga0070667_100162598 3300005367 Bacteria 1967
55 Ga0070714_100125240 3300005435 Bacteria 2290
56 Ga0070711_100176618 3300005439 Bacteria 1632
57 Ga0070705_100093787 3300005440 Bacteria 1878
58 Ga0070663_100005315 3300005455 Bacteria 7641
59 Ga0070678_100003476 3300005456 Bacteria 8779
60 Ga0070662_100002384 3300005457 Bacteria 11544
61 Ga0070681_10000746 3300005458 Bacteria 27005
62 Ga0068867_100008363 3300005459 Bacteria 7301
63 Ga0068867_100029996 3300005459 Bacteria 3922
64 Ga0070685_10000002 3300005466 Bacteria 295205
65 Ga0070685_10020498 3300005466 Bacteria 3577
66 Ga0070706_100108730 3300005467 Bacteria 2580
67 Ga0070706_100309292 3300005467 Bacteria 1474
68 Ga0070707_100425834 3300005468 Bacteria 1288
69 Ga0070698_100066406 3300005471 Bacteria 3631
70 Ga0070698_100104724 3300005471 Bacteria 2799
71 Ga0070679_100007841 3300005530 Bacteria 10010
72 Ga0068853_100002265 3300005539 Bacteria 14368
73 Ga0068853_100035764 3300005539 Bacteria 4220
74 Ga0068853_100043248 3300005539 Bacteria 3854
75 Ga0068853_100076250 3300005539 Bacteria 2927
76 Ga0070672_100013917 3300005543 Bacteria 5692
77 Ga0070672_100064851 3300005543 Bacteria 2887
78 Ga0070696_100061739 3300005546 Bacteria 2622
79 Ga0070693_100004068 3300005547 Bacteria 6885
80 Ga0070665_100002758 3300005548 Bacteria 19041
81 Ga0070665_100012190 3300005548 Bacteria 8668
82 Ga0070665_100074772 3300005548 Bacteria 3394
83 Ga0070704_100345089 3300005549 Bacteria 1255
84 Ga0068855_100001912 3300005563 Bacteria 25837
85 Ga0068855_100078234 3300005563 Bacteria 3837
86 Ga0070664_100027829 3300005564 Bacteria 4700
87 Ga0070664_100185300 3300005564 Bacteria 1852
88 Ga0068857_100004902 3300005577 Bacteria 11356
89 Ga0068857_100270444 3300005577 Bacteria 1562
90 Ga0068854_100002245 3300005578 Bacteria 11892
91 Ga0068854_100197870 3300005578 Bacteria 1578
92 Ga0068856_100002241 3300005614 Bacteria 19964
93 Ga0068852_100002292 3300005616 Bacteria 13161
94 Ga0068859_100011410 3300005617 Bacteria 8933
95 Ga0068859_100152228 3300005617 Bacteria 2388
96 Ga0068859_100215222 3300005617 Bacteria 2008
97 Ga0068864_100000219 3300005618 Bacteria 51801
98 Ga0068864_100170677 3300005618 Bacteria 1983
99 Ga0068861_100022703 3300005719 Bacteria 4524
100 Ga0068861_100047335 3300005719 Bacteria 3246
101 Ga0068861_100126034 3300005719 Bacteria 2072
102 Ga0068851_10002958 3300005834 Bacteria 7511
103 Ga0068851_10094263 3300005834 Bacteria 1580
104 Ga0068863_100008937 3300005841 Bacteria 9782
105 Ga0068863_100039472 3300005841 Bacteria 4491
106 Ga0068863_100066373 3300005841 Bacteria 3413
107 Ga0068863_100093670 3300005841 Bacteria 2851
108 Ga0068858_100056739 3300005842 Bacteria 3619
109 Ga0068858_100402127 3300005842 Bacteria 1316
110 Ga0068860_100000015 3300005843 Bacteria 313639
111 Ga0068860_100001564 3300005843 Bacteria 24652
112 Ga0068860_100051949 3300005843 Bacteria 3899
113 Ga0068860_100133889 3300005843 Bacteria 2380
114 Ga0068860_100146437 3300005843 Bacteria 2273
115 Ga0068862_100001673 3300005844 Bacteria 20087
116 Ga0068862_100006372 3300005844 Bacteria 9813
117 Ga0068862_100088433 3300005844 Bacteria 2695
118 Ga0068862_100120093 3300005844 Bacteria 2316
119 Ga0081455_10000391 3300005937 Bacteria 57931
120 Ga0081540_1003425 3300005983 Bacteria 12542
121 Ga0081539_10000203 3300005985 Bacteria 138096
122 Ga0081539_10000316 3300005985 Bacteria 107841
123 Ga0075368_10052603 3300006042 Bacteria 1620
124 Ga0075363_100000506 3300006048 Bacteria 12473
125 Ga0075363_100053469 3300006048 Bacteria 2158
126 Ga0075363_100057444 3300006048 Bacteria 2088
127 Ga0075362_10013292 3300006177 Bacteria 3293
128 Ga0075367_10048860 3300006178 Bacteria 2493
129 Ga0075369_10019359 3300006186 Bacteria 2779
130 Ga0075366_10120826 3300006195 Bacteria 1579
131 Ga0097621_100028254 3300006237 Bacteria 4421
132 Ga0075370_10025155 3300006353 Bacteria 3291
133 Ga0075428_100169101 3300006844 Bacteria 2371
134 Ga0075431_100032041 3300006847 Bacteria 5417
135 Ga0075431_100033531 3300006847 Bacteria 5291
136 Ga0075431_100138743 3300006847 Bacteria 2506
137 Ga0075429_100058235 3300006880 Bacteria 3364
138 Ga0068865_100041090 3300006881 Bacteria 3146
139 Ga0097620_100011410 3300006931 Bacteria 8933
140 Ga0097620_100152237 3300006931 Bacteria 2388
141 Ga0097620_100215225 3300006931 Bacteria 2008
142 Ga0079104_1000294 3300006946 Bacteria 63150
143 Ga0075435_100147607 3300007076 Bacteria 1976
144 Ga0099794_10000703 3300007265 Bacteria 11248
145 Ga0099794_10023616 3300007265 Bacteria 2815
146 Ga0099795_10002134 3300007788 Bacteria 4559
147 Ga0099795_10038661 3300007788 Bacteria 1685
148 Ga0105244_10004592 3300009036 Bacteria 9453
149 Ga0105240_10009713 3300009093 Bacteria 13584
150 Ga0105240_10017325 3300009093 Bacteria 9712
151 Ga0105240_10021363 3300009093 Bacteria 8610
152 Ga0105240_10080085 3300009093 Bacteria 4018
153 Ga0111539_10130613 3300009094 Bacteria 2941
154 Ga0111539_10150922 3300009094 Bacteria 2720
155 Ga0111539_10226551 3300009094 Bacteria 2177
156 Ga0105245_10001099 3300009098 Bacteria 24505
157 Ga0105247_10026286 3300009101 Bacteria 3514
158 Ga0114129_10000523 3300009147 Bacteria 46856
159 Ga0105243_10000293 3300009148 Bacteria 55165
160 Ga0105241_10014586 3300009174 Bacteria 5754
161 Ga0105248_10000851 3300009177 Bacteria 34362
162 Ga0105248_10022168 3300009177 Bacteria 7041
163 Ga0105248_10096218 3300009177 Bacteria 3335
164 Ga0105248_10123808 3300009177 Bacteria 2916
165 Ga0105237_10053764 3300009545 Bacteria 4038
166 Ga0105237_10196031 3300009545 Bacteria 2020
167 Ga0105237_10235451 3300009545 Bacteria 1832
168 Ga0105238_10000493 3300009551 Bacteria 41482
169 Ga0105238_10006619 3300009551 Bacteria 11548
170 Ga0105249_10018235 3300009553 Bacteria 6238
171 Ga0105249_10031571 3300009553 Bacteria 4791
172 Ga0105249_10070334 3300009553 Bacteria 3230
173 Ga0105249_10306810 3300009553 Bacteria 1594
174 Ga0099796_10000651 3300010159 Bacteria 6047
175 Ga0105239_10055846 3300010375 Bacteria 4332
176 Ga0157373_10044194 3300013100 Bacteria 3181
177 Ga0157371_10004600 3300013102 Bacteria 11980
178 Ga0157370_10124958 3300013104 Bacteria 2402
179 Ga0157369_10026347 3300013105 Bacteria 6450
180 Ga0171462_1013 3300013250 Bacteria 202864
181 Ga0157378_10009277 3300013297 Bacteria 8571
182 Ga0157378_10175857 3300013297 Bacteria 2011
183 Ga0163162_10234112 3300013306 Bacteria 1968
184 Ga0157372_10072967 3300013307 Bacteria 3868
185 Ga0157375_10005737 3300013308 Bacteria 10800
186 Ga0157375_10051189 3300013308 Bacteria 4055
187 Ga0157375_10404997 3300013308 Bacteria 1531
188 Ga0163163_10004461 3300014325 Bacteria 11936
189 Ga0182008_10124288 3300014497 Bacteria 1283
190 Ga0157379_10157466 3300014968 Bacteria 2049
191 Ga0157379_10297689 3300014968 Bacteria 1470
192 Ga0157379_10409934 3300014968 Bacteria 1247
193 Ga0157376_10132038 3300014969 Bacteria 2230
194 Ga0157376_10270986 3300014969 Bacteria 1595
195 Ga0183361_10003 3300016635 Bacteria 577277
196 Ga0163161_10037715 3300017792 Bacteria 3465
197 Ga0213872_10000019 3300021361 Bacteria 172803
198 Ga0213872_10001794 3300021361 Bacteria 13382
199 Ga0213872_10003169 3300021361 Bacteria 9226
200 Ga0213874_10024099 3300021377 Bacteria 1703
201 Ga0213874_10038923 3300021377 Bacteria 1414
202 Ga0213876_10000611 3300021384 Bacteria 26400
203 Ga0213875_10001414 3300021388 Bacteria 15605
204 Ga0213875_10003941 3300021388 Bacteria 8290
205 Ga0213875_10007514 3300021388 Bacteria 5619
206 Ga0209437_103668 3300025233 Bacteria 2750
207 Ga0209646_1000007 3300025246 Bacteria 670994
208 Ga0209565_1000003 3300025263 Bacteria 1099648
209 Ga0209673_1000003 3300025273 Bacteria 980859
210 Ga0209675_1000003 3300025291 Bacteria 1003982
211 Ga0209675_1000909 3300025291 Bacteria 18906
212 Ga0209675_1016544 3300025291 Bacteria 2142
213 Ga0209676_1000267 3300025292 Bacteria 109237
214 Ga0209025_1000063 3300025294 Bacteria 303962
215 Ga0209564_1000002 3300025295 Bacteria 1636803
216 Ga0209564_1000007 3300025295 Bacteria 1028582
217 Ga0209564_1000012 3300025295 Bacteria 792078
218 Ga0209564_1000043 3300025295 Bacteria 388153
219 Ga0209564_1000052 3300025295 Bacteria 356578
220 Ga0209050_1000915 3300025298 Bacteria 38980
221 Ga0209050_1000916 3300025298 Bacteria 38869
222 Ga0209050_1010784 3300025298 Bacteria 4448
223 Ga0209256_1000036 3300025299 Bacteria 386664
224 Ga0209256_1000172 3300025299 Bacteria 129025
225 Ga0209256_1000697 3300025299 Bacteria 44617
226 Ga0209051_1000230 3300025303 Bacteria 94027
227 Ga0209051_1000379 3300025303 Bacteria 63486
228 Ga0209257_1000141 3300025304 Bacteria 201130
229 Ga0209257_1000676 3300025304 Bacteria 53204
230 Ga0209257_1028785 3300025304 Bacteria 1823
231 Ga0207656_10010386 3300025321 Bacteria 3487
232 Ga0207656_10066613 3300025321 Bacteria 1592
233 Ga0207682_10000061 3300025893 Bacteria 46850
234 Ga0207642_10116554 3300025899 Bacteria 1370
235 Ga0207710_10150175 3300025900 Bacteria 1130
236 Ga0207680_10000489 3300025903 Bacteria 18801
237 Ga0207680_10031077 3300025903 Bacteria 3021
238 Ga0207680_10107901 3300025903 Bacteria 1800
239 Ga0207647_10000817 3300025904 Bacteria 24192
240 Ga0207645_10003267 3300025907 Bacteria 12380
241 Ga0207645_10036693 3300025907 Bacteria 3147
242 Ga0207643_10015602 3300025908 Bacteria 4136
243 Ga0207705_10072679 3300025909 Bacteria 2495
244 Ga0207684_10068853 3300025910 Bacteria 3008
245 Ga0207684_10263923 3300025910 Bacteria 1486
246 Ga0207695_10037969 3300025913 Bacteria 5192
247 Ga0207695_10067720 3300025913 Bacteria 3661
248 Ga0207695_10068557 3300025913 Bacteria 3634
249 Ga0207662_10081503 3300025918 Bacteria 1975
250 Ga0207649_10020345 3300025920 Bacteria 3805
251 Ga0207681_10007036 3300025923 Bacteria 6905
252 Ga0207681_10075811 3300025923 Bacteria 2360
253 Ga0207694_10000397 3300025924 Bacteria 40466
254 Ga0207694_10063477 3300025924 Bacteria 2877
255 Ga0207650_10000002 3300025925 Bacteria 1439222
256 Ga0207650_10060737 3300025925 Bacteria 2821
257 Ga0207659_10146894 3300025926 Bacteria 1837
258 Ga0207659_10163884 3300025926 Bacteria 1748
259 Ga0207687_10002035 3300025927 Bacteria 13862
260 Ga0207644_10000372 3300025931 Bacteria 29326
261 Ga0207644_10005509 3300025931 Bacteria 8244
262 Ga0207644_10039648 3300025931 Bacteria 3325
263 Ga0207644_10089089 3300025931 Bacteria 2296
264 Ga0207706_10000744 3300025933 Bacteria 33884
265 Ga0207706_10009544 3300025933 Bacteria 8910
266 Ga0207706_10042045 3300025933 Bacteria 4050
267 Ga0207706_10231483 3300025933 Bacteria 1617
268 Ga0207706_10279438 3300025933 Bacteria 1456
269 Ga0207709_10000076 3300025935 Bacteria 173292
270 Ga0207704_10052278 3300025938 Bacteria 2476
271 Ga0207691_10000016 3300025940 Bacteria 141024
272 Ga0207691_10024116 3300025940 Bacteria 5721
273 Ga0207711_10002050 3300025941 Bacteria 18223
274 Ga0207711_10003955 3300025941 Bacteria 12744
275 Ga0207689_10105939 3300025942 Bacteria 2310
276 Ga0207679_10088532 3300025945 Bacteria 2387
277 Ga0207679_10137793 3300025945 Bacteria 1968
278 Ga0207667_10051563 3300025949 Bacteria 4337
279 Ga0207667_10098298 3300025949 Bacteria 3020
280 Ga0207651_10029503 3300025960 Bacteria 3476
281 Ga0207712_10019361 3300025961 Bacteria 4444
282 Ga0207712_10026403 3300025961 Bacteria 3869
283 Ga0207668_10010412 3300025972 Bacteria 5617
284 Ga0207668_10049405 3300025972 Bacteria 2891
285 Ga0207640_10065584 3300025981 Bacteria 2423
286 Ga0207658_10000001 3300025986 Bacteria 1439333
287 Ga0207658_10001061 3300025986 Bacteria 22224
288 Ga0207658_10005073 3300025986 Bacteria 9059
289 Ga0207658_10025287 3300025986 Bacteria 4157
290 Ga0207658_10130949 3300025986 Bacteria 2015
291 Ga0207658_10361965 3300025986 Bacteria 1266
292 Ga0207703_10067840 3300026035 Bacteria 2937
293 Ga0207703_10092071 3300026035 Bacteria 2551
294 Ga0207639_10000632 3300026041 Bacteria 24237
295 Ga0207639_10037373 3300026041 Bacteria 3606
296 Ga0207639_10061248 3300026041 Bacteria 2905
297 Ga0207639_10062057 3300026041 Bacteria 2889
298 Ga0207678_10000914 3300026067 Bacteria 27005
299 Ga0207678_10013650 3300026067 Bacteria 7134
300 Ga0207702_10001373 3300026078 Bacteria 24259
301 Ga0207702_10020598 3300026078 Bacteria 5459
302 Ga0207641_10008740 3300026088 Bacteria 8367
303 Ga0207641_10050012 3300026088 Bacteria 3535
304 Ga0207641_10224594 3300026088 Bacteria 1743
305 Ga0207648_10004401 3300026089 Bacteria 14473
306 Ga0207648_10005187 3300026089 Bacteria 13193
307 Ga0207676_10000001 3300026095 Bacteria 1439222
308 Ga0207676_10014847 3300026095 Bacteria 5611
309 Ga0207676_10181994 3300026095 Bacteria 1841
310 Ga0207676_10208096 3300026095 Bacteria 1733
311 Ga0207676_10395469 3300026095 Bacteria 1290
312 Ga0207674_10001538 3300026116 Bacteria 29722
313 Ga0207674_10021564 3300026116 Bacteria 6935
314 Ga0207675_100039056 3300026118 Bacteria 4430
315 Ga0207675_100056394 3300026118 Bacteria 3664
316 Ga0207675_100160883 3300026118 Bacteria 2141
317 Ga0207683_10000322 3300026121 Bacteria 43758
318 Ga0207683_10175467 3300026121 Bacteria 1942
319 Ga0209281_1000423 3300027111 Bacteria 63126
320 Ga0209179_1000828 3300027512 Bacteria 3412
321 Ga0268266_10007343 3300028379 Bacteria 9955
322 Ga0268266_10009218 3300028379 Bacteria 8707
323 Ga0268266_10013731 3300028379 Bacteria 6975
324 Ga0268266_10023392 3300028379 Bacteria 5262
325 Ga0268266_10121103 3300028379 Bacteria 2329
326 Ga0268265_10083838 3300028380 Bacteria 2525
327 Ga0268265_10084293 3300028380 Bacteria 2519
328 Ga0268265_10356246 3300028380 Bacteria 1338
329 Ga0268264_10000002 3300028381 Bacteria 1153045
330 Ga0268264_10000004 3300028381 Bacteria 1116842
331 Ga0268264_10000014 3300028381 Bacteria 509962
332 Ga0268264_10009680 3300028381 Bacteria 7983
333 Ga0268264_10042701 3300028381 Bacteria 3754
334 Ga0307515_10000006 3300028794 Bacteria 725810
335 Ga0307515_10063025 3300028794 Bacteria 5221
336 Ga0307511_10000025 3300030521 Bacteria 112344
337 Ga0316177_1212761 3300030731 Bacteria 3251
338 Ga0265325_10005792 3300031241 Bacteria 7577
339 Ga0265340_10144815 3300031247 Bacteria 1085
340 Ga0265339_10010596 3300031249 Bacteria 5720
341 Ga0265327_10001131 3300031251 Bacteria 36638
342 Ga0265327_10008872 3300031251 Bacteria 7389
343 Ga0265327_10010715 3300031251 Bacteria 6405
344 Ga0307408_100060395 3300031548 Bacteria 2763
345 Ga0307408_100075499 3300031548 Bacteria 2504
346 Ga0265313_10040486 3300031595 Bacteria 2303
347 Ga0265314_10029756 3300031711 Bacteria 4055
348 Ga0316576_10124408 3300031727 Bacteria 1937
349 Ga0316576_10267391 3300031727 Unclassified 1282
350 Ga0316578_10053225 3300031728 Bacteria 2371
351 Ga0307516_10046623 3300031730 Bacteria 4275
352 Ga0307405_10033113 3300031731 Bacteria 3061
353 Ga0307405_10140183 3300031731 Bacteria 1684
354 Ga0316577_10019978 3300031733 Bacteria 3710
355 Ga0307413_10110899 3300031824 Bacteria 1836
356 Ga0307518_10222053 3300031838 Bacteria 1232
357 Ga0307410_10137388 3300031852 Bacteria 1803
358 Ga0307410_10173092 3300031852 Bacteria 1628
359 Ga0307406_10012195 3300031901 Bacteria 4896
360 Ga0307406_10091859 3300031901 Bacteria 2046
361 Ga0307407_10005506 3300031903 Bacteria 5503
362 Ga0307412_10024218 3300031911 Bacteria 3745
363 Ga0307412_10168454 3300031911 Bacteria 1635
364 Ga0307409_100005750 3300031995 Bacteria 7188
365 Ga0307414_10026730 3300032004 Bacteria 3719
366 Ga0307414_10094848 3300032004 Bacteria 2228
367 Ga0307415_100273674 3300032126 Bacteria 1384
368 Ga0307507_10035925 3300033179 Bacteria 5077
369 Ga0307510_10001839 3300033180 Bacteria 23770
370 Ga0307510_10039902 3300033180 Bacteria 5163
371 Ga0307510_10202941 3300033180 Bacteria 1515
372 Ga0373926_0014404 3300035083 Bacteria 2688
373 Ga0373923_0009335 3300035111 Bacteria 3537
374 Ga0373936_0017021 3300035113 Bacteria 2795
375 Ga0373936_0068214 3300035113 Bacteria 1462
376 Ga0373945_0026017 3300035116 Bacteria 2036
377 Ga0373943_0003641 3300035170 Bacteria 7005
378 Ga0373946_0002251 3300035171 Bacteria 6811
379 Ga0373946_0007659 3300035171 Bacteria 3955
380 Ga0373955_0040066 3300035172 Bacteria 2503
381 Ga0373924_0039566 3300035410 Bacteria 1927
382 Ga0373931_0016354 3300035691 Bacteria 3651
383 Ga0373935_0004899 3300035692 Bacteria 7870
384 Ga0373935_0019897 3300035692 Bacteria 4097
385 Ga0373935_0056067 3300035692 Bacteria 2511
386 Ga0373927_0002255 3300035695 Bacteria 14135
387 Ga0373927_0002256 3300035695 Bacteria 14126
388 Ga0373947_0001432 3300035725 Bacteria 14679
389 Ga0373947_0204067 3300035725 Bacteria 1294
390 Ga0316584_0016657 3300036712 Bacteria 5272
391 Ga0373925_0000104 3300037068 Bacteria 91673
392 Ga0373925_0000976 3300037068 Bacteria 26036
393 Ga0373925_0075408 3300037068 Bacteria 2555
394 Ga0395899_0000361 3300037312 Bacteria 55292
395 Ga0395899_0013123 3300037312 Bacteria 6337
396 Ga0395899_0262044 3300037312 Unclassified 1182
397 Ga0395900_0000046 3300037418 Bacteria 230114
398 Ga0395900_0000237 3300037418 Bacteria 86507
399 Ga0395900_0064772 3300037418 Bacteria 3755
400 Ga0395900_0166403 3300037418 Bacteria 2247
401 Ga0395900_0190827 3300037418 Bacteria 2078
402 Ga0395900_0296593 3300037418 Bacteria 1604
403 Ga0395905_0000498 3300037471 Bacteria 53933
404 Ga0395905_0087405 3300037471 Bacteria 2922
405 Ga0395905_0124786 3300037471 Bacteria 2421
406 Ga0395905_0167522 3300037471 Bacteria 2064
407 Ga0395905_0173861 3300037471 Bacteria 2022
408 Ga0395905_0187495 3300037471 Bacteria 1941
409 Ga0395905_0315121 3300037471 Bacteria 1453
410 Ga0436364_0473640 3300037853 Bacteria 15605
411 Ga0436364_0563933 3300037853 Bacteria 17439
412 Ga0436364_0786035 3300037853 Bacteria 3970
413 Ga0436364_0804800 3300037853 Bacteria 21862
414 Ga0395901_0000028 3300038443 Bacteria 242653
415 Ga0395901_0100110 3300038443 Bacteria 3040
416 Ga0395901_0452827 3300038443 Bacteria 1312
417 Ga0400483_068090 3300039062 Bacteria 1885
418 Ga0436365_1595143 3300039437 Bacteria 26401
419 Ga0436360_0787362 3300039438 Bacteria 1673
420 Ga0436361_0075382 3300039447 Bacteria 4523
421 Ga0436361_0330198 3300039447 Bacteria 18763
422 Ga0436361_0352948 3300039447 Bacteria 62639
423 Ga0436361_0635819 3300039447 Bacteria 1362
424 Ga0436361_1127083 3300039447 Bacteria 3115
425 Ga0436363_0240244 3300039450 Bacteria 4335
426 Ga0436363_1348059 3300039450 Bacteria 4809
427 Ga0439441_005803 3300042001 Bacteria 1933
428 Ga0439449_0054328 3300042007 Bacteria 1480
429 Ga0450904_000658 3300042139 Bacteria 6256
430 Ga0451577_0001960 3300042876 Bacteria 25893
431 Ga0451577_0034963 3300042876 Bacteria 4528
432 Ga0451577_0040418 3300042876 Bacteria 4187
433 Ga0453683_0262854 3300044673 Bacteria 1101
434 Ga0466965_0112314 3300044683 Bacteria 1401
435 Ga0466966_0002584 3300044684 Bacteria 11864
436 Ga0451576_0000025 3300045051 Bacteria 427980
437 Ga0495617_000060 3300046452 Bacteria 97123
438 Ga0495617_000072 3300046452 Bacteria 80951
439 Ga0495617_018523 3300046452 Bacteria 2354
440 Ga0495627_000272 3300046453 Bacteria 52368
441 Ga0495627_000489 3300046453 Bacteria 33226
442 Ga0495603_0069937 3300046455 Bacteria 2064
443 Ga0495603_0125092 3300046455 Bacteria 1498
444 Ga0495590_0000005 3300046457 Bacteria 384276
445 Ga0495590_0000008 3300046457 Bacteria 330520
446 Ga0495590_0000424 3300046457 Bacteria 21300
447 Ga0495590_0000562 3300046457 Bacteria 17639
448 Ga0495590_0010969 3300046457 Bacteria 3396
449 Ga0495591_000051 3300046458 Bacteria 137457
450 Ga0495629_0000365 3300046459 Bacteria 38312
451 Ga0495629_0027120 3300046459 Bacteria 4069
452 Ga0495629_0055488 3300046459 Bacteria 2770
453 Ga0495629_0067560 3300046459 Bacteria 2494
454 Ga0495638_0000027 3300046460 Bacteria 337569
455 Ga0495638_0001965 3300046460 Bacteria 17609
456 Ga0495638_0003652 3300046460 Bacteria 12000
457 Ga0495641_0045723 3300046461 Bacteria 2015
458 Ga0495653_0000880 3300046463 Bacteria 23178
459 Ga0495653_0008489 3300046463 Bacteria 8422
460 Ga0495653_0009298 3300046463 Bacteria 8041
461 Ga0495653_0015205 3300046463 Bacteria 6273
462 Ga0495653_0136800 3300046463 Bacteria 1727
463 Ga0495653_0189182 3300046463 Bacteria 1406
464 Ga0495650_0000044 3300046471 Bacteria 355139
465 Ga0495650_0000185 3300046471 Bacteria 136913
466 Ga0495650_0000323 3300046471 Bacteria 85563
467 Ga0495650_0002258 3300046471 Bacteria 16098
468 Ga0495650_0003969 3300046471 Bacteria 10397
469 Ga0495650_0005067 3300046471 Bacteria 8716
470 Ga0495650_0055439 3300046471 Bacteria 1613
471 Ga0495580_0003410 3300046472 Bacteria 13548
472 Ga0495580_0006376 3300046472 Bacteria 9624
473 Ga0495582_0090689 3300046473 Bacteria 1704
474 Ga0495605_0000049 3300046474 Bacteria 166669
475 Ga0495605_0017778 3300046474 Bacteria 3822
476 Ga0495605_0019852 3300046474 Bacteria 3580
477 Ga0495639_0006411 3300046475 Bacteria 5062
478 Ga0495662_0067417 3300046476 Bacteria 1732
479 Ga0495664_0002204 3300046477 Bacteria 10434
480 Ga0495664_0028490 3300046477 Bacteria 3261
481 Ga0495584_0000001 3300046491 Bacteria 649329
482 Ga0495584_0000024 3300046491 Bacteria 117259
483 Ga0495584_0001263 3300046491 Bacteria 15400
484 Ga0495584_0003873 3300046491 Bacteria 8108
485 Ga0495584_0009495 3300046491 Bacteria 5009
486 Ga0495585_0000040 3300046492 Bacteria 130615
487 Ga0495585_0002248 3300046492 Bacteria 13971
488 Ga0495585_0002439 3300046492 Bacteria 13331
489 Ga0495585_0036912 3300046492 Bacteria 2753
490 Ga0495585_0039002 3300046492 Bacteria 2672
491 Ga0495585_0059017 3300046492 Bacteria 2115
492 Ga0495585_0122419 3300046492 Bacteria 1375
493 Ga0495594_0046635 3300046499 Bacteria 2380
494 Ga0495594_0097782 3300046499 Bacteria 1649
495 Ga0495596_0000714 3300046500 Bacteria 20519
496 Ga0495596_0001374 3300046500 Bacteria 13962
497 Ga0495596_0008634 3300046500 Bacteria 4523
498 Ga0495596_0010135 3300046500 Bacteria 4118
499 Ga0495596_0010676 3300046500 Bacteria 3991
500 Ga0495596_0012118 3300046500 Bacteria 3700
501 Ga0495596_0037335 3300046500 Bacteria 1921
502 Ga0495607_0000473 3300046501 Bacteria 40325
503 Ga0495607_0000984 3300046501 Bacteria 26388
504 Ga0495607_0003885 3300046501 Bacteria 11256
505 Ga0495607_0031534 3300046501 Bacteria 3244
506 Ga0495607_0055116 3300046501 Bacteria 2288
507 Ga0495607_0064406 3300046501 Bacteria 2070
508 Ga0495583_0000055 3300046506 Bacteria 201245
509 Ga0495583_0000100 3300046506 Bacteria 145745
510 Ga0495583_0000117 3300046506 Bacteria 135061
511 Ga0495583_0000314 3300046506 Bacteria 76522
512 Ga0495583_0000792 3300046506 Bacteria 39204
513 Ga0495583_0001305 3300046506 Bacteria 25935
514 Ga0495583_0003790 3300046506 Bacteria 11230
515 Ga0495583_0036350 3300046506 Bacteria 2344
516 Ga0495583_0038279 3300046506 Bacteria 2266
517 Ga0495583_0039360 3300046506 Bacteria 2228
518 Ga0495606_0000053 3300046507 Bacteria 200818
519 Ga0495606_0000059 3300046507 Bacteria 186886
520 Ga0495606_0004757 3300046507 Bacteria 13358
521 Ga0495606_0008214 3300046507 Bacteria 9125
522 Ga0495606_0013949 3300046507 Bacteria 6305
523 Ga0495606_0019668 3300046507 Bacteria 5011
524 Ga0495606_0044306 3300046507 Bacteria 2960
525 Ga0495606_0075230 3300046507 Bacteria 2113
526 Ga0495606_0117201 3300046507 Bacteria 1598
527 Ga0495606_0125542 3300046507 Bacteria 1531
528 Ga0495610_0000008 3300046512 Bacteria 622732
529 Ga0495610_0000556 3300046512 Bacteria 37327
530 Ga0495610_0000771 3300046512 Bacteria 30226
531 Ga0495610_0002195 3300046512 Bacteria 16525
532 Ga0495610_0007885 3300046512 Bacteria 6996
533 Ga0495610_0022630 3300046512 Bacteria 3433
534 Ga0495610_0039922 3300046512 Bacteria 2370
535 Ga0495616_0000035 3300046513 Bacteria 128636
536 Ga0495616_0000080 3300046513 Bacteria 81238
537 Ga0495616_0003689 3300046513 Bacteria 9782
538 Ga0495616_0011085 3300046513 Bacteria 5180
539 Ga0495616_0011853 3300046513 Bacteria 4969
540 Ga0495616_0023409 3300046513 Bacteria 3322
541 Ga0495616_0035134 3300046513 Bacteria 2596
542 Ga0495618_0080682 3300046514 Bacteria 2076
543 Ga0495620_0000351 3300046515 Bacteria 31904
544 Ga0495628_0003503 3300046516 Bacteria 14044
545 Ga0495628_0028044 3300046516 Bacteria 4579
546 Ga0495630_0002597 3300046517 Bacteria 12524
547 Ga0495630_0074389 3300046517 Bacteria 2558
548 Ga0495630_0084314 3300046517 Bacteria 2399
549 Ga0495631_0003168 3300046518 Bacteria 9050
550 Ga0495631_0008273 3300046518 Bacteria 5244
551 Ga0495631_0011965 3300046518 Bacteria 4254
552 Ga0495631_0018765 3300046518 Bacteria 3252
553 Ga0495631_0019353 3300046518 Bacteria 3193
554 Ga0495631_0026730 3300046518 Bacteria 2646
555 Ga0495631_0026941 3300046518 Bacteria 2634
556 Ga0495631_0036889 3300046518 Bacteria 2180
557 Ga0495632_0000044 3300046519 Bacteria 141051
558 Ga0495632_0000066 3300046519 Bacteria 115170
559 Ga0495632_0000285 3300046519 Bacteria 49299
560 Ga0495632_0011220 3300046519 Bacteria 5243
561 Ga0495632_0095856 3300046519 Bacteria 1401
562 Ga0495637_0000009 3300046520 Bacteria 402028
563 Ga0495637_0000189 3300046520 Bacteria 48390
564 Ga0495637_0007240 3300046520 Bacteria 5518
565 Ga0495637_0009788 3300046520 Bacteria 4664
566 Ga0495643_0000022 3300046522 Bacteria 289691
567 Ga0495643_0000094 3300046522 Bacteria 150795
568 Ga0495643_0026589 3300046522 Bacteria 3263
569 Ga0495643_0056149 3300046522 Bacteria 2103
570 Ga0495643_0065384 3300046522 Bacteria 1920
571 Ga0495644_0006445 3300046523 Bacteria 4547
572 Ga0495644_0007635 3300046523 Bacteria 4169
573 Ga0495644_0010658 3300046523 Bacteria 3540
574 Ga0495644_0011124 3300046523 Bacteria 3468
575 Ga0495648_0000411 3300046524 Bacteria 47243
576 Ga0495648_0001558 3300046524 Bacteria 22405
577 Ga0495648_0005347 3300046524 Bacteria 10699
578 Ga0495648_0019087 3300046524 Bacteria 4834
579 Ga0495648_0021267 3300046524 Bacteria 4498
580 Ga0495648_0025112 3300046524 Bacteria 4039
581 Ga0495648_0032359 3300046524 Bacteria 3433
582 Ga0495648_0045189 3300046524 Bacteria 2742
583 Ga0495648_0063905 3300046524 Bacteria 2170
584 Ga0495663_0004172 3300046525 Bacteria 4083
585 Ga0495663_0022815 3300046525 Bacteria 1810
586 Ga0495663_0035034 3300046525 Bacteria 1506
587 Ga0495666_0004909 3300046526 Bacteria 6765
588 Ga0495666_0007197 3300046526 Bacteria 5586
589 Ga0495666_0017775 3300046526 Bacteria 3541
590 Ga0495642_0000012 3300046528 Bacteria 127229
591 Ga0495642_0002273 3300046528 Bacteria 7846
592 Ga0495642_0014066 3300046528 Bacteria 3101
593 Ga0495642_0016372 3300046528 Bacteria 2889
594 Ga0495642_0018803 3300046528 Bacteria 2705
595 Ga0495642_0109106 3300046528 Bacteria 1182
596 Ga0495652_0018714 3300046529 Bacteria 6173
597 Ga0495652_0020109 3300046529 Bacteria 5937
598 Ga0495652_0030202 3300046529 Bacteria 4755
599 Ga0495654_0000002 3300046530 Bacteria 1021205
600 Ga0495654_0011218 3300046530 Bacteria 4860
601 Ga0495654_0061171 3300046530 Bacteria 1809
602 Ga0495665_0000097 3300046531 Bacteria 40415
603 Ga0495665_0015244 3300046531 Bacteria 4141
604 Ga0495665_0065446 3300046531 Bacteria 1919
605 Ga0495665_0125272 3300046531 Bacteria 1345
606 Ga0495665_0146228 3300046531 Bacteria 1234
607 Ga0495640_0002599 3300046533 Bacteria 14518
608 Ga0495640_0064218 3300046533 Bacteria 2483
609 Ga0495586_0003981 3300046535 Bacteria 7924
610 Ga0495587_0016570 3300046536 Bacteria 4584
611 Ga0495587_0026273 3300046536 Bacteria 3551
612 Ga0495609_0000177 3300046538 Bacteria 64469
613 Ga0495609_0000981 3300046538 Bacteria 20439
614 Ga0495609_0001757 3300046538 Bacteria 13913
615 Ga0495609_0008006 3300046538 Bacteria 5218
616 Ga0495609_0021747 3300046538 Bacteria 2959
617 Ga0495609_0079108 3300046538 Bacteria 1438
618 Ga0495597_0000009 3300046542 Bacteria 227319
619 Ga0495597_0000055 3300046542 Bacteria 95175
620 Ga0495597_0000672 3300046542 Bacteria 27772
621 Ga0495597_0005908 3300046542 Bacteria 6392
622 Ga0495597_0011159 3300046542 Bacteria 4361
623 Ga0495597_0015727 3300046542 Bacteria 3580
624 Ga0495597_0016538 3300046542 Bacteria 3482
625 Ga0495645_0002089 3300046543 Bacteria 13565
626 Ga0495645_0019718 3300046543 Bacteria 4857
627 Ga0495645_0039510 3300046543 Bacteria 3441
628 Ga0495622_0000009 3300046557 Bacteria 224622
629 Ga0495622_0000128 3300046557 Bacteria 65352
630 Ga0495633_0000050 3300046558 Bacteria 155466
631 Ga0495633_0012260 3300046558 Bacteria 4570
632 Ga0495633_0030058 3300046558 Bacteria 2640
633 Ga0495633_0057903 3300046558 Bacteria 1819
634 Ga0495633_0073416 3300046558 Bacteria 1594
635 Ga0495667_0103145 3300046559 Bacteria 1845
636 Ga0495656_0014920 3300046615 Bacteria 2922
637 Ga0495668_0000006 3300046616 Bacteria 553404
638 Ga0495668_0000027 3300046616 Bacteria 297194
639 Ga0495668_0000350 3300046616 Bacteria 61356
640 Ga0495668_0000353 3300046616 Bacteria 61110
641 Ga0495668_0001625 3300046616 Bacteria 20999
642 Ga0495668_0007466 3300046616 Bacteria 6986
643 Ga0495668_0023465 3300046616 Bacteria 3517
644 Ga0495668_0063250 3300046616 Bacteria 2038
645 Ga0495668_0082766 3300046616 Bacteria 1760
646 Ga0495668_0105224 3300046616 Bacteria 1543
647 Ga0495634_0014394 3300046642 Bacteria 5706
648 Ga0495634_0079051 3300046642 Bacteria 2154
649 Ga0495611_0000311 3300046648 Bacteria 32985
650 Ga0495611_0007917 3300046648 Bacteria 4511
651 Ga0495611_0027492 3300046648 Bacteria 2486
652 Ga0495611_0039772 3300046648 Bacteria 2094
653 Ga0495611_0041086 3300046648 Bacteria 2062
654 Ga0495625_0003531 3300046660 Bacteria 15480
655 Ga0495625_0005763 3300046660 Bacteria 11200
656 Ga0495625_0014914 3300046660 Bacteria 6180
657 Ga0495625_0039909 3300046660 Bacteria 3426
658 Ga0495625_0149651 3300046660 Bacteria 1570
659 Ga0495625_0238049 3300046660 Bacteria 1186
660 Ga0495659_0009489 3300046664 Bacteria 3107
661 Ga0495661_0000531 3300046665 Bacteria 39271
662 Ga0495661_0033987 3300046665 Bacteria 3212
663 Ga0495661_0036495 3300046665 Bacteria 3077
664 Ga0495661_0051487 3300046665 Bacteria 2486
665 Ga0495661_0065344 3300046665 Bacteria 2144
666 Ga0495661_0075402 3300046665 Bacteria 1960
667 Ga0495661_0086346 3300046665 Bacteria 1796
668 Ga0495661_0181877 3300046665 Bacteria 1113
669 Ga0495588_0029914 3300046674 Bacteria 2734
670 Ga0495588_0062678 3300046674 Bacteria 1927
671 Ga0495588_0091777 3300046674 Bacteria 1591
672 Ga0495599_0066007 3300046678 Bacteria 2261
673 Ga0495623_0003969 3300046679 Bacteria 9738
674 Ga0495646_0006689 3300046680 Bacteria 7309
675 Ga0495647_0021282 3300046681 Bacteria 2334
676 Ga0495647_0064955 3300046681 Bacteria 1448
677 Ga0495669_0000017 3300046684 Bacteria 131447
678 Ga0495669_0005081 3300046684 Bacteria 5474
679 Ga0495669_0017390 3300046684 Bacteria 3086
680 Ga0495669_0024204 3300046684 Bacteria 2645
681 Ga0495669_0076352 3300046684 Bacteria 1533
682 Ga0495613_0038721 3300046689 Bacteria 3534
683 Ga0495613_0086690 3300046689 Bacteria 2270
684 Ga0495624_0000316 3300046690 Bacteria 38401
685 Ga0495624_0004924 3300046690 Bacteria 9682
686 Ga0495624_0015579 3300046690 Bacteria 5130
687 Ga0495624_0054496 3300046690 Bacteria 2521
688 Ga0495670_0008894 3300046691 Bacteria 4939
689 Ga0495670_0020761 3300046691 Bacteria 3239
690 Ga0495670_0023483 3300046691 Bacteria 3043
691 Ga0495670_0025810 3300046691 Bacteria 2907
692 Ga0495671_0000002 3300046692 Bacteria 1136189
693 Ga0495671_0000469 3300046692 Bacteria 31566
694 Ga0495671_0013575 3300046692 Bacteria 4404
695 Ga0495649_0000546 3300046694 Bacteria 31916
696 Ga0495649_0020472 3300046694 Bacteria 3711
697 Ga0495649_0024363 3300046694 Bacteria 3375
698 Ga0495649_0026329 3300046694 Bacteria 3235
699 Ga0495649_0075244 3300046694 Bacteria 1808
700 Ga0495589_0000102 3300046794 Bacteria 82380
701 Ga0495589_0001114 3300046794 Bacteria 16022
702 Ga0495589_0016132 3300046794 Bacteria 3838
703 Ga0495589_0080051 3300046794 Bacteria 1589
704 Ga0495589_0080682 3300046794 Bacteria 1583
705 Ga0495589_0100900 3300046794 Bacteria 1396
706 Ga0495660_0003891 3300046810 Bacteria 9128
707 Ga0495660_0019284 3300046810 Bacteria 3916
708 Ga0495660_0020441 3300046810 Bacteria 3795
709 Ga0495660_0043022 3300046810 Bacteria 2493
710 Ga0495660_0070542 3300046810 Bacteria 1854
711 Ga0495581_0002330 3300047315 Bacteria 10701
712 Ga0495581_0006456 3300047315 Bacteria 6805
713 Ga0495581_0027224 3300047315 Bacteria 3315
714 Ga0495604_0012826 3300047317 Bacteria 6674
715 Ga0495604_0062580 3300047317 Bacteria 2842
716 Ga0495604_0090387 3300047317 Bacteria 2274
717 Ga0495636_0037515 3300047318 Bacteria 2001
718 Ga0495636_0112751 3300047318 Bacteria 1197
719 Ga0495674_0000923 3300047319 Bacteria 28086
720 Ga0495674_0003405 3300047319 Bacteria 15455
721 Ga0495674_0007608 3300047319 Bacteria 10351
722 Ga0495674_0012637 3300047319 Bacteria 7956
723 Ga0495674_0163125 3300047319 Bacteria 1863
724 Ga0495674_0193456 3300047319 Bacteria 1689
725 Ga0495672_0000131 3300047320 Bacteria 111562
726 Ga0495672_0000290 3300047320 Bacteria 69104
727 Ga0495672_0000738 3300047320 Bacteria 35882
728 Ga0495672_0001642 3300047320 Bacteria 21746
729 Ga0495672_0025534 3300047320 Bacteria 3778
730 Ga0495672_0087181 3300047320 Bacteria 1724
731 Ga0495676_0044397 3300047321 Bacteria 3628
732 Ga0495676_0135153 3300047321 Bacteria 1774
733 Ga0495680_0001842 3300047322 Bacteria 22357
734 Ga0495680_0006432 3300047322 Bacteria 10918
735 Ga0495680_0035667 3300047322 Bacteria 4004
736 Ga0495683_0000160 3300047323 Bacteria 65995
737 Ga0495683_0071165 3300047323 Bacteria 1707
738 Ga0495683_0104951 3300047323 Bacteria 1355
739 Ga0495687_000034 3300047443 Bacteria 257321
740 Ga0495687_000048 3300047443 Bacteria 205967
741 Ga0495687_000550 3300047443 Bacteria 44560
742 Ga0495687_001509 3300047443 Bacteria 21213
743 Ga0495687_005005 3300047443 Bacteria 8659
744 Ga0495675_0004046 3300047444 Bacteria 8887
745 Ga0495677_0000085 3300047445 Bacteria 48240
746 Ga0495677_0004620 3300047445 Bacteria 5255
747 Ga0495677_0005820 3300047445 Bacteria 4665
748 Ga0495677_0024761 3300047445 Bacteria 2177
749 Ga0495677_0035575 3300047445 Bacteria 1817
750 Ga0495677_0036393 3300047445 Bacteria 1798
751 Ga0495677_0057661 3300047445 Bacteria 1436
752 Ga0495677_0067032 3300047445 Bacteria 1335
753 Ga0495679_011256 3300047446 Bacteria 3465
754 Ga0495679_024963 3300047446 Bacteria 2005
755 Ga0495685_002522 3300047447 Bacteria 5746
756 Ga0495685_012896 3300047447 Bacteria 2833
757 Ga0495685_046097 3300047447 Bacteria 1483
758 Ga0495685_048914 3300047447 Bacteria 1437
759 Ga0495673_0000005 3300047469 Bacteria 943364
760 Ga0495673_0000059 3300047469 Bacteria 233234
761 Ga0495673_0000067 3300047469 Bacteria 219908
762 Ga0495673_0011100 3300047469 Bacteria 4866
763 Ga0495681_0000269 3300047470 Bacteria 41587
764 Ga0495681_0002027 3300047470 Bacteria 14779
765 Ga0495681_0073047 3300047470 Bacteria 1549
766 Ga0495684_0003539 3300047471 Bacteria 12218
767 Ga0495684_0018009 3300047471 Bacteria 5442
768 Ga0495684_0033143 3300047471 Bacteria 3964
769 Ga0495686_0000135 3300047472 Bacteria 148920
770 Ga0495686_0012055 3300047472 Bacteria 6073
771 Ga0495686_0020942 3300047472 Bacteria 4354
772 Ga0495686_0026380 3300047472 Bacteria 3801
773 Ga0495593_0000787 3300047673 Bacteria 18362
774 Ga0495593_0003596 3300047673 Bacteria 9258
775 Ga0495593_0006297 3300047673 Bacteria 6965
776 Ga0495593_0006547 3300047673 Bacteria 6819
777 Ga0495593_0008040 3300047673 Bacteria 6137
778 Ga0495602_0019299 3300048088 Bacteria 6774
779 Ga0495602_0049914 3300048088 Bacteria 3743
780 Ga0495614_0000655 3300048089 Bacteria 14492
781 Ga0495615_0000090 3300048090 Bacteria 26651
782 Ga0495626_0000015 3300048091 Bacteria 232238
783 Ga0495626_0002439 3300048091 Bacteria 12912
784 Ga0495626_0005763 3300048091 Bacteria 7145
785 Ga0495626_0012922 3300048091 Bacteria 4357
786 Ga0495626_0023280 3300048091 Bacteria 3052
787 Ga0495626_0052382 3300048091 Bacteria 1881
788 Ga0495626_0055004 3300048091 Bacteria 1826
789 Ga0495626_0114231 3300048091 Bacteria 1166
790 Ga0496100_0171307 3300048903 Bacteria 1563
791 Ga0496101_0062832 3300048904 Bacteria 2701
792 Ga0496102_0000101 3300048905 Bacteria 123198
793 Ga0496102_0000437 3300048905 Bacteria 47555
794 Ga0496102_0076585 3300048905 Bacteria 3077
795 Ga0496102_0106931 3300048905 Bacteria 2604
796 Ga0496103_0013818 3300048906 Bacteria 4793
797 Ga0496103_0033628 3300048906 Bacteria 3132
798 Ga0496103_0035675 3300048906 Bacteria 3045
799 Ga0496104_0013762 3300048907 Bacteria 7297
800 Ga0496105_0039366 3300048908 Bacteria 3896
801 Ga0496107_0094146 3300048910 Bacteria 2192
802 Ga0496109_0015097 3300048912 Bacteria 6723
803 Ga0496110_0000001 3300048913 Bacteria 232652
804 Ga0496110_0042658 3300048913 Bacteria 3960
805 Ga0496110_0193506 3300048913 Bacteria 1847
806 Ga0496110_0337279 3300048913 Bacteria 1373
807 Ga0496112_0021563 3300048915 Bacteria 6128
808 Ga0496113_0000447 3300048916 Bacteria 20018
809 Ga0496114_0016647 3300048917 Bacteria 5929
810 Ga0496114_0047896 3300048917 Bacteria 3555
811 Ga0496119_0042509 3300048922 Bacteria 2880
812 Ga0496120_0001365 3300048923 Bacteria 29928
813 Ga0496120_0021525 3300048923 Bacteria 4075
814 Ga0496121_0070897 3300048924 Bacteria 2804
815 Ga0496121_0137174 3300048924 Bacteria 1821
816 Ga0496121_0139723 3300048924 Bacteria 1799
817 Ga0496121_0194771 3300048924 Bacteria 1450
818 Ga0496122_0001169 3300048925 Bacteria 44889
819 Ga0496122_0004108 3300048925 Bacteria 18427
820 Ga0496122_0050551 3300048925 Bacteria 3169
821 Ga0496123_0001064 3300048926 Bacteria 41497
822 Ga0496123_0004336 3300048926 Bacteria 15028
823 Ga0496123_0007104 3300048926 Bacteria 10637
824 Ga0496123_0147219 3300048926 Bacteria 1277
825 Ga0496124_0005968 3300048927 Bacteria 13453
826 Ga0496124_0007668 3300048927 Bacteria 11416
827 Ga0496124_0026267 3300048927 Bacteria 5255
828 Ga0496124_0041894 3300048927 Bacteria 3947
829 Ga0496124_0085686 3300048927 Bacteria 2581
830 Ga0496124_0286204 3300048927 Bacteria 1199
831 Ga0496125_0011546 3300048928 Bacteria 8824
832 Ga0496125_0189281 3300048928 Bacteria 1361
833 Ga0496126_0002152 3300048929 Bacteria 27443
834 Ga0496126_0024193 3300048929 Bacteria 5866
835 Ga0496126_0042436 3300048929 Bacteria 4201
836 Ga0496126_0088348 3300048929 Bacteria 2730
837 Ga0496126_0097812 3300048929 Bacteria 2572
838 Ga0496126_0102895 3300048929 Bacteria 2496
839 Ga0496126_0206076 3300048929 Bacteria 1658
840 Ga0496126_0365375 3300048929 Bacteria 1178
841 Ga0495678_000071 3300049459 Bacteria 128709
842 Ga0495678_000092 3300049459 Bacteria 114501
843 Ga0495678_000100 3300049459 Bacteria 106118
844 Ga0495678_000562 3300049459 Bacteria 35639
845 Ga0495678_000574 3300049459 Bacteria 34979
846 Ga0495678_001283 3300049459 Bacteria 20328
847 Ga0495678_009839 3300049459 Bacteria 4694
848 Ga0495678_029020 3300049459 Bacteria 2327
849 Ga0495682_0000066 3300049460 Bacteria 97829
850 Ga0495682_0006833 3300049460 Bacteria 4594
851 Ga0495682_0015804 3300049460 Bacteria 2858
852 Ga0501033_0012115 3300049570 Bacteria 6583
853 Ga0501033_0025514 3300049570 Bacteria 4453
854 Ga0501033_0141149 3300049570 Bacteria 1741
855 Ga0501036_0001539 3300049572 Bacteria 17819
856 Ga0501036_0017070 3300049572 Bacteria 6068
857 Ga0501036_0019669 3300049572 Bacteria 5669
858 Ga0501036_0051445 3300049572 Bacteria 3488
859 Ga0501036_0097595 3300049572 Bacteria 2484
860 Ga0501038_0000983 3300049574 Bacteria 25585
861 Ga0501038_0001449 3300049574 Bacteria 21794
862 Ga0501038_0117021 3300049574 Bacteria 2202
863 Ga0501039_0000223 3300049575 Bacteria 41655
864 Ga0501039_0027408 3300049575 Bacteria 4381
865 Ga0501040_0000073 3300049576 Bacteria 48338
866 Ga0501040_0087357 3300049576 Bacteria 2165
867 Ga0501040_0106558 3300049576 Bacteria 1958
868 Ga0501041_0008206 3300049577 Bacteria 6147
869 Ga0501041_0009275 3300049577 Bacteria 5794
870 Ga0501041_0065199 3300049577 Bacteria 2231
871 Ga0501042_0000169 3300049578 Bacteria 30114
872 Ga0501042_0008157 3300049578 Bacteria 6899
873 Ga0501042_0065113 3300049578 Bacteria 2605
874 Ga0501043_0000053 3300049579 Bacteria 106085
875 Ga0501043_0099436 3300049579 Bacteria 2287
876 Ga0501043_0279726 3300049579 Bacteria 1279
877 Ga0501046_0000018 3300049580 Bacteria 220589
878 Ga0501046_0037357 3300049580 Bacteria 3903
879 Ga0501046_0038066 3300049580 Bacteria 3862
880 Ga0501046_0161851 3300049580 Bacteria 1683
881 Ga0501047_0000020 3300049581 Bacteria 259377
882 Ga0501047_0053445 3300049581 Bacteria 3906
883 Ga0501047_0142759 3300049581 Bacteria 2272
884 Ga0501048_0000167 3300049582 Bacteria 41216
885 Ga0501048_0005219 3300049582 Bacteria 9892
886 Ga0501048_0010984 3300049582 Bacteria 6756
887 Ga0501067_0065581 3300049583 Bacteria 2010
888 Ga0501068_0016008 3300049584 Bacteria 4319
889 Ga0501068_0216222 3300049584 Bacteria 1218
890 Ga0501069_0132329 3300049585 Bacteria 1428
891 Ga0501069_0169818 3300049585 Bacteria 1258
892 Ga0501070_0006281 3300049586 Bacteria 10112
893 Ga0501070_0056453 3300049586 Bacteria 3255
894 Ga0501070_0090867 3300049586 Bacteria 2527
895 Ga0501070_0247151 3300049586 Bacteria 1460
896 Ga0501071_0000160 3300049587 Bacteria 28746
897 Ga0501071_0059970 3300049587 Bacteria 2754
898 Ga0501072_0000890 3300049588 Bacteria 21918
899 Ga0501072_0000995 3300049588 Bacteria 20951
900 Ga0501073_0084056 3300049589 Bacteria 2215
901 Ga0501073_0216064 3300049589 Bacteria 1325
902 Ga0501074_0006489 3300049590 Bacteria 8449
903 Ga0501074_0032276 3300049590 Bacteria 3793
904 Ga0501074_0062972 3300049590 Bacteria 2672
905 Ga0501074_0117684 3300049590 Bacteria 1901
906 Ga0501075_0000005 3300049591 Bacteria 112003
907 Ga0501075_0000068 3300049591 Bacteria 45392
908 Ga0501076_0000014 3300049592 Bacteria 97509
909 Ga0501076_0000024 3300049592 Bacteria 78719
910 Ga0501076_0014841 3300049592 Bacteria 5876
911 Ga0501076_0204564 3300049592 Bacteria 1612
912 Ga0501077_0000248 3300049593 Bacteria 31988
913 Ga0501077_0016102 3300049593 Bacteria 4711
914 Ga0501077_0037286 3300049593 Bacteria 3097
915 Ga0501077_0044770 3300049593 Bacteria 2811
916 Ga0501079_0000025 3300049741 Bacteria 62163
917 Ga0501079_0014104 3300049741 Bacteria 6091
918 Ga0501080_0001721 3300049742 Bacteria 18697
919 Ga0501080_0021361 3300049742 Bacteria 5992
920 Ga0501080_0083312 3300049742 Bacteria 2971
921 Ga0501080_0121170 3300049742 Bacteria 2424
922 Ga0501080_0413242 3300049742 Bacteria 1213
923 Ga0501080_0448196 3300049742 Bacteria 1157
924 Ga0501081_0000007 3300049743 Bacteria 73600
925 Ga0501081_0013224 3300049743 Bacteria 5427
926 Ga0501081_0022564 3300049743 Bacteria 4213
927 Ga0501081_0105267 3300049743 Bacteria 1998
928 Ga0501081_0138769 3300049743 Bacteria 1741
929 Ga0501083_0008644 3300049744 Bacteria 7187
930 Ga0501035_0013335 3300049822 Bacteria 7584
931 Ga0501035_0105238 3300049822 Bacteria 2474
932 Ga0501035_0118312 3300049822 Bacteria 2318
933 Ga0501044_0001029 3300049823 Bacteria 33592
934 Ga0501044_0099539 3300049823 Bacteria 2926
935 Ga0501044_0255709 3300049823 Bacteria 1691
936 Ga0501045_0000003 3300049824 Bacteria 88725
937 Ga0501045_0002602 3300049824 Bacteria 12303
938 Ga0501045_0024218 3300049824 Bacteria 4356
939 Ga0501045_0030962 3300049824 Bacteria 3874
940 Ga0501045_0229092 3300049824 Bacteria 1383
941 nmdc:mga03n38_96369_c1 3300050490 Bacteria 1419
942 nmdc:mga00v17_44215_c1 3300050491 Bacteria 2686
943 nmdc:mga0k408_43237_c1 3300050493 Bacteria 2596
944 nmdc:mga06z11_144218_c1 3300050494 Bacteria 1348
945 nmdc:mga06z11_64616_c1 3300050494 Bacteria 1919
946 nmdc:mga04h51_10581_c1 3300050495 Bacteria 2538
947 nmdc:mga07m45_24707_c2 3300050496 Bacteria 1749
948 nmdc:mga05p37_652_c1 3300050507 Bacteria 38364
949 nmdc:mga0qj67_134453_c1 3300050509 Bacteria 2003
950 nmdc:mga06r32_38689_c1 3300050510 Bacteria 4521
951 nmdc:mga08y16_283407_c1 3300050511 Bacteria 1709
952 nmdc:mga08x19_57524_c1 3300050514 Bacteria 2513
953 nmdc:mga0sz30_43295_c1 3300050516 Bacteria 1895
954 Ga0495601_0001429 3300053077 Bacteria 13150
955 Ga0500643_043954 3300053087 Bacteria 1301
956 Ga0500583_0003224 3300053092 Bacteria 5086
957 Ga0500651_0083462 3300053093 Bacteria 1977
958 Ga0500650_0000016 3300053098 Bacteria 70975
959 Ga0500555_000125 3300053103 Bacteria 36635
960 Ga0500556_0008611 3300053104 Bacteria 2947
961 Ga0500595_044607 3300053119 Bacteria 1404
962 Ga0500618_000187 3300053125 Bacteria 50730
963 Ga0500658_0016231 3300053134 Bacteria 2773
964 Ga0500568_0031391 3300053139 Bacteria 2193
965 Ga0500588_0003016 3300053146 Unclassified 3510
966 Ga0500604_0009644 3300053151 Bacteria 2574
967 Ga0500616_0000085 3300053153 Bacteria 193192
968 Ga0500616_0046502 3300053153 Bacteria 2307
969 Ga0500645_001226 3300053730 Bacteria 13522
970 Ga0500645_007461 3300053730 Bacteria 3805
971 Ga0501084_0002287 3300054114 Bacteria 15381
972 Ga0501084_0008211 3300054114 Bacteria 8613
973 Ga0501084_0033507 3300054114 Bacteria 4297
974 Ga0587090_005911 3300059510 Bacteria 1554
975 Ga0501082_0000062 3300060353 Bacteria 77313
976 Ga0501082_0023279 3300060353 Bacteria 5343
977 Ga0501082_0154630 3300060353 Bacteria 1993
978 Ga0530510_0000062 3300061734 Bacteria 52768
979 Ga0530510_0000201 3300061734 Bacteria 36954
980 Ga0530510_0093688 3300061734 Bacteria 2193
981 Ga0530510_0217878 3300061734 Bacteria 1418

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046616 Ga0495668_0105224 Ga0495668_0105224_20_868 269
2 3300031247 Ga0265340_10144815 Ga0265340_101448152 272
3 3300025900 Ga0207710_10150175 Ga0207710_101501752 286
4 3300025933 Ga0207706_10231483 Ga0207706_102314832 289
5 3300046472 Ga0495580_0006376 Ga0495580_0006376_8673_9590 290
6 3300046476 Ga0495662_0067417 Ga0495662_0067417_35_952 290
7 3300046681 Ga0495647_0064955 Ga0495647_0064955_555_1433 290
8 3300047445 Ga0495677_0067032 Ga0495677_0067032_399_1319 291
9 3300025933 Ga0207706_10279438 Ga0207706_102794382 293
10 3300003775 Ga0055524_1000469 Ga0055524_100046919 306
11 3300025291 Ga0209675_1016544 Ga0209675_10165442 306
12 3300025299 Ga0209256_1000036 Ga0209256_1000036349 306
13 3300037312 Ga0395899_0262044 Ga0395899_0262044_44_988 306
14 3300048917 Ga0496114_0047896 Ga0496114_0047896_900_1904 306
15 3300048091 Ga0495626_0114231 Ga0495626_0114231_13_960 307
16 3300003771 Ga0055526_1001266 Ga0055526_100126615 309
17 3300025295 Ga0209564_1000043 Ga0209564_1000043186 310
18 3300047320 Ga0495672_0000738 Ga0495672_0000738_3155_4180 313
19 3300048929 Ga0496126_0002152 Ga0496126_0002152_2334_3296 314
20 3300003791 Ga0055530_10000630 Ga0055530_1000063017 316
21 3300003792 Ga0055540_1000173 Ga0055540_100017313 316
22 3300003794 Ga0055531_10005811 Ga0055531_100058115 316
23 3300025298 Ga0209050_1000916 Ga0209050_100091622 316
24 3300025298 Ga0209050_1010784 Ga0209050_10107843 316
25 3300025303 Ga0209051_1000379 Ga0209051_100037941 316
26 3300025304 Ga0209257_1000141 Ga0209257_1000141135 316
27 3300048913 Ga0496110_0193506 Ga0496110_0193506_665_1672 316
28 3300046506 Ga0495583_0000055 Ga0495583_0000055_150444_151436 318
29 3300053103 Ga0500555_000125 Ga0500555_000125_2739_3731 318
30 3300009093 Ga0105240_10021363 Ga0105240_100213632 319
31 3300047323 Ga0495683_0104951 Ga0495683_0104951_111_1148 319
32 3300048922 Ga0496119_0042509 Ga0496119_0042509_432_1448 319
33 3300048923 Ga0496120_0001365 Ga0496120_0001365_27762_28778 319
34 3300035171 Ga0373946_0007659 Ga0373946_0007659_117_1157 321
35 3300035172 Ga0373955_0040066 Ga0373955_0040066_1420_2460 321
36 3300035692 Ga0373935_0019897 Ga0373935_0019897_823_1863 321
37 3300037068 Ga0373925_0075408 Ga0373925_0075408_695_1735 321
38 3300046459 Ga0495629_0055488 Ga0495629_0055488_1389_2429 321
39 3300046475 Ga0495639_0006411 Ga0495639_0006411_3897_4937 321
40 3300046477 Ga0495664_0002204 Ga0495664_0002204_1658_2698 321
41 3300046559 Ga0495667_0103145 Ga0495667_0103145_795_1835 321
42 3300046642 Ga0495634_0079051 Ga0495634_0079051_419_1459 321
43 3300046680 Ga0495646_0006689 Ga0495646_0006689_4483_5523 321
44 3300046681 Ga0495647_0021282 Ga0495647_0021282_419_1459 321
45 3300046689 Ga0495613_0086690 Ga0495613_0086690_1183_2223 321
46 3300047317 Ga0495604_0062580 Ga0495604_0062580_361_1401 321
47 3300047319 Ga0495674_0003405 Ga0495674_0003405_12223_13263 321
48 3300047321 Ga0495676_0044397 Ga0495676_0044397_1779_2819 321
49 3300047471 Ga0495684_0003539 Ga0495684_0003539_7519_8559 321
50 3300047673 Ga0495593_0006297 Ga0495593_0006297_507_1547 321
51 iso_pu_bacteria 2881412998 2881414782 321
52 3300005841 Ga0068863_100039472 Ga0068863_1000394724 322
53 3300005843 Ga0068860_100133889 Ga0068860_1001338892 322
54 3300005983 Ga0081540_1003425 Ga0081540_100342515 322
55 3300006946 Ga0079104_1000294 Ga0079104_100029414 322
56 3300009101 Ga0105247_10026286 Ga0105247_100262862 322
57 3300014968 Ga0157379_10297689 Ga0157379_102976892 322
58 3300027111 Ga0209281_1000423 Ga0209281_100042340 322
59 3300033180 Ga0307510_10001839 Ga0307510_1000183921 322
60 3300035111 Ga0373923_0009335 Ga0373923_0009335_609_1652 322
61 3300037418 Ga0395900_0296593 Ga0395900_0296593_351_1343 322
62 3300037471 Ga0395905_0000498 Ga0395905_0000498_10620_11612 322
63 3300039062 Ga0400483_068090 Ga0400483_068090_15_1043 322
64 3300046452 Ga0495617_018523 Ga0495617_018523_223_1266 322
65 3300046455 Ga0495603_0069937 Ga0495603_0069937_35_1078 322
66 3300046455 Ga0495603_0125092 Ga0495603_0125092_387_1430 322
67 3300046457 Ga0495590_0010969 Ga0495590_0010969_855_1898 322
68 3300046461 Ga0495641_0045723 Ga0495641_0045723_898_1941 322
69 3300046471 Ga0495650_0055439 Ga0495650_0055439_240_1283 322
70 3300046491 Ga0495584_0009495 Ga0495584_0009495_261_1304 322
71 3300046512 Ga0495610_0039922 Ga0495610_0039922_344_1387 322
72 3300046518 Ga0495631_0018765 Ga0495631_0018765_1694_2737 322
73 3300046519 Ga0495632_0095856 Ga0495632_0095856_261_1304 322
74 3300046524 Ga0495648_0005347 Ga0495648_0005347_1624_2667 322
75 3300046526 Ga0495666_0017775 Ga0495666_0017775_1911_2954 322
76 3300046528 Ga0495642_0016372 Ga0495642_0016372_1235_2278 322
77 3300046529 Ga0495652_0020109 Ga0495652_0020109_4876_5919 322
78 3300046542 Ga0495597_0016538 Ga0495597_0016538_170_1213 322
79 3300046648 Ga0495611_0007917 Ga0495611_0007917_3208_4251 322
80 3300046665 Ga0495661_0033987 Ga0495661_0033987_230_1273 322
81 3300046684 Ga0495669_0024204 Ga0495669_0024204_1404_2447 322
82 3300047315 Ga0495581_0027224 Ga0495581_0027224_965_2008 322
83 3300047469 Ga0495673_0011100 Ga0495673_0011100_907_1950 322
84 3300048924 Ga0496121_0070897 Ga0496121_0070897_122_1165 322
85 3300048929 Ga0496126_0088348 Ga0496126_0088348_282_1325 322
86 3300053134 Ga0500658_0016231 Ga0500658_0016231_1583_2623 322
87 3300053151 Ga0500604_0009644 Ga0500604_0009644_647_1690 322
88 3300005458 Ga0070681_10000746 Ga0070681_100007468 323
89 3300005467 Ga0070706_100108730 Ga0070706_1001087302 323
90 3300013104 Ga0157370_10124958 Ga0157370_101249582 323
91 3300025910 Ga0207684_10068853 Ga0207684_100688532 323
92 3300033180 Ga0307510_10202941 Ga0307510_102029412 323
93 3300021388 Ga0213875_10001414 Ga0213875_1000141410 324
94 3300021388 Ga0213875_10003941 Ga0213875_100039412 324
95 3300021388 Ga0213875_10007514 Ga0213875_100075142 324
96 3300037853 Ga0436364_0473640 Ga0436364_0473640_9067_10098 324
97 3300037853 Ga0436364_0563933 Ga0436364_0563933_1315_2340 324
98 3300037853 Ga0436364_0804800 Ga0436364_0804800_14583_15605 324
99 3300003203 JGI25406J46586_10030970 JGI25406J46586_100309702 325
100 3300005985 Ga0081539_10000316 Ga0081539_1000031643 325
101 3300009148 Ga0105243_10000293 Ga0105243_1000029319 325
102 3300025292 Ga0209676_1000267 Ga0209676_100026742 325
103 3300025303 Ga0209051_1000230 Ga0209051_100023051 325
104 3300025935 Ga0207709_10000076 Ga0207709_1000007680 325
105 3300031548 Ga0307408_100075499 Ga0307408_1000754992 325
106 3300031731 Ga0307405_10033113 Ga0307405_100331133 325
107 3300031731 Ga0307405_10140183 Ga0307405_101401832 325
108 3300031824 Ga0307413_10110899 Ga0307413_101108991 325
109 3300031852 Ga0307410_10137388 Ga0307410_101373881 325
110 3300031903 Ga0307407_10005506 Ga0307407_100055062 325
111 3300031911 Ga0307412_10168454 Ga0307412_101684542 325
112 3300031995 Ga0307409_100005750 Ga0307409_1000057502 325
113 3300032004 Ga0307414_10026730 Ga0307414_100267302 325
114 3300032126 Ga0307415_100273674 Ga0307415_1002736742 325
115 3300049570 Ga0501033_0025514 Ga0501033_0025514_211_1242 325
116 3300049579 Ga0501043_0099436 Ga0501043_0099436_144_1175 325
117 3300049581 Ga0501047_0053445 Ga0501047_0053445_328_1359 325
118 3300049586 Ga0501070_0006281 Ga0501070_0006281_5806_6837 325
119 3300049589 Ga0501073_0084056 Ga0501073_0084056_199_1230 325
120 3300049590 Ga0501074_0062972 Ga0501074_0062972_752_1783 325
121 3300049823 Ga0501044_0001029 Ga0501044_0001029_28683_29714 325
122 3300031249 Ga0265339_10010596 Ga0265339_100105966 326
123 3300031730 Ga0307516_10046623 Ga0307516_100466232 326
124 iso_pu_bacteria 2824617872 2824618536 326
125 iso_pu_bacteria 2824626560 2824627249 326
126 iso_pu_bacteria 2824635225 2824635535 326
127 iso_pu_bacteria 2824644064 2824644371 326
128 iso_pu_bacteria 2824714736 2824716812 326
129 iso_pu_bacteria 2824723954 2824725500 326
130 iso_pu_bacteria 2938014810 2938021679 326
131 iso_pu_bacteria 2996310559 2996312385 326
132 3300005530 Ga0070679_100007841 Ga0070679_1000078418 327
133 3300031595 Ga0265313_10040486 Ga0265313_100404864 327
134 3300042876 Ga0451577_0001960 Ga0451577_0001960_24550_25698 327
135 3300042876 Ga0451577_0040418 Ga0451577_0040418_1048_2136 327
136 3300048929 Ga0496126_0102895 Ga0496126_0102895_525_1556 327
137 iso_pu_bacteria 2883291878 2883294893 327
138 3300049583 Ga0501067_0065581 Ga0501067_0065581_628_1686 328
139 iso_pu_bacteria 2508501127 2509141272 328
140 iso_pu_bacteria 8055617313 8055623814 328
141 3300003187 JGI25151J46595_10000030 JGI25151J46595_1000003082 329
142 3300003771 Ga0055526_1000502 Ga0055526_100050224 329
143 3300003775 Ga0055524_1000069 Ga0055524_100006962 329
144 3300013250 Ga0171462_1013 Ga0171462_1013144 329
145 3300025291 Ga0209675_1000909 Ga0209675_10009097 329
146 3300025294 Ga0209025_1000063 Ga0209025_1000063144 329
147 3300025295 Ga0209564_1000052 Ga0209564_100005288 329
148 3300025299 Ga0209256_1000172 Ga0209256_100017265 329
149 3300025304 Ga0209257_1028785 Ga0209257_10287851 329
150 3300035113 Ga0373936_0017021 Ga0373936_0017021_1301_2329 329
151 3300048913 Ga0496110_0042658 Ga0496110_0042658_895_1935 329
152 3300048926 Ga0496123_0147219 Ga0496123_0147219_20_1069 329
153 3300048928 Ga0496125_0189281 Ga0496125_0189281_199_1236 329
154 3300048929 Ga0496126_0042436 Ga0496126_0042436_2618_3655 329
155 3300049576 Ga0501040_0106558 Ga0501040_0106558_92_1135 329
156 3300049578 Ga0501042_0008157 Ga0501042_0008157_3404_4447 329
157 3300049585 Ga0501069_0169818 Ga0501069_0169818_78_1121 329
158 3300049586 Ga0501070_0247151 Ga0501070_0247151_277_1320 329
159 3300049587 Ga0501071_0059970 Ga0501071_0059970_826_1869 329
160 3300049590 Ga0501074_0032276 Ga0501074_0032276_763_1806 329
161 3300049592 Ga0501076_0014841 Ga0501076_0014841_851_1894 329
162 3300049593 Ga0501077_0016102 Ga0501077_0016102_2564_3607 329
163 3300049743 Ga0501081_0138769 Ga0501081_0138769_458_1501 329
164 3300049824 Ga0501045_0002602 Ga0501045_0002602_3510_4553 329
165 3300054114 Ga0501084_0033507 Ga0501084_0033507_277_1320 329
166 3300061734 Ga0530510_0217878 Ga0530510_0217878_171_1214 329
167 iso_pu_bacteria 2513237351 2514590420 329
168 iso_pu_bacteria 2597489875 2597815495 329
169 iso_pu_bacteria 2643221734 2644737527 329
170 iso_pu_bacteria 2738543024 2739305704 329
171 iso_pu_bacteria 2841734538 2841735434 329
172 iso_pu_bacteria 2856342000 2856347601 329
173 iso_pu_bacteria 2869162929 2869168956 329
174 iso_pu_bacteria 2871474448 2871479687 329
175 iso_pu_bacteria 2878788777 2878796705 329
176 iso_pu_bacteria 2885312484 2885315522 329
177 iso_pu_bacteria 2888343758 2888349398 329
178 iso_pu_bacteria 2917699015 2917702878 329
179 iso_pu_bacteria 2924754689 2924755239 329
180 iso_pu_bacteria 2937836603 2937842251 329
181 iso_pu_bacteria 2958071322 2958075570 329
182 iso_pu_bacteria 2970524798 2970531017 329
183 iso_pu_bacteria 2970540015 2970543282 329
184 iso_pu_bacteria 8004633249 8004639505 329
185 3300005355 Ga0070671_100230895 Ga0070671_1002308952 330
186 3300016635 Ga0183361_10003 Ga0183361_1000329 330
187 3300026121 Ga0207683_10175467 Ga0207683_101754672 330
188 3300037418 Ga0395900_0166403 Ga0395900_0166403_1207_2223 330
189 3300037471 Ga0395905_0187495 Ga0395905_0187495_842_1900 330
190 3300038443 Ga0395901_0452827 Ga0395901_0452827_70_1086 330
191 3300039447 Ga0436361_0075382 Ga0436361_0075382_100_1155 330
192 3300042139 Ga0450904_000658 Ga0450904_000658_1050_2159 330
193 3300042876 Ga0451577_0034963 Ga0451577_0034963_2253_3275 330
194 3300046457 Ga0495590_0000424 Ga0495590_0000424_2258_3316 330
195 3300046463 Ga0495653_0009298 Ga0495653_0009298_5962_7020 330
196 3300046463 Ga0495653_0136800 Ga0495653_0136800_384_1442 330
197 3300046506 Ga0495583_0001305 Ga0495583_0001305_17853_18899 330
198 3300046506 Ga0495583_0038279 Ga0495583_0038279_365_1435 330
199 3300046507 Ga0495606_0044306 Ga0495606_0044306_861_1919 330
200 3300046513 Ga0495616_0000035 Ga0495616_0000035_26821_27867 330
201 3300046522 Ga0495643_0000094 Ga0495643_0000094_58364_59410 330
202 3300046526 Ga0495666_0004909 Ga0495666_0004909_3301_4359 330
203 3300046529 Ga0495652_0030202 Ga0495652_0030202_112_1170 330
204 3300046531 Ga0495665_0146228 Ga0495665_0146228_126_1184 330
205 3300046536 Ga0495587_0016570 Ga0495587_0016570_1988_3046 330
206 3300046536 Ga0495587_0026273 Ga0495587_0026273_479_1537 330
207 3300046642 Ga0495634_0014394 Ga0495634_0014394_1347_2405 330
208 3300046665 Ga0495661_0075402 Ga0495661_0075402_215_1273 330
209 3300046665 Ga0495661_0086346 Ga0495661_0086346_198_1244 330
210 3300047320 Ga0495672_0087181 Ga0495672_0087181_317_1375 330
211 3300047322 Ga0495680_0035667 Ga0495680_0035667_2192_3250 330
212 3300047443 Ga0495687_005005 Ga0495687_005005_7317_8387 330
213 3300048088 Ga0495602_0019299 Ga0495602_0019299_5459_6517 330
214 3300048091 Ga0495626_0002439 Ga0495626_0002439_4487_5533 330
215 3300049590 Ga0501074_0117684 Ga0501074_0117684_833_1882 330
216 3300003771 Ga0055526_1000368 Ga0055526_100036812 331
217 3300003773 Ga0055537_1000159 Ga0055537_100015933 331
218 3300003775 Ga0055524_1009528 Ga0055524_10095286 331
219 3300003784 Ga0055534_1000045 Ga0055534_10000453 331
220 3300003790 Ga0055528_1000323 Ga0055528_100032340 331
221 3300005295 Ga0065707_10119488 Ga0065707_101194882 331
222 3300005331 Ga0070670_100000052 Ga0070670_100000052114 331
223 3300005335 Ga0070666_10009376 Ga0070666_100093765 331
224 3300005353 Ga0070669_100006210 Ga0070669_1000062107 331
225 3300005355 Ga0070671_100000043 Ga0070671_10000004370 331
226 3300005367 Ga0070667_100000021 Ga0070667_10000002121 331
227 3300005466 Ga0070685_10000002 Ga0070685_1000000213 331
228 3300005539 Ga0068853_100043248 Ga0068853_1000432482 331
229 3300005547 Ga0070693_100004068 Ga0070693_1000040687 331
230 3300005618 Ga0068864_100000219 Ga0068864_10000021937 331
231 3300005843 Ga0068860_100001564 Ga0068860_10000156426 331
232 3300005844 Ga0068862_100001673 Ga0068862_10000167323 331
233 3300006353 Ga0075370_10025155 Ga0075370_100251552 331
234 3300006844 Ga0075428_100169101 Ga0075428_1001691012 331
235 3300006847 Ga0075431_100138743 Ga0075431_1001387433 331
236 3300009177 Ga0105248_10000851 Ga0105248_1000085117 331
237 3300009177 Ga0105248_10022168 Ga0105248_100221684 331
238 3300009553 Ga0105249_10018235 Ga0105249_100182353 331
239 3300014325 Ga0163163_10004461 Ga0163163_1000446114 331
240 3300014497 Ga0182008_10124288 Ga0182008_101242882 331
241 3300014968 Ga0157379_10157466 Ga0157379_101574662 331
242 3300025263 Ga0209565_1000003 Ga0209565_1000003429 331
243 3300025273 Ga0209673_1000003 Ga0209673_1000003315 331
244 3300025291 Ga0209675_1000003 Ga0209675_1000003609 331
245 3300025295 Ga0209564_1000012 Ga0209564_1000012417 331
246 3300025299 Ga0209256_1000697 Ga0209256_100069712 331
247 3300025903 Ga0207680_10107901 Ga0207680_101079011 331
248 3300025923 Ga0207681_10007036 Ga0207681_100070366 331
249 3300025925 Ga0207650_10000002 Ga0207650_10000002659 331
250 3300025931 Ga0207644_10000372 Ga0207644_1000037218 331
251 3300025941 Ga0207711_10002050 Ga0207711_100020504 331
252 3300025941 Ga0207711_10003955 Ga0207711_100039556 331
253 3300025986 Ga0207658_10000001 Ga0207658_10000001693 331
254 3300026041 Ga0207639_10062057 Ga0207639_100620572 331
255 3300026088 Ga0207641_10008740 Ga0207641_100087404 331
256 3300026095 Ga0207676_10000001 Ga0207676_10000001659 331
257 3300028379 Ga0268266_10007343 Ga0268266_1000734314 331
258 3300028381 Ga0268264_10000004 Ga0268264_10000004650 331
259 3300031251 Ga0265327_10001131 Ga0265327_1000113110 331
260 3300037418 Ga0395900_0000046 Ga0395900_0000046_218133_219209 331
261 3300037471 Ga0395905_0087405 Ga0395905_0087405_443_1501 331
262 3300037471 Ga0395905_0315121 Ga0395905_0315121_119_1189 331
263 3300044673 Ga0453683_0262854 Ga0453683_0262854_56_1081 331
264 3300046459 Ga0495629_0027120 Ga0495629_0027120_23_1072 331
265 3300046463 Ga0495653_0008489 Ga0495653_0008489_1625_2674 331
266 3300046471 Ga0495650_0000185 Ga0495650_0000185_67608_68669 331
267 3300046477 Ga0495664_0028490 Ga0495664_0028490_1675_2724 331
268 3300046500 Ga0495596_0037335 Ga0495596_0037335_471_1535 331
269 3300046501 Ga0495607_0055116 Ga0495607_0055116_579_1760 331
270 3300046506 Ga0495583_0000314 Ga0495583_0000314_56470_57534 331
271 3300046507 Ga0495606_0019668 Ga0495606_0019668_1678_2706 331
272 3300046507 Ga0495606_0117201 Ga0495606_0117201_44_1108 331
273 3300046513 Ga0495616_0011085 Ga0495616_0011085_2729_3793 331
274 3300046513 Ga0495616_0023409 Ga0495616_0023409_260_1324 331
275 3300046516 Ga0495628_0028044 Ga0495628_0028044_716_1765 331
276 3300046517 Ga0495630_0084314 Ga0495630_0084314_837_1886 331
277 3300046518 Ga0495631_0019353 Ga0495631_0019353_750_1814 331
278 3300046519 Ga0495632_0000285 Ga0495632_0000285_26280_27344 331
279 3300046523 Ga0495644_0011124 Ga0495644_0011124_846_1910 331
280 3300046529 Ga0495652_0018714 Ga0495652_0018714_4316_5365 331
281 3300046531 Ga0495665_0000097 Ga0495665_0000097_11884_12933 331
282 3300046543 Ga0495645_0039510 Ga0495645_0039510_1880_2929 331
283 3300046678 Ga0495599_0066007 Ga0495599_0066007_558_1586 331
284 3300046679 Ga0495623_0003969 Ga0495623_0003969_8634_9707 331
285 3300046690 Ga0495624_0015579 Ga0495624_0015579_1088_2137 331
286 3300046692 Ga0495671_0013575 Ga0495671_0013575_3154_4335 331
287 3300046694 Ga0495649_0026329 Ga0495649_0026329_676_1740 331
288 3300046810 Ga0495660_0020441 Ga0495660_0020441_1752_2816 331
289 3300047317 Ga0495604_0012826 Ga0495604_0012826_5287_6336 331
290 3300047319 Ga0495674_0163125 Ga0495674_0163125_684_1733 331
291 3300047319 Ga0495674_0193456 Ga0495674_0193456_131_1159 331
292 3300047322 Ga0495680_0006432 Ga0495680_0006432_7094_8122 331
293 3300047673 Ga0495593_0000787 Ga0495593_0000787_16929_17978 331
294 3300048088 Ga0495602_0049914 Ga0495602_0049914_2064_3113 331
295 3300048904 Ga0496101_0062832 Ga0496101_0062832_1632_2681 331
296 3300048906 Ga0496103_0035675 Ga0496103_0035675_17_1045 331
297 3300048907 Ga0496104_0013762 Ga0496104_0013762_3177_4205 331
298 3300048908 Ga0496105_0039366 Ga0496105_0039366_2711_3739 331
299 3300048927 Ga0496124_0026267 Ga0496124_0026267_1458_2480 331
300 3300048929 Ga0496126_0097812 Ga0496126_0097812_658_1707 331
301 3300049459 Ga0495678_000562 Ga0495678_000562_21942_23006 331
302 3300049459 Ga0495678_000574 Ga0495678_000574_21263_22327 331
303 3300049459 Ga0495678_009839 Ga0495678_009839_1903_2964 331
304 3300049460 Ga0495682_0000066 Ga0495682_0000066_95037_96101 331
305 3300049586 Ga0501070_0090867 Ga0501070_0090867_1366_2421 331
306 3300050496 nmdc:mga07m45_24707_c2 nmdc:mga07m45_24707_c2_72_1091 331
307 3300050509 nmdc:mga0qj67_134453_c1 nmdc:mga0qj67_134453_c1_657_1706 331
308 3300053087 Ga0500643_043954 Ga0500643_043954_85_1116 331
309 3300053098 Ga0500650_0000016 Ga0500650_0000016_46498_47568 331
310 iso_pu_bacteria 2513237082 2513556885 331
311 iso_pu_bacteria 2513237083 2513564892 331
312 iso_pu_bacteria 2524614729 2525556280 331
313 iso_pu_bacteria 2627854209 2630649510 331
314 iso_pu_bacteria 8003955200 8003960762 331
315 3300005337 Ga0070682_100017170 Ga0070682_1000171703 332
316 3300005546 Ga0070696_100061739 Ga0070696_1000617393 332
317 3300006847 Ga0075431_100032041 Ga0075431_1000320412 332
318 3300009094 Ga0111539_10150922 Ga0111539_101509223 332
319 3300009553 Ga0105249_10031571 Ga0105249_100315712 332
320 3300013297 Ga0157378_10175857 Ga0157378_101758571 332
321 3300025926 Ga0207659_10146894 Ga0207659_101468941 332
322 3300025933 Ga0207706_10009544 Ga0207706_100095446 332
323 3300025961 Ga0207712_10019361 Ga0207712_100193614 332
324 3300028794 Ga0307515_10000006 Ga0307515_10000006381 332
325 3300031251 Ga0265327_10010715 Ga0265327_100107153 332
326 3300033179 Ga0307507_10035925 Ga0307507_100359253 332
327 3300037312 Ga0395899_0013123 Ga0395899_0013123_2686_3747 332
328 3300046491 Ga0495584_0003873 Ga0495584_0003873_1019_2083 332
329 3300046500 Ga0495596_0001374 Ga0495596_0001374_11279_12355 332
330 3300046500 Ga0495596_0010135 Ga0495596_0010135_508_1584 332
331 3300046506 Ga0495583_0036350 Ga0495583_0036350_197_1273 332
332 3300046519 Ga0495632_0000044 Ga0495632_0000044_120924_121988 332
333 3300046520 Ga0495637_0009788 Ga0495637_0009788_1844_2896 332
334 3300046524 Ga0495648_0021267 Ga0495648_0021267_1153_2217 332
335 3300046525 Ga0495663_0035034 Ga0495663_0035034_349_1425 332
336 3300046538 Ga0495609_0000981 Ga0495609_0000981_6112_7176 332
337 3300046665 Ga0495661_0000531 Ga0495661_0000531_25771_26835 332
338 3300046665 Ga0495661_0065344 Ga0495661_0065344_878_1942 332
339 3300046691 Ga0495670_0025810 Ga0495670_0025810_992_2068 332
340 3300047443 Ga0495687_000034 Ga0495687_000034_179456_180520 332
341 3300047470 Ga0495681_0002027 Ga0495681_0002027_12647_13723 332
342 3300048091 Ga0495626_0055004 Ga0495626_0055004_748_1800 332
343 3300048903 Ga0496100_0171307 Ga0496100_0171307_385_1449 332
344 3300048916 Ga0496113_0000447 Ga0496113_0000447_14071_15135 332
345 3300048925 Ga0496122_0001169 Ga0496122_0001169_32970_34034 332
346 3300048926 Ga0496123_0001064 Ga0496123_0001064_30288_31352 332
347 3300048928 Ga0496125_0011546 Ga0496125_0011546_2880_3944 332
348 3300049579 Ga0501043_0000053 Ga0501043_0000053_34449_35519 332
349 3300049580 Ga0501046_0000018 Ga0501046_0000018_30770_31840 332
350 3300049580 Ga0501046_0161851 Ga0501046_0161851_105_1163 332
351 3300049581 Ga0501047_0000020 Ga0501047_0000020_69579_70649 332
352 3300049582 Ga0501048_0005219 Ga0501048_0005219_6289_7359 332
353 3300049742 Ga0501080_0121170 Ga0501080_0121170_1348_2379 332
354 3300049823 Ga0501044_0099539 Ga0501044_0099539_823_1893 332
355 3300049824 Ga0501045_0024218 Ga0501045_0024218_1266_2336 332
356 3300050510 nmdc:mga06r32_38689_c1 nmdc:mga06r32_38689_c1_2450_3505 332
357 3300053730 Ga0500645_007461 Ga0500645_007461_190_1239 332
358 3300059510 Ga0587090_005911 Ga0587090_005911_129_1190 332
359 3300002738 JGI25154J39366_1001838 JGI25154J39366_10018385 333
360 3300003203 JGI25406J46586_10005781 JGI25406J46586_100057812 333
361 3300003771 Ga0055526_1000013 Ga0055526_1000013154 333
362 3300003771 Ga0055526_1000019 Ga0055526_100001936 333
363 3300005262 Ga0065165_1000243 Ga0065165_100024352 333
364 3300005435 Ga0070714_100125240 Ga0070714_1001252402 333
365 3300005549 Ga0070704_100345089 Ga0070704_1003450892 333
366 3300005985 Ga0081539_10000203 Ga0081539_1000020325 333
367 3300006847 Ga0075431_100033531 Ga0075431_1000335316 333
368 3300009036 Ga0105244_10004592 Ga0105244_100045924 333
369 3300009094 Ga0111539_10130613 Ga0111539_101306132 333
370 3300009147 Ga0114129_10000523 Ga0114129_1000052311 333
371 3300021361 Ga0213872_10000019 Ga0213872_1000001921 333
372 3300021361 Ga0213872_10001794 Ga0213872_1000179410 333
373 3300021361 Ga0213872_10003169 Ga0213872_100031692 333
374 3300021377 Ga0213874_10024099 Ga0213874_100240991 333
375 3300025233 Ga0209437_103668 Ga0209437_1036682 333
376 3300025246 Ga0209646_1000007 Ga0209646_1000007159 333
377 3300025295 Ga0209564_1000002 Ga0209564_1000002856 333
378 3300025295 Ga0209564_1000007 Ga0209564_1000007192 333
379 3300025918 Ga0207662_10081503 Ga0207662_100815031 333
380 3300025933 Ga0207706_10042045 Ga0207706_100420451 333
381 3300028794 Ga0307515_10063025 Ga0307515_100630256 333
382 3300031711 Ga0265314_10029756 Ga0265314_100297562 333
383 3300031727 Ga0316576_10124408 Ga0316576_101244081 333
384 3300031727 Ga0316576_10267391 Ga0316576_102673911 333
385 3300031728 Ga0316578_10053225 Ga0316578_100532252 333
386 3300031733 Ga0316577_10019978 Ga0316577_100199782 333
387 3300036712 Ga0316584_0016657 Ga0316584_0016657_1904_2965 333
388 3300037418 Ga0395900_0064772 Ga0395900_0064772_1914_2981 333
389 3300037418 Ga0395900_0190827 Ga0395900_0190827_644_1711 333
390 3300037471 Ga0395905_0167522 Ga0395905_0167522_100_1167 333
391 3300037471 Ga0395905_0173861 Ga0395905_0173861_482_1549 333
392 3300038443 Ga0395901_0100110 Ga0395901_0100110_524_1591 333
393 3300039438 Ga0436360_0787362 Ga0436360_0787362_85_1149 333
394 3300039447 Ga0436361_0330198 Ga0436361_0330198_9522_10589 333
395 3300039447 Ga0436361_0352948 Ga0436361_0352948_34766_35833 333
396 3300039447 Ga0436361_0635819 Ga0436361_0635819_28_1104 333
397 3300039447 Ga0436361_1127083 Ga0436361_1127083_66_1133 333
398 3300039450 Ga0436363_1348059 Ga0436363_1348059_3623_4681 333
399 3300044683 Ga0466965_0112314 Ga0466965_0112314_185_1249 333
400 3300044684 Ga0466966_0002584 Ga0466966_0002584_10330_11394 333
401 3300045051 Ga0451576_0000025 Ga0451576_0000025_392118_393143 333
402 3300046452 Ga0495617_000060 Ga0495617_000060_26344_27411 333
403 3300046452 Ga0495617_000072 Ga0495617_000072_6859_7926 333
404 3300046453 Ga0495627_000272 Ga0495627_000272_25680_26747 333
405 3300046457 Ga0495590_0000005 Ga0495590_0000005_156245_157312 333
406 3300046457 Ga0495590_0000008 Ga0495590_0000008_260585_261652 333
407 3300046457 Ga0495590_0000562 Ga0495590_0000562_12691_13773 333
408 3300046458 Ga0495591_000051 Ga0495591_000051_114981_116075 333
409 3300046460 Ga0495638_0000027 Ga0495638_0000027_38282_39349 333
410 3300046460 Ga0495638_0003652 Ga0495638_0003652_943_2040 333
411 3300046471 Ga0495650_0000044 Ga0495650_0000044_144638_145705 333
412 3300046471 Ga0495650_0000323 Ga0495650_0000323_68742_69821 333
413 3300046471 Ga0495650_0002258 Ga0495650_0002258_6432_7499 333
414 3300046471 Ga0495650_0003969 Ga0495650_0003969_2011_3078 333
415 3300046471 Ga0495650_0005067 Ga0495650_0005067_4880_5947 333
416 3300046474 Ga0495605_0000049 Ga0495605_0000049_41813_42880 333
417 3300046474 Ga0495605_0017778 Ga0495605_0017778_581_1663 333
418 3300046474 Ga0495605_0019852 Ga0495605_0019852_1718_2785 333
419 3300046491 Ga0495584_0000001 Ga0495584_0000001_315825_316892 333
420 3300046491 Ga0495584_0000024 Ga0495584_0000024_1107_2201 333
421 3300046491 Ga0495584_0001263 Ga0495584_0001263_1190_2257 333
422 3300046492 Ga0495585_0000040 Ga0495585_0000040_104368_105435 333
423 3300046492 Ga0495585_0002248 Ga0495585_0002248_939_2006 333
424 3300046492 Ga0495585_0002439 Ga0495585_0002439_5364_6431 333
425 3300046492 Ga0495585_0036912 Ga0495585_0036912_187_1254 333
426 3300046492 Ga0495585_0039002 Ga0495585_0039002_763_1830 333
427 3300046492 Ga0495585_0059017 Ga0495585_0059017_475_1542 333
428 3300046492 Ga0495585_0122419 Ga0495585_0122419_184_1251 333
429 3300046499 Ga0495594_0046635 Ga0495594_0046635_300_1367 333
430 3300046500 Ga0495596_0000714 Ga0495596_0000714_11875_12942 333
431 3300046500 Ga0495596_0008634 Ga0495596_0008634_882_1949 333
432 3300046500 Ga0495596_0010676 Ga0495596_0010676_1704_2771 333
433 3300046500 Ga0495596_0012118 Ga0495596_0012118_1486_2568 333
434 3300046501 Ga0495607_0000473 Ga0495607_0000473_28314_29408 333
435 3300046501 Ga0495607_0000984 Ga0495607_0000984_2071_3138 333
436 3300046501 Ga0495607_0031534 Ga0495607_0031534_1306_2388 333
437 3300046501 Ga0495607_0064406 Ga0495607_0064406_921_2003 333
438 3300046506 Ga0495583_0000100 Ga0495583_0000100_79601_80668 333
439 3300046506 Ga0495583_0000117 Ga0495583_0000117_44816_45883 333
440 3300046506 Ga0495583_0000792 Ga0495583_0000792_11536_12603 333
441 3300046506 Ga0495583_0003790 Ga0495583_0003790_6935_8017 333
442 3300046507 Ga0495606_0000053 Ga0495606_0000053_156148_157215 333
443 3300046507 Ga0495606_0000059 Ga0495606_0000059_146823_147923 333
444 3300046507 Ga0495606_0004757 Ga0495606_0004757_11433_12500 333
445 3300046507 Ga0495606_0008214 Ga0495606_0008214_2910_3977 333
446 3300046507 Ga0495606_0013949 Ga0495606_0013949_917_1984 333
447 3300046507 Ga0495606_0075230 Ga0495606_0075230_981_2063 333
448 3300046512 Ga0495610_0000008 Ga0495610_0000008_370023_371090 333
449 3300046512 Ga0495610_0000771 Ga0495610_0000771_15101_16195 333
450 3300046512 Ga0495610_0002195 Ga0495610_0002195_11395_12462 333
451 3300046512 Ga0495610_0007885 Ga0495610_0007885_5105_6172 333
452 3300046512 Ga0495610_0022630 Ga0495610_0022630_750_1817 333
453 3300046513 Ga0495616_0000080 Ga0495616_0000080_14124_15191 333
454 3300046513 Ga0495616_0003689 Ga0495616_0003689_1833_2900 333
455 3300046513 Ga0495616_0011853 Ga0495616_0011853_797_1879 333
456 3300046513 Ga0495616_0035134 Ga0495616_0035134_1062_2129 333
457 3300046518 Ga0495631_0003168 Ga0495631_0003168_1038_2105 333
458 3300046518 Ga0495631_0008273 Ga0495631_0008273_1636_2718 333
459 3300046518 Ga0495631_0026730 Ga0495631_0026730_924_1991 333
460 3300046518 Ga0495631_0026941 Ga0495631_0026941_1500_2567 333
461 3300046518 Ga0495631_0036889 Ga0495631_0036889_67_1134 333
462 3300046519 Ga0495632_0000066 Ga0495632_0000066_14102_15169 333
463 3300046520 Ga0495637_0000009 Ga0495637_0000009_91540_92634 333
464 3300046520 Ga0495637_0000189 Ga0495637_0000189_14184_15251 333
465 3300046520 Ga0495637_0007240 Ga0495637_0007240_2612_3712 333
466 3300046522 Ga0495643_0000022 Ga0495643_0000022_56703_57770 333
467 3300046522 Ga0495643_0026589 Ga0495643_0026589_592_1659 333
468 3300046522 Ga0495643_0056149 Ga0495643_0056149_610_1677 333
469 3300046522 Ga0495643_0065384 Ga0495643_0065384_527_1657 333
470 3300046523 Ga0495644_0006445 Ga0495644_0006445_1633_2700 333
471 3300046523 Ga0495644_0007635 Ga0495644_0007635_1469_2536 333
472 3300046523 Ga0495644_0010658 Ga0495644_0010658_1110_2177 333
473 3300046524 Ga0495648_0000411 Ga0495648_0000411_21477_22544 333
474 3300046524 Ga0495648_0001558 Ga0495648_0001558_10414_11481 333
475 3300046524 Ga0495648_0019087 Ga0495648_0019087_2473_3540 333
476 3300046524 Ga0495648_0025112 Ga0495648_0025112_2482_3549 333
477 3300046524 Ga0495648_0032359 Ga0495648_0032359_1721_2788 333
478 3300046524 Ga0495648_0045189 Ga0495648_0045189_1511_2578 333
479 3300046524 Ga0495648_0063905 Ga0495648_0063905_426_1493 333
480 3300046525 Ga0495663_0022815 Ga0495663_0022815_161_1228 333
481 3300046526 Ga0495666_0007197 Ga0495666_0007197_678_1745 333
482 3300046528 Ga0495642_0000012 Ga0495642_0000012_2362_3429 333
483 3300046528 Ga0495642_0002273 Ga0495642_0002273_2189_3256 333
484 3300046528 Ga0495642_0014066 Ga0495642_0014066_655_1722 333
485 3300046530 Ga0495654_0000002 Ga0495654_0000002_834085_835152 333
486 3300046530 Ga0495654_0011218 Ga0495654_0011218_2963_4030 333
487 3300046530 Ga0495654_0061171 Ga0495654_0061171_49_1116 333
488 3300046531 Ga0495665_0015244 Ga0495665_0015244_2322_3389 333
489 3300046535 Ga0495586_0003981 Ga0495586_0003981_1825_2907 333
490 3300046538 Ga0495609_0001757 Ga0495609_0001757_3890_4957 333
491 3300046538 Ga0495609_0008006 Ga0495609_0008006_129_1196 333
492 3300046538 Ga0495609_0079108 Ga0495609_0079108_314_1396 333
493 3300046542 Ga0495597_0000009 Ga0495597_0000009_105086_106153 333
494 3300046542 Ga0495597_0000055 Ga0495597_0000055_31925_32992 333
495 3300046542 Ga0495597_0000672 Ga0495597_0000672_889_1956 333
496 3300046542 Ga0495597_0005908 Ga0495597_0005908_846_1913 333
497 3300046542 Ga0495597_0011159 Ga0495597_0011159_655_1737 333
498 3300046557 Ga0495622_0000009 Ga0495622_0000009_70823_71890 333
499 3300046557 Ga0495622_0000128 Ga0495622_0000128_37935_39002 333
500 3300046558 Ga0495633_0000050 Ga0495633_0000050_124079_125146 333
501 3300046558 Ga0495633_0030058 Ga0495633_0030058_1545_2612 333
502 3300046558 Ga0495633_0073416 Ga0495633_0073416_293_1375 333
503 3300046615 Ga0495656_0014920 Ga0495656_0014920_1371_2438 333
504 3300046616 Ga0495668_0000027 Ga0495668_0000027_247706_248773 333
505 3300046616 Ga0495668_0000350 Ga0495668_0000350_35339_36406 333
506 3300046616 Ga0495668_0001625 Ga0495668_0001625_16636_17718 333
507 3300046616 Ga0495668_0007466 Ga0495668_0007466_2442_3521 333
508 3300046616 Ga0495668_0023465 Ga0495668_0023465_1898_2980 333
509 3300046616 Ga0495668_0082766 Ga0495668_0082766_28_1095 333
510 3300046648 Ga0495611_0000311 Ga0495611_0000311_6778_7872 333
511 3300046648 Ga0495611_0027492 Ga0495611_0027492_469_1551 333
512 3300046648 Ga0495611_0039772 Ga0495611_0039772_381_1448 333
513 3300046648 Ga0495611_0041086 Ga0495611_0041086_786_1853 333
514 3300046660 Ga0495625_0005763 Ga0495625_0005763_6847_7914 333
515 3300046660 Ga0495625_0014914 Ga0495625_0014914_3942_5024 333
516 3300046660 Ga0495625_0149651 Ga0495625_0149651_432_1499 333
517 3300046665 Ga0495661_0036495 Ga0495661_0036495_1788_2870 333
518 3300046665 Ga0495661_0051487 Ga0495661_0051487_1010_2077 333
519 3300046665 Ga0495661_0181877 Ga0495661_0181877_29_1096 333
520 3300046674 Ga0495588_0029914 Ga0495588_0029914_56_1123 333
521 3300046674 Ga0495588_0062678 Ga0495588_0062678_697_1764 333
522 3300046684 Ga0495669_0000017 Ga0495669_0000017_128219_129301 333
523 3300046684 Ga0495669_0005081 Ga0495669_0005081_3569_4636 333
524 3300046689 Ga0495613_0038721 Ga0495613_0038721_364_1446 333
525 3300046691 Ga0495670_0008894 Ga0495670_0008894_3455_4537 333
526 3300046691 Ga0495670_0020761 Ga0495670_0020761_109_1176 333
527 3300046691 Ga0495670_0023483 Ga0495670_0023483_1443_2510 333
528 3300046692 Ga0495671_0000002 Ga0495671_0000002_897554_898621 333
529 3300046692 Ga0495671_0000469 Ga0495671_0000469_26661_27728 333
530 3300046694 Ga0495649_0000546 Ga0495649_0000546_19444_20538 333
531 3300046694 Ga0495649_0020472 Ga0495649_0020472_359_1426 333
532 3300046694 Ga0495649_0024363 Ga0495649_0024363_1722_2789 333
533 3300046794 Ga0495589_0000102 Ga0495589_0000102_226_1293 333
534 3300046794 Ga0495589_0001114 Ga0495589_0001114_13831_14898 333
535 3300046794 Ga0495589_0016132 Ga0495589_0016132_654_1736 333
536 3300046794 Ga0495589_0080051 Ga0495589_0080051_61_1128 333
537 3300046794 Ga0495589_0100900 Ga0495589_0100900_25_1092 333
538 3300046810 Ga0495660_0003891 Ga0495660_0003891_1692_2759 333
539 3300046810 Ga0495660_0019284 Ga0495660_0019284_1613_2680 333
540 3300046810 Ga0495660_0043022 Ga0495660_0043022_853_1920 333
541 3300046810 Ga0495660_0070542 Ga0495660_0070542_128_1195 333
542 3300047315 Ga0495581_0006456 Ga0495581_0006456_135_1217 333
543 3300047317 Ga0495604_0090387 Ga0495604_0090387_79_1146 333
544 3300047318 Ga0495636_0112751 Ga0495636_0112751_116_1183 333
545 3300047320 Ga0495672_0000131 Ga0495672_0000131_52195_53289 333
546 3300047320 Ga0495672_0000290 Ga0495672_0000290_27464_28531 333
547 3300047320 Ga0495672_0001642 Ga0495672_0001642_11496_12563 333
548 3300047320 Ga0495672_0025534 Ga0495672_0025534_2075_3157 333
549 3300047322 Ga0495680_0001842 Ga0495680_0001842_11663_12745 333
550 3300047323 Ga0495683_0000160 Ga0495683_0000160_19403_20497 333
551 3300047443 Ga0495687_000048 Ga0495687_000048_79621_80688 333
552 3300047443 Ga0495687_000550 Ga0495687_000550_10778_11845 333
553 3300047443 Ga0495687_001509 Ga0495687_001509_9456_10523 333
554 3300047444 Ga0495675_0004046 Ga0495675_0004046_6970_8052 333
555 3300047445 Ga0495677_0000085 Ga0495677_0000085_31943_33010 333
556 3300047445 Ga0495677_0005820 Ga0495677_0005820_1422_2489 333
557 3300047445 Ga0495677_0024761 Ga0495677_0024761_214_1296 333
558 3300047445 Ga0495677_0035575 Ga0495677_0035575_149_1216 333
559 3300047445 Ga0495677_0057661 Ga0495677_0057661_52_1119 333
560 3300047446 Ga0495679_011256 Ga0495679_011256_482_1549 333
561 3300047446 Ga0495679_024963 Ga0495679_024963_752_1834 333
562 3300047447 Ga0495685_046097 Ga0495685_046097_331_1398 333
563 3300047469 Ga0495673_0000005 Ga0495673_0000005_736898_737965 333
564 3300047469 Ga0495673_0000059 Ga0495673_0000059_188691_189758 333
565 3300047469 Ga0495673_0000067 Ga0495673_0000067_72178_73245 333
566 3300047470 Ga0495681_0073047 Ga0495681_0073047_97_1191 333
567 3300047472 Ga0495686_0000135 Ga0495686_0000135_1173_2240 333
568 3300047472 Ga0495686_0012055 Ga0495686_0012055_4385_5452 333
569 3300047472 Ga0495686_0020942 Ga0495686_0020942_2819_3886 333
570 3300047472 Ga0495686_0026380 Ga0495686_0026380_10_1065 333
571 3300047673 Ga0495593_0003596 Ga0495593_0003596_2342_3424 333
572 3300048089 Ga0495614_0000655 Ga0495614_0000655_9613_10695 333
573 3300048091 Ga0495626_0005763 Ga0495626_0005763_5486_6553 333
574 3300048091 Ga0495626_0012922 Ga0495626_0012922_864_1931 333
575 3300048091 Ga0495626_0023280 Ga0495626_0023280_518_1585 333
576 3300048905 Ga0496102_0000437 Ga0496102_0000437_21193_22260 333
577 3300048905 Ga0496102_0076585 Ga0496102_0076585_1035_2102 333
578 3300048906 Ga0496103_0033628 Ga0496103_0033628_267_1334 333
579 3300048910 Ga0496107_0094146 Ga0496107_0094146_175_1242 333
580 3300048913 Ga0496110_0000001 Ga0496110_0000001_229309_230376 333
581 3300048915 Ga0496112_0021563 Ga0496112_0021563_343_1401 333
582 3300048923 Ga0496120_0021525 Ga0496120_0021525_2168_3235 333
583 3300048924 Ga0496121_0137174 Ga0496121_0137174_24_1091 333
584 3300048924 Ga0496121_0139723 Ga0496121_0139723_194_1261 333
585 3300048925 Ga0496122_0050551 Ga0496122_0050551_644_1711 333
586 3300048926 Ga0496123_0007104 Ga0496123_0007104_6281_7348 333
587 3300048927 Ga0496124_0085686 Ga0496124_0085686_910_2013 333
588 3300048927 Ga0496124_0286204 Ga0496124_0286204_13_1050 333
589 3300048929 Ga0496126_0024193 Ga0496126_0024193_3982_5049 333
590 3300049459 Ga0495678_000071 Ga0495678_000071_72795_73862 333
591 3300049459 Ga0495678_000092 Ga0495678_000092_92037_93104 333
592 3300049459 Ga0495678_000100 Ga0495678_000100_21025_22092 333
593 3300049459 Ga0495678_029020 Ga0495678_029020_1132_2199 333
594 3300049460 Ga0495682_0015804 Ga0495682_0015804_631_1698 333
595 3300049570 Ga0501033_0012115 Ga0501033_0012115_1693_2751 333
596 3300049572 Ga0501036_0001539 Ga0501036_0001539_3346_4404 333
597 3300049572 Ga0501036_0019669 Ga0501036_0019669_890_1948 333
598 3300049574 Ga0501038_0000983 Ga0501038_0000983_23468_24526 333
599 3300049575 Ga0501039_0000223 Ga0501039_0000223_32006_33064 333
600 3300049576 Ga0501040_0000073 Ga0501040_0000073_34102_35160 333
601 3300049576 Ga0501040_0087357 Ga0501040_0087357_297_1355 333
602 3300049577 Ga0501041_0009275 Ga0501041_0009275_1103_2161 333
603 3300049577 Ga0501041_0065199 Ga0501041_0065199_1007_2065 333
604 3300049578 Ga0501042_0000169 Ga0501042_0000169_15567_16625 333
605 3300049579 Ga0501043_0279726 Ga0501043_0279726_208_1266 333
606 3300049580 Ga0501046_0037357 Ga0501046_0037357_24_1082 333
607 3300049580 Ga0501046_0038066 Ga0501046_0038066_2349_3407 333
608 3300049582 Ga0501048_0000167 Ga0501048_0000167_3977_5035 333
609 3300049582 Ga0501048_0010984 Ga0501048_0010984_5466_6524 333
610 3300049584 Ga0501068_0016008 Ga0501068_0016008_766_1824 333
611 3300049584 Ga0501068_0216222 Ga0501068_0216222_91_1149 333
612 3300049585 Ga0501069_0132329 Ga0501069_0132329_336_1394 333
613 3300049586 Ga0501070_0056453 Ga0501070_0056453_299_1357 333
614 3300049587 Ga0501071_0000160 Ga0501071_0000160_25811_26869 333
615 3300049588 Ga0501072_0000995 Ga0501072_0000995_471_1529 333
616 3300049589 Ga0501073_0216064 Ga0501073_0216064_137_1195 333
617 3300049590 Ga0501074_0006489 Ga0501074_0006489_4601_5659 333
618 3300049591 Ga0501075_0000005 Ga0501075_0000005_63977_65035 333
619 3300049592 Ga0501076_0000024 Ga0501076_0000024_47244_48302 333
620 3300049592 Ga0501076_0204564 Ga0501076_0204564_403_1461 333
621 3300049593 Ga0501077_0000248 Ga0501077_0000248_5024_6082 333
622 3300049593 Ga0501077_0044770 Ga0501077_0044770_360_1418 333
623 3300049741 Ga0501079_0000025 Ga0501079_0000025_6233_7291 333
624 3300049742 Ga0501080_0001721 Ga0501080_0001721_13534_14592 333
625 3300049742 Ga0501080_0448196 Ga0501080_0448196_13_1071 333
626 3300049743 Ga0501081_0000007 Ga0501081_0000007_9453_10511 333
627 3300049743 Ga0501081_0022564 Ga0501081_0022564_1794_2852 333
628 3300049744 Ga0501083_0008644 Ga0501083_0008644_1176_2234 333
629 3300049822 Ga0501035_0013335 Ga0501035_0013335_409_1467 333
630 3300049824 Ga0501045_0000003 Ga0501045_0000003_64870_65928 333
631 3300050494 nmdc:mga06z11_144218_c1 nmdc:mga06z11_144218_c1_124_1185 333
632 3300050507 nmdc:mga05p37_652_c1 nmdc:mga05p37_652_c1_31102_32160 333
633 3300050511 nmdc:mga08y16_283407_c1 nmdc:mga08y16_283407_c1_239_1297 333
634 3300053125 Ga0500618_000187 Ga0500618_000187_34453_35520 333
635 3300054114 Ga0501084_0008211 Ga0501084_0008211_2521_3579 333
636 3300060353 Ga0501082_0000062 Ga0501082_0000062_38333_39391 333
637 3300061734 Ga0530510_0000062 Ga0530510_0000062_51688_52746 333
638 3300061734 Ga0530510_0093688 Ga0530510_0093688_1096_2154 333
639 iso_pu_bacteria 2738541297 2738827981 333
640 iso_pu_bacteria 2738541357 2739151777 333
641 iso_pu_bacteria 2738543003 2739194202 333
642 iso_pu_bacteria 2738543026 2739320173 333
643 iso_pu_bacteria 2738543029 2739338919 333
644 iso_pu_bacteria 2775507255 2778126350 333
645 iso_pu_bacteria 2821131069 2821132733 333
646 iso_pu_bacteria 2857558681 2857562065 333
647 iso_pu_bacteria 2857564685 2857566802 333
648 3300005328 Ga0070676_10002638 Ga0070676_100026388 334
649 3300005338 Ga0068868_100201892 Ga0068868_1002018922 334
650 3300005459 Ga0068867_100029996 Ga0068867_1000299963 334
651 3300005578 Ga0068854_100197870 Ga0068854_1001978702 334
652 3300005842 Ga0068858_100402127 Ga0068858_1004021272 334
653 3300007265 Ga0099794_10000703 Ga0099794_100007038 334
654 3300010159 Ga0099796_10000651 Ga0099796_100006512 334
655 3300014968 Ga0157379_10409934 Ga0157379_104099342 334
656 3300025907 Ga0207645_10036693 Ga0207645_100366933 334
657 3300025931 Ga0207644_10089089 Ga0207644_100890893 334
658 3300025981 Ga0207640_10065584 Ga0207640_100655842 334
659 3300026035 Ga0207703_10067840 Ga0207703_100678402 334
660 3300026089 Ga0207648_10005187 Ga0207648_1000518710 334
661 3300027512 Ga0209179_1000828 Ga0209179_10008283 334
662 3300031251 Ga0265327_10008872 Ga0265327_100088722 334
663 3300031838 Ga0307518_10222053 Ga0307518_102220532 334
664 3300046501 Ga0495607_0003885 Ga0495607_0003885_3208_4278 334
665 3300046507 Ga0495606_0125542 Ga0495606_0125542_269_1339 334
666 3300046518 Ga0495631_0011965 Ga0495631_0011965_801_1871 334
667 3300046525 Ga0495663_0004172 Ga0495663_0004172_125_1195 334
668 3300046528 Ga0495642_0109106 Ga0495642_0109106_18_1088 334
669 3300046538 Ga0495609_0000177 Ga0495609_0000177_13567_14637 334
670 3300046558 Ga0495633_0057903 Ga0495633_0057903_152_1222 334
671 3300046616 Ga0495668_0000006 Ga0495668_0000006_122957_124027 334
672 3300046616 Ga0495668_0000353 Ga0495668_0000353_47946_49016 334
673 3300046616 Ga0495668_0063250 Ga0495668_0063250_335_1405 334
674 3300046660 Ga0495625_0039909 Ga0495625_0039909_135_1205 334
675 3300046664 Ga0495659_0009489 Ga0495659_0009489_1981_3051 334
676 3300046674 Ga0495588_0091777 Ga0495588_0091777_89_1159 334
677 3300046684 Ga0495669_0017390 Ga0495669_0017390_1611_2681 334
678 3300046694 Ga0495649_0075244 Ga0495649_0075244_348_1418 334
679 3300046794 Ga0495589_0080682 Ga0495589_0080682_367_1437 334
680 3300047445 Ga0495677_0004620 Ga0495677_0004620_714_1784 334
681 3300047447 Ga0495685_002522 Ga0495685_002522_2919_3989 334
682 3300048091 Ga0495626_0000015 Ga0495626_0000015_67146_68225 334
683 3300048905 Ga0496102_0106931 Ga0496102_0106931_1074_2144 334
684 3300048906 Ga0496103_0013818 Ga0496103_0013818_621_1691 334
685 3300048924 Ga0496121_0194771 Ga0496121_0194771_49_1110 334
686 3300048927 Ga0496124_0005968 Ga0496124_0005968_10592_11656 334
687 3300048927 Ga0496124_0007668 Ga0496124_0007668_540_1610 334
688 3300048929 Ga0496126_0206076 Ga0496126_0206076_325_1371 334
689 3300048929 Ga0496126_0365375 Ga0496126_0365375_31_1095 334
690 3300049459 Ga0495678_001283 Ga0495678_001283_13585_14703 334
691 3300049570 Ga0501033_0141149 Ga0501033_0141149_213_1274 334
692 3300049572 Ga0501036_0017070 Ga0501036_0017070_2510_3571 334
693 3300049572 Ga0501036_0051445 Ga0501036_0051445_303_1364 334
694 3300049572 Ga0501036_0097595 Ga0501036_0097595_957_2018 334
695 3300049574 Ga0501038_0001449 Ga0501038_0001449_1291_2352 334
696 3300049574 Ga0501038_0117021 Ga0501038_0117021_792_1853 334
697 3300049575 Ga0501039_0027408 Ga0501039_0027408_1695_2756 334
698 3300049577 Ga0501041_0008206 Ga0501041_0008206_2457_3518 334
699 3300049578 Ga0501042_0065113 Ga0501042_0065113_944_2005 334
700 3300049588 Ga0501072_0000890 Ga0501072_0000890_2050_3111 334
701 3300049591 Ga0501075_0000068 Ga0501075_0000068_25424_26485 334
702 3300049592 Ga0501076_0000014 Ga0501076_0000014_48689_49750 334
703 3300049593 Ga0501077_0037286 Ga0501077_0037286_152_1213 334
704 3300049741 Ga0501079_0014104 Ga0501079_0014104_4440_5501 334
705 3300049742 Ga0501080_0021361 Ga0501080_0021361_1216_2277 334
706 3300049742 Ga0501080_0413242 Ga0501080_0413242_31_1092 334
707 3300049743 Ga0501081_0013224 Ga0501081_0013224_1358_2419 334
708 3300049743 Ga0501081_0105267 Ga0501081_0105267_176_1237 334
709 3300049822 Ga0501035_0105238 Ga0501035_0105238_545_1606 334
710 3300049822 Ga0501035_0118312 Ga0501035_0118312_871_1932 334
711 3300049824 Ga0501045_0030962 Ga0501045_0030962_27_1088 334
712 3300049824 Ga0501045_0229092 Ga0501045_0229092_65_1126 334
713 3300053153 Ga0500616_0000085 Ga0500616_0000085_95591_96655 334
714 3300053153 Ga0500616_0046502 Ga0500616_0046502_144_1196 334
715 3300054114 Ga0501084_0002287 Ga0501084_0002287_1472_2533 334
716 3300060353 Ga0501082_0023279 Ga0501082_0023279_2928_3989 334
717 3300060353 Ga0501082_0154630 Ga0501082_0154630_698_1759 334
718 3300061734 Ga0530510_0000201 Ga0530510_0000201_16986_18047 334
719 iso_pu_bacteria 2643221651 2644287921 334
720 iso_pu_bacteria 2894023352 2894023462 334
721 iso_pu_bacteria 8055225921 8055228882 334
722 3300005328 Ga0070676_10120668 Ga0070676_101206682 335
723 3300005330 Ga0070690_100164033 Ga0070690_1001640331 335
724 3300005355 Ga0070671_100021300 Ga0070671_1000213002 335
725 3300005439 Ga0070711_100176618 Ga0070711_1001766182 335
726 3300005440 Ga0070705_100093787 Ga0070705_1000937872 335
727 3300005467 Ga0070706_100309292 Ga0070706_1003092922 335
728 3300005468 Ga0070707_100425834 Ga0070707_1004258341 335
729 3300005471 Ga0070698_100066406 Ga0070698_1000664064 335
730 3300005471 Ga0070698_100104724 Ga0070698_1001047242 335
731 3300005577 Ga0068857_100270444 Ga0068857_1002704442 335
732 3300005617 Ga0068859_100152228 Ga0068859_1001522282 335
733 3300005617 Ga0068859_100215222 Ga0068859_1002152223 335
734 3300005719 Ga0068861_100126034 Ga0068861_1001260342 335
735 3300005843 Ga0068860_100146437 Ga0068860_1001464372 335
736 3300005844 Ga0068862_100088433 Ga0068862_1000884332 335
737 3300006042 Ga0075368_10052603 Ga0075368_100526032 335
738 3300006048 Ga0075363_100053469 Ga0075363_1000534691 335
739 3300006177 Ga0075362_10013292 Ga0075362_100132922 335
740 3300006178 Ga0075367_10048860 Ga0075367_100488602 335
741 3300006186 Ga0075369_10019359 Ga0075369_100193592 335
742 3300006195 Ga0075366_10120826 Ga0075366_101208261 335
743 3300006880 Ga0075429_100058235 Ga0075429_1000582352 335
744 3300006931 Ga0097620_100152237 Ga0097620_1001522372 335
745 3300006931 Ga0097620_100215225 Ga0097620_1002152252 335
746 3300007265 Ga0099794_10023616 Ga0099794_100236162 335
747 3300007788 Ga0099795_10038661 Ga0099795_100386611 335
748 3300009094 Ga0111539_10226551 Ga0111539_102265512 335
749 3300013297 Ga0157378_10009277 Ga0157378_100092772 335
750 3300025910 Ga0207684_10263923 Ga0207684_102639232 335
751 3300025931 Ga0207644_10005509 Ga0207644_100055095 335
752 3300025961 Ga0207712_10026403 Ga0207712_100264035 335
753 3300025986 Ga0207658_10361965 Ga0207658_103619651 335
754 3300026116 Ga0207674_10021564 Ga0207674_100215642 335
755 3300026118 Ga0207675_100160883 Ga0207675_1001608832 335
756 3300028379 Ga0268266_10121103 Ga0268266_101211032 335
757 3300028380 Ga0268265_10356246 Ga0268265_103562462 335
758 3300028381 Ga0268264_10042701 Ga0268264_100427012 335
759 3300030521 Ga0307511_10000025 Ga0307511_1000002511 335
760 3300030731 Ga0316177_1212761 Ga0316177_12127612 335
761 3300031901 Ga0307406_10091859 Ga0307406_100918592 335
762 3300035691 Ga0373931_0016354 Ga0373931_0016354_650_1726 335
763 3300042001 Ga0439441_005803 Ga0439441_005803_624_1691 335
764 3300046499 Ga0495594_0097782 Ga0495594_0097782_343_1410 335
765 3300046519 Ga0495632_0011220 Ga0495632_0011220_630_1736 335
766 3300046528 Ga0495642_0018803 Ga0495642_0018803_579_1685 335
767 3300046538 Ga0495609_0021747 Ga0495609_0021747_227_1333 335
768 3300046542 Ga0495597_0015727 Ga0495597_0015727_831_1937 335
769 3300046660 Ga0495625_0238049 Ga0495625_0238049_22_1128 335
770 3300047318 Ga0495636_0037515 Ga0495636_0037515_476_1549 335
771 3300047323 Ga0495683_0071165 Ga0495683_0071165_492_1598 335
772 3300047447 Ga0495685_012896 Ga0495685_012896_327_1400 335
773 3300047447 Ga0495685_048914 Ga0495685_048914_227_1333 335
774 3300048090 Ga0495615_0000090 Ga0495615_0000090_43_1116 335
775 3300048091 Ga0495626_0052382 Ga0495626_0052382_587_1693 335
776 3300048905 Ga0496102_0000101 Ga0496102_0000101_75839_76912 335
777 3300048925 Ga0496122_0004108 Ga0496122_0004108_17291_18352 335
778 3300048926 Ga0496123_0004336 Ga0496123_0004336_82_1143 335
779 3300048927 Ga0496124_0041894 Ga0496124_0041894_2781_3842 335
780 3300049460 Ga0495682_0006833 Ga0495682_0006833_563_1669 335
781 3300050490 nmdc:mga03n38_96369_c1 nmdc:mga03n38_96369_c1_247_1317 335
782 3300050491 nmdc:mga00v17_44215_c1 nmdc:mga00v17_44215_c1_1559_2629 335
783 3300050493 nmdc:mga0k408_43237_c1 nmdc:mga0k408_43237_c1_395_1465 335
784 3300050494 nmdc:mga06z11_64616_c1 nmdc:mga06z11_64616_c1_254_1324 335
785 3300050495 nmdc:mga04h51_10581_c1 nmdc:mga04h51_10581_c1_1234_2304 335
786 3300050516 nmdc:mga0sz30_43295_c1 nmdc:mga0sz30_43295_c1_533_1603 335
787 3300053139 Ga0500568_0031391 Ga0500568_0031391_262_1332 335
788 3300005327 Ga0070658_10049172 Ga0070658_100491723 336
789 3300005328 Ga0070676_10002512 Ga0070676_100025125 336
790 3300005333 Ga0070677_10000311 Ga0070677_100003112 336
791 3300005335 Ga0070666_10007951 Ga0070666_100079512 336
792 3300005335 Ga0070666_10012511 Ga0070666_100125114 336
793 3300005335 Ga0070666_10027544 Ga0070666_100275443 336
794 3300005338 Ga0068868_100003668 Ga0068868_10000366810 336
795 3300005347 Ga0070668_100049834 Ga0070668_1000498341 336
796 3300005354 Ga0070675_100063964 Ga0070675_1000639642 336
797 3300005356 Ga0070674_100007399 Ga0070674_1000073994 336
798 3300005367 Ga0070667_100162598 Ga0070667_1001625981 336
799 3300005455 Ga0070663_100005315 Ga0070663_1000053153 336
800 3300005456 Ga0070678_100003476 Ga0070678_1000034763 336
801 3300005459 Ga0068867_100008363 Ga0068867_1000083634 336
802 3300005466 Ga0070685_10020498 Ga0070685_100204983 336
803 3300005539 Ga0068853_100035764 Ga0068853_1000357644 336
804 3300005548 Ga0070665_100012190 Ga0070665_1000121904 336
805 3300005563 Ga0068855_100078234 Ga0068855_1000782343 336
806 3300005564 Ga0070664_100185300 Ga0070664_1001853002 336
807 3300005616 Ga0068852_100002292 Ga0068852_1000022924 336
808 3300005719 Ga0068861_100022703 Ga0068861_1000227032 336
809 3300005834 Ga0068851_10002958 Ga0068851_100029585 336
810 3300005841 Ga0068863_100008937 Ga0068863_1000089373 336
811 3300006237 Ga0097621_100028254 Ga0097621_1000282543 336
812 3300006881 Ga0068865_100041090 Ga0068865_1000410903 336
813 3300009177 Ga0105248_10123808 Ga0105248_101238083 336
814 3300009553 Ga0105249_10306810 Ga0105249_103068101 336
815 3300010375 Ga0105239_10055846 Ga0105239_100558462 336
816 3300013306 Ga0163162_10234112 Ga0163162_102341122 336
817 3300013308 Ga0157375_10005737 Ga0157375_100057374 336
818 3300013308 Ga0157375_10051189 Ga0157375_100511893 336
819 3300013308 Ga0157375_10404997 Ga0157375_104049972 336
820 3300014969 Ga0157376_10132038 Ga0157376_101320382 336
821 3300014969 Ga0157376_10270986 Ga0157376_102709862 336
822 3300017792 Ga0163161_10037715 Ga0163161_100377153 336
823 3300025321 Ga0207656_10010386 Ga0207656_100103862 336
824 3300025893 Ga0207682_10000061 Ga0207682_1000006120 336
825 3300025903 Ga0207680_10000489 Ga0207680_1000048911 336
826 3300025903 Ga0207680_10031077 Ga0207680_100310772 336
827 3300025907 Ga0207645_10003267 Ga0207645_100032673 336
828 3300025908 Ga0207643_10015602 Ga0207643_100156022 336
829 3300025909 Ga0207705_10072679 Ga0207705_100726792 336
830 3300025923 Ga0207681_10075811 Ga0207681_100758112 336
831 3300025925 Ga0207650_10060737 Ga0207650_100607372 336
832 3300025931 Ga0207644_10039648 Ga0207644_100396482 336
833 3300025938 Ga0207704_10052278 Ga0207704_100522783 336
834 3300025940 Ga0207691_10000016 Ga0207691_10000016124 336
835 3300025942 Ga0207689_10105939 Ga0207689_101059392 336
836 3300025945 Ga0207679_10137793 Ga0207679_101377932 336
837 3300025949 Ga0207667_10051563 Ga0207667_100515632 336
838 3300025960 Ga0207651_10029503 Ga0207651_100295032 336
839 3300025972 Ga0207668_10049405 Ga0207668_100494052 336
840 3300025986 Ga0207658_10001061 Ga0207658_1000106118 336
841 3300025986 Ga0207658_10130949 Ga0207658_101309492 336
842 3300026041 Ga0207639_10037373 Ga0207639_100373732 336
843 3300026067 Ga0207678_10013650 Ga0207678_100136502 336
844 3300026078 Ga0207702_10020598 Ga0207702_100205984 336
845 3300026089 Ga0207648_10004401 Ga0207648_100044014 336
846 3300026095 Ga0207676_10208096 Ga0207676_102080962 336
847 3300026118 Ga0207675_100039056 Ga0207675_1000390564 336
848 3300026121 Ga0207683_10000322 Ga0207683_1000032230 336
849 3300028379 Ga0268266_10009218 Ga0268266_100092184 336
850 3300031241 Ga0265325_10005792 Ga0265325_100057925 336
851 3300035695 Ga0373927_0002256 Ga0373927_0002256_7036_8151 336
852 3300037068 Ga0373925_0000104 Ga0373925_0000104_7036_8151 336
853 3300046543 Ga0495645_0019718 Ga0495645_0019718_3054_4094 336
854 iso_pu_bacteria 2904541872 2904549692 336
855 iso_pu_bacteria 2929160207 2929168461 336
856 3300005937 Ga0081455_10000391 Ga0081455_100003917 337
857 3300009545 Ga0105237_10235451 Ga0105237_102354512 337
858 3300021377 Ga0213874_10038923 Ga0213874_100389231 337
859 3300042007 Ga0439449_0054328 Ga0439449_0054328_355_1422 337
860 3300046453 Ga0495627_000489 Ga0495627_000489_29655_30728 337
861 3300046512 Ga0495610_0000556 Ga0495610_0000556_7845_8918 337
862 3300046515 Ga0495620_0000351 Ga0495620_0000351_28409_29482 337
863 3300046558 Ga0495633_0012260 Ga0495633_0012260_213_1286 337
864 3300047470 Ga0495681_0000269 Ga0495681_0000269_28319_29392 337
865 iso_pu_bacteria 2852680915 2852683884 337
866 iso_pu_bacteria 2984564862 2984567235 337
867 3300003791 Ga0055530_10000160 Ga0055530_1000016040 338
868 3300004625 Ga0055543_1006928 Ga0055543_10069282 338
869 3300005347 Ga0070668_100002357 Ga0070668_1000023574 338
870 3300005367 Ga0070667_100005451 Ga0070667_1000054515 338
871 3300005539 Ga0068853_100076250 Ga0068853_1000762502 338
872 3300005543 Ga0070672_100013917 Ga0070672_1000139172 338
873 3300005548 Ga0070665_100002758 Ga0070665_10000275811 338
874 3300005548 Ga0070665_100074772 Ga0070665_1000747722 338
875 3300005617 Ga0068859_100011410 Ga0068859_1000114104 338
876 3300005618 Ga0068864_100170677 Ga0068864_1001706772 338
877 3300005719 Ga0068861_100047335 Ga0068861_1000473353 338
878 3300005841 Ga0068863_100066373 Ga0068863_1000663732 338
879 3300005841 Ga0068863_100093670 Ga0068863_1000936703 338
880 3300005842 Ga0068858_100056739 Ga0068858_1000567392 338
881 3300005843 Ga0068860_100000015 Ga0068860_100000015182 338
882 3300005843 Ga0068860_100051949 Ga0068860_1000519494 338
883 3300005844 Ga0068862_100006372 Ga0068862_1000063729 338
884 3300005844 Ga0068862_100120093 Ga0068862_1001200932 338
885 3300006048 Ga0075363_100057444 Ga0075363_1000574442 338
886 3300006931 Ga0097620_100011410 Ga0097620_1000114105 338
887 3300009093 Ga0105240_10009713 Ga0105240_100097137 338
888 3300009093 Ga0105240_10080085 Ga0105240_100800853 338
889 3300009177 Ga0105248_10096218 Ga0105248_100962182 338
890 3300009545 Ga0105237_10196031 Ga0105237_101960312 338
891 3300009553 Ga0105249_10070334 Ga0105249_100703343 338
892 3300025304 Ga0209257_1000676 Ga0209257_100067610 338
893 3300025913 Ga0207695_10037969 Ga0207695_100379692 338
894 3300025913 Ga0207695_10068557 Ga0207695_100685572 338
895 3300025926 Ga0207659_10163884 Ga0207659_101638842 338
896 3300025940 Ga0207691_10024116 Ga0207691_100241162 338
897 3300025972 Ga0207668_10010412 Ga0207668_100104124 338
898 3300025986 Ga0207658_10005073 Ga0207658_100050733 338
899 3300025986 Ga0207658_10025287 Ga0207658_100252872 338
900 3300026035 Ga0207703_10092071 Ga0207703_100920712 338
901 3300026041 Ga0207639_10061248 Ga0207639_100612482 338
902 3300026088 Ga0207641_10050012 Ga0207641_100500123 338
903 3300026088 Ga0207641_10224594 Ga0207641_102245942 338
904 3300026095 Ga0207676_10014847 Ga0207676_100148473 338
905 3300026095 Ga0207676_10181994 Ga0207676_101819942 338
906 3300026095 Ga0207676_10395469 Ga0207676_103954691 338
907 3300026118 Ga0207675_100056394 Ga0207675_1000563942 338
908 3300028379 Ga0268266_10013731 Ga0268266_100137313 338
909 3300028379 Ga0268266_10023392 Ga0268266_100233924 338
910 3300028380 Ga0268265_10083838 Ga0268265_100838382 338
911 3300028380 Ga0268265_10084293 Ga0268265_100842932 338
912 3300028381 Ga0268264_10000002 Ga0268264_10000002926 338
913 3300028381 Ga0268264_10000014 Ga0268264_10000014185 338
914 3300028381 Ga0268264_10009680 Ga0268264_100096805 338
915 3300031548 Ga0307408_100060395 Ga0307408_1000603952 338
916 3300035083 Ga0373926_0014404 Ga0373926_0014404_856_1932 338
917 3300035113 Ga0373936_0068214 Ga0373936_0068214_171_1247 338
918 3300035116 Ga0373945_0026017 Ga0373945_0026017_502_1578 338
919 3300035170 Ga0373943_0003641 Ga0373943_0003641_839_1915 338
920 3300035171 Ga0373946_0002251 Ga0373946_0002251_5174_6250 338
921 3300035410 Ga0373924_0039566 Ga0373924_0039566_242_1318 338
922 3300035692 Ga0373935_0004899 Ga0373935_0004899_802_1878 338
923 3300035692 Ga0373935_0056067 Ga0373935_0056067_601_1677 338
924 3300035695 Ga0373927_0002255 Ga0373927_0002255_7839_8915 338
925 3300035725 Ga0373947_0001432 Ga0373947_0001432_5821_6897 338
926 3300035725 Ga0373947_0204067 Ga0373947_0204067_77_1153 338
927 3300037068 Ga0373925_0000976 Ga0373925_0000976_13415_14491 338
928 3300037312 Ga0395899_0000361 Ga0395899_0000361_47461_48537 338
929 3300037418 Ga0395900_0000237 Ga0395900_0000237_69806_70882 338
930 3300037471 Ga0395905_0124786 Ga0395905_0124786_300_1385 338
931 3300038443 Ga0395901_0000028 Ga0395901_0000028_226099_227175 338
932 3300039450 Ga0436363_0240244 Ga0436363_0240244_3033_4118 338
933 3300046459 Ga0495629_0067560 Ga0495629_0067560_26_1102 338
934 3300046463 Ga0495653_0015205 Ga0495653_0015205_1842_2918 338
935 3300046463 Ga0495653_0189182 Ga0495653_0189182_180_1256 338
936 3300046473 Ga0495582_0090689 Ga0495582_0090689_415_1491 338
937 3300046506 Ga0495583_0039360 Ga0495583_0039360_377_1459 338
938 3300046514 Ga0495618_0080682 Ga0495618_0080682_857_1933 338
939 3300046517 Ga0495630_0002597 Ga0495630_0002597_10591_11667 338
940 3300046517 Ga0495630_0074389 Ga0495630_0074389_489_1565 338
941 3300046531 Ga0495665_0065446 Ga0495665_0065446_177_1253 338
942 3300046531 Ga0495665_0125272 Ga0495665_0125272_121_1197 338
943 3300046533 Ga0495640_0002599 Ga0495640_0002599_8406_9482 338
944 3300046533 Ga0495640_0064218 Ga0495640_0064218_1147_2223 338
945 3300046543 Ga0495645_0002089 Ga0495645_0002089_2436_3512 338
946 3300046684 Ga0495669_0076352 Ga0495669_0076352_132_1208 338
947 3300046690 Ga0495624_0004924 Ga0495624_0004924_2948_4024 338
948 3300046690 Ga0495624_0054496 Ga0495624_0054496_929_2005 338
949 3300047315 Ga0495581_0002330 Ga0495581_0002330_8768_9844 338
950 3300047319 Ga0495674_0007608 Ga0495674_0007608_2412_3488 338
951 3300047321 Ga0495676_0135153 Ga0495676_0135153_571_1647 338
952 3300047445 Ga0495677_0036393 Ga0495677_0036393_91_1167 338
953 3300047471 Ga0495684_0018009 Ga0495684_0018009_3306_4382 338
954 3300047471 Ga0495684_0033143 Ga0495684_0033143_2081_3157 338
955 3300047673 Ga0495593_0008040 Ga0495593_0008040_4674_5750 338
956 3300048912 Ga0496109_0015097 Ga0496109_0015097_3622_4698 338
957 3300048913 Ga0496110_0337279 Ga0496110_0337279_138_1205 338
958 3300048917 Ga0496114_0016647 Ga0496114_0016647_1845_2912 338
959 3300053077 Ga0495601_0001429 Ga0495601_0001429_7038_8114 338
960 3300053730 Ga0500645_001226 Ga0500645_001226_1273_2349 338
961 3300007076 Ga0075435_100147607 Ga0075435_1001476072 339
962 3300007788 Ga0099795_10002134 Ga0099795_100021345 339
963 3300009098 Ga0105245_10001099 Ga0105245_1000109910 339
964 3300009551 Ga0105238_10000493 Ga0105238_1000049331 339
965 3300025899 Ga0207642_10116554 Ga0207642_101165542 339
966 3300025924 Ga0207694_10000397 Ga0207694_1000039732 339
967 3300025927 Ga0207687_10002035 Ga0207687_100020355 339
968 3300037853 Ga0436364_0786035 Ga0436364_0786035_2408_3487 339
969 3300046459 Ga0495629_0000365 Ga0495629_0000365_16268_17353 339
970 3300046463 Ga0495653_0000880 Ga0495653_0000880_17009_18094 339
971 3300046472 Ga0495580_0003410 Ga0495580_0003410_10318_11403 339
972 3300046516 Ga0495628_0003503 Ga0495628_0003503_11438_12523 339
973 3300046690 Ga0495624_0000316 Ga0495624_0000316_20965_22050 339
974 3300047319 Ga0495674_0000923 Ga0495674_0000923_6065_7150 339
975 3300047319 Ga0495674_0012637 Ga0495674_0012637_515_1678 339
976 3300047673 Ga0495593_0006547 Ga0495593_0006547_2831_3916 339
977 3300049581 Ga0501047_0142759 Ga0501047_0142759_458_1543 339
978 3300049742 Ga0501080_0083312 Ga0501080_0083312_909_1994 339
979 3300049823 Ga0501044_0255709 Ga0501044_0255709_301_1386 339
980 3300050514 nmdc:mga08x19_57524_c1 nmdc:mga08x19_57524_c1_1131_2216 339
981 3300053119 Ga0500595_044607 Ga0500595_044607_63_1142 339
982 3300053146 Ga0500588_0003016 Ga0500588_0003016_251_1390 339
983 iso_pu_bacteria 2562617112 2563064119 339
984 iso_pu_bacteria 2711768613 2713472393 339
985 iso_pu_bacteria 2900634093 2900642227 339
986 iso_pu_bacteria 2921643360 2921650169 339
987 3300001904 JGI24736J21556_1002424 JGI24736J21556_10024243 340
988 3300001915 JGI24741J21665_1000034 JGI24741J21665_100003416 340
989 3300001979 JGI24740J21852_10000403 JGI24740J21852_100004035 340
990 3300001989 JGI24739J22299_10000059 JGI24739J22299_1000005915 340
991 3300001990 JGI24737J22298_10000084 JGI24737J22298_1000008416 340
992 3300002067 JGI24735J21928_10000109 JGI24735J21928_1000010920 340
993 3300005344 Ga0070661_100004880 Ga0070661_1000048803 340
994 3300005457 Ga0070662_100002384 Ga0070662_1000023844 340
995 3300005539 Ga0068853_100002265 Ga0068853_1000022654 340
996 3300005543 Ga0070672_100064851 Ga0070672_1000648513 340
997 3300005563 Ga0068855_100001912 Ga0068855_10000191215 340
998 3300005564 Ga0070664_100027829 Ga0070664_1000278293 340
999 3300005577 Ga0068857_100004902 Ga0068857_1000049025 340
1000 3300005578 Ga0068854_100002245 Ga0068854_1000022455 340
1001 3300005614 Ga0068856_100002241 Ga0068856_1000022413 340
1002 3300005834 Ga0068851_10094263 Ga0068851_100942631 340
1003 3300006048 Ga0075363_100000506 Ga0075363_1000005066 340
1004 3300009093 Ga0105240_10017325 Ga0105240_100173258 340
1005 3300009174 Ga0105241_10014586 Ga0105241_100145864 340
1006 3300009545 Ga0105237_10053764 Ga0105237_100537643 340
1007 3300009551 Ga0105238_10006619 Ga0105238_100066198 340
1008 3300013100 Ga0157373_10044194 Ga0157373_100441942 340
1009 3300013102 Ga0157371_10004600 Ga0157371_1000460010 340
1010 3300013105 Ga0157369_10026347 Ga0157369_100263475 340
1011 3300013307 Ga0157372_10072967 Ga0157372_100729673 340
1012 3300021384 Ga0213876_10000611 Ga0213876_100006118 340
1013 3300025298 Ga0209050_1000915 Ga0209050_100091525 340
1014 3300025321 Ga0207656_10066613 Ga0207656_100666132 340
1015 3300025904 Ga0207647_10000817 Ga0207647_1000081714 340
1016 3300025913 Ga0207695_10067720 Ga0207695_100677202 340
1017 3300025920 Ga0207649_10020345 Ga0207649_100203452 340
1018 3300025924 Ga0207694_10063477 Ga0207694_100634773 340
1019 3300025933 Ga0207706_10000744 Ga0207706_1000074413 340
1020 3300025945 Ga0207679_10088532 Ga0207679_100885322 340
1021 3300025949 Ga0207667_10098298 Ga0207667_100982982 340
1022 3300026041 Ga0207639_10000632 Ga0207639_1000063214 340
1023 3300026067 Ga0207678_10000914 Ga0207678_1000091418 340
1024 3300026078 Ga0207702_10001373 Ga0207702_1000137310 340
1025 3300026116 Ga0207674_10001538 Ga0207674_100015387 340
1026 3300031852 Ga0307410_10173092 Ga0307410_101730922 340
1027 3300031901 Ga0307406_10012195 Ga0307406_100121952 340
1028 3300031911 Ga0307412_10024218 Ga0307412_100242183 340
1029 3300032004 Ga0307414_10094848 Ga0307414_100948482 340
1030 3300033180 Ga0307510_10039902 Ga0307510_100399025 340
1031 3300039437 Ga0436365_1595143 Ga0436365_1595143_15498_16538 340
1032 3300046460 Ga0495638_0001965 Ga0495638_0001965_14761_15915 340
1033 3300046660 Ga0495625_0003531 Ga0495625_0003531_11484_12638 340
1034 3300053092 Ga0500583_0003224 Ga0500583_0003224_1533_2633 340
1035 3300053093 Ga0500651_0083462 Ga0500651_0083462_690_1790 340
1036 3300053104 Ga0500556_0008611 Ga0500556_0008611_975_2048 340
1037 iso_pu_bacteria 2818991438 2819553216 340

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

77

335

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxp-assembly1.cif.gz_A-2 crystal structure of a putative aminoglycoside phosphotransferase (reut_a1007) from ralstonia eutropha jmp134 at 2.32 a resolution 0.9302 4 335
3dxp-assembly1.cif.gz_A-2 crystal structure of a putative aminoglycoside phosphotransferase (reut_a1007) from ralstonia eutropha jmp134 at 2.32 a resolution 0.9167 4 335
3att-assembly1.cif.gz_A crystal structure of rv3168 with atp 0.7529 6 329
2ppq-assembly1.cif.gz_A-2 crystal structure of the homoserine kinase from agrobacterium tumefaciens 0.7447 2 336
4dfb-assembly2.cif.gz_B "crystal structure of aminoglycoside phosphotransferase aph(2"")-id/aph(2"")-iva in complex with kanamycin" 0.744 23 322
ID Description Score Start End Superfamily
af_Q8K370_368_600_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9508 106 335 3.90.1200.10
af_O01590_328_568_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9431 105 338 3.90.1200.10
3dxpA02 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9402 105 335 3.90.1200.10
af_Q8K370_368_600_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9351 106 335 3.90.1200.10
af_Q8RWZ3_128_373_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.9251 106 333 3.90.1200.10
ID Description Score Start End GO Terms
AF-A0A3B9AZX6-F1-model_v4 deleted 0.981 86 336
AF-A0A6L4A8W3-F1-model_v4 deleted 0.977 74 338
AF-A0A3N2QIF4-F1-model_v4 deleted 0.9754 1 339
AF-H0TE96-F1-model_v4 Putative aminoglycoside phosphotransferase 0.9753 4 338 GO:0016740
AF-A0A358J1J6-F1-model_v4 Phosphotransferase family protein 0.9737 142 340 GO:0016740

Feature Viewer

pLDDT pTM Quality
92.03 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map