F488450
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1023 | 485 | 966 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0255934|Ga0496102_0255934_221_1030 |
| Length | 261 |
| Sequence | MGQAVFIAGPPPVHLSTLEESMYKIVFMRHGESTWNLENRFTGWTDVDLTAKGVQEAKNAGKVLKEAGFTFDLAYTSVLKRAIRTLWLTMDEMDMLWLPVVNDWRLNERHYGALQGLDKGETAAKYGDAQVLVWRRSYDTPERTSFSDPRYARLERSQIPLTECLKDTVARVMPAWDEEIAPAIRAGRQILISAHGNSLRALIKMLDGISDEDIVGLNIPNGQPLVYELDADLKPIRHYYLGDAAAIAAATAAVANQGKAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 3 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 4 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 5 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 6 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 7 | 2576861424 | Paenibacillus sabinae T27 | Isolate | Rhizosphere |
| 8 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 9 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 10 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 11 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 12 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 13 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 14 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 15 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 16 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 17 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 18 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 19 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 20 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 21 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 22 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 23 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 24 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 25 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 26 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 27 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 28 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 29 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 30 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 31 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 32 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 33 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 34 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 35 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 36 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 37 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 38 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 39 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 40 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 41 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 42 | 2889415604 | Paludisphaera rhizosphaerae JC665 | Isolate | Rhizosphere |
| 43 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 44 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 45 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 46 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 47 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 48 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 49 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 50 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 51 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 52 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 53 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 54 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 55 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 56 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 57 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 58 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 59 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 60 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 61 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 62 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 63 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 64 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 65 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 66 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 67 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 68 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 69 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 70 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 71 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 72 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 73 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 74 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 75 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 76 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 77 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 78 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 79 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 80 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 81 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 82 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 83 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 84 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 85 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 86 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 87 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 88 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 89 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 90 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 91 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 92 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 97 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 99 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 101 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 118 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 119 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 121 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 122 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 124 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 127 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 128 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 130 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 131 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 132 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 133 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 134 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 135 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 136 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 137 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 138 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 139 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 140 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 141 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 142 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 143 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 144 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 146 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 147 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 149 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 150 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 172 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 175 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 176 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 177 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 179 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 180 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 193 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 194 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 197 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 206 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 209 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 262 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 263 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 267 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 268 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 269 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 270 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 271 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 272 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 273 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 274 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 275 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 276 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 277 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 278 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 279 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 280 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 281 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 282 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 283 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 284 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 285 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 286 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 287 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 288 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 289 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 290 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 293 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 294 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 295 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 296 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 297 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 298 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 299 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 300 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 301 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 302 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 304 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 305 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 306 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 307 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 308 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 309 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 310 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 311 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 312 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 313 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 314 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 315 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 316 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 317 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 318 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 319 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 320 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 321 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 322 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 323 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 324 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 325 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 326 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 327 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 328 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 329 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 416 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 417 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 418 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 419 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 420 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 421 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 422 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 424 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 425 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 426 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 427 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 428 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 429 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 430 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 431 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 432 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 433 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 434 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 435 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 436 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 437 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 438 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 460 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 461 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 465 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 466 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 470 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 474 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 475 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 476 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 477 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 478 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 479 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 480 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 483 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 485 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.74 |
| Metatranscriptomes | 0.68 |
| Isolates | 5.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.95 |
| Nodule | 0.88 |
| Rhizoplane | 2.54 |
| Rhizosphere | 76.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1435602 | 2162886007 | Bacteria | 1876 |
| 2 | JGI24737J22298_10007165 | 3300001990 | Bacteria | 3774 |
| 3 | JGI25155J39150_1000170 | 3300002704 | Bacteria | 28479 |
| 4 | JGI25155J39150_1000681 | 3300002704 | Bacteria | 6401 |
| 5 | JGI25156J39149_1000293 | 3300002705 | Bacteria | 33788 |
| 6 | JGI25162J39368_1000148 | 3300002737 | Bacteria | 76611 |
| 7 | JGI25154J39366_1000260 | 3300002738 | Bacteria | 33788 |
| 8 | JGI25154J39366_1000267 | 3300002738 | Bacteria | 32817 |
| 9 | JGI25154J39366_1001696 | 3300002738 | Bacteria | 7240 |
| 10 | JGI25158J39367_1003777 | 3300002739 | Bacteria | 2309 |
| 11 | JGI25157J39369_1000327 | 3300002741 | Bacteria | 33804 |
| 12 | JGI25152J39213_1012831 | 3300002773 | Bacteria | 1776 |
| 13 | JGI25150J39212_1001790 | 3300002774 | Bacteria | 5724 |
| 14 | JGI25150J39212_1003475 | 3300002774 | Bacteria | 3677 |
| 15 | JGI25159J45721_1012602 | 3300002987 | Bacteria | 2008 |
| 16 | JGI25159J45721_1014381 | 3300002987 | Bacteria | 1789 |
| 17 | JGI25165J46597_1000030 | 3300003214 | Bacteria | 305254 |
| 18 | JGI25153J46596_10000527 | 3300003215 | Bacteria | 24017 |
| 19 | rootL2_10059351 | 3300003322 | Bacteria | 4970 |
| 20 | rootL2_10082641 | 3300003322 | Bacteria | 4053 |
| 21 | JGI25160J50197_1024978 | 3300003354 | Bacteria | 1682 |
| 22 | JGI25161J50226_1005964 | 3300003374 | Bacteria | 2271 |
| 23 | Ga0007409J51694_1018111 | 3300003575 | Bacteria | 1589 |
| 24 | Ga0055538_1000017 | 3300003751 | Bacteria | 305254 |
| 25 | Ga0055538_1000138 | 3300003751 | Bacteria | 51369 |
| 26 | Ga0055539_1000022 | 3300003752 | Bacteria | 305254 |
| 27 | Ga0055539_1000187 | 3300003752 | Bacteria | 51369 |
| 28 | Ga0055533_1000030 | 3300003756 | Bacteria | 305254 |
| 29 | Ga0055533_1000189 | 3300003756 | Bacteria | 51369 |
| 30 | Ga0055532_1000184 | 3300003758 | Bacteria | 52595 |
| 31 | Ga0055525_1000034 | 3300003759 | Bacteria | 305254 |
| 32 | Ga0055525_1000254 | 3300003759 | Bacteria | 51369 |
| 33 | Ga0055535_1013432 | 3300003761 | Bacteria | 1208 |
| 34 | Ga0055529_1000097 | 3300003763 | Bacteria | 132109 |
| 35 | Ga0055529_1001308 | 3300003763 | Bacteria | 8446 |
| 36 | Ga0055526_1000030 | 3300003771 | Bacteria | 143833 |
| 37 | Ga0055526_1000167 | 3300003771 | Bacteria | 57804 |
| 38 | Ga0055526_1000696 | 3300003771 | Bacteria | 25648 |
| 39 | Ga0055526_1001016 | 3300003771 | Bacteria | 20552 |
| 40 | Ga0055526_1021142 | 3300003771 | Bacteria | 2277 |
| 41 | Ga0055537_1000114 | 3300003773 | Bacteria | 60836 |
| 42 | Ga0055534_1000398 | 3300003784 | Bacteria | 26851 |
| 43 | Ga0055534_1001436 | 3300003784 | Bacteria | 9475 |
| 44 | Ga0055528_1000683 | 3300003790 | Bacteria | 24377 |
| 45 | Ga0055528_1001913 | 3300003790 | Bacteria | 11822 |
| 46 | Ga0055530_10010680 | 3300003791 | Bacteria | 3367 |
| 47 | Ga0055531_10018382 | 3300003794 | Bacteria | 2888 |
| 48 | Ga0055541_1000015 | 3300003841 | Bacteria | 305254 |
| 49 | Ga0055541_1000122 | 3300003841 | Bacteria | 51369 |
| 50 | Ga0055543_1008303 | 3300004625 | Bacteria | 2309 |
| 51 | Ga0065165_1000161 | 3300005262 | Bacteria | 116828 |
| 52 | Ga0065165_1060300 | 3300005262 | Bacteria | 1041 |
| 53 | Ga0065714_10108397 | 3300005288 | Bacteria | 1516 |
| 54 | Ga0065704_10077125 | 3300005289 | Bacteria | 4847 |
| 55 | Ga0065704_10175861 | 3300005289 | Bacteria | 1264 |
| 56 | Ga0070658_10007092 | 3300005327 | Bacteria | 9045 |
| 57 | Ga0070658_10026431 | 3300005327 | Bacteria | 4656 |
| 58 | Ga0070658_10140070 | 3300005327 | Bacteria | 2020 |
| 59 | Ga0070676_10004199 | 3300005328 | Bacteria | 7566 |
| 60 | Ga0070676_10074245 | 3300005328 | Bacteria | 2048 |
| 61 | Ga0070676_10449498 | 3300005328 | Bacteria | 906 |
| 62 | Ga0070683_100181374 | 3300005329 | Bacteria | 1998 |
| 63 | Ga0070670_100016771 | 3300005331 | Bacteria | 6285 |
| 64 | Ga0070670_100202220 | 3300005331 | Bacteria | 1726 |
| 65 | Ga0068869_100132290 | 3300005334 | Bacteria | 1919 |
| 66 | Ga0070666_10074780 | 3300005335 | Bacteria | 2309 |
| 67 | Ga0070680_100009867 | 3300005336 | Bacteria | 7349 |
| 68 | Ga0070682_100012497 | 3300005337 | Bacteria | 4871 |
| 69 | Ga0068868_100039188 | 3300005338 | Bacteria | 3681 |
| 70 | Ga0068868_100054684 | 3300005338 | Bacteria | 3147 |
| 71 | Ga0070660_100003375 | 3300005339 | Bacteria | 10984 |
| 72 | Ga0070660_100267634 | 3300005339 | Bacteria | 1396 |
| 73 | Ga0070660_100321858 | 3300005339 | Bacteria | 1270 |
| 74 | Ga0070687_100102571 | 3300005343 | Bacteria | 1605 |
| 75 | Ga0070661_100009715 | 3300005344 | Bacteria | 6673 |
| 76 | Ga0070668_100059566 | 3300005347 | Bacteria | 2955 |
| 77 | Ga0070668_100144430 | 3300005347 | Bacteria | 1920 |
| 78 | Ga0070668_100574234 | 3300005347 | Bacteria | 984 |
| 79 | Ga0070669_100050314 | 3300005353 | Bacteria | 3043 |
| 80 | Ga0070669_100379589 | 3300005353 | Bacteria | 1152 |
| 81 | Ga0070675_100016252 | 3300005354 | Bacteria | 5904 |
| 82 | Ga0070675_100035845 | 3300005354 | Bacteria | 4034 |
| 83 | Ga0070675_100657543 | 3300005354 | Bacteria | 953 |
| 84 | Ga0070671_100013439 | 3300005355 | Bacteria | 6600 |
| 85 | Ga0070671_100494674 | 3300005355 | Bacteria | 1052 |
| 86 | Ga0070674_100007074 | 3300005356 | Bacteria | 6596 |
| 87 | Ga0070673_100072473 | 3300005364 | Bacteria | 2770 |
| 88 | Ga0070673_100373610 | 3300005364 | Bacteria | 1270 |
| 89 | Ga0070673_100572690 | 3300005364 | Bacteria | 1028 |
| 90 | Ga0070659_100005084 | 3300005366 | Bacteria | 9432 |
| 91 | Ga0070659_100025581 | 3300005366 | Bacteria | 4535 |
| 92 | Ga0070659_100047684 | 3300005366 | Bacteria | 3362 |
| 93 | Ga0070667_100031274 | 3300005367 | Bacteria | 4438 |
| 94 | Ga0070667_100051141 | 3300005367 | Bacteria | 3483 |
| 95 | Ga0070700_100253903 | 3300005441 | Bacteria | 1263 |
| 96 | Ga0070694_100152490 | 3300005444 | Bacteria | 1689 |
| 97 | Ga0070663_100056072 | 3300005455 | Bacteria | 2822 |
| 98 | Ga0070678_100113817 | 3300005456 | Bacteria | 2121 |
| 99 | Ga0070662_100004735 | 3300005457 | Bacteria | 8625 |
| 100 | Ga0070662_100020288 | 3300005457 | Bacteria | 4524 |
| 101 | Ga0070662_100071262 | 3300005457 | Bacteria | 2562 |
| 102 | Ga0070662_100114298 | 3300005457 | Bacteria | 2061 |
| 103 | Ga0070681_10141338 | 3300005458 | Bacteria | 2337 |
| 104 | Ga0068867_100003983 | 3300005459 | Bacteria | 10390 |
| 105 | Ga0068867_100068393 | 3300005459 | Bacteria | 2650 |
| 106 | Ga0068867_100154219 | 3300005459 | Bacteria | 1806 |
| 107 | Ga0070698_100040134 | 3300005471 | Bacteria | 4813 |
| 108 | Ga0070679_100001135 | 3300005530 | Bacteria | 23268 |
| 109 | Ga0070684_100055097 | 3300005535 | Bacteria | 3465 |
| 110 | Ga0070697_100609112 | 3300005536 | Bacteria | 960 |
| 111 | Ga0068853_100081877 | 3300005539 | Bacteria | 2827 |
| 112 | Ga0068853_100136891 | 3300005539 | Bacteria | 2196 |
| 113 | Ga0068853_100370259 | 3300005539 | Bacteria | 1336 |
| 114 | Ga0070672_100003086 | 3300005543 | Bacteria | 10747 |
| 115 | Ga0070672_100006477 | 3300005543 | Bacteria | 7874 |
| 116 | Ga0070672_100020307 | 3300005543 | Bacteria | 4843 |
| 117 | Ga0070693_100003885 | 3300005547 | Bacteria | 7008 |
| 118 | Ga0070704_100019965 | 3300005549 | Bacteria | 4312 |
| 119 | Ga0068855_100016431 | 3300005563 | Bacteria | 8898 |
| 120 | Ga0068855_100155206 | 3300005563 | Bacteria | 2601 |
| 121 | Ga0068855_100468323 | 3300005563 | Bacteria | 1373 |
| 122 | Ga0068855_100817558 | 3300005563 | Bacteria | 989 |
| 123 | Ga0070664_100011679 | 3300005564 | Bacteria | 7127 |
| 124 | Ga0070664_100058114 | 3300005564 | Bacteria | 3289 |
| 125 | Ga0068857_100171310 | 3300005577 | Bacteria | 1973 |
| 126 | Ga0068854_100005545 | 3300005578 | Bacteria | 7973 |
| 127 | Ga0068854_100006914 | 3300005578 | Bacteria | 7235 |
| 128 | Ga0068854_100284426 | 3300005578 | Bacteria | 1333 |
| 129 | Ga0068856_100014658 | 3300005614 | Bacteria | 7568 |
| 130 | Ga0068856_100105392 | 3300005614 | Bacteria | 2813 |
| 131 | Ga0068852_100001864 | 3300005616 | Bacteria | 14345 |
| 132 | Ga0068852_100016051 | 3300005616 | Bacteria | 5831 |
| 133 | Ga0068852_100026218 | 3300005616 | Bacteria | 4734 |
| 134 | Ga0068852_100032708 | 3300005616 | Bacteria | 4309 |
| 135 | Ga0068852_100039754 | 3300005616 | Bacteria | 3962 |
| 136 | Ga0068852_100089122 | 3300005616 | Bacteria | 2756 |
| 137 | Ga0068859_100167420 | 3300005617 | Bacteria | 2278 |
| 138 | Ga0068864_100025908 | 3300005618 | Bacteria | 4942 |
| 139 | Ga0068864_100112595 | 3300005618 | Bacteria | 2425 |
| 140 | Ga0068866_10005780 | 3300005718 | Bacteria | 5130 |
| 141 | Ga0068861_100253840 | 3300005719 | Bacteria | 1502 |
| 142 | Ga0068851_10039543 | 3300005834 | Bacteria | 2369 |
| 143 | Ga0068851_10044585 | 3300005834 | Bacteria | 2239 |
| 144 | Ga0068863_100025161 | 3300005841 | Bacteria | 5676 |
| 145 | Ga0068863_100038014 | 3300005841 | Bacteria | 4580 |
| 146 | Ga0068863_100058931 | 3300005841 | Bacteria | 3633 |
| 147 | Ga0068858_100001998 | 3300005842 | Bacteria | 20859 |
| 148 | Ga0068858_100039965 | 3300005842 | Bacteria | 4350 |
| 149 | Ga0068860_100006591 | 3300005843 | Bacteria | 11658 |
| 150 | Ga0068860_100007427 | 3300005843 | Bacteria | 10961 |
| 151 | Ga0068862_100025452 | 3300005844 | Bacteria | 4969 |
| 152 | Ga0070712_100474367 | 3300006175 | Bacteria | 1045 |
| 153 | Ga0075362_10011637 | 3300006177 | Bacteria | 3471 |
| 154 | Ga0097621_100161101 | 3300006237 | Bacteria | 1929 |
| 155 | Ga0097621_100247032 | 3300006237 | Bacteria | 1561 |
| 156 | Ga0097621_100366525 | 3300006237 | Bacteria | 1284 |
| 157 | Ga0097621_100518447 | 3300006237 | Bacteria | 1082 |
| 158 | Ga0068871_100028510 | 3300006358 | Bacteria | 4377 |
| 159 | Ga0068871_100043305 | 3300006358 | Bacteria | 3616 |
| 160 | Ga0068865_100018012 | 3300006881 | Bacteria | 4552 |
| 161 | Ga0097620_100167407 | 3300006931 | Bacteria | 2278 |
| 162 | Ga0079104_1000001 | 3300006946 | Bacteria | 521847 |
| 163 | Ga0079104_1003285 | 3300006946 | Bacteria | 7707 |
| 164 | Ga0099826_10000033 | 3300006948 | Bacteria | 120668 |
| 165 | Ga0105244_10001268 | 3300009036 | Bacteria | 20676 |
| 166 | Ga0105244_10002331 | 3300009036 | Bacteria | 14435 |
| 167 | Ga0105244_10042192 | 3300009036 | Bacteria | 2360 |
| 168 | Ga0105240_10001692 | 3300009093 | Bacteria | 37346 |
| 169 | Ga0105240_10025647 | 3300009093 | Bacteria | 7742 |
| 170 | Ga0105240_10396201 | 3300009093 | Bacteria | 1556 |
| 171 | Ga0105240_10404556 | 3300009093 | Bacteria | 1537 |
| 172 | Ga0111539_10053128 | 3300009094 | Bacteria | 4823 |
| 173 | Ga0111539_11099926 | 3300009094 | Bacteria | 924 |
| 174 | Ga0105245_10042161 | 3300009098 | Bacteria | 4071 |
| 175 | Ga0105243_10012713 | 3300009148 | Bacteria | 6359 |
| 176 | Ga0105243_10085443 | 3300009148 | Bacteria | 2586 |
| 177 | Ga0105243_10239384 | 3300009148 | Bacteria | 1614 |
| 178 | Ga0105243_10241511 | 3300009148 | Bacteria | 1608 |
| 179 | Ga0105242_10075246 | 3300009176 | Bacteria | 2811 |
| 180 | Ga0105248_10074587 | 3300009177 | Bacteria | 3813 |
| 181 | Ga0105248_10229035 | 3300009177 | Bacteria | 2092 |
| 182 | Ga0105248_10231964 | 3300009177 | Bacteria | 2078 |
| 183 | Ga0105248_10304816 | 3300009177 | Bacteria | 1794 |
| 184 | Ga0105237_10020036 | 3300009545 | Bacteria | 6904 |
| 185 | Ga0105238_10000255 | 3300009551 | Bacteria | 59531 |
| 186 | Ga0105238_10072050 | 3300009551 | Bacteria | 3452 |
| 187 | Ga0105238_10139346 | 3300009551 | Bacteria | 2403 |
| 188 | Ga0105238_10290698 | 3300009551 | Bacteria | 1616 |
| 189 | Ga0105238_10600016 | 3300009551 | Bacteria | 1109 |
| 190 | Ga0105249_10038942 | 3300009553 | Bacteria | 4314 |
| 191 | Ga0105249_10148454 | 3300009553 | Bacteria | 2254 |
| 192 | Ga0105239_10004709 | 3300010375 | Bacteria | 16200 |
| 193 | Ga0105239_10006370 | 3300010375 | Bacteria | 13712 |
| 194 | Ga0105239_10053867 | 3300010375 | Bacteria | 4412 |
| 195 | Ga0105239_10694149 | 3300010375 | Bacteria | 1163 |
| 196 | Ga0105246_10225218 | 3300011119 | Bacteria | 1473 |
| 197 | Ga0157373_10012943 | 3300013100 | Bacteria | 6126 |
| 198 | Ga0157373_10127244 | 3300013100 | Bacteria | 1792 |
| 199 | Ga0157373_10187374 | 3300013100 | Bacteria | 1458 |
| 200 | Ga0157371_10000003 | 3300013102 | Bacteria | 543317 |
| 201 | Ga0157369_10074822 | 3300013105 | Bacteria | 3633 |
| 202 | Ga0157374_10003229 | 3300013296 | Bacteria | 13694 |
| 203 | Ga0157374_10061688 | 3300013296 | Bacteria | 3512 |
| 204 | Ga0163162_10011979 | 3300013306 | Bacteria | 8457 |
| 205 | Ga0163162_10012367 | 3300013306 | Bacteria | 8334 |
| 206 | Ga0157372_10058889 | 3300013307 | Bacteria | 4295 |
| 207 | Ga0157375_10021719 | 3300013308 | Bacteria | 5892 |
| 208 | Ga0157375_10022979 | 3300013308 | Bacteria | 5748 |
| 209 | Ga0157375_10061463 | 3300013308 | Bacteria | 3730 |
| 210 | Ga0157375_10663720 | 3300013308 | Bacteria | 1198 |
| 211 | Ga0163163_10146227 | 3300014325 | Bacteria | 2407 |
| 212 | Ga0157380_10044658 | 3300014326 | Bacteria | 3474 |
| 213 | Ga0157380_10048785 | 3300014326 | Bacteria | 3336 |
| 214 | Ga0182008_10263676 | 3300014497 | Bacteria | 892 |
| 215 | Ga0157379_10013161 | 3300014968 | Bacteria | 7243 |
| 216 | Ga0157379_10016872 | 3300014968 | Bacteria | 6426 |
| 217 | Ga0157376_10016557 | 3300014969 | Bacteria | 5601 |
| 218 | Ga0157376_10233751 | 3300014969 | Bacteria | 1709 |
| 219 | Ga0182006_1000007 | 3300015261 | Bacteria | 452190 |
| 220 | Ga0182006_1000102 | 3300015261 | Bacteria | 94384 |
| 221 | Ga0182006_1034063 | 3300015261 | Bacteria | 2040 |
| 222 | Ga0182007_10001496 | 3300015262 | Bacteria | 12509 |
| 223 | Ga0182007_10018972 | 3300015262 | Bacteria | 2480 |
| 224 | Ga0182007_10063366 | 3300015262 | Bacteria | 1211 |
| 225 | Ga0182005_1000006 | 3300015265 | Bacteria | 515188 |
| 226 | Ga0182005_1000010 | 3300015265 | Bacteria | 434103 |
| 227 | Ga0182005_1000134 | 3300015265 | Bacteria | 53164 |
| 228 | Ga0163161_10049369 | 3300017792 | Bacteria | 3041 |
| 229 | Ga0163161_10465340 | 3300017792 | Bacteria | 1024 |
| 230 | Ga0213872_10000041 | 3300021361 | Bacteria | 118955 |
| 231 | Ga0213872_10000167 | 3300021361 | Bacteria | 59191 |
| 232 | Ga0213872_10000929 | 3300021361 | Bacteria | 20720 |
| 233 | Ga0213872_10003231 | 3300021361 | Bacteria | 9101 |
| 234 | Ga0213872_10069435 | 3300021361 | Bacteria | 1589 |
| 235 | Ga0209435_100079 | 3300025206 | Bacteria | 51612 |
| 236 | Ga0209435_100657 | 3300025206 | Bacteria | 6146 |
| 237 | Ga0209760_100848 | 3300025207 | Bacteria | 3985 |
| 238 | Ga0209436_100449 | 3300025208 | Bacteria | 18426 |
| 239 | Ga0209436_107310 | 3300025208 | Bacteria | 2322 |
| 240 | Ga0209784_100034 | 3300025224 | Bacteria | 305504 |
| 241 | Ga0209784_100035 | 3300025224 | Bacteria | 299760 |
| 242 | Ga0209566_100038 | 3300025225 | Bacteria | 305504 |
| 243 | Ga0209566_100040 | 3300025225 | Bacteria | 299760 |
| 244 | Ga0209674_100056 | 3300025226 | Bacteria | 305504 |
| 245 | Ga0209674_100057 | 3300025226 | Bacteria | 299760 |
| 246 | Ga0209672_105447 | 3300025228 | Bacteria | 2178 |
| 247 | Ga0209147_100060 | 3300025229 | Bacteria | 249588 |
| 248 | Ga0209563_100057 | 3300025230 | Bacteria | 305604 |
| 249 | Ga0209563_100059 | 3300025230 | Bacteria | 299760 |
| 250 | Ga0207427_101876 | 3300025231 | Bacteria | 6632 |
| 251 | Ga0209437_100071 | 3300025233 | Bacteria | 305604 |
| 252 | Ga0209437_100081 | 3300025233 | Bacteria | 271072 |
| 253 | Ga0209258_100141 | 3300025242 | Bacteria | 166385 |
| 254 | Ga0209258_107060 | 3300025242 | Bacteria | 1696 |
| 255 | Ga0207425_1000009 | 3300025245 | Bacteria | 593135 |
| 256 | Ga0207425_1000068 | 3300025245 | Bacteria | 124067 |
| 257 | Ga0207425_1001046 | 3300025245 | Bacteria | 12809 |
| 258 | Ga0209646_1000251 | 3300025246 | Bacteria | 53754 |
| 259 | Ga0209646_1000265 | 3300025246 | Bacteria | 50897 |
| 260 | Ga0209646_1000290 | 3300025246 | Bacteria | 42743 |
| 261 | Ga0209026_1000330 | 3300025250 | Bacteria | 47453 |
| 262 | Ga0209677_100035 | 3300025253 | Bacteria | 305504 |
| 263 | Ga0209677_100036 | 3300025253 | Bacteria | 299760 |
| 264 | Ga0209148_1001530 | 3300025254 | Bacteria | 11318 |
| 265 | Ga0209759_1000473 | 3300025256 | Bacteria | 44908 |
| 266 | Ga0209759_1000485 | 3300025256 | Bacteria | 43802 |
| 267 | Ga0209129_1000061 | 3300025258 | Bacteria | 246061 |
| 268 | Ga0209233_1000094 | 3300025261 | Bacteria | 305604 |
| 269 | Ga0209565_1000032 | 3300025263 | Bacteria | 316777 |
| 270 | Ga0209565_1001187 | 3300025263 | Bacteria | 12426 |
| 271 | Ga0209565_1005779 | 3300025263 | Bacteria | 3553 |
| 272 | Ga0209565_1006593 | 3300025263 | Bacteria | 3237 |
| 273 | Ga0209565_1007733 | 3300025263 | Bacteria | 2871 |
| 274 | Ga0209455_1000031 | 3300025272 | Bacteria | 519952 |
| 275 | Ga0209455_1000820 | 3300025272 | Bacteria | 16895 |
| 276 | Ga0209455_1003128 | 3300025272 | Bacteria | 6028 |
| 277 | Ga0209673_1000029 | 3300025273 | Bacteria | 351978 |
| 278 | Ga0209673_1004770 | 3300025273 | Bacteria | 7127 |
| 279 | Ga0209130_1000833 | 3300025284 | Bacteria | 25861 |
| 280 | Ga0209130_1001452 | 3300025284 | Bacteria | 15642 |
| 281 | Ga0209130_1002479 | 3300025284 | Bacteria | 9193 |
| 282 | Ga0209675_1000019 | 3300025291 | Bacteria | 351950 |
| 283 | Ga0209675_1001158 | 3300025291 | Bacteria | 16010 |
| 284 | Ga0209025_1001504 | 3300025294 | Bacteria | 30047 |
| 285 | Ga0209025_1020665 | 3300025294 | Bacteria | 3586 |
| 286 | Ga0209564_1000010 | 3300025295 | Bacteria | 885399 |
| 287 | Ga0209564_1000067 | 3300025295 | Bacteria | 311242 |
| 288 | Ga0209564_1000291 | 3300025295 | Bacteria | 101831 |
| 289 | Ga0209564_1000315 | 3300025295 | Bacteria | 95095 |
| 290 | Ga0209564_1001538 | 3300025295 | Bacteria | 22863 |
| 291 | Ga0209758_1000101 | 3300025297 | Bacteria | 225913 |
| 292 | Ga0209758_1001181 | 3300025297 | Bacteria | 33038 |
| 293 | Ga0209050_1000040 | 3300025298 | Bacteria | 408492 |
| 294 | Ga0209050_1000123 | 3300025298 | Bacteria | 195061 |
| 295 | Ga0209256_1000018 | 3300025299 | Bacteria | 568467 |
| 296 | Ga0209256_1000058 | 3300025299 | Bacteria | 272934 |
| 297 | Ga0209256_1001142 | 3300025299 | Bacteria | 30135 |
| 298 | Ga0209256_1002252 | 3300025299 | Bacteria | 16394 |
| 299 | Ga0209256_1002524 | 3300025299 | Bacteria | 14704 |
| 300 | Ga0209256_1008625 | 3300025299 | Bacteria | 4675 |
| 301 | Ga0207426_1002785 | 3300025302 | Bacteria | 10501 |
| 302 | Ga0209257_1000054 | 3300025304 | Bacteria | 416957 |
| 303 | Ga0209257_1022074 | 3300025304 | Bacteria | 2284 |
| 304 | Ga0207697_10197326 | 3300025315 | Bacteria | 885 |
| 305 | Ga0207655_1001917 | 3300025728 | Bacteria | 17826 |
| 306 | Ga0207655_1002585 | 3300025728 | Bacteria | 14437 |
| 307 | Ga0207655_1087104 | 3300025728 | Bacteria | 1109 |
| 308 | Ga0207682_10007962 | 3300025893 | Bacteria | 4206 |
| 309 | Ga0207682_10139083 | 3300025893 | Bacteria | 1089 |
| 310 | Ga0207642_10058223 | 3300025899 | Bacteria | 1782 |
| 311 | Ga0207688_10219599 | 3300025901 | Bacteria | 1145 |
| 312 | Ga0207680_10013820 | 3300025903 | Bacteria | 4158 |
| 313 | Ga0207645_10009451 | 3300025907 | Bacteria | 6743 |
| 314 | Ga0207645_10075307 | 3300025907 | Bacteria | 2160 |
| 315 | Ga0207645_10245722 | 3300025907 | Bacteria | 1183 |
| 316 | Ga0207643_10192237 | 3300025908 | Bacteria | 1239 |
| 317 | Ga0207643_10259738 | 3300025908 | Bacteria | 1072 |
| 318 | Ga0207705_10007914 | 3300025909 | Bacteria | 7800 |
| 319 | Ga0207705_10150054 | 3300025909 | Bacteria | 1746 |
| 320 | Ga0207705_10507884 | 3300025909 | Bacteria | 936 |
| 321 | Ga0207695_10003241 | 3300025913 | Bacteria | 23170 |
| 322 | Ga0207695_10004922 | 3300025913 | Bacteria | 18003 |
| 323 | Ga0207671_10010224 | 3300025914 | Bacteria | 7766 |
| 324 | Ga0207671_10012953 | 3300025914 | Bacteria | 6674 |
| 325 | Ga0207693_10349281 | 3300025915 | Bacteria | 1157 |
| 326 | Ga0207662_10002613 | 3300025918 | Bacteria | 9088 |
| 327 | Ga0207657_10001836 | 3300025919 | Bacteria | 22933 |
| 328 | Ga0207657_10029728 | 3300025919 | Bacteria | 4969 |
| 329 | Ga0207657_10104136 | 3300025919 | Bacteria | 2351 |
| 330 | Ga0207649_10031155 | 3300025920 | Bacteria | 3167 |
| 331 | Ga0207649_10156682 | 3300025920 | Bacteria | 1574 |
| 332 | Ga0207652_10005815 | 3300025921 | Bacteria | 10002 |
| 333 | Ga0207681_10004802 | 3300025923 | Bacteria | 8311 |
| 334 | Ga0207681_10130278 | 3300025923 | Bacteria | 1859 |
| 335 | Ga0207681_10261937 | 3300025923 | Bacteria | 1354 |
| 336 | Ga0207694_10000193 | 3300025924 | Bacteria | 61887 |
| 337 | Ga0207694_10068785 | 3300025924 | Bacteria | 2765 |
| 338 | Ga0207694_10215926 | 3300025924 | Bacteria | 1563 |
| 339 | Ga0207650_10004090 | 3300025925 | Bacteria | 9960 |
| 340 | Ga0207650_10114481 | 3300025925 | Bacteria | 2092 |
| 341 | Ga0207650_10471805 | 3300025925 | Bacteria | 1046 |
| 342 | Ga0207659_10053371 | 3300025926 | Bacteria | 2883 |
| 343 | Ga0207659_10119689 | 3300025926 | Bacteria | 2016 |
| 344 | Ga0207659_10187089 | 3300025926 | Bacteria | 1645 |
| 345 | Ga0207659_10469214 | 3300025926 | Bacteria | 1062 |
| 346 | Ga0207687_10131789 | 3300025927 | Bacteria | 1885 |
| 347 | Ga0207644_10007449 | 3300025931 | Bacteria | 7135 |
| 348 | Ga0207644_10182581 | 3300025931 | Bacteria | 1645 |
| 349 | Ga0207690_10004063 | 3300025932 | Bacteria | 8647 |
| 350 | Ga0207690_10021740 | 3300025932 | Bacteria | 3982 |
| 351 | Ga0207690_10069485 | 3300025932 | Bacteria | 2423 |
| 352 | Ga0207690_10335909 | 3300025932 | Bacteria | 1191 |
| 353 | Ga0207706_10003874 | 3300025933 | Bacteria | 14233 |
| 354 | Ga0207706_10009517 | 3300025933 | Bacteria | 8921 |
| 355 | Ga0207706_10043365 | 3300025933 | Bacteria | 3986 |
| 356 | Ga0207686_10023622 | 3300025934 | Bacteria | 3553 |
| 357 | Ga0207686_10109241 | 3300025934 | Bacteria | 1862 |
| 358 | Ga0207686_10332017 | 3300025934 | Bacteria | 1139 |
| 359 | Ga0207669_10064183 | 3300025937 | Bacteria | 2271 |
| 360 | Ga0207669_10200684 | 3300025937 | Bacteria | 1447 |
| 361 | Ga0207669_10214007 | 3300025937 | Bacteria | 1409 |
| 362 | Ga0207704_10030838 | 3300025938 | Bacteria | 3012 |
| 363 | Ga0207704_10215592 | 3300025938 | Bacteria | 1416 |
| 364 | Ga0207691_10023398 | 3300025940 | Bacteria | 5815 |
| 365 | Ga0207691_10042166 | 3300025940 | Bacteria | 4207 |
| 366 | Ga0207691_10094288 | 3300025940 | Bacteria | 2679 |
| 367 | Ga0207691_10117245 | 3300025940 | Bacteria | 2362 |
| 368 | Ga0207691_10255047 | 3300025940 | Bacteria | 1513 |
| 369 | Ga0207691_10264903 | 3300025940 | Bacteria | 1481 |
| 370 | Ga0207711_10016963 | 3300025941 | Bacteria | 6049 |
| 371 | Ga0207711_10022414 | 3300025941 | Bacteria | 5280 |
| 372 | Ga0207689_10009199 | 3300025942 | Bacteria | 8545 |
| 373 | Ga0207689_10024820 | 3300025942 | Bacteria | 5026 |
| 374 | Ga0207661_10084711 | 3300025944 | Bacteria | 2626 |
| 375 | Ga0207679_10002742 | 3300025945 | Bacteria | 10896 |
| 376 | Ga0207679_10051912 | 3300025945 | Bacteria | 3004 |
| 377 | Ga0207667_10000946 | 3300025949 | Bacteria | 37051 |
| 378 | Ga0207667_10007809 | 3300025949 | Bacteria | 12787 |
| 379 | Ga0207667_10025505 | 3300025949 | Bacteria | 6468 |
| 380 | Ga0207667_10047499 | 3300025949 | Bacteria | 4543 |
| 381 | Ga0207667_10097646 | 3300025949 | Bacteria | 3032 |
| 382 | Ga0207667_10393649 | 3300025949 | Bacteria | 1411 |
| 383 | Ga0207651_10192944 | 3300025960 | Bacteria | 1626 |
| 384 | Ga0207712_10164794 | 3300025961 | Bacteria | 1726 |
| 385 | Ga0207668_10004465 | 3300025972 | Bacteria | 8226 |
| 386 | Ga0207668_10248073 | 3300025972 | Bacteria | 1444 |
| 387 | Ga0207640_10002854 | 3300025981 | Bacteria | 9268 |
| 388 | Ga0207640_10123798 | 3300025981 | Bacteria | 1858 |
| 389 | Ga0207640_10144246 | 3300025981 | Bacteria | 1740 |
| 390 | Ga0207658_10006432 | 3300025986 | Bacteria | 8017 |
| 391 | Ga0207658_10027327 | 3300025986 | Bacteria | 4007 |
| 392 | Ga0207677_10045580 | 3300026023 | Bacteria | 2929 |
| 393 | Ga0207677_10191446 | 3300026023 | Bacteria | 1618 |
| 394 | Ga0207677_10212389 | 3300026023 | Bacteria | 1546 |
| 395 | Ga0207703_10004840 | 3300026035 | Bacteria | 10958 |
| 396 | Ga0207703_10007247 | 3300026035 | Bacteria | 8818 |
| 397 | Ga0207703_10155663 | 3300026035 | Bacteria | 1997 |
| 398 | Ga0207639_10017985 | 3300026041 | Bacteria | 5015 |
| 399 | Ga0207639_10042297 | 3300026041 | Bacteria | 3414 |
| 400 | Ga0207639_10053261 | 3300026041 | Bacteria | 3087 |
| 401 | Ga0207639_10284816 | 3300026041 | Bacteria | 1455 |
| 402 | Ga0207678_10514647 | 3300026067 | Bacteria | 1044 |
| 403 | Ga0207708_10161090 | 3300026075 | Bacteria | 1772 |
| 404 | Ga0207702_10059880 | 3300026078 | Bacteria | 3245 |
| 405 | Ga0207702_10792858 | 3300026078 | Bacteria | 936 |
| 406 | Ga0207641_10012562 | 3300026088 | Bacteria | 6942 |
| 407 | Ga0207641_10045484 | 3300026088 | Bacteria | 3696 |
| 408 | Ga0207641_10142731 | 3300026088 | Bacteria | 2162 |
| 409 | Ga0207648_10014995 | 3300026089 | Bacteria | 7139 |
| 410 | Ga0207648_10073729 | 3300026089 | Bacteria | 2975 |
| 411 | Ga0207648_10105638 | 3300026089 | Bacteria | 2470 |
| 412 | Ga0207676_10160692 | 3300026095 | Bacteria | 1946 |
| 413 | Ga0207676_10216584 | 3300026095 | Bacteria | 1702 |
| 414 | Ga0207676_10275111 | 3300026095 | Bacteria | 1526 |
| 415 | Ga0207675_100004479 | 3300026118 | Bacteria | 13502 |
| 416 | Ga0207675_100286924 | 3300026118 | Bacteria | 1600 |
| 417 | Ga0207683_10019240 | 3300026121 | Bacteria | 5830 |
| 418 | Ga0207683_10027233 | 3300026121 | Bacteria | 4939 |
| 419 | Ga0207683_10131915 | 3300026121 | Bacteria | 2248 |
| 420 | Ga0207698_10005137 | 3300026142 | Bacteria | 8045 |
| 421 | Ga0207698_10031618 | 3300026142 | Bacteria | 3823 |
| 422 | Ga0207698_10034855 | 3300026142 | Bacteria | 3675 |
| 423 | Ga0207698_10284895 | 3300026142 | Bacteria | 1530 |
| 424 | Ga0209281_1000151 | 3300027111 | Bacteria | 167268 |
| 425 | Ga0209281_1003261 | 3300027111 | Bacteria | 5506 |
| 426 | Ga0209282_1000014 | 3300027666 | Bacteria | 207318 |
| 427 | Ga0268266_10561043 | 3300028379 | Bacteria | 1095 |
| 428 | Ga0268265_10008762 | 3300028380 | Bacteria | 6835 |
| 429 | Ga0268264_10002117 | 3300028381 | Bacteria | 17697 |
| 430 | Ga0268264_10009653 | 3300028381 | Bacteria | 7994 |
| 431 | Ga0268264_10104767 | 3300028381 | Bacteria | 2466 |
| 432 | Ga0265323_10009697 | 3300028653 | Bacteria | 3923 |
| 433 | Ga0307515_10000432 | 3300028794 | Bacteria | 100348 |
| 434 | Ga0307515_10005908 | 3300028794 | Bacteria | 24693 |
| 435 | Ga0307515_10024457 | 3300028794 | Bacteria | 10523 |
| 436 | Ga0316177_1029947 | 3300030731 | Bacteria | 4994 |
| 437 | Ga0316182_1085102 | 3300030745 | Bacteria | 1099 |
| 438 | Ga0265325_10006514 | 3300031241 | Bacteria | 7081 |
| 439 | Ga0265329_10000056 | 3300031242 | Bacteria | 49127 |
| 440 | Ga0265339_10124660 | 3300031249 | Bacteria | 1321 |
| 441 | Ga0265327_10192746 | 3300031251 | Bacteria | 927 |
| 442 | Ga0265316_10000484 | 3300031344 | Bacteria | 45058 |
| 443 | Ga0265316_10023663 | 3300031344 | Bacteria | 5157 |
| 444 | Ga0265316_10100890 | 3300031344 | Bacteria | 2194 |
| 445 | Ga0307408_100002393 | 3300031548 | Bacteria | 13234 |
| 446 | Ga0307408_100030624 | 3300031548 | Bacteria | 3738 |
| 447 | Ga0307408_100235289 | 3300031548 | Bacteria | 1502 |
| 448 | Ga0307408_100424224 | 3300031548 | Bacteria | 1148 |
| 449 | Ga0265313_10006226 | 3300031595 | Bacteria | 8521 |
| 450 | Ga0265314_10005760 | 3300031711 | Bacteria | 11117 |
| 451 | Ga0265342_10000405 | 3300031712 | Bacteria | 47657 |
| 452 | Ga0265342_10001757 | 3300031712 | Bacteria | 19789 |
| 453 | Ga0316576_10014776 | 3300031727 | Bacteria | 5221 |
| 454 | Ga0316578_10000134 | 3300031728 | Bacteria | 18909 |
| 455 | Ga0307516_10000127 | 3300031730 | Bacteria | 90180 |
| 456 | Ga0307516_10003164 | 3300031730 | Bacteria | 21417 |
| 457 | Ga0307516_10013408 | 3300031730 | Bacteria | 8738 |
| 458 | Ga0307516_10157567 | 3300031730 | Bacteria | 2024 |
| 459 | Ga0307405_10039787 | 3300031731 | Bacteria | 2844 |
| 460 | Ga0307518_10067826 | 3300031838 | Bacteria | 2586 |
| 461 | Ga0307412_10138629 | 3300031911 | Bacteria | 1778 |
| 462 | Ga0307409_100025249 | 3300031995 | Bacteria | 4163 |
| 463 | Ga0307416_100032061 | 3300032002 | Bacteria | 3965 |
| 464 | Ga0307416_100142601 | 3300032002 | Bacteria | 2180 |
| 465 | Ga0307414_10013571 | 3300032004 | Bacteria | 4855 |
| 466 | Ga0307414_10044379 | 3300032004 | Bacteria | 3036 |
| 467 | Ga0307411_10061113 | 3300032005 | Bacteria | 2506 |
| 468 | Ga0307415_100020811 | 3300032126 | Bacteria | 4015 |
| 469 | Ga0316593_10023535 | 3300032168 | Bacteria | 1945 |
| 470 | Ga0316596_1015766 | 3300033541 | Bacteria | 1887 |
| 471 | Ga0373954_0002027 | 3300035118 | Bacteria | 8419 |
| 472 | Ga0373946_0066994 | 3300035171 | Bacteria | 1541 |
| 473 | Ga0373962_0031080 | 3300035242 | Bacteria | 1464 |
| 474 | Ga0316574_0012379 | 3300035398 | Bacteria | 4879 |
| 475 | Ga0373931_0054053 | 3300035691 | Bacteria | 2145 |
| 476 | Ga0373935_0085832 | 3300035692 | Bacteria | 2053 |
| 477 | Ga0373933_0182179 | 3300035724 | Bacteria | 1340 |
| 478 | Ga0373947_0223568 | 3300035725 | Bacteria | 1238 |
| 479 | Ga0373937_0045307 | 3300036401 | Bacteria | 4020 |
| 480 | Ga0373937_0218595 | 3300036401 | Bacteria | 1793 |
| 481 | Ga0316584_0021567 | 3300036712 | Bacteria | 4684 |
| 482 | Ga0316584_0135137 | 3300036712 | Bacteria | 1841 |
| 483 | Ga0373925_0119245 | 3300037068 | Bacteria | 2047 |
| 484 | Ga0395899_0000329 | 3300037312 | Bacteria | 60135 |
| 485 | Ga0395899_0000787 | 3300037312 | Bacteria | 31050 |
| 486 | Ga0395899_0019086 | 3300037312 | Bacteria | 5211 |
| 487 | Ga0395899_0138806 | 3300037312 | Bacteria | 1731 |
| 488 | Ga0395900_0012488 | 3300037418 | Bacteria | 8686 |
| 489 | Ga0395900_0099595 | 3300037418 | Bacteria | 2985 |
| 490 | Ga0395900_0376962 | 3300037418 | Bacteria | 1387 |
| 491 | Ga0395900_0378752 | 3300037418 | Bacteria | 1383 |
| 492 | Ga0395900_0812681 | 3300037418 | Bacteria | 862 |
| 493 | Ga0395898_0000283 | 3300037466 | Bacteria | 122630 |
| 494 | Ga0395898_0134878 | 3300037466 | Bacteria | 2364 |
| 495 | Ga0395898_0208690 | 3300037466 | Bacteria | 1863 |
| 496 | Ga0395905_0000703 | 3300037471 | Bacteria | 44419 |
| 497 | Ga0395905_0005750 | 3300037471 | Bacteria | 12609 |
| 498 | Ga0395905_0027360 | 3300037471 | Bacteria | 5377 |
| 499 | Ga0395905_0052947 | 3300037471 | Bacteria | 3799 |
| 500 | Ga0395905_0139583 | 3300037471 | Bacteria | 2280 |
| 501 | Ga0395905_0232058 | 3300037471 | Bacteria | 1725 |
| 502 | Ga0395901_0000881 | 3300038443 | Bacteria | 33019 |
| 503 | Ga0395901_0015819 | 3300038443 | Bacteria | 7687 |
| 504 | Ga0395901_0364545 | 3300038443 | Bacteria | 1489 |
| 505 | Ga0400485_08530 | 3300038735 | Bacteria | 9384 |
| 506 | Ga0400489_08019 | 3300039093 | Bacteria | 3322 |
| 507 | Ga0436361_0136418 | 3300039447 | Bacteria | 7819 |
| 508 | Ga0436361_0279393 | 3300039447 | Bacteria | 1911 |
| 509 | Ga0436361_0391791 | 3300039447 | Bacteria | 42494 |
| 510 | Ga0436361_0438991 | 3300039447 | Bacteria | 100787 |
| 511 | Ga0436361_0599511 | 3300039447 | Bacteria | 4326 |
| 512 | Ga0436361_0674579 | 3300039447 | Bacteria | 5395 |
| 513 | Ga0436361_1059260 | 3300039447 | Bacteria | 1308 |
| 514 | Ga0439441_052679 | 3300042001 | Bacteria | 842 |
| 515 | Ga0450904_000871 | 3300042139 | Bacteria | 4938 |
| 516 | Ga0451577_0001500 | 3300042876 | Bacteria | 30862 |
| 517 | Ga0451577_0009424 | 3300042876 | Bacteria | 9411 |
| 518 | Ga0466969_0000013 | 3300044656 | Bacteria | 111537 |
| 519 | Ga0466972_0000453 | 3300044658 | Bacteria | 21090 |
| 520 | Ga0466972_0003939 | 3300044658 | Bacteria | 7409 |
| 521 | Ga0453683_0042631 | 3300044673 | Bacteria | 2849 |
| 522 | Ga0466965_0000132 | 3300044683 | Bacteria | 21358 |
| 523 | Ga0466965_0000278 | 3300044683 | Bacteria | 16904 |
| 524 | Ga0466965_0048747 | 3300044683 | Bacteria | 2099 |
| 525 | Ga0466965_0122743 | 3300044683 | Bacteria | 1342 |
| 526 | Ga0466965_0168340 | 3300044683 | Bacteria | 1151 |
| 527 | Ga0466966_0016417 | 3300044684 | Bacteria | 4892 |
| 528 | Ga0466966_0020568 | 3300044684 | Bacteria | 4337 |
| 529 | Ga0466966_0044546 | 3300044684 | Bacteria | 2840 |
| 530 | Ga0466961_0049174 | 3300044693 | Bacteria | 2695 |
| 531 | Ga0466964_0000573 | 3300044706 | Bacteria | 11581 |
| 532 | Ga0466964_0018762 | 3300044706 | Bacteria | 2656 |
| 533 | Ga0453684_0000694 | 3300044712 | Bacteria | 119688 |
| 534 | Ga0466968_0012527 | 3300044735 | Bacteria | 3323 |
| 535 | Ga0466968_0143545 | 3300044735 | Bacteria | 1093 |
| 536 | Ga0466970_0267197 | 3300044765 | Bacteria | 960 |
| 537 | Ga0466957_0017868 | 3300044842 | Bacteria | 4160 |
| 538 | Ga0466957_0034529 | 3300044842 | Bacteria | 3034 |
| 539 | Ga0466959_0002428 | 3300045049 | Bacteria | 11908 |
| 540 | Ga0466959_0026613 | 3300045049 | Bacteria | 4287 |
| 541 | Ga0466959_0043954 | 3300045049 | Bacteria | 3291 |
| 542 | Ga0466959_0087527 | 3300045049 | Bacteria | 2240 |
| 543 | Ga0451576_0008355 | 3300045051 | Bacteria | 12162 |
| 544 | Ga0451576_0127712 | 3300045051 | Bacteria | 2649 |
| 545 | Ga0451576_0739525 | 3300045051 | Bacteria | 1033 |
| 546 | Ga0466958_0039431 | 3300045836 | Bacteria | 2838 |
| 547 | Ga0466967_0132012 | 3300045976 | Bacteria | 2319 |
| 548 | Ga0466967_0163069 | 3300045976 | Bacteria | 2093 |
| 549 | Ga0495617_000128 | 3300046452 | Bacteria | 50370 |
| 550 | Ga0495617_001419 | 3300046452 | Bacteria | 10526 |
| 551 | Ga0495617_001910 | 3300046452 | Bacteria | 8763 |
| 552 | Ga0495617_085941 | 3300046452 | Bacteria | 1028 |
| 553 | Ga0495627_000004 | 3300046453 | Bacteria | 640612 |
| 554 | Ga0495627_028838 | 3300046453 | Bacteria | 1770 |
| 555 | Ga0495592_0010789 | 3300046454 | Bacteria | 6890 |
| 556 | Ga0495603_0002466 | 3300046455 | Bacteria | 10887 |
| 557 | Ga0495590_0000014 | 3300046457 | Bacteria | 258314 |
| 558 | Ga0495590_0001614 | 3300046457 | Bacteria | 9648 |
| 559 | Ga0495590_0001672 | 3300046457 | Bacteria | 9440 |
| 560 | Ga0495590_0014643 | 3300046457 | Bacteria | 2860 |
| 561 | Ga0495590_0029243 | 3300046457 | Bacteria | 1932 |
| 562 | Ga0495629_0006457 | 3300046459 | Bacteria | 8688 |
| 563 | Ga0495629_0024599 | 3300046459 | Bacteria | 4288 |
| 564 | Ga0495638_0000064 | 3300046460 | Bacteria | 180807 |
| 565 | Ga0495638_0004227 | 3300046460 | Bacteria | 10928 |
| 566 | Ga0495638_0056035 | 3300046460 | Bacteria | 2446 |
| 567 | Ga0495638_0155969 | 3300046460 | Bacteria | 1321 |
| 568 | Ga0495651_0003413 | 3300046462 | Bacteria | 12184 |
| 569 | Ga0495653_0000056 | 3300046463 | Bacteria | 100732 |
| 570 | Ga0495653_0035719 | 3300046463 | Bacteria | 3919 |
| 571 | Ga0495653_0228620 | 3300046463 | Bacteria | 1246 |
| 572 | Ga0495650_0000062 | 3300046471 | Bacteria | 277977 |
| 573 | Ga0495650_0000283 | 3300046471 | Bacteria | 96503 |
| 574 | Ga0495650_0001144 | 3300046471 | Bacteria | 28755 |
| 575 | Ga0495650_0001153 | 3300046471 | Bacteria | 28463 |
| 576 | Ga0495650_0014839 | 3300046471 | Bacteria | 4025 |
| 577 | Ga0495650_0032504 | 3300046471 | Bacteria | 2332 |
| 578 | Ga0495650_0033108 | 3300046471 | Bacteria | 2303 |
| 579 | Ga0495580_0226975 | 3300046472 | Bacteria | 1282 |
| 580 | Ga0495582_0104406 | 3300046473 | Bacteria | 1588 |
| 581 | Ga0495605_0000127 | 3300046474 | Bacteria | 100664 |
| 582 | Ga0495605_0000225 | 3300046474 | Bacteria | 69738 |
| 583 | Ga0495605_0001850 | 3300046474 | Bacteria | 13537 |
| 584 | Ga0495605_0018816 | 3300046474 | Bacteria | 3697 |
| 585 | Ga0495605_0026919 | 3300046474 | Bacteria | 2983 |
| 586 | Ga0495605_0123489 | 3300046474 | Bacteria | 1172 |
| 587 | Ga0495605_0128194 | 3300046474 | Bacteria | 1146 |
| 588 | Ga0495584_0000040 | 3300046491 | Bacteria | 91797 |
| 589 | Ga0495584_0001407 | 3300046491 | Bacteria | 14482 |
| 590 | Ga0495584_0001529 | 3300046491 | Bacteria | 13753 |
| 591 | Ga0495584_0002355 | 3300046491 | Bacteria | 10769 |
| 592 | Ga0495584_0005114 | 3300046491 | Bacteria | 6967 |
| 593 | Ga0495584_0005804 | 3300046491 | Bacteria | 6508 |
| 594 | Ga0495584_0016289 | 3300046491 | Bacteria | 3790 |
| 595 | Ga0495584_0027869 | 3300046491 | Bacteria | 2861 |
| 596 | Ga0495584_0125292 | 3300046491 | Bacteria | 1302 |
| 597 | Ga0495585_0000230 | 3300046492 | Bacteria | 57614 |
| 598 | Ga0495585_0000566 | 3300046492 | Bacteria | 34921 |
| 599 | Ga0495585_0000776 | 3300046492 | Bacteria | 28221 |
| 600 | Ga0495585_0003019 | 3300046492 | Bacteria | 11596 |
| 601 | Ga0495585_0003507 | 3300046492 | Bacteria | 10582 |
| 602 | Ga0495585_0046525 | 3300046492 | Bacteria | 2419 |
| 603 | Ga0495585_0070037 | 3300046492 | Bacteria | 1913 |
| 604 | Ga0495585_0100033 | 3300046492 | Bacteria | 1551 |
| 605 | Ga0495585_0180470 | 3300046492 | Bacteria | 1085 |
| 606 | Ga0495594_0012651 | 3300046499 | Bacteria | 4399 |
| 607 | Ga0495594_0079993 | 3300046499 | Bacteria | 1824 |
| 608 | Ga0495596_0000671 | 3300046500 | Bacteria | 21298 |
| 609 | Ga0495596_0001532 | 3300046500 | Bacteria | 13180 |
| 610 | Ga0495596_0006464 | 3300046500 | Bacteria | 5387 |
| 611 | Ga0495596_0007938 | 3300046500 | Bacteria | 4749 |
| 612 | Ga0495607_0000853 | 3300046501 | Bacteria | 28749 |
| 613 | Ga0495607_0001656 | 3300046501 | Bacteria | 19266 |
| 614 | Ga0495607_0001772 | 3300046501 | Bacteria | 18457 |
| 615 | Ga0495607_0003675 | 3300046501 | Bacteria | 11640 |
| 616 | Ga0495607_0036798 | 3300046501 | Bacteria | 2946 |
| 617 | Ga0495607_0256282 | 3300046501 | Bacteria | 840 |
| 618 | Ga0495583_0000046 | 3300046506 | Bacteria | 218059 |
| 619 | Ga0495583_0000137 | 3300046506 | Bacteria | 123815 |
| 620 | Ga0495583_0000156 | 3300046506 | Bacteria | 114296 |
| 621 | Ga0495583_0000231 | 3300046506 | Bacteria | 93091 |
| 622 | Ga0495583_0000287 | 3300046506 | Bacteria | 80398 |
| 623 | Ga0495583_0001530 | 3300046506 | Bacteria | 22917 |
| 624 | Ga0495583_0001556 | 3300046506 | Bacteria | 22704 |
| 625 | Ga0495583_0004187 | 3300046506 | Bacteria | 10504 |
| 626 | Ga0495606_0000353 | 3300046507 | Bacteria | 78700 |
| 627 | Ga0495606_0000400 | 3300046507 | Bacteria | 73341 |
| 628 | Ga0495606_0000589 | 3300046507 | Bacteria | 57638 |
| 629 | Ga0495606_0000933 | 3300046507 | Bacteria | 43050 |
| 630 | Ga0495606_0001708 | 3300046507 | Bacteria | 28313 |
| 631 | Ga0495606_0002937 | 3300046507 | Bacteria | 18821 |
| 632 | Ga0495606_0006490 | 3300046507 | Bacteria | 10762 |
| 633 | Ga0495606_0067300 | 3300046507 | Bacteria | 2268 |
| 634 | Ga0495608_0018854 | 3300046511 | Bacteria | 4754 |
| 635 | Ga0495610_0000027 | 3300046512 | Bacteria | 275273 |
| 636 | Ga0495610_0001111 | 3300046512 | Bacteria | 24494 |
| 637 | Ga0495610_0016864 | 3300046512 | Bacteria | 4185 |
| 638 | Ga0495610_0036421 | 3300046512 | Bacteria | 2514 |
| 639 | Ga0495616_0000072 | 3300046513 | Bacteria | 87767 |
| 640 | Ga0495616_0002779 | 3300046513 | Bacteria | 11431 |
| 641 | Ga0495616_0009303 | 3300046513 | Bacteria | 5759 |
| 642 | Ga0495616_0059252 | 3300046513 | Bacteria | 1883 |
| 643 | Ga0495616_0070870 | 3300046513 | Bacteria | 1686 |
| 644 | Ga0495616_0221880 | 3300046513 | Bacteria | 822 |
| 645 | Ga0495618_0021041 | 3300046514 | Bacteria | 4019 |
| 646 | Ga0495620_0009333 | 3300046515 | Bacteria | 5223 |
| 647 | Ga0495628_0000076 | 3300046516 | Bacteria | 78344 |
| 648 | Ga0495628_0001441 | 3300046516 | Bacteria | 21826 |
| 649 | Ga0495628_0115865 | 3300046516 | Bacteria | 2058 |
| 650 | Ga0495628_0419528 | 3300046516 | Bacteria | 975 |
| 651 | Ga0495631_0000290 | 3300046518 | Bacteria | 35042 |
| 652 | Ga0495631_0001418 | 3300046518 | Bacteria | 14563 |
| 653 | Ga0495631_0015619 | 3300046518 | Bacteria | 3632 |
| 654 | Ga0495631_0038625 | 3300046518 | Bacteria | 2121 |
| 655 | Ga0495632_0000403 | 3300046519 | Bacteria | 40753 |
| 656 | Ga0495632_0004394 | 3300046519 | Bacteria | 9584 |
| 657 | Ga0495637_0000430 | 3300046520 | Bacteria | 30664 |
| 658 | Ga0495637_0009837 | 3300046520 | Bacteria | 4650 |
| 659 | Ga0495637_0010156 | 3300046520 | Bacteria | 4564 |
| 660 | Ga0495643_0000108 | 3300046522 | Bacteria | 136032 |
| 661 | Ga0495643_0000255 | 3300046522 | Bacteria | 78465 |
| 662 | Ga0495643_0000716 | 3300046522 | Bacteria | 38007 |
| 663 | Ga0495643_0001683 | 3300046522 | Bacteria | 19297 |
| 664 | Ga0495643_0020799 | 3300046522 | Bacteria | 3776 |
| 665 | Ga0495643_0049091 | 3300046522 | Bacteria | 2277 |
| 666 | Ga0495643_0067644 | 3300046522 | Bacteria | 1881 |
| 667 | Ga0495643_0131709 | 3300046522 | Bacteria | 1254 |
| 668 | Ga0495644_0005344 | 3300046523 | Bacteria | 5016 |
| 669 | Ga0495644_0020071 | 3300046523 | Bacteria | 2550 |
| 670 | Ga0495644_0026066 | 3300046523 | Bacteria | 2219 |
| 671 | Ga0495648_0000006 | 3300046524 | Bacteria | 361208 |
| 672 | Ga0495648_0000134 | 3300046524 | Bacteria | 87750 |
| 673 | Ga0495648_0000841 | 3300046524 | Bacteria | 32356 |
| 674 | Ga0495648_0002507 | 3300046524 | Bacteria | 16848 |
| 675 | Ga0495648_0014318 | 3300046524 | Bacteria | 5813 |
| 676 | Ga0495648_0023331 | 3300046524 | Bacteria | 4240 |
| 677 | Ga0495648_0035462 | 3300046524 | Bacteria | 3233 |
| 678 | Ga0495648_0045577 | 3300046524 | Bacteria | 2726 |
| 679 | Ga0495648_0076198 | 3300046524 | Bacteria | 1926 |
| 680 | Ga0495663_0003306 | 3300046525 | Bacteria | 4669 |
| 681 | Ga0495666_0009701 | 3300046526 | Bacteria | 4810 |
| 682 | Ga0495666_0015888 | 3300046526 | Bacteria | 3749 |
| 683 | Ga0495642_0000871 | 3300046528 | Bacteria | 14228 |
| 684 | Ga0495642_0002341 | 3300046528 | Bacteria | 7720 |
| 685 | Ga0495642_0002943 | 3300046528 | Bacteria | 6788 |
| 686 | Ga0495642_0003138 | 3300046528 | Bacteria | 6557 |
| 687 | Ga0495642_0004427 | 3300046528 | Bacteria | 5452 |
| 688 | Ga0495652_0005760 | 3300046529 | Bacteria | 11598 |
| 689 | Ga0495652_0140029 | 3300046529 | Bacteria | 1903 |
| 690 | Ga0495654_0000131 | 3300046530 | Bacteria | 80339 |
| 691 | Ga0495654_0007219 | 3300046530 | Bacteria | 6232 |
| 692 | Ga0495654_0024239 | 3300046530 | Bacteria | 3137 |
| 693 | Ga0495654_0033901 | 3300046530 | Bacteria | 2580 |
| 694 | Ga0495665_0065133 | 3300046531 | Bacteria | 1923 |
| 695 | Ga0495586_0025907 | 3300046535 | Bacteria | 3137 |
| 696 | Ga0495587_0083004 | 3300046536 | Bacteria | 1856 |
| 697 | Ga0495609_0000136 | 3300046538 | Bacteria | 77986 |
| 698 | Ga0495609_0001765 | 3300046538 | Bacteria | 13888 |
| 699 | Ga0495609_0006092 | 3300046538 | Bacteria | 6204 |
| 700 | Ga0495609_0026224 | 3300046538 | Bacteria | 2669 |
| 701 | Ga0495621_0109696 | 3300046539 | Bacteria | 1057 |
| 702 | Ga0495597_0000091 | 3300046542 | Bacteria | 80111 |
| 703 | Ga0495597_0000223 | 3300046542 | Bacteria | 51556 |
| 704 | Ga0495597_0000882 | 3300046542 | Bacteria | 23337 |
| 705 | Ga0495597_0000971 | 3300046542 | Bacteria | 22161 |
| 706 | Ga0495597_0001469 | 3300046542 | Bacteria | 16900 |
| 707 | Ga0495597_0007404 | 3300046542 | Bacteria | 5575 |
| 708 | Ga0495597_0034443 | 3300046542 | Bacteria | 2288 |
| 709 | Ga0495597_0052294 | 3300046542 | Bacteria | 1799 |
| 710 | Ga0495645_0016449 | 3300046543 | Bacteria | 5282 |
| 711 | Ga0495645_0055606 | 3300046543 | Bacteria | 2874 |
| 712 | Ga0495622_0000013 | 3300046557 | Bacteria | 186778 |
| 713 | Ga0495622_0005626 | 3300046557 | Bacteria | 5812 |
| 714 | Ga0495622_0115802 | 3300046557 | Bacteria | 1225 |
| 715 | Ga0495622_0224052 | 3300046557 | Bacteria | 832 |
| 716 | Ga0495633_0001545 | 3300046558 | Bacteria | 17672 |
| 717 | Ga0495633_0002191 | 3300046558 | Bacteria | 13994 |
| 718 | Ga0495633_0002981 | 3300046558 | Bacteria | 11576 |
| 719 | Ga0495633_0003195 | 3300046558 | Bacteria | 11064 |
| 720 | Ga0495633_0015631 | 3300046558 | Bacteria | 3934 |
| 721 | Ga0495633_0148610 | 3300046558 | Bacteria | 1082 |
| 722 | Ga0495633_0168873 | 3300046558 | Bacteria | 1008 |
| 723 | Ga0495656_0000675 | 3300046615 | Bacteria | 10967 |
| 724 | Ga0495656_0037159 | 3300046615 | Bacteria | 2009 |
| 725 | Ga0495668_0000029 | 3300046616 | Bacteria | 279128 |
| 726 | Ga0495668_0000119 | 3300046616 | Bacteria | 118812 |
| 727 | Ga0495668_0000209 | 3300046616 | Bacteria | 84817 |
| 728 | Ga0495668_0000359 | 3300046616 | Bacteria | 60366 |
| 729 | Ga0495668_0003302 | 3300046616 | Bacteria | 12217 |
| 730 | Ga0495668_0022417 | 3300046616 | Bacteria | 3609 |
| 731 | Ga0495668_0086796 | 3300046616 | Bacteria | 1716 |
| 732 | Ga0495611_0015040 | 3300046648 | Bacteria | 3307 |
| 733 | Ga0495611_0018009 | 3300046648 | Bacteria | 3026 |
| 734 | Ga0495625_0000871 | 3300046660 | Bacteria | 41066 |
| 735 | Ga0495625_0001309 | 3300046660 | Bacteria | 31061 |
| 736 | Ga0495625_0001595 | 3300046660 | Bacteria | 26843 |
| 737 | Ga0495625_0007432 | 3300046660 | Bacteria | 9533 |
| 738 | Ga0495625_0007978 | 3300046660 | Bacteria | 9097 |
| 739 | Ga0495625_0010041 | 3300046660 | Bacteria | 7868 |
| 740 | Ga0495625_0011228 | 3300046660 | Bacteria | 7324 |
| 741 | Ga0495625_0015358 | 3300046660 | Bacteria | 6067 |
| 742 | Ga0495659_0001898 | 3300046664 | Bacteria | 6884 |
| 743 | Ga0495659_0002191 | 3300046664 | Bacteria | 6372 |
| 744 | Ga0495659_0044416 | 3300046664 | Bacteria | 1598 |
| 745 | Ga0495661_0000979 | 3300046665 | Bacteria | 25811 |
| 746 | Ga0495661_0007457 | 3300046665 | Bacteria | 7631 |
| 747 | Ga0495661_0013316 | 3300046665 | Bacteria | 5529 |
| 748 | Ga0495661_0021185 | 3300046665 | Bacteria | 4239 |
| 749 | Ga0495661_0027022 | 3300046665 | Bacteria | 3688 |
| 750 | Ga0495661_0055997 | 3300046665 | Bacteria | 2361 |
| 751 | Ga0495588_0000091 | 3300046674 | Bacteria | 183183 |
| 752 | Ga0495588_0077315 | 3300046674 | Bacteria | 1735 |
| 753 | Ga0495657_0041222 | 3300046675 | Bacteria | 3162 |
| 754 | Ga0495657_0277382 | 3300046675 | Bacteria | 1004 |
| 755 | Ga0495599_0003657 | 3300046678 | Bacteria | 9015 |
| 756 | Ga0495599_0071047 | 3300046678 | Bacteria | 2173 |
| 757 | Ga0495623_0000743 | 3300046679 | Bacteria | 21830 |
| 758 | Ga0495646_0005231 | 3300046680 | Bacteria | 8180 |
| 759 | Ga0495646_0161407 | 3300046680 | Bacteria | 1240 |
| 760 | Ga0495658_0009494 | 3300046683 | Bacteria | 4851 |
| 761 | Ga0495658_0073811 | 3300046683 | Bacteria | 1987 |
| 762 | Ga0495669_0000021 | 3300046684 | Bacteria | 121650 |
| 763 | Ga0495669_0001117 | 3300046684 | Bacteria | 11129 |
| 764 | Ga0495613_0117767 | 3300046689 | Bacteria | 1910 |
| 765 | Ga0495624_0036851 | 3300046690 | Bacteria | 3150 |
| 766 | Ga0495624_0062485 | 3300046690 | Bacteria | 2329 |
| 767 | Ga0495670_0016780 | 3300046691 | Bacteria | 3600 |
| 768 | Ga0495670_0035008 | 3300046691 | Bacteria | 2502 |
| 769 | Ga0495670_0063015 | 3300046691 | Bacteria | 1866 |
| 770 | Ga0495670_0064268 | 3300046691 | Bacteria | 1848 |
| 771 | Ga0495670_0074575 | 3300046691 | Bacteria | 1721 |
| 772 | Ga0495671_0000106 | 3300046692 | Bacteria | 74947 |
| 773 | Ga0495671_0002593 | 3300046692 | Bacteria | 11369 |
| 774 | Ga0495671_0022032 | 3300046692 | Bacteria | 3341 |
| 775 | Ga0495671_0051785 | 3300046692 | Bacteria | 2041 |
| 776 | Ga0495671_0111413 | 3300046692 | Bacteria | 1336 |
| 777 | Ga0495649_0000549 | 3300046694 | Bacteria | 31847 |
| 778 | Ga0495649_0000709 | 3300046694 | Bacteria | 27174 |
| 779 | Ga0495649_0014906 | 3300046694 | Bacteria | 4442 |
| 780 | Ga0495649_0015177 | 3300046694 | Bacteria | 4385 |
| 781 | Ga0495589_0000269 | 3300046794 | Bacteria | 42228 |
| 782 | Ga0495600_0000340 | 3300046809 | Bacteria | 24902 |
| 783 | Ga0495660_0000823 | 3300046810 | Bacteria | 23073 |
| 784 | Ga0495660_0001854 | 3300046810 | Bacteria | 13878 |
| 785 | Ga0495660_0015627 | 3300046810 | Bacteria | 4386 |
| 786 | Ga0495660_0016122 | 3300046810 | Bacteria | 4310 |
| 787 | Ga0495660_0047240 | 3300046810 | Bacteria | 2358 |
| 788 | Ga0495660_0073796 | 3300046810 | Bacteria | 1803 |
| 789 | Ga0495660_0086344 | 3300046810 | Bacteria | 1637 |
| 790 | Ga0495581_0175579 | 3300047315 | Bacteria | 1252 |
| 791 | Ga0495604_0085636 | 3300047317 | Bacteria | 2351 |
| 792 | Ga0495604_0227925 | 3300047317 | Bacteria | 1279 |
| 793 | Ga0495636_0000933 | 3300047318 | Bacteria | 10904 |
| 794 | Ga0495636_0002175 | 3300047318 | Bacteria | 7515 |
| 795 | Ga0495636_0006937 | 3300047318 | Bacteria | 4455 |
| 796 | Ga0495636_0053940 | 3300047318 | Bacteria | 1688 |
| 797 | Ga0495636_0122325 | 3300047318 | Bacteria | 1152 |
| 798 | Ga0495674_0032572 | 3300047319 | Bacteria | 4727 |
| 799 | Ga0495672_0000088 | 3300047320 | Bacteria | 153860 |
| 800 | Ga0495672_0001122 | 3300047320 | Bacteria | 27137 |
| 801 | Ga0495676_0028858 | 3300047321 | Bacteria | 4732 |
| 802 | Ga0495676_0094213 | 3300047321 | Bacteria | 2231 |
| 803 | Ga0495680_0054419 | 3300047322 | Bacteria | 3108 |
| 804 | Ga0495680_0183159 | 3300047322 | Bacteria | 1510 |
| 805 | Ga0495683_0000125 | 3300047323 | Bacteria | 76538 |
| 806 | Ga0495683_0000892 | 3300047323 | Bacteria | 21047 |
| 807 | Ga0495683_0018689 | 3300047323 | Bacteria | 3581 |
| 808 | Ga0495687_000042 | 3300047443 | Bacteria | 218868 |
| 809 | Ga0495687_000115 | 3300047443 | Bacteria | 122883 |
| 810 | Ga0495687_001828 | 3300047443 | Bacteria | 18701 |
| 811 | Ga0495687_003232 | 3300047443 | Bacteria | 12032 |
| 812 | Ga0495687_003687 | 3300047443 | Bacteria | 10903 |
| 813 | Ga0495687_009013 | 3300047443 | Bacteria | 5634 |
| 814 | Ga0495687_011544 | 3300047443 | Bacteria | 4741 |
| 815 | Ga0495675_0008756 | 3300047444 | Bacteria | 6282 |
| 816 | Ga0495677_0000156 | 3300047445 | Bacteria | 32695 |
| 817 | Ga0495677_0006078 | 3300047445 | Bacteria | 4563 |
| 818 | Ga0495677_0019510 | 3300047445 | Bacteria | 2458 |
| 819 | Ga0495677_0102268 | 3300047445 | Bacteria | 1085 |
| 820 | Ga0495685_000523 | 3300047447 | Bacteria | 11867 |
| 821 | Ga0495685_001719 | 3300047447 | Bacteria | 6743 |
| 822 | Ga0495685_006046 | 3300047447 | Bacteria | 3956 |
| 823 | Ga0495673_0000008 | 3300047469 | Bacteria | 752462 |
| 824 | Ga0495673_0000009 | 3300047469 | Bacteria | 731993 |
| 825 | Ga0495673_0000185 | 3300047469 | Bacteria | 100703 |
| 826 | Ga0495673_0007424 | 3300047469 | Bacteria | 6304 |
| 827 | Ga0495681_0000278 | 3300047470 | Bacteria | 40906 |
| 828 | Ga0495681_0000951 | 3300047470 | Bacteria | 22261 |
| 829 | Ga0495681_0001142 | 3300047470 | Bacteria | 20166 |
| 830 | Ga0495681_0010879 | 3300047470 | Bacteria | 5471 |
| 831 | Ga0495684_0058149 | 3300047471 | Bacteria | 2946 |
| 832 | Ga0495686_0000212 | 3300047472 | Bacteria | 107418 |
| 833 | Ga0495686_0001207 | 3300047472 | Bacteria | 29745 |
| 834 | Ga0495686_0003602 | 3300047472 | Bacteria | 13287 |
| 835 | Ga0495686_0004528 | 3300047472 | Bacteria | 11390 |
| 836 | Ga0495686_0011929 | 3300047472 | Bacteria | 6105 |
| 837 | Ga0495686_0019954 | 3300047472 | Bacteria | 4473 |
| 838 | Ga0495686_0115612 | 3300047472 | Bacteria | 1604 |
| 839 | Ga0495686_0147370 | 3300047472 | Bacteria | 1384 |
| 840 | Ga0495593_0001579 | 3300047673 | Bacteria | 13434 |
| 841 | Ga0495593_0009011 | 3300047673 | Bacteria | 5791 |
| 842 | Ga0495602_0059604 | 3300048088 | Bacteria | 3331 |
| 843 | Ga0495602_0168608 | 3300048088 | Bacteria | 1701 |
| 844 | Ga0495626_0000043 | 3300048091 | Bacteria | 168109 |
| 845 | Ga0495626_0000091 | 3300048091 | Bacteria | 118146 |
| 846 | Ga0495626_0000667 | 3300048091 | Bacteria | 33004 |
| 847 | Ga0495626_0001829 | 3300048091 | Bacteria | 15989 |
| 848 | Ga0495626_0004783 | 3300048091 | Bacteria | 8170 |
| 849 | Ga0495626_0008166 | 3300048091 | Bacteria | 5767 |
| 850 | Ga0495626_0024848 | 3300048091 | Bacteria | 2933 |
| 851 | Ga0495626_0084997 | 3300048091 | Bacteria | 1400 |
| 852 | Ga0496101_0136173 | 3300048904 | Bacteria | 1869 |
| 853 | Ga0496102_0001181 | 3300048905 | Bacteria | 23797 |
| 854 | Ga0496102_0255934 | 3300048905 | Bacteria | 1650 |
| 855 | Ga0496102_0370989 | 3300048905 | Bacteria | 1347 |
| 856 | Ga0496103_0010503 | 3300048906 | Bacteria | 5480 |
| 857 | Ga0496103_0212373 | 3300048906 | Bacteria | 1244 |
| 858 | Ga0496104_0039773 | 3300048907 | Bacteria | 4404 |
| 859 | Ga0496104_0040104 | 3300048907 | Bacteria | 4388 |
| 860 | Ga0496105_0037751 | 3300048908 | Bacteria | 3978 |
| 861 | Ga0496106_0190134 | 3300048909 | Bacteria | 1632 |
| 862 | Ga0496107_0086074 | 3300048910 | Bacteria | 2294 |
| 863 | Ga0496107_0113128 | 3300048910 | Bacteria | 1996 |
| 864 | Ga0496108_0056737 | 3300048911 | Bacteria | 3291 |
| 865 | Ga0496108_0407208 | 3300048911 | Bacteria | 1188 |
| 866 | Ga0496109_0082777 | 3300048912 | Bacteria | 2958 |
| 867 | Ga0496110_0021592 | 3300048913 | Bacteria | 5454 |
| 868 | Ga0496110_0085888 | 3300048913 | Bacteria | 2809 |
| 869 | Ga0496110_0706778 | 3300048913 | Bacteria | 910 |
| 870 | Ga0496111_0003127 | 3300048914 | Bacteria | 10186 |
| 871 | Ga0496111_0503122 | 3300048914 | Bacteria | 892 |
| 872 | Ga0496112_0116693 | 3300048915 | Bacteria | 2640 |
| 873 | Ga0496114_0005135 | 3300048917 | Bacteria | 10210 |
| 874 | Ga0496114_0101555 | 3300048917 | Bacteria | 2456 |
| 875 | Ga0496115_0068854 | 3300048918 | Bacteria | 2866 |
| 876 | Ga0496115_0213154 | 3300048918 | Bacteria | 1595 |
| 877 | Ga0496116_0024641 | 3300048919 | Bacteria | 4444 |
| 878 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 879 | Ga0496117_0016121 | 3300048920 | Bacteria | 6323 |
| 880 | Ga0496118_0000022 | 3300048921 | Bacteria | 438602 |
| 881 | Ga0496118_0014998 | 3300048921 | Bacteria | 7207 |
| 882 | Ga0496121_0009122 | 3300048924 | Bacteria | 11480 |
| 883 | Ga0496121_0102810 | 3300048924 | Bacteria | 2200 |
| 884 | Ga0496122_0000968 | 3300048925 | Bacteria | 51537 |
| 885 | Ga0496122_0006223 | 3300048925 | Bacteria | 13823 |
| 886 | Ga0496122_0009051 | 3300048925 | Bacteria | 10568 |
| 887 | Ga0496122_0012265 | 3300048925 | Bacteria | 8565 |
| 888 | Ga0496122_0267623 | 3300048925 | Bacteria | 944 |
| 889 | Ga0496123_0000983 | 3300048926 | Bacteria | 44022 |
| 890 | Ga0496123_0002475 | 3300048926 | Bacteria | 22799 |
| 891 | Ga0496123_0012980 | 3300048926 | Bacteria | 7039 |
| 892 | Ga0496123_0048162 | 3300048926 | Bacteria | 2870 |
| 893 | Ga0496124_0001001 | 3300048927 | Bacteria | 44775 |
| 894 | Ga0496124_0036741 | 3300048927 | Bacteria | 4268 |
| 895 | Ga0496124_0081285 | 3300048927 | Bacteria | 2664 |
| 896 | Ga0496124_0169625 | 3300048927 | Bacteria | 1692 |
| 897 | Ga0496125_0001086 | 3300048928 | Bacteria | 41927 |
| 898 | Ga0496125_0003905 | 3300048928 | Bacteria | 17598 |
| 899 | Ga0496125_0007199 | 3300048928 | Bacteria | 11860 |
| 900 | Ga0496125_0018481 | 3300048928 | Bacteria | 6620 |
| 901 | Ga0496125_0075761 | 3300048928 | Bacteria | 2601 |
| 902 | Ga0496126_0006515 | 3300048929 | Bacteria | 12994 |
| 903 | Ga0496126_0075641 | 3300048929 | Bacteria | 2988 |
| 904 | Ga0495678_000149 | 3300049459 | Bacteria | 84717 |
| 905 | Ga0495678_000259 | 3300049459 | Bacteria | 59034 |
| 906 | Ga0495678_000652 | 3300049459 | Bacteria | 31953 |
| 907 | Ga0495678_005168 | 3300049459 | Bacteria | 7312 |
| 908 | Ga0495682_0000585 | 3300049460 | Bacteria | 24747 |
| 909 | Ga0495682_0000819 | 3300049460 | Bacteria | 19524 |
| 910 | Ga0495682_0002024 | 3300049460 | Bacteria | 9991 |
| 911 | Ga0495682_0009318 | 3300049460 | Bacteria | 3834 |
| 912 | Ga0501316_007077 | 3300049532 | Bacteria | 1210 |
| 913 | Ga0501031_0275151 | 3300049568 | Bacteria | 1093 |
| 914 | Ga0501032_0185265 | 3300049569 | Bacteria | 1362 |
| 915 | Ga0501033_0001795 | 3300049570 | Bacteria | 18727 |
| 916 | Ga0501036_0136855 | 3300049572 | Bacteria | 2067 |
| 917 | Ga0501038_0637578 | 3300049574 | Bacteria | 803 |
| 918 | Ga0501039_0157376 | 3300049575 | Bacteria | 1785 |
| 919 | Ga0501039_0194198 | 3300049575 | Bacteria | 1596 |
| 920 | Ga0501040_0007105 | 3300049576 | Bacteria | 7253 |
| 921 | Ga0501043_0322791 | 3300049579 | Bacteria | 1177 |
| 922 | Ga0501047_0003401 | 3300049581 | Bacteria | 15066 |
| 923 | Ga0501048_0007051 | 3300049582 | Bacteria | 8537 |
| 924 | Ga0501048_0254721 | 3300049582 | Bacteria | 1247 |
| 925 | Ga0501067_0276512 | 3300049583 | Bacteria | 935 |
| 926 | Ga0501069_0043257 | 3300049585 | Bacteria | 2492 |
| 927 | Ga0501070_0006609 | 3300049586 | Bacteria | 9867 |
| 928 | Ga0501070_0010057 | 3300049586 | Bacteria | 8002 |
| 929 | Ga0501070_0104394 | 3300049586 | Bacteria | 2343 |
| 930 | Ga0501072_0002698 | 3300049588 | Bacteria | 13315 |
| 931 | Ga0501074_0001841 | 3300049590 | Bacteria | 14534 |
| 932 | Ga0501075_0004622 | 3300049591 | Bacteria | 9342 |
| 933 | Ga0501076_0000088 | 3300049592 | Bacteria | 48517 |
| 934 | Ga0501077_0040395 | 3300049593 | Bacteria | 2972 |
| 935 | Ga0501230_000829 | 3300049667 | Bacteria | 3417 |
| 936 | Ga0501238_005139 | 3300049671 | Bacteria | 1651 |
| 937 | Ga0501079_0001059 | 3300049741 | Bacteria | 19101 |
| 938 | Ga0501080_0474110 | 3300049742 | Bacteria | 1120 |
| 939 | Ga0501081_0010465 | 3300049743 | Bacteria | 6052 |
| 940 | Ga0501269_000164 | 3300049766 | Bacteria | 20408 |
| 941 | Ga0501279_002426 | 3300049775 | Bacteria | 2447 |
| 942 | Ga0501035_0001552 | 3300049822 | Bacteria | 23412 |
| 943 | Ga0501035_0054021 | 3300049822 | Bacteria | 3590 |
| 944 | Ga0501035_0514817 | 3300049822 | Bacteria | 983 |
| 945 | Ga0501044_0000185 | 3300049823 | Bacteria | 77663 |
| 946 | Ga0501044_0001443 | 3300049823 | Bacteria | 27936 |
| 947 | Ga0501044_0275538 | 3300049823 | Bacteria | 1617 |
| 948 | Ga0501045_0004039 | 3300049824 | Bacteria | 10117 |
| 949 | nmdc:mga00v17_126051_c1 | 3300050491 | Bacteria | 1634 |
| 950 | nmdc:mga0n895_378667_c1 | 3300050512 | Bacteria | 1432 |
| 951 | Ga0495601_0002072 | 3300053077 | Bacteria | 11252 |
| 952 | Ga0495619_0128040 | 3300053085 | Bacteria | 1744 |
| 953 | Ga0500595_016546 | 3300053119 | Bacteria | 2744 |
| 954 | Ga0500607_058486 | 3300053121 | Unclassified | 2028 |
| 955 | Ga0500618_000557 | 3300053125 | Bacteria | 23163 |
| 956 | Ga0500618_003629 | 3300053125 | Bacteria | 5224 |
| 957 | Ga0500559_0014184 | 3300053136 | Bacteria | 3368 |
| 958 | Ga0500574_002040 | 3300053141 | Bacteria | 3212 |
| 959 | Ga0500586_000137 | 3300053145 | Bacteria | 13327 |
| 960 | Ga0500619_000170 | 3300053154 | Bacteria | 15695 |
| 961 | Ga0500619_000263 | 3300053154 | Bacteria | 11028 |
| 962 | Ga0587082_036398 | 3300059504 | Bacteria | 883 |
| 963 | Ga0587083_0002118 | 3300059505 | Bacteria | 2408 |
| 964 | Ga0587072_011698 | 3300059643 | Bacteria | 1439 |
| 965 | Ga0501082_0011645 | 3300060353 | Bacteria | 7561 |
| 966 | Ga0530510_0001266 | 3300061734 | Bacteria | 16876 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049582 | Ga0501048_0254721 | Ga0501048_0254721_497_1120 | 195 |
| 2 | 3300049585 | Ga0501069_0043257 | Ga0501069_0043257_468_1277 | 221 |
| 3 | 3300049586 | Ga0501070_0006609 | Ga0501070_0006609_8728_9537 | 221 |
| 4 | 3300049590 | Ga0501074_0001841 | Ga0501074_0001841_6280_7029 | 221 |
| 5 | 3300049742 | Ga0501080_0474110 | Ga0501080_0474110_361_1110 | 221 |
| 6 | 3300046524 | Ga0495648_0076198 | Ga0495648_0076198_22_768 | 226 |
| 7 | 3300047318 | Ga0495636_0122325 | Ga0495636_0122325_266_1012 | 226 |
| 8 | 3300047447 | Ga0495685_006046 | Ga0495685_006046_1785_2513 | 226 |
| 9 | 3300046501 | Ga0495607_0003675 | Ga0495607_0003675_1674_2375 | 227 |
| 10 | 3300046457 | Ga0495590_0001614 | Ga0495590_0001614_7125_7853 | 228 |
| 11 | 3300046530 | Ga0495654_0033901 | Ga0495654_0033901_745_1473 | 228 |
| 12 | 3300048905 | Ga0496102_0370989 | Ga0496102_0370989_607_1335 | 228 |
| 13 | 3300001990 | JGI24737J22298_10007165 | JGI24737J22298_100071653 | 229 |
| 14 | 3300005354 | Ga0070675_100657543 | Ga0070675_1006575432 | 229 |
| 15 | 3300010375 | Ga0105239_10004709 | Ga0105239_1000470912 | 229 |
| 16 | 3300017792 | Ga0163161_10465340 | Ga0163161_104653401 | 229 |
| 17 | 3300025914 | Ga0207671_10012953 | Ga0207671_100129534 | 229 |
| 18 | 3300025981 | Ga0207640_10123798 | Ga0207640_101237983 | 229 |
| 19 | 3300028794 | Ga0307515_10000432 | Ga0307515_1000043276 | 229 |
| 20 | 3300047470 | Ga0495681_0000278 | Ga0495681_0000278_31153_31899 | 229 |
| 21 | 3300047472 | Ga0495686_0003602 | Ga0495686_0003602_10634_11323 | 229 |
| 22 | 3300053121 | Ga0500607_058486 | Ga0500607_058486_18_773 | 229 |
| 23 | iso_pu_bacteria | 2919437846 | 2919441091 | 229 |
| 24 | 3300046810 | Ga0495660_0086344 | Ga0495660_0086344_676_1404 | 230 |
| 25 | 3300005328 | Ga0070676_10449498 | Ga0070676_104494981 | 231 |
| 26 | 3300005339 | Ga0070660_100267634 | Ga0070660_1002676341 | 231 |
| 27 | 3300006237 | Ga0097621_100247032 | Ga0097621_1002470322 | 231 |
| 28 | 3300009098 | Ga0105245_10042161 | Ga0105245_100421612 | 231 |
| 29 | 3300009148 | Ga0105243_10012713 | Ga0105243_100127137 | 231 |
| 30 | 3300010375 | Ga0105239_10694149 | Ga0105239_106941491 | 231 |
| 31 | 3300025728 | Ga0207655_1087104 | Ga0207655_10871042 | 231 |
| 32 | 3300025907 | Ga0207645_10245722 | Ga0207645_102457221 | 231 |
| 33 | 3300025940 | Ga0207691_10117245 | Ga0207691_101172452 | 231 |
| 34 | 3300046674 | Ga0495588_0000091 | Ga0495588_0000091_82294_83040 | 231 |
| 35 | 3300049586 | Ga0501070_0104394 | Ga0501070_0104394_331_1080 | 231 |
| 36 | 3300005288 | Ga0065714_10108397 | Ga0065714_101083972 | 232 |
| 37 | 3300025893 | Ga0207682_10139083 | Ga0207682_101390832 | 232 |
| 38 | 3300025923 | Ga0207681_10130278 | Ga0207681_101302783 | 232 |
| 39 | 3300044712 | Ga0453684_0000694 | Ga0453684_0000694_102898_103644 | 232 |
| 40 | 3300046492 | Ga0495585_0003507 | Ga0495585_0003507_8706_9452 | 232 |
| 41 | 3300046500 | Ga0495596_0006464 | Ga0495596_0006464_4469_5215 | 232 |
| 42 | 3300046557 | Ga0495622_0000013 | Ga0495622_0000013_81958_82704 | 232 |
| 43 | 3300047443 | Ga0495687_000115 | Ga0495687_000115_71815_72561 | 232 |
| 44 | 3300026078 | Ga0207702_10059880 | Ga0207702_100598803 | 233 |
| 45 | 3300026078 | Ga0207702_10792858 | Ga0207702_107928581 | 233 |
| 46 | 3300045976 | Ga0466967_0163069 | Ga0466967_0163069_300_1046 | 233 |
| 47 | 3300046557 | Ga0495622_0115802 | Ga0495622_0115802_41_760 | 233 |
| 48 | 3300047318 | Ga0495636_0053940 | Ga0495636_0053940_916_1662 | 233 |
| 49 | 3300003322 | rootL2_10059351 | rootL2_100593514 | 234 |
| 50 | 3300003575 | Ga0007409J51694_1018111 | Ga0007409J51694_10181111 | 234 |
| 51 | 3300005327 | Ga0070658_10140070 | Ga0070658_101400704 | 234 |
| 52 | 3300005366 | Ga0070659_100025581 | Ga0070659_1000255813 | 234 |
| 53 | 3300005457 | Ga0070662_100071262 | Ga0070662_1000712622 | 234 |
| 54 | 3300005459 | Ga0068867_100154219 | Ga0068867_1001542193 | 234 |
| 55 | 3300005563 | Ga0068855_100155206 | Ga0068855_1001552063 | 234 |
| 56 | 3300005578 | Ga0068854_100284426 | Ga0068854_1002844262 | 234 |
| 57 | 3300005834 | Ga0068851_10039543 | Ga0068851_100395433 | 234 |
| 58 | 3300009093 | Ga0105240_10404556 | Ga0105240_104045562 | 234 |
| 59 | 3300009176 | Ga0105242_10075246 | Ga0105242_100752462 | 234 |
| 60 | 3300009551 | Ga0105238_10072050 | Ga0105238_100720503 | 234 |
| 61 | 3300009551 | Ga0105238_10600016 | Ga0105238_106000162 | 234 |
| 62 | 3300011119 | Ga0105246_10225218 | Ga0105246_102252181 | 234 |
| 63 | 3300013100 | Ga0157373_10187374 | Ga0157373_101873742 | 234 |
| 64 | 3300025909 | Ga0207705_10007914 | Ga0207705_100079144 | 234 |
| 65 | 3300025919 | Ga0207657_10029728 | Ga0207657_100297284 | 234 |
| 66 | 3300025932 | Ga0207690_10069485 | Ga0207690_100694854 | 234 |
| 67 | 3300025934 | Ga0207686_10109241 | Ga0207686_101092414 | 234 |
| 68 | 3300025949 | Ga0207667_10025505 | Ga0207667_1002550510 | 234 |
| 69 | 3300026041 | Ga0207639_10284816 | Ga0207639_102848162 | 234 |
| 70 | 3300026089 | Ga0207648_10105638 | Ga0207648_101056382 | 234 |
| 71 | 3300035171 | Ga0373946_0066994 | Ga0373946_0066994_220_966 | 234 |
| 72 | 3300035692 | Ga0373935_0085832 | Ga0373935_0085832_1201_1947 | 234 |
| 73 | 3300035724 | Ga0373933_0182179 | Ga0373933_0182179_539_1285 | 234 |
| 74 | 3300035725 | Ga0373947_0223568 | Ga0373947_0223568_315_1061 | 234 |
| 75 | 3300036401 | Ga0373937_0218595 | Ga0373937_0218595_122_868 | 234 |
| 76 | 3300037471 | Ga0395905_0027360 | Ga0395905_0027360_4576_5322 | 234 |
| 77 | 3300037471 | Ga0395905_0232058 | Ga0395905_0232058_130_876 | 234 |
| 78 | 3300044683 | Ga0466965_0122743 | Ga0466965_0122743_404_1150 | 234 |
| 79 | 3300044683 | Ga0466965_0168340 | Ga0466965_0168340_330_1076 | 234 |
| 80 | 3300044684 | Ga0466966_0016417 | Ga0466966_0016417_2277_3023 | 234 |
| 81 | 3300044684 | Ga0466966_0044546 | Ga0466966_0044546_1069_1815 | 234 |
| 82 | 3300044706 | Ga0466964_0000573 | Ga0466964_0000573_6843_7589 | 234 |
| 83 | 3300044842 | Ga0466957_0017868 | Ga0466957_0017868_1467_2213 | 234 |
| 84 | 3300045049 | Ga0466959_0043954 | Ga0466959_0043954_2470_3216 | 234 |
| 85 | 3300045049 | Ga0466959_0087527 | Ga0466959_0087527_701_1447 | 234 |
| 86 | 3300045836 | Ga0466958_0039431 | Ga0466958_0039431_1347_2093 | 234 |
| 87 | 3300045976 | Ga0466967_0132012 | Ga0466967_0132012_319_1065 | 234 |
| 88 | 3300046457 | Ga0495590_0029243 | Ga0495590_0029243_698_1444 | 234 |
| 89 | 3300046459 | Ga0495629_0024599 | Ga0495629_0024599_1697_2443 | 234 |
| 90 | 3300046474 | Ga0495605_0000225 | Ga0495605_0000225_30035_30781 | 234 |
| 91 | 3300046491 | Ga0495584_0001407 | Ga0495584_0001407_1015_1761 | 234 |
| 92 | 3300046507 | Ga0495606_0000400 | Ga0495606_0000400_59476_60222 | 234 |
| 93 | 3300046516 | Ga0495628_0115865 | Ga0495628_0115865_276_1022 | 234 |
| 94 | 3300046522 | Ga0495643_0131709 | Ga0495643_0131709_321_1067 | 234 |
| 95 | 3300046524 | Ga0495648_0002507 | Ga0495648_0002507_10391_11137 | 234 |
| 96 | 3300046665 | Ga0495661_0027022 | Ga0495661_0027022_1350_2096 | 234 |
| 97 | 3300046675 | Ga0495657_0277382 | Ga0495657_0277382_136_882 | 234 |
| 98 | 3300046683 | Ga0495658_0009494 | Ga0495658_0009494_925_1671 | 234 |
| 99 | 3300046692 | Ga0495671_0002593 | Ga0495671_0002593_10441_11187 | 234 |
| 100 | 3300046794 | Ga0495589_0000269 | Ga0495589_0000269_32366_33112 | 234 |
| 101 | 3300046810 | Ga0495660_0000823 | Ga0495660_0000823_3637_4383 | 234 |
| 102 | 3300047320 | Ga0495672_0001122 | Ga0495672_0001122_9171_9917 | 234 |
| 103 | 3300047322 | Ga0495680_0054419 | Ga0495680_0054419_1796_2542 | 234 |
| 104 | 3300047443 | Ga0495687_001828 | Ga0495687_001828_936_1682 | 234 |
| 105 | 3300047443 | Ga0495687_003232 | Ga0495687_003232_930_1676 | 234 |
| 106 | 3300047471 | Ga0495684_0058149 | Ga0495684_0058149_365_1111 | 234 |
| 107 | 3300047472 | Ga0495686_0019954 | Ga0495686_0019954_763_1509 | 234 |
| 108 | 3300048091 | Ga0495626_0000091 | Ga0495626_0000091_33237_33983 | 234 |
| 109 | 3300048905 | Ga0496102_0255934 | Ga0496102_0255934_221_1030 | 234 |
| 110 | 3300048906 | Ga0496103_0010503 | Ga0496103_0010503_801_1610 | 234 |
| 111 | 3300048911 | Ga0496108_0407208 | Ga0496108_0407208_51_797 | 234 |
| 112 | 3300048914 | Ga0496111_0503122 | Ga0496111_0503122_95_841 | 234 |
| 113 | 3300048925 | Ga0496122_0012265 | Ga0496122_0012265_1080_1826 | 234 |
| 114 | 3300048926 | Ga0496123_0000983 | Ga0496123_0000983_26443_27189 | 234 |
| 115 | 3300059504 | Ga0587082_036398 | Ga0587082_036398_62_835 | 234 |
| 116 | 3300059505 | Ga0587083_0002118 | Ga0587083_0002118_661_1407 | 234 |
| 117 | 3300059643 | Ga0587072_011698 | Ga0587072_011698_675_1421 | 234 |
| 118 | 3300003322 | rootL2_10082641 | rootL2_100826413 | 235 |
| 119 | 3300009177 | Ga0105248_10231964 | Ga0105248_102319642 | 235 |
| 120 | 3300025254 | Ga0209148_1001530 | Ga0209148_100153011 | 235 |
| 121 | 3300025294 | Ga0209025_1001504 | Ga0209025_100150430 | 235 |
| 122 | 3300046471 | Ga0495650_0000283 | Ga0495650_0000283_82099_82845 | 235 |
| 123 | 3300046474 | Ga0495605_0026919 | Ga0495605_0026919_955_1701 | 235 |
| 124 | 3300046491 | Ga0495584_0001529 | Ga0495584_0001529_8733_9479 | 235 |
| 125 | 3300046506 | Ga0495583_0001530 | Ga0495583_0001530_21563_22309 | 235 |
| 126 | 3300046518 | Ga0495631_0000290 | Ga0495631_0000290_32975_33721 | 235 |
| 127 | 3300046528 | Ga0495642_0000871 | Ga0495642_0000871_477_1223 | 235 |
| 128 | 3300046694 | Ga0495649_0000549 | Ga0495649_0000549_21641_22387 | 235 |
| 129 | 3300046810 | Ga0495660_0047240 | Ga0495660_0047240_1071_1817 | 235 |
| 130 | 3300047445 | Ga0495677_0000156 | Ga0495677_0000156_953_1699 | 235 |
| 131 | 3300047472 | Ga0495686_0011929 | Ga0495686_0011929_4403_5149 | 235 |
| 132 | 3300048091 | Ga0495626_0004783 | Ga0495626_0004783_1304_2050 | 235 |
| 133 | 3300049459 | Ga0495678_000652 | Ga0495678_000652_9522_10268 | 235 |
| 134 | 3300049460 | Ga0495682_0009318 | Ga0495682_0009318_523_1269 | 235 |
| 135 | 3300049569 | Ga0501032_0185265 | Ga0501032_0185265_137_883 | 235 |
| 136 | 3300049574 | Ga0501038_0637578 | Ga0501038_0637578_36_782 | 235 |
| 137 | 3300049583 | Ga0501067_0276512 | Ga0501067_0276512_16_768 | 235 |
| 138 | 3300049586 | Ga0501070_0010057 | Ga0501070_0010057_5982_6728 | 235 |
| 139 | 3300049822 | Ga0501035_0054021 | Ga0501035_0054021_2666_3412 | 235 |
| 140 | 3300049823 | Ga0501044_0275538 | Ga0501044_0275538_246_992 | 235 |
| 141 | 3300006946 | Ga0079104_1000001 | Ga0079104_1000001350 | 236 |
| 142 | 3300015262 | Ga0182007_10018972 | Ga0182007_100189722 | 236 |
| 143 | 3300025934 | Ga0207686_10332017 | Ga0207686_103320172 | 236 |
| 144 | 3300027111 | Ga0209281_1000151 | Ga0209281_100015133 | 236 |
| 145 | 3300037418 | Ga0395900_0376962 | Ga0395900_0376962_638_1372 | 236 |
| 146 | 3300037418 | Ga0395900_0812681 | Ga0395900_0812681_17_745 | 236 |
| 147 | 3300039447 | Ga0436361_0438991 | Ga0436361_0438991_48961_49689 | 236 |
| 148 | 3300046501 | Ga0495607_0000853 | Ga0495607_0000853_24501_25229 | 236 |
| 149 | 3300046506 | Ga0495583_0000137 | Ga0495583_0000137_45647_46375 | 236 |
| 150 | 3300046513 | Ga0495616_0000072 | Ga0495616_0000072_79042_79770 | 236 |
| 151 | 3300046518 | Ga0495631_0001418 | Ga0495631_0001418_3691_4437 | 236 |
| 152 | 3300046518 | Ga0495631_0038625 | Ga0495631_0038625_693_1439 | 236 |
| 153 | 3300046524 | Ga0495648_0014318 | Ga0495648_0014318_3249_3995 | 236 |
| 154 | 3300046542 | Ga0495597_0000971 | Ga0495597_0000971_8799_9545 | 236 |
| 155 | 3300046557 | Ga0495622_0224052 | Ga0495622_0224052_91_819 | 236 |
| 156 | 3300046616 | Ga0495668_0000359 | Ga0495668_0000359_56813_57559 | 236 |
| 157 | 3300046665 | Ga0495661_0021185 | Ga0495661_0021185_233_979 | 236 |
| 158 | 3300046684 | Ga0495669_0000021 | Ga0495669_0000021_88374_89120 | 236 |
| 159 | 3300047469 | Ga0495673_0000008 | Ga0495673_0000008_90819_91547 | 236 |
| 160 | 3300048091 | Ga0495626_0000043 | Ga0495626_0000043_76522_77268 | 236 |
| 161 | 3300048913 | Ga0496110_0085888 | Ga0496110_0085888_1962_2690 | 236 |
| 162 | 3300048913 | Ga0496110_0706778 | Ga0496110_0706778_165_893 | 236 |
| 163 | 3300049570 | Ga0501033_0001795 | Ga0501033_0001795_6257_6991 | 236 |
| 164 | 3300049575 | Ga0501039_0194198 | Ga0501039_0194198_252_986 | 236 |
| 165 | 3300049581 | Ga0501047_0003401 | Ga0501047_0003401_3635_4369 | 236 |
| 166 | 3300049822 | Ga0501035_0001552 | Ga0501035_0001552_6068_6802 | 236 |
| 167 | 3300049823 | Ga0501044_0001443 | Ga0501044_0001443_20251_20985 | 236 |
| 168 | 3300053119 | Ga0500595_016546 | Ga0500595_016546_17_745 | 236 |
| 169 | 3300005343 | Ga0070687_100102571 | Ga0070687_1001025712 | 237 |
| 170 | 3300006358 | Ga0068871_100043305 | Ga0068871_1000433053 | 237 |
| 171 | 3300035398 | Ga0316574_0012379 | Ga0316574_0012379_35_781 | 237 |
| 172 | 3300036712 | Ga0316584_0021567 | Ga0316584_0021567_2645_3391 | 237 |
| 173 | 3300048907 | Ga0496104_0039773 | Ga0496104_0039773_1299_2045 | 237 |
| 174 | 3300048915 | Ga0496112_0116693 | Ga0496112_0116693_797_1543 | 237 |
| 175 | 3300005355 | Ga0070671_100013439 | Ga0070671_1000134397 | 238 |
| 176 | 3300005355 | Ga0070671_100494674 | Ga0070671_1004946741 | 238 |
| 177 | 3300005457 | Ga0070662_100114298 | Ga0070662_1001142982 | 238 |
| 178 | 3300025931 | Ga0207644_10007449 | Ga0207644_100074492 | 238 |
| 179 | 3300025931 | Ga0207644_10182581 | Ga0207644_101825812 | 238 |
| 180 | 3300025933 | Ga0207706_10043365 | Ga0207706_100433652 | 238 |
| 181 | 3300025941 | Ga0207711_10016963 | Ga0207711_100169635 | 238 |
| 182 | 3300026121 | Ga0207683_10027233 | Ga0207683_100272336 | 238 |
| 183 | 3300045051 | Ga0451576_0739525 | Ga0451576_0739525_250_996 | 238 |
| 184 | iso_pu_bacteria | 2511231003 | 2511247489 | 238 |
| 185 | iso_pu_bacteria | 2511231026 | 2511384300 | 238 |
| 186 | iso_pu_bacteria | 2521172590 | 2521560911 | 238 |
| 187 | iso_pu_bacteria | 2548876994 | 2550696641 | 238 |
| 188 | iso_pu_bacteria | 2551306416 | 2553007620 | 238 |
| 189 | iso_pu_bacteria | 2576861424 | 2578338350 | 238 |
| 190 | iso_pu_bacteria | 2600255292 | 2601671231 | 238 |
| 191 | iso_pu_bacteria | 2643221554 | 2643792722 | 238 |
| 192 | iso_pu_bacteria | 2643221603 | 2644028145 | 238 |
| 193 | iso_pu_bacteria | 2643221638 | 2644212842 | 238 |
| 194 | iso_pu_bacteria | 2643221645 | 2644254894 | 238 |
| 195 | iso_pu_bacteria | 2643221664 | 2644359320 | 238 |
| 196 | iso_pu_bacteria | 2738541280 | 2738738255 | 238 |
| 197 | iso_pu_bacteria | 2738541297 | 2738826610 | 238 |
| 198 | iso_pu_bacteria | 2738541300 | 2738842938 | 238 |
| 199 | iso_pu_bacteria | 2738541357 | 2739150407 | 238 |
| 200 | iso_pu_bacteria | 2738543003 | 2739192326 | 238 |
| 201 | iso_pu_bacteria | 2738543018 | 2739273686 | 238 |
| 202 | iso_pu_bacteria | 2738543026 | 2739318803 | 238 |
| 203 | iso_pu_bacteria | 2738543029 | 2739337044 | 238 |
| 204 | iso_pu_bacteria | 2738543030 | 2739342730 | 238 |
| 205 | iso_pu_bacteria | 2808606386 | 2808984255 | 238 |
| 206 | iso_pu_bacteria | 2808606415 | 2809132059 | 238 |
| 207 | iso_pu_bacteria | 2808606419 | 2809151682 | 238 |
| 208 | iso_pu_bacteria | 2818991436 | 2819542297 | 238 |
| 209 | iso_pu_bacteria | 2818991445 | 2819594315 | 238 |
| 210 | iso_pu_bacteria | 2818991449 | 2819618781 | 238 |
| 211 | iso_pu_bacteria | 2821131069 | 2821135322 | 238 |
| 212 | iso_pu_bacteria | 2839094727 | 2839095431 | 238 |
| 213 | iso_pu_bacteria | 2842711865 | 2842717386 | 238 |
| 214 | iso_pu_bacteria | 2852618963 | 2852622858 | 238 |
| 215 | iso_pu_bacteria | 2857547612 | 2857548925 | 238 |
| 216 | iso_pu_bacteria | 2857553236 | 2857556433 | 238 |
| 217 | iso_pu_bacteria | 2857558681 | 2857562167 | 238 |
| 218 | iso_pu_bacteria | 2857564685 | 2857567839 | 238 |
| 219 | iso_pu_bacteria | 2884811622 | 2884811650 | 238 |
| 220 | iso_pu_bacteria | 2884836552 | 2884840708 | 238 |
| 221 | iso_pu_bacteria | 2884852848 | 2884857696 | 238 |
| 222 | iso_pu_bacteria | 2885080285 | 2885080990 | 238 |
| 223 | iso_pu_bacteria | 2889415604 | 2889418852 | 238 |
| 224 | iso_pu_bacteria | 2896154374 | 2896158636 | 238 |
| 225 | iso_pu_bacteria | 2904424332 | 2904427915 | 238 |
| 226 | iso_pu_bacteria | 2904439833 | 2904442466 | 238 |
| 227 | iso_pu_bacteria | 2904530477 | 2904533733 | 238 |
| 228 | iso_pu_bacteria | 2904584206 | 2904589430 | 238 |
| 229 | iso_pu_bacteria | 2904589729 | 2904595133 | 238 |
| 230 | iso_pu_bacteria | 2904601388 | 2904602365 | 238 |
| 231 | iso_pu_bacteria | 2919046199 | 2919050713 | 238 |
| 232 | iso_pu_bacteria | 2919079590 | 2919084908 | 238 |
| 233 | iso_pu_bacteria | 2919476304 | 2919476797 | 238 |
| 234 | iso_pu_bacteria | 2923510766 | 2923514751 | 238 |
| 235 | iso_pu_bacteria | 2928130867 | 2928135647 | 238 |
| 236 | iso_pu_bacteria | 2932410948 | 2932415379 | 238 |
| 237 | iso_pu_bacteria | 2932416698 | 2932421460 | 238 |
| 238 | iso_pu_bacteria | 8048746797 | 8048747327 | 238 |
| 239 | 3300044683 | Ga0466965_0048747 | Ga0466965_0048747_724_1458 | 239 |
| 240 | 3300044842 | Ga0466957_0034529 | Ga0466957_0034529_1369_2103 | 239 |
| 241 | 3300005327 | Ga0070658_10026431 | Ga0070658_100264315 | 240 |
| 242 | 3300005841 | Ga0068863_100038014 | Ga0068863_1000380144 | 240 |
| 243 | 3300025909 | Ga0207705_10150054 | Ga0207705_101500543 | 240 |
| 244 | 3300026088 | Ga0207641_10045484 | Ga0207641_100454844 | 240 |
| 245 | 3300046471 | Ga0495650_0014839 | Ga0495650_0014839_2293_3039 | 240 |
| 246 | 3300046506 | Ga0495583_0000046 | Ga0495583_0000046_58362_59108 | 240 |
| 247 | 3300046507 | Ga0495606_0002937 | Ga0495606_0002937_6754_7500 | 240 |
| 248 | 3300046616 | Ga0495668_0086796 | Ga0495668_0086796_768_1514 | 240 |
| 249 | 3300046660 | Ga0495625_0011228 | Ga0495625_0011228_6208_6954 | 240 |
| 250 | 3300046694 | Ga0495649_0000709 | Ga0495649_0000709_24768_25514 | 240 |
| 251 | 3300048918 | Ga0496115_0213154 | Ga0496115_0213154_25_771 | 240 |
| 252 | 3300053136 | Ga0500559_0014184 | Ga0500559_0014184_130_876 | 240 |
| 253 | 3300038735 | Ga0400485_08530 | Ga0400485_08530_7806_8546 | 241 |
| 254 | 2162886007 | SwRhRL2b_contig_1435602 | SwRhRL2b_0964.00004560 | 242 |
| 255 | 3300002704 | JGI25155J39150_1000170 | JGI25155J39150_100017025 | 242 |
| 256 | 3300002704 | JGI25155J39150_1000681 | JGI25155J39150_10006816 | 242 |
| 257 | 3300002705 | JGI25156J39149_1000293 | JGI25156J39149_10002939 | 242 |
| 258 | 3300002737 | JGI25162J39368_1000148 | JGI25162J39368_100014815 | 242 |
| 259 | 3300002738 | JGI25154J39366_1000260 | JGI25154J39366_10002609 | 242 |
| 260 | 3300002738 | JGI25154J39366_1000267 | JGI25154J39366_100026724 | 242 |
| 261 | 3300002738 | JGI25154J39366_1001696 | JGI25154J39366_10016965 | 242 |
| 262 | 3300002739 | JGI25158J39367_1003777 | JGI25158J39367_10037772 | 242 |
| 263 | 3300002741 | JGI25157J39369_1000327 | JGI25157J39369_10003279 | 242 |
| 264 | 3300002773 | JGI25152J39213_1012831 | JGI25152J39213_10128311 | 242 |
| 265 | 3300002774 | JGI25150J39212_1001790 | JGI25150J39212_10017902 | 242 |
| 266 | 3300002774 | JGI25150J39212_1003475 | JGI25150J39212_10034752 | 242 |
| 267 | 3300002987 | JGI25159J45721_1012602 | JGI25159J45721_10126022 | 242 |
| 268 | 3300002987 | JGI25159J45721_1014381 | JGI25159J45721_10143811 | 242 |
| 269 | 3300003214 | JGI25165J46597_1000030 | JGI25165J46597_100003059 | 242 |
| 270 | 3300003215 | JGI25153J46596_10000527 | JGI25153J46596_1000052715 | 242 |
| 271 | 3300003354 | JGI25160J50197_1024978 | JGI25160J50197_10249782 | 242 |
| 272 | 3300003374 | JGI25161J50226_1005964 | JGI25161J50226_10059642 | 242 |
| 273 | 3300003751 | Ga0055538_1000017 | Ga0055538_1000017241 | 242 |
| 274 | 3300003751 | Ga0055538_1000138 | Ga0055538_100013853 | 242 |
| 275 | 3300003752 | Ga0055539_1000022 | Ga0055539_1000022241 | 242 |
| 276 | 3300003752 | Ga0055539_1000187 | Ga0055539_100018753 | 242 |
| 277 | 3300003756 | Ga0055533_1000030 | Ga0055533_1000030241 | 242 |
| 278 | 3300003756 | Ga0055533_1000189 | Ga0055533_100018953 | 242 |
| 279 | 3300003758 | Ga0055532_1000184 | Ga0055532_100018455 | 242 |
| 280 | 3300003759 | Ga0055525_1000034 | Ga0055525_1000034241 | 242 |
| 281 | 3300003759 | Ga0055525_1000254 | Ga0055525_100025453 | 242 |
| 282 | 3300003761 | Ga0055535_1013432 | Ga0055535_10134322 | 242 |
| 283 | 3300003763 | Ga0055529_1000097 | Ga0055529_100009760 | 242 |
| 284 | 3300003763 | Ga0055529_1001308 | Ga0055529_10013087 | 242 |
| 285 | 3300003771 | Ga0055526_1000030 | Ga0055526_100003059 | 242 |
| 286 | 3300003771 | Ga0055526_1000167 | Ga0055526_100016730 | 242 |
| 287 | 3300003771 | Ga0055526_1000696 | Ga0055526_100069614 | 242 |
| 288 | 3300003771 | Ga0055526_1001016 | Ga0055526_100101627 | 242 |
| 289 | 3300003771 | Ga0055526_1021142 | Ga0055526_10211421 | 242 |
| 290 | 3300003773 | Ga0055537_1000114 | Ga0055537_100011413 | 242 |
| 291 | 3300003784 | Ga0055534_1000398 | Ga0055534_10003987 | 242 |
| 292 | 3300003784 | Ga0055534_1001436 | Ga0055534_10014363 | 242 |
| 293 | 3300003790 | Ga0055528_1000683 | Ga0055528_10006836 | 242 |
| 294 | 3300003790 | Ga0055528_1001913 | Ga0055528_10019135 | 242 |
| 295 | 3300003791 | Ga0055530_10010680 | Ga0055530_100106803 | 242 |
| 296 | 3300003794 | Ga0055531_10018382 | Ga0055531_100183822 | 242 |
| 297 | 3300003841 | Ga0055541_1000015 | Ga0055541_1000015241 | 242 |
| 298 | 3300003841 | Ga0055541_1000122 | Ga0055541_100012213 | 242 |
| 299 | 3300004625 | Ga0055543_1008303 | Ga0055543_10083032 | 242 |
| 300 | 3300005262 | Ga0065165_1000161 | Ga0065165_100016181 | 242 |
| 301 | 3300005262 | Ga0065165_1060300 | Ga0065165_10603002 | 242 |
| 302 | 3300005289 | Ga0065704_10077125 | Ga0065704_100771252 | 242 |
| 303 | 3300005289 | Ga0065704_10175861 | Ga0065704_101758611 | 242 |
| 304 | 3300005327 | Ga0070658_10007092 | Ga0070658_1000709210 | 242 |
| 305 | 3300005328 | Ga0070676_10004199 | Ga0070676_1000419910 | 242 |
| 306 | 3300005328 | Ga0070676_10074245 | Ga0070676_100742452 | 242 |
| 307 | 3300005329 | Ga0070683_100181374 | Ga0070683_1001813742 | 242 |
| 308 | 3300005331 | Ga0070670_100016771 | Ga0070670_1000167719 | 242 |
| 309 | 3300005331 | Ga0070670_100202220 | Ga0070670_1002022202 | 242 |
| 310 | 3300005334 | Ga0068869_100132290 | Ga0068869_1001322902 | 242 |
| 311 | 3300005335 | Ga0070666_10074780 | Ga0070666_100747804 | 242 |
| 312 | 3300005336 | Ga0070680_100009867 | Ga0070680_1000098674 | 242 |
| 313 | 3300005337 | Ga0070682_100012497 | Ga0070682_1000124976 | 242 |
| 314 | 3300005338 | Ga0068868_100039188 | Ga0068868_1000391886 | 242 |
| 315 | 3300005338 | Ga0068868_100054684 | Ga0068868_1000546843 | 242 |
| 316 | 3300005339 | Ga0070660_100003375 | Ga0070660_1000033756 | 242 |
| 317 | 3300005339 | Ga0070660_100321858 | Ga0070660_1003218582 | 242 |
| 318 | 3300005344 | Ga0070661_100009715 | Ga0070661_1000097156 | 242 |
| 319 | 3300005347 | Ga0070668_100059566 | Ga0070668_1000595662 | 242 |
| 320 | 3300005347 | Ga0070668_100144430 | Ga0070668_1001444303 | 242 |
| 321 | 3300005347 | Ga0070668_100574234 | Ga0070668_1005742341 | 242 |
| 322 | 3300005353 | Ga0070669_100050314 | Ga0070669_1000503145 | 242 |
| 323 | 3300005353 | Ga0070669_100379589 | Ga0070669_1003795892 | 242 |
| 324 | 3300005354 | Ga0070675_100016252 | Ga0070675_1000162526 | 242 |
| 325 | 3300005354 | Ga0070675_100035845 | Ga0070675_1000358455 | 242 |
| 326 | 3300005356 | Ga0070674_100007074 | Ga0070674_1000070749 | 242 |
| 327 | 3300005364 | Ga0070673_100072473 | Ga0070673_1000724733 | 242 |
| 328 | 3300005364 | Ga0070673_100373610 | Ga0070673_1003736101 | 242 |
| 329 | 3300005364 | Ga0070673_100572690 | Ga0070673_1005726901 | 242 |
| 330 | 3300005366 | Ga0070659_100005084 | Ga0070659_1000050843 | 242 |
| 331 | 3300005366 | Ga0070659_100047684 | Ga0070659_1000476845 | 242 |
| 332 | 3300005367 | Ga0070667_100031274 | Ga0070667_1000312741 | 242 |
| 333 | 3300005367 | Ga0070667_100051141 | Ga0070667_1000511414 | 242 |
| 334 | 3300005441 | Ga0070700_100253903 | Ga0070700_1002539031 | 242 |
| 335 | 3300005444 | Ga0070694_100152490 | Ga0070694_1001524902 | 242 |
| 336 | 3300005455 | Ga0070663_100056072 | Ga0070663_1000560723 | 242 |
| 337 | 3300005456 | Ga0070678_100113817 | Ga0070678_1001138171 | 242 |
| 338 | 3300005457 | Ga0070662_100004735 | Ga0070662_10000473510 | 242 |
| 339 | 3300005457 | Ga0070662_100020288 | Ga0070662_1000202882 | 242 |
| 340 | 3300005458 | Ga0070681_10141338 | Ga0070681_101413382 | 242 |
| 341 | 3300005459 | Ga0068867_100003983 | Ga0068867_1000039834 | 242 |
| 342 | 3300005459 | Ga0068867_100068393 | Ga0068867_1000683932 | 242 |
| 343 | 3300005471 | Ga0070698_100040134 | Ga0070698_1000401343 | 242 |
| 344 | 3300005530 | Ga0070679_100001135 | Ga0070679_1000011354 | 242 |
| 345 | 3300005535 | Ga0070684_100055097 | Ga0070684_1000550973 | 242 |
| 346 | 3300005536 | Ga0070697_100609112 | Ga0070697_1006091121 | 242 |
| 347 | 3300005539 | Ga0068853_100081877 | Ga0068853_1000818773 | 242 |
| 348 | 3300005539 | Ga0068853_100136891 | Ga0068853_1001368912 | 242 |
| 349 | 3300005539 | Ga0068853_100370259 | Ga0068853_1003702592 | 242 |
| 350 | 3300005543 | Ga0070672_100003086 | Ga0070672_10000308611 | 242 |
| 351 | 3300005543 | Ga0070672_100006477 | Ga0070672_10000647710 | 242 |
| 352 | 3300005543 | Ga0070672_100020307 | Ga0070672_1000203074 | 242 |
| 353 | 3300005547 | Ga0070693_100003885 | Ga0070693_1000038858 | 242 |
| 354 | 3300005549 | Ga0070704_100019965 | Ga0070704_1000199656 | 242 |
| 355 | 3300005563 | Ga0068855_100016431 | Ga0068855_10001643110 | 242 |
| 356 | 3300005563 | Ga0068855_100468323 | Ga0068855_1004683232 | 242 |
| 357 | 3300005563 | Ga0068855_100817558 | Ga0068855_1008175582 | 242 |
| 358 | 3300005564 | Ga0070664_100011679 | Ga0070664_1000116794 | 242 |
| 359 | 3300005564 | Ga0070664_100058114 | Ga0070664_1000581144 | 242 |
| 360 | 3300005577 | Ga0068857_100171310 | Ga0068857_1001713104 | 242 |
| 361 | 3300005578 | Ga0068854_100005545 | Ga0068854_10000554510 | 242 |
| 362 | 3300005578 | Ga0068854_100006914 | Ga0068854_1000069146 | 242 |
| 363 | 3300005614 | Ga0068856_100014658 | Ga0068856_1000146585 | 242 |
| 364 | 3300005614 | Ga0068856_100105392 | Ga0068856_1001053925 | 242 |
| 365 | 3300005616 | Ga0068852_100001864 | Ga0068852_1000018647 | 242 |
| 366 | 3300005616 | Ga0068852_100016051 | Ga0068852_1000160516 | 242 |
| 367 | 3300005616 | Ga0068852_100026218 | Ga0068852_1000262186 | 242 |
| 368 | 3300005616 | Ga0068852_100032708 | Ga0068852_1000327084 | 242 |
| 369 | 3300005616 | Ga0068852_100039754 | Ga0068852_1000397543 | 242 |
| 370 | 3300005616 | Ga0068852_100089122 | Ga0068852_1000891223 | 242 |
| 371 | 3300005617 | Ga0068859_100167420 | Ga0068859_1001674203 | 242 |
| 372 | 3300005618 | Ga0068864_100025908 | Ga0068864_1000259085 | 242 |
| 373 | 3300005618 | Ga0068864_100112595 | Ga0068864_1001125952 | 242 |
| 374 | 3300005718 | Ga0068866_10005780 | Ga0068866_100057802 | 242 |
| 375 | 3300005719 | Ga0068861_100253840 | Ga0068861_1002538402 | 242 |
| 376 | 3300005834 | Ga0068851_10044585 | Ga0068851_100445853 | 242 |
| 377 | 3300005841 | Ga0068863_100025161 | Ga0068863_1000251612 | 242 |
| 378 | 3300005841 | Ga0068863_100058931 | Ga0068863_1000589312 | 242 |
| 379 | 3300005842 | Ga0068858_100001998 | Ga0068858_10000199812 | 242 |
| 380 | 3300005842 | Ga0068858_100039965 | Ga0068858_1000399655 | 242 |
| 381 | 3300005843 | Ga0068860_100006591 | Ga0068860_10000659113 | 242 |
| 382 | 3300005843 | Ga0068860_100007427 | Ga0068860_1000074277 | 242 |
| 383 | 3300005844 | Ga0068862_100025452 | Ga0068862_1000254528 | 242 |
| 384 | 3300006175 | Ga0070712_100474367 | Ga0070712_1004743671 | 242 |
| 385 | 3300006177 | Ga0075362_10011637 | Ga0075362_100116375 | 242 |
| 386 | 3300006237 | Ga0097621_100161101 | Ga0097621_1001611012 | 242 |
| 387 | 3300006237 | Ga0097621_100366525 | Ga0097621_1003665252 | 242 |
| 388 | 3300006237 | Ga0097621_100518447 | Ga0097621_1005184472 | 242 |
| 389 | 3300006358 | Ga0068871_100028510 | Ga0068871_1000285105 | 242 |
| 390 | 3300006881 | Ga0068865_100018012 | Ga0068865_1000180124 | 242 |
| 391 | 3300006931 | Ga0097620_100167407 | Ga0097620_1001674073 | 242 |
| 392 | 3300006946 | Ga0079104_1003285 | Ga0079104_10032857 | 242 |
| 393 | 3300006948 | Ga0099826_10000033 | Ga0099826_1000003364 | 242 |
| 394 | 3300009036 | Ga0105244_10001268 | Ga0105244_1000126814 | 242 |
| 395 | 3300009036 | Ga0105244_10002331 | Ga0105244_1000233116 | 242 |
| 396 | 3300009036 | Ga0105244_10042192 | Ga0105244_100421922 | 242 |
| 397 | 3300009093 | Ga0105240_10001692 | Ga0105240_1000169227 | 242 |
| 398 | 3300009093 | Ga0105240_10025647 | Ga0105240_1002564710 | 242 |
| 399 | 3300009093 | Ga0105240_10396201 | Ga0105240_103962012 | 242 |
| 400 | 3300009094 | Ga0111539_10053128 | Ga0111539_100531283 | 242 |
| 401 | 3300009094 | Ga0111539_11099926 | Ga0111539_110999261 | 242 |
| 402 | 3300009148 | Ga0105243_10085443 | Ga0105243_100854433 | 242 |
| 403 | 3300009148 | Ga0105243_10239384 | Ga0105243_102393843 | 242 |
| 404 | 3300009148 | Ga0105243_10241511 | Ga0105243_102415112 | 242 |
| 405 | 3300009177 | Ga0105248_10074587 | Ga0105248_100745875 | 242 |
| 406 | 3300009177 | Ga0105248_10229035 | Ga0105248_102290352 | 242 |
| 407 | 3300009177 | Ga0105248_10304816 | Ga0105248_103048162 | 242 |
| 408 | 3300009545 | Ga0105237_10020036 | Ga0105237_100200368 | 242 |
| 409 | 3300009551 | Ga0105238_10000255 | Ga0105238_1000025563 | 242 |
| 410 | 3300009551 | Ga0105238_10139346 | Ga0105238_101393463 | 242 |
| 411 | 3300009551 | Ga0105238_10290698 | Ga0105238_102906982 | 242 |
| 412 | 3300009553 | Ga0105249_10038942 | Ga0105249_100389422 | 242 |
| 413 | 3300009553 | Ga0105249_10148454 | Ga0105249_101484543 | 242 |
| 414 | 3300010375 | Ga0105239_10006370 | Ga0105239_100063709 | 242 |
| 415 | 3300010375 | Ga0105239_10053867 | Ga0105239_100538677 | 242 |
| 416 | 3300013100 | Ga0157373_10012943 | Ga0157373_100129437 | 242 |
| 417 | 3300013100 | Ga0157373_10127244 | Ga0157373_101272442 | 242 |
| 418 | 3300013102 | Ga0157371_10000003 | Ga0157371_1000000375 | 242 |
| 419 | 3300013105 | Ga0157369_10074822 | Ga0157369_100748222 | 242 |
| 420 | 3300013296 | Ga0157374_10003229 | Ga0157374_1000322911 | 242 |
| 421 | 3300013296 | Ga0157374_10061688 | Ga0157374_100616884 | 242 |
| 422 | 3300013306 | Ga0163162_10011979 | Ga0163162_100119797 | 242 |
| 423 | 3300013306 | Ga0163162_10012367 | Ga0163162_1001236710 | 242 |
| 424 | 3300013307 | Ga0157372_10058889 | Ga0157372_100588894 | 242 |
| 425 | 3300013308 | Ga0157375_10021719 | Ga0157375_100217193 | 242 |
| 426 | 3300013308 | Ga0157375_10022979 | Ga0157375_100229797 | 242 |
| 427 | 3300013308 | Ga0157375_10061463 | Ga0157375_100614635 | 242 |
| 428 | 3300013308 | Ga0157375_10663720 | Ga0157375_106637202 | 242 |
| 429 | 3300014325 | Ga0163163_10146227 | Ga0163163_101462272 | 242 |
| 430 | 3300014326 | Ga0157380_10044658 | Ga0157380_100446583 | 242 |
| 431 | 3300014326 | Ga0157380_10048785 | Ga0157380_100487853 | 242 |
| 432 | 3300014497 | Ga0182008_10263676 | Ga0182008_102636761 | 242 |
| 433 | 3300014968 | Ga0157379_10013161 | Ga0157379_100131615 | 242 |
| 434 | 3300014968 | Ga0157379_10016872 | Ga0157379_100168721 | 242 |
| 435 | 3300014969 | Ga0157376_10016557 | Ga0157376_100165577 | 242 |
| 436 | 3300014969 | Ga0157376_10233751 | Ga0157376_102337512 | 242 |
| 437 | 3300015261 | Ga0182006_1000007 | Ga0182006_100000763 | 242 |
| 438 | 3300015261 | Ga0182006_1000102 | Ga0182006_100010222 | 242 |
| 439 | 3300015261 | Ga0182006_1034063 | Ga0182006_10340633 | 242 |
| 440 | 3300015262 | Ga0182007_10001496 | Ga0182007_1000149615 | 242 |
| 441 | 3300015262 | Ga0182007_10063366 | Ga0182007_100633661 | 242 |
| 442 | 3300015265 | Ga0182005_1000006 | Ga0182005_1000006389 | 242 |
| 443 | 3300015265 | Ga0182005_1000010 | Ga0182005_100001062 | 242 |
| 444 | 3300015265 | Ga0182005_1000134 | Ga0182005_100013410 | 242 |
| 445 | 3300017792 | Ga0163161_10049369 | Ga0163161_100493695 | 242 |
| 446 | 3300021361 | Ga0213872_10000041 | Ga0213872_1000004146 | 242 |
| 447 | 3300021361 | Ga0213872_10000167 | Ga0213872_1000016747 | 242 |
| 448 | 3300021361 | Ga0213872_10000929 | Ga0213872_1000092916 | 242 |
| 449 | 3300021361 | Ga0213872_10003231 | Ga0213872_100032317 | 242 |
| 450 | 3300021361 | Ga0213872_10069435 | Ga0213872_100694352 | 242 |
| 451 | 3300025206 | Ga0209435_100079 | Ga0209435_10007913 | 242 |
| 452 | 3300025206 | Ga0209435_100657 | Ga0209435_1006574 | 242 |
| 453 | 3300025207 | Ga0209760_100848 | Ga0209760_1008483 | 242 |
| 454 | 3300025208 | Ga0209436_100449 | Ga0209436_1004497 | 242 |
| 455 | 3300025208 | Ga0209436_107310 | Ga0209436_1073102 | 242 |
| 456 | 3300025224 | Ga0209784_100034 | Ga0209784_10003459 | 242 |
| 457 | 3300025224 | Ga0209784_100035 | Ga0209784_100035185 | 242 |
| 458 | 3300025225 | Ga0209566_100038 | Ga0209566_100038240 | 242 |
| 459 | 3300025225 | Ga0209566_100040 | Ga0209566_100040185 | 242 |
| 460 | 3300025226 | Ga0209674_100056 | Ga0209674_10005659 | 242 |
| 461 | 3300025226 | Ga0209674_100057 | Ga0209674_100057185 | 242 |
| 462 | 3300025228 | Ga0209672_105447 | Ga0209672_1054472 | 242 |
| 463 | 3300025229 | Ga0209147_100060 | Ga0209147_100060234 | 242 |
| 464 | 3300025230 | Ga0209563_100057 | Ga0209563_100057240 | 242 |
| 465 | 3300025230 | Ga0209563_100059 | Ga0209563_100059185 | 242 |
| 466 | 3300025231 | Ga0207427_101876 | Ga0207427_10187611 | 242 |
| 467 | 3300025233 | Ga0209437_100071 | Ga0209437_100071240 | 242 |
| 468 | 3300025233 | Ga0209437_100081 | Ga0209437_100081214 | 242 |
| 469 | 3300025242 | Ga0209258_100141 | Ga0209258_1001412 | 242 |
| 470 | 3300025242 | Ga0209258_107060 | Ga0209258_1070602 | 242 |
| 471 | 3300025245 | Ga0207425_1000009 | Ga0207425_1000009517 | 242 |
| 472 | 3300025245 | Ga0207425_1000068 | Ga0207425_1000068104 | 242 |
| 473 | 3300025245 | Ga0207425_1001046 | Ga0207425_10010466 | 242 |
| 474 | 3300025246 | Ga0209646_1000251 | Ga0209646_100025148 | 242 |
| 475 | 3300025246 | Ga0209646_1000265 | Ga0209646_100026552 | 242 |
| 476 | 3300025246 | Ga0209646_1000290 | Ga0209646_100029013 | 242 |
| 477 | 3300025250 | Ga0209026_1000330 | Ga0209026_100033052 | 242 |
| 478 | 3300025253 | Ga0209677_100035 | Ga0209677_10003559 | 242 |
| 479 | 3300025253 | Ga0209677_100036 | Ga0209677_100036185 | 242 |
| 480 | 3300025256 | Ga0209759_1000473 | Ga0209759_100047340 | 242 |
| 481 | 3300025256 | Ga0209759_1000485 | Ga0209759_100048530 | 242 |
| 482 | 3300025258 | Ga0209129_1000061 | Ga0209129_1000061163 | 242 |
| 483 | 3300025261 | Ga0209233_1000094 | Ga0209233_1000094240 | 242 |
| 484 | 3300025263 | Ga0209565_1000032 | Ga0209565_100003258 | 242 |
| 485 | 3300025263 | Ga0209565_1001187 | Ga0209565_100118715 | 242 |
| 486 | 3300025263 | Ga0209565_1005779 | Ga0209565_10057792 | 242 |
| 487 | 3300025263 | Ga0209565_1006593 | Ga0209565_10065934 | 242 |
| 488 | 3300025263 | Ga0209565_1007733 | Ga0209565_10077333 | 242 |
| 489 | 3300025272 | Ga0209455_1000031 | Ga0209455_1000031424 | 242 |
| 490 | 3300025272 | Ga0209455_1000820 | Ga0209455_100082013 | 242 |
| 491 | 3300025272 | Ga0209455_1003128 | Ga0209455_10031282 | 242 |
| 492 | 3300025273 | Ga0209673_1000029 | Ga0209673_100002983 | 242 |
| 493 | 3300025273 | Ga0209673_1004770 | Ga0209673_10047706 | 242 |
| 494 | 3300025284 | Ga0209130_1000833 | Ga0209130_100083329 | 242 |
| 495 | 3300025284 | Ga0209130_1001452 | Ga0209130_10014522 | 242 |
| 496 | 3300025284 | Ga0209130_1002479 | Ga0209130_10024797 | 242 |
| 497 | 3300025291 | Ga0209675_1000019 | Ga0209675_1000019260 | 242 |
| 498 | 3300025291 | Ga0209675_1001158 | Ga0209675_10011584 | 242 |
| 499 | 3300025294 | Ga0209025_1020665 | Ga0209025_10206653 | 242 |
| 500 | 3300025295 | Ga0209564_1000010 | Ga0209564_100001078 | 242 |
| 501 | 3300025295 | Ga0209564_1000067 | Ga0209564_1000067278 | 242 |
| 502 | 3300025295 | Ga0209564_1000291 | Ga0209564_100029154 | 242 |
| 503 | 3300025295 | Ga0209564_1000315 | Ga0209564_100031539 | 242 |
| 504 | 3300025295 | Ga0209564_1001538 | Ga0209564_100153819 | 242 |
| 505 | 3300025297 | Ga0209758_1000101 | Ga0209758_100010167 | 242 |
| 506 | 3300025297 | Ga0209758_1001181 | Ga0209758_100118117 | 242 |
| 507 | 3300025298 | Ga0209050_1000040 | Ga0209050_1000040379 | 242 |
| 508 | 3300025298 | Ga0209050_1000123 | Ga0209050_1000123182 | 242 |
| 509 | 3300025299 | Ga0209256_1000018 | Ga0209256_1000018476 | 242 |
| 510 | 3300025299 | Ga0209256_1000058 | Ga0209256_100005831 | 242 |
| 511 | 3300025299 | Ga0209256_1001142 | Ga0209256_100114220 | 242 |
| 512 | 3300025299 | Ga0209256_1002252 | Ga0209256_100225223 | 242 |
| 513 | 3300025299 | Ga0209256_1002524 | Ga0209256_100252414 | 242 |
| 514 | 3300025299 | Ga0209256_1008625 | Ga0209256_10086253 | 242 |
| 515 | 3300025302 | Ga0207426_1002785 | Ga0207426_10027852 | 242 |
| 516 | 3300025304 | Ga0209257_1000054 | Ga0209257_100005420 | 242 |
| 517 | 3300025304 | Ga0209257_1022074 | Ga0209257_10220741 | 242 |
| 518 | 3300025315 | Ga0207697_10197326 | Ga0207697_101973261 | 242 |
| 519 | 3300025728 | Ga0207655_1001917 | Ga0207655_100191711 | 242 |
| 520 | 3300025728 | Ga0207655_1002585 | Ga0207655_100258516 | 242 |
| 521 | 3300025893 | Ga0207682_10007962 | Ga0207682_100079623 | 242 |
| 522 | 3300025899 | Ga0207642_10058223 | Ga0207642_100582232 | 242 |
| 523 | 3300025901 | Ga0207688_10219599 | Ga0207688_102195991 | 242 |
| 524 | 3300025903 | Ga0207680_10013820 | Ga0207680_100138201 | 242 |
| 525 | 3300025907 | Ga0207645_10009451 | Ga0207645_1000945110 | 242 |
| 526 | 3300025907 | Ga0207645_10075307 | Ga0207645_100753072 | 242 |
| 527 | 3300025908 | Ga0207643_10192237 | Ga0207643_101922372 | 242 |
| 528 | 3300025908 | Ga0207643_10259738 | Ga0207643_102597381 | 242 |
| 529 | 3300025909 | Ga0207705_10507884 | Ga0207705_105078841 | 242 |
| 530 | 3300025913 | Ga0207695_10003241 | Ga0207695_1000324121 | 242 |
| 531 | 3300025913 | Ga0207695_10004922 | Ga0207695_100049228 | 242 |
| 532 | 3300025914 | Ga0207671_10010224 | Ga0207671_100102242 | 242 |
| 533 | 3300025915 | Ga0207693_10349281 | Ga0207693_103492812 | 242 |
| 534 | 3300025918 | Ga0207662_10002613 | Ga0207662_100026134 | 242 |
| 535 | 3300025919 | Ga0207657_10001836 | Ga0207657_100018368 | 242 |
| 536 | 3300025919 | Ga0207657_10104136 | Ga0207657_101041363 | 242 |
| 537 | 3300025920 | Ga0207649_10031155 | Ga0207649_100311553 | 242 |
| 538 | 3300025920 | Ga0207649_10156682 | Ga0207649_101566822 | 242 |
| 539 | 3300025921 | Ga0207652_10005815 | Ga0207652_100058154 | 242 |
| 540 | 3300025923 | Ga0207681_10004802 | Ga0207681_1000480211 | 242 |
| 541 | 3300025923 | Ga0207681_10261937 | Ga0207681_102619371 | 242 |
| 542 | 3300025924 | Ga0207694_10000193 | Ga0207694_1000019316 | 242 |
| 543 | 3300025924 | Ga0207694_10068785 | Ga0207694_100687855 | 242 |
| 544 | 3300025924 | Ga0207694_10215926 | Ga0207694_102159261 | 242 |
| 545 | 3300025925 | Ga0207650_10004090 | Ga0207650_100040904 | 242 |
| 546 | 3300025925 | Ga0207650_10114481 | Ga0207650_101144812 | 242 |
| 547 | 3300025925 | Ga0207650_10471805 | Ga0207650_104718052 | 242 |
| 548 | 3300025926 | Ga0207659_10053371 | Ga0207659_100533712 | 242 |
| 549 | 3300025926 | Ga0207659_10119689 | Ga0207659_101196893 | 242 |
| 550 | 3300025926 | Ga0207659_10187089 | Ga0207659_101870892 | 242 |
| 551 | 3300025926 | Ga0207659_10469214 | Ga0207659_104692142 | 242 |
| 552 | 3300025927 | Ga0207687_10131789 | Ga0207687_101317892 | 242 |
| 553 | 3300025932 | Ga0207690_10004063 | Ga0207690_1000406311 | 242 |
| 554 | 3300025932 | Ga0207690_10021740 | Ga0207690_100217404 | 242 |
| 555 | 3300025932 | Ga0207690_10335909 | Ga0207690_103359092 | 242 |
| 556 | 3300025933 | Ga0207706_10003874 | Ga0207706_1000387411 | 242 |
| 557 | 3300025933 | Ga0207706_10009517 | Ga0207706_100095174 | 242 |
| 558 | 3300025934 | Ga0207686_10023622 | Ga0207686_100236223 | 242 |
| 559 | 3300025937 | Ga0207669_10064183 | Ga0207669_100641834 | 242 |
| 560 | 3300025937 | Ga0207669_10200684 | Ga0207669_102006841 | 242 |
| 561 | 3300025937 | Ga0207669_10214007 | Ga0207669_102140071 | 242 |
| 562 | 3300025938 | Ga0207704_10030838 | Ga0207704_100308383 | 242 |
| 563 | 3300025938 | Ga0207704_10215592 | Ga0207704_102155922 | 242 |
| 564 | 3300025940 | Ga0207691_10023398 | Ga0207691_100233984 | 242 |
| 565 | 3300025940 | Ga0207691_10042166 | Ga0207691_100421664 | 242 |
| 566 | 3300025940 | Ga0207691_10094288 | Ga0207691_100942882 | 242 |
| 567 | 3300025940 | Ga0207691_10255047 | Ga0207691_102550472 | 242 |
| 568 | 3300025940 | Ga0207691_10264903 | Ga0207691_102649032 | 242 |
| 569 | 3300025941 | Ga0207711_10022414 | Ga0207711_100224142 | 242 |
| 570 | 3300025942 | Ga0207689_10009199 | Ga0207689_100091995 | 242 |
| 571 | 3300025942 | Ga0207689_10024820 | Ga0207689_100248207 | 242 |
| 572 | 3300025944 | Ga0207661_10084711 | Ga0207661_100847113 | 242 |
| 573 | 3300025945 | Ga0207679_10002742 | Ga0207679_100027424 | 242 |
| 574 | 3300025945 | Ga0207679_10051912 | Ga0207679_100519124 | 242 |
| 575 | 3300025949 | Ga0207667_10000946 | Ga0207667_1000094624 | 242 |
| 576 | 3300025949 | Ga0207667_10007809 | Ga0207667_100078093 | 242 |
| 577 | 3300025949 | Ga0207667_10047499 | Ga0207667_100474992 | 242 |
| 578 | 3300025949 | Ga0207667_10097646 | Ga0207667_100976462 | 242 |
| 579 | 3300025949 | Ga0207667_10393649 | Ga0207667_103936492 | 242 |
| 580 | 3300025960 | Ga0207651_10192944 | Ga0207651_101929442 | 242 |
| 581 | 3300025961 | Ga0207712_10164794 | Ga0207712_101647942 | 242 |
| 582 | 3300025972 | Ga0207668_10004465 | Ga0207668_100044652 | 242 |
| 583 | 3300025972 | Ga0207668_10248073 | Ga0207668_102480732 | 242 |
| 584 | 3300025981 | Ga0207640_10002854 | Ga0207640_100028547 | 242 |
| 585 | 3300025981 | Ga0207640_10144246 | Ga0207640_101442463 | 242 |
| 586 | 3300025986 | Ga0207658_10006432 | Ga0207658_100064323 | 242 |
| 587 | 3300025986 | Ga0207658_10027327 | Ga0207658_100273275 | 242 |
| 588 | 3300026023 | Ga0207677_10045580 | Ga0207677_100455802 | 242 |
| 589 | 3300026023 | Ga0207677_10191446 | Ga0207677_101914462 | 242 |
| 590 | 3300026023 | Ga0207677_10212389 | Ga0207677_102123892 | 242 |
| 591 | 3300026035 | Ga0207703_10004840 | Ga0207703_100048409 | 242 |
| 592 | 3300026035 | Ga0207703_10007247 | Ga0207703_1000724710 | 242 |
| 593 | 3300026035 | Ga0207703_10155663 | Ga0207703_101556633 | 242 |
| 594 | 3300026041 | Ga0207639_10017985 | Ga0207639_100179852 | 242 |
| 595 | 3300026041 | Ga0207639_10042297 | Ga0207639_100422973 | 242 |
| 596 | 3300026041 | Ga0207639_10053261 | Ga0207639_100532613 | 242 |
| 597 | 3300026067 | Ga0207678_10514647 | Ga0207678_105146471 | 242 |
| 598 | 3300026075 | Ga0207708_10161090 | Ga0207708_101610904 | 242 |
| 599 | 3300026088 | Ga0207641_10012562 | Ga0207641_100125627 | 242 |
| 600 | 3300026088 | Ga0207641_10142731 | Ga0207641_101427312 | 242 |
| 601 | 3300026089 | Ga0207648_10014995 | Ga0207648_100149958 | 242 |
| 602 | 3300026089 | Ga0207648_10073729 | Ga0207648_100737295 | 242 |
| 603 | 3300026095 | Ga0207676_10160692 | Ga0207676_101606922 | 242 |
| 604 | 3300026095 | Ga0207676_10216584 | Ga0207676_102165842 | 242 |
| 605 | 3300026095 | Ga0207676_10275111 | Ga0207676_102751112 | 242 |
| 606 | 3300026118 | Ga0207675_100004479 | Ga0207675_1000044798 | 242 |
| 607 | 3300026118 | Ga0207675_100286924 | Ga0207675_1002869242 | 242 |
| 608 | 3300026121 | Ga0207683_10019240 | Ga0207683_100192408 | 242 |
| 609 | 3300026121 | Ga0207683_10131915 | Ga0207683_101319153 | 242 |
| 610 | 3300026142 | Ga0207698_10005137 | Ga0207698_100051377 | 242 |
| 611 | 3300026142 | Ga0207698_10031618 | Ga0207698_100316187 | 242 |
| 612 | 3300026142 | Ga0207698_10034855 | Ga0207698_100348553 | 242 |
| 613 | 3300026142 | Ga0207698_10284895 | Ga0207698_102848953 | 242 |
| 614 | 3300027111 | Ga0209281_1003261 | Ga0209281_10032613 | 242 |
| 615 | 3300027666 | Ga0209282_1000014 | Ga0209282_100001455 | 242 |
| 616 | 3300028379 | Ga0268266_10561043 | Ga0268266_105610432 | 242 |
| 617 | 3300028380 | Ga0268265_10008762 | Ga0268265_100087628 | 242 |
| 618 | 3300028381 | Ga0268264_10002117 | Ga0268264_1000211712 | 242 |
| 619 | 3300028381 | Ga0268264_10009653 | Ga0268264_100096532 | 242 |
| 620 | 3300028381 | Ga0268264_10104767 | Ga0268264_101047672 | 242 |
| 621 | 3300028653 | Ga0265323_10009697 | Ga0265323_100096974 | 242 |
| 622 | 3300028794 | Ga0307515_10005908 | Ga0307515_1000590811 | 242 |
| 623 | 3300028794 | Ga0307515_10024457 | Ga0307515_1002445710 | 242 |
| 624 | 3300030731 | Ga0316177_1029947 | Ga0316177_10299473 | 242 |
| 625 | 3300030745 | Ga0316182_1085102 | Ga0316182_10851022 | 242 |
| 626 | 3300031241 | Ga0265325_10006514 | Ga0265325_100065148 | 242 |
| 627 | 3300031242 | Ga0265329_10000056 | Ga0265329_1000005627 | 242 |
| 628 | 3300031249 | Ga0265339_10124660 | Ga0265339_101246601 | 242 |
| 629 | 3300031251 | Ga0265327_10192746 | Ga0265327_101927461 | 242 |
| 630 | 3300031344 | Ga0265316_10000484 | Ga0265316_1000048442 | 242 |
| 631 | 3300031344 | Ga0265316_10023663 | Ga0265316_100236633 | 242 |
| 632 | 3300031344 | Ga0265316_10100890 | Ga0265316_101008902 | 242 |
| 633 | 3300031548 | Ga0307408_100002393 | Ga0307408_10000239311 | 242 |
| 634 | 3300031548 | Ga0307408_100030624 | Ga0307408_1000306244 | 242 |
| 635 | 3300031548 | Ga0307408_100235289 | Ga0307408_1002352891 | 242 |
| 636 | 3300031548 | Ga0307408_100424224 | Ga0307408_1004242242 | 242 |
| 637 | 3300031595 | Ga0265313_10006226 | Ga0265313_100062262 | 242 |
| 638 | 3300031711 | Ga0265314_10005760 | Ga0265314_100057602 | 242 |
| 639 | 3300031712 | Ga0265342_10000405 | Ga0265342_1000040544 | 242 |
| 640 | 3300031712 | Ga0265342_10001757 | Ga0265342_100017575 | 242 |
| 641 | 3300031727 | Ga0316576_10014776 | Ga0316576_100147765 | 242 |
| 642 | 3300031728 | Ga0316578_10000134 | Ga0316578_1000013413 | 242 |
| 643 | 3300031730 | Ga0307516_10000127 | Ga0307516_1000012773 | 242 |
| 644 | 3300031730 | Ga0307516_10003164 | Ga0307516_1000316415 | 242 |
| 645 | 3300031730 | Ga0307516_10013408 | Ga0307516_100134082 | 242 |
| 646 | 3300031730 | Ga0307516_10157567 | Ga0307516_101575671 | 242 |
| 647 | 3300031731 | Ga0307405_10039787 | Ga0307405_100397872 | 242 |
| 648 | 3300031838 | Ga0307518_10067826 | Ga0307518_100678262 | 242 |
| 649 | 3300031911 | Ga0307412_10138629 | Ga0307412_101386293 | 242 |
| 650 | 3300031995 | Ga0307409_100025249 | Ga0307409_1000252497 | 242 |
| 651 | 3300032002 | Ga0307416_100032061 | Ga0307416_1000320612 | 242 |
| 652 | 3300032002 | Ga0307416_100142601 | Ga0307416_1001426012 | 242 |
| 653 | 3300032004 | Ga0307414_10013571 | Ga0307414_100135712 | 242 |
| 654 | 3300032004 | Ga0307414_10044379 | Ga0307414_100443794 | 242 |
| 655 | 3300032005 | Ga0307411_10061113 | Ga0307411_100611133 | 242 |
| 656 | 3300032126 | Ga0307415_100020811 | Ga0307415_1000208113 | 242 |
| 657 | 3300032168 | Ga0316593_10023535 | Ga0316593_100235351 | 242 |
| 658 | 3300033541 | Ga0316596_1015766 | Ga0316596_10157662 | 242 |
| 659 | 3300035118 | Ga0373954_0002027 | Ga0373954_0002027_2527_3276 | 242 |
| 660 | 3300035242 | Ga0373962_0031080 | Ga0373962_0031080_492_1238 | 242 |
| 661 | 3300035691 | Ga0373931_0054053 | Ga0373931_0054053_1000_1746 | 242 |
| 662 | 3300036401 | Ga0373937_0045307 | Ga0373937_0045307_352_1104 | 242 |
| 663 | 3300036712 | Ga0316584_0135137 | Ga0316584_0135137_401_1150 | 242 |
| 664 | 3300037068 | Ga0373925_0119245 | Ga0373925_0119245_1152_1904 | 242 |
| 665 | 3300037312 | Ga0395899_0000329 | Ga0395899_0000329_58029_58775 | 242 |
| 666 | 3300037312 | Ga0395899_0000787 | Ga0395899_0000787_912_1658 | 242 |
| 667 | 3300037312 | Ga0395899_0019086 | Ga0395899_0019086_4314_5060 | 242 |
| 668 | 3300037312 | Ga0395899_0138806 | Ga0395899_0138806_78_866 | 242 |
| 669 | 3300037418 | Ga0395900_0012488 | Ga0395900_0012488_3906_4652 | 242 |
| 670 | 3300037418 | Ga0395900_0099595 | Ga0395900_0099595_1999_2745 | 242 |
| 671 | 3300037418 | Ga0395900_0378752 | Ga0395900_0378752_126_872 | 242 |
| 672 | 3300037466 | Ga0395898_0000283 | Ga0395898_0000283_120588_121331 | 242 |
| 673 | 3300037466 | Ga0395898_0134878 | Ga0395898_0134878_1186_1974 | 242 |
| 674 | 3300037466 | Ga0395898_0208690 | Ga0395898_0208690_964_1710 | 242 |
| 675 | 3300037471 | Ga0395905_0000703 | Ga0395905_0000703_11598_12344 | 242 |
| 676 | 3300037471 | Ga0395905_0005750 | Ga0395905_0005750_5679_6425 | 242 |
| 677 | 3300037471 | Ga0395905_0052947 | Ga0395905_0052947_2075_2821 | 242 |
| 678 | 3300037471 | Ga0395905_0139583 | Ga0395905_0139583_266_1012 | 242 |
| 679 | 3300038443 | Ga0395901_0000881 | Ga0395901_0000881_14097_14843 | 242 |
| 680 | 3300038443 | Ga0395901_0015819 | Ga0395901_0015819_321_1067 | 242 |
| 681 | 3300038443 | Ga0395901_0364545 | Ga0395901_0364545_511_1257 | 242 |
| 682 | 3300039093 | Ga0400489_08019 | Ga0400489_08019_1811_2557 | 242 |
| 683 | 3300039447 | Ga0436361_0136418 | Ga0436361_0136418_62_808 | 242 |
| 684 | 3300039447 | Ga0436361_0279393 | Ga0436361_0279393_683_1429 | 242 |
| 685 | 3300039447 | Ga0436361_0391791 | Ga0436361_0391791_36900_37646 | 242 |
| 686 | 3300039447 | Ga0436361_0599511 | Ga0436361_0599511_3446_4192 | 242 |
| 687 | 3300039447 | Ga0436361_0674579 | Ga0436361_0674579_3979_4725 | 242 |
| 688 | 3300039447 | Ga0436361_1059260 | Ga0436361_1059260_281_1024 | 242 |
| 689 | 3300042001 | Ga0439441_052679 | Ga0439441_052679_56_802 | 242 |
| 690 | 3300042139 | Ga0450904_000871 | Ga0450904_000871_3063_3809 | 242 |
| 691 | 3300042876 | Ga0451577_0001500 | Ga0451577_0001500_23710_24456 | 242 |
| 692 | 3300042876 | Ga0451577_0009424 | Ga0451577_0009424_4578_5327 | 242 |
| 693 | 3300044656 | Ga0466969_0000013 | Ga0466969_0000013_76143_76886 | 242 |
| 694 | 3300044658 | Ga0466972_0000453 | Ga0466972_0000453_18729_19475 | 242 |
| 695 | 3300044658 | Ga0466972_0003939 | Ga0466972_0003939_5289_6035 | 242 |
| 696 | 3300044673 | Ga0453683_0042631 | Ga0453683_0042631_170_916 | 242 |
| 697 | 3300044683 | Ga0466965_0000132 | Ga0466965_0000132_7488_8234 | 242 |
| 698 | 3300044683 | Ga0466965_0000278 | Ga0466965_0000278_14310_15056 | 242 |
| 699 | 3300044684 | Ga0466966_0020568 | Ga0466966_0020568_2831_3574 | 242 |
| 700 | 3300044693 | Ga0466961_0049174 | Ga0466961_0049174_946_1689 | 242 |
| 701 | 3300044706 | Ga0466964_0018762 | Ga0466964_0018762_63_809 | 242 |
| 702 | 3300044735 | Ga0466968_0012527 | Ga0466968_0012527_1383_2129 | 242 |
| 703 | 3300044735 | Ga0466968_0143545 | Ga0466968_0143545_286_1032 | 242 |
| 704 | 3300044765 | Ga0466970_0267197 | Ga0466970_0267197_46_792 | 242 |
| 705 | 3300045049 | Ga0466959_0002428 | Ga0466959_0002428_11094_11855 | 242 |
| 706 | 3300045049 | Ga0466959_0026613 | Ga0466959_0026613_33_779 | 242 |
| 707 | 3300045051 | Ga0451576_0008355 | Ga0451576_0008355_4916_5665 | 242 |
| 708 | 3300045051 | Ga0451576_0127712 | Ga0451576_0127712_177_926 | 242 |
| 709 | 3300046452 | Ga0495617_000128 | Ga0495617_000128_35868_36614 | 242 |
| 710 | 3300046452 | Ga0495617_001419 | Ga0495617_001419_5295_6041 | 242 |
| 711 | 3300046452 | Ga0495617_001910 | Ga0495617_001910_1921_2667 | 242 |
| 712 | 3300046452 | Ga0495617_085941 | Ga0495617_085941_48_794 | 242 |
| 713 | 3300046453 | Ga0495627_000004 | Ga0495627_000004_568493_569239 | 242 |
| 714 | 3300046453 | Ga0495627_028838 | Ga0495627_028838_627_1373 | 242 |
| 715 | 3300046454 | Ga0495592_0010789 | Ga0495592_0010789_2119_2865 | 242 |
| 716 | 3300046455 | Ga0495603_0002466 | Ga0495603_0002466_1320_2066 | 242 |
| 717 | 3300046457 | Ga0495590_0000014 | Ga0495590_0000014_175041_175787 | 242 |
| 718 | 3300046457 | Ga0495590_0001672 | Ga0495590_0001672_3907_4653 | 242 |
| 719 | 3300046457 | Ga0495590_0014643 | Ga0495590_0014643_534_1280 | 242 |
| 720 | 3300046459 | Ga0495629_0006457 | Ga0495629_0006457_5266_6012 | 242 |
| 721 | 3300046460 | Ga0495638_0000064 | Ga0495638_0000064_99816_100562 | 242 |
| 722 | 3300046460 | Ga0495638_0004227 | Ga0495638_0004227_6322_7068 | 242 |
| 723 | 3300046460 | Ga0495638_0056035 | Ga0495638_0056035_1021_1767 | 242 |
| 724 | 3300046460 | Ga0495638_0155969 | Ga0495638_0155969_28_774 | 242 |
| 725 | 3300046462 | Ga0495651_0003413 | Ga0495651_0003413_4830_5576 | 242 |
| 726 | 3300046463 | Ga0495653_0000056 | Ga0495653_0000056_85100_85846 | 242 |
| 727 | 3300046463 | Ga0495653_0035719 | Ga0495653_0035719_1234_1980 | 242 |
| 728 | 3300046463 | Ga0495653_0228620 | Ga0495653_0228620_306_1052 | 242 |
| 729 | 3300046471 | Ga0495650_0000062 | Ga0495650_0000062_209762_210508 | 242 |
| 730 | 3300046471 | Ga0495650_0001144 | Ga0495650_0001144_6552_7298 | 242 |
| 731 | 3300046471 | Ga0495650_0001153 | Ga0495650_0001153_6539_7285 | 242 |
| 732 | 3300046471 | Ga0495650_0032504 | Ga0495650_0032504_680_1426 | 242 |
| 733 | 3300046471 | Ga0495650_0033108 | Ga0495650_0033108_721_1467 | 242 |
| 734 | 3300046472 | Ga0495580_0226975 | Ga0495580_0226975_379_1125 | 242 |
| 735 | 3300046473 | Ga0495582_0104406 | Ga0495582_0104406_426_1172 | 242 |
| 736 | 3300046474 | Ga0495605_0000127 | Ga0495605_0000127_59049_59795 | 242 |
| 737 | 3300046474 | Ga0495605_0001850 | Ga0495605_0001850_2520_3266 | 242 |
| 738 | 3300046474 | Ga0495605_0018816 | Ga0495605_0018816_2587_3333 | 242 |
| 739 | 3300046474 | Ga0495605_0123489 | Ga0495605_0123489_273_1019 | 242 |
| 740 | 3300046474 | Ga0495605_0128194 | Ga0495605_0128194_177_923 | 242 |
| 741 | 3300046491 | Ga0495584_0000040 | Ga0495584_0000040_77482_78228 | 242 |
| 742 | 3300046491 | Ga0495584_0002355 | Ga0495584_0002355_8914_9660 | 242 |
| 743 | 3300046491 | Ga0495584_0005114 | Ga0495584_0005114_612_1358 | 242 |
| 744 | 3300046491 | Ga0495584_0005804 | Ga0495584_0005804_2695_3441 | 242 |
| 745 | 3300046491 | Ga0495584_0016289 | Ga0495584_0016289_992_1738 | 242 |
| 746 | 3300046491 | Ga0495584_0027869 | Ga0495584_0027869_361_1107 | 242 |
| 747 | 3300046491 | Ga0495584_0125292 | Ga0495584_0125292_32_778 | 242 |
| 748 | 3300046492 | Ga0495585_0000230 | Ga0495585_0000230_49560_50306 | 242 |
| 749 | 3300046492 | Ga0495585_0000566 | Ga0495585_0000566_34152_34898 | 242 |
| 750 | 3300046492 | Ga0495585_0000776 | Ga0495585_0000776_20017_20763 | 242 |
| 751 | 3300046492 | Ga0495585_0003019 | Ga0495585_0003019_2783_3529 | 242 |
| 752 | 3300046492 | Ga0495585_0046525 | Ga0495585_0046525_1053_1799 | 242 |
| 753 | 3300046492 | Ga0495585_0070037 | Ga0495585_0070037_24_770 | 242 |
| 754 | 3300046492 | Ga0495585_0100033 | Ga0495585_0100033_268_1014 | 242 |
| 755 | 3300046492 | Ga0495585_0180470 | Ga0495585_0180470_105_851 | 242 |
| 756 | 3300046499 | Ga0495594_0012651 | Ga0495594_0012651_1649_2395 | 242 |
| 757 | 3300046499 | Ga0495594_0079993 | Ga0495594_0079993_336_1082 | 242 |
| 758 | 3300046500 | Ga0495596_0000671 | Ga0495596_0000671_7460_8206 | 242 |
| 759 | 3300046500 | Ga0495596_0001532 | Ga0495596_0001532_12349_13095 | 242 |
| 760 | 3300046500 | Ga0495596_0007938 | Ga0495596_0007938_1230_1976 | 242 |
| 761 | 3300046501 | Ga0495607_0001656 | Ga0495607_0001656_5084_5830 | 242 |
| 762 | 3300046501 | Ga0495607_0001772 | Ga0495607_0001772_1046_1792 | 242 |
| 763 | 3300046501 | Ga0495607_0036798 | Ga0495607_0036798_1999_2745 | 242 |
| 764 | 3300046501 | Ga0495607_0256282 | Ga0495607_0256282_51_797 | 242 |
| 765 | 3300046506 | Ga0495583_0000156 | Ga0495583_0000156_63253_63999 | 242 |
| 766 | 3300046506 | Ga0495583_0000231 | Ga0495583_0000231_86928_87674 | 242 |
| 767 | 3300046506 | Ga0495583_0000287 | Ga0495583_0000287_66457_67203 | 242 |
| 768 | 3300046506 | Ga0495583_0001556 | Ga0495583_0001556_12760_13506 | 242 |
| 769 | 3300046506 | Ga0495583_0004187 | Ga0495583_0004187_7302_8048 | 242 |
| 770 | 3300046507 | Ga0495606_0000353 | Ga0495606_0000353_9965_10711 | 242 |
| 771 | 3300046507 | Ga0495606_0000589 | Ga0495606_0000589_38532_39278 | 242 |
| 772 | 3300046507 | Ga0495606_0000933 | Ga0495606_0000933_6615_7361 | 242 |
| 773 | 3300046507 | Ga0495606_0001708 | Ga0495606_0001708_19884_20630 | 242 |
| 774 | 3300046507 | Ga0495606_0006490 | Ga0495606_0006490_6674_7420 | 242 |
| 775 | 3300046507 | Ga0495606_0067300 | Ga0495606_0067300_1447_2193 | 242 |
| 776 | 3300046511 | Ga0495608_0018854 | Ga0495608_0018854_553_1299 | 242 |
| 777 | 3300046512 | Ga0495610_0000027 | Ga0495610_0000027_193276_194022 | 242 |
| 778 | 3300046512 | Ga0495610_0001111 | Ga0495610_0001111_19276_20022 | 242 |
| 779 | 3300046512 | Ga0495610_0016864 | Ga0495610_0016864_1160_1906 | 242 |
| 780 | 3300046512 | Ga0495610_0036421 | Ga0495610_0036421_473_1219 | 242 |
| 781 | 3300046513 | Ga0495616_0002779 | Ga0495616_0002779_5610_6356 | 242 |
| 782 | 3300046513 | Ga0495616_0009303 | Ga0495616_0009303_1306_2052 | 242 |
| 783 | 3300046513 | Ga0495616_0059252 | Ga0495616_0059252_649_1395 | 242 |
| 784 | 3300046513 | Ga0495616_0070870 | Ga0495616_0070870_304_1050 | 242 |
| 785 | 3300046513 | Ga0495616_0221880 | Ga0495616_0221880_45_791 | 242 |
| 786 | 3300046514 | Ga0495618_0021041 | Ga0495618_0021041_679_1425 | 242 |
| 787 | 3300046515 | Ga0495620_0009333 | Ga0495620_0009333_2207_2953 | 242 |
| 788 | 3300046516 | Ga0495628_0000076 | Ga0495628_0000076_18765_19511 | 242 |
| 789 | 3300046516 | Ga0495628_0001441 | Ga0495628_0001441_15646_16392 | 242 |
| 790 | 3300046516 | Ga0495628_0419528 | Ga0495628_0419528_102_851 | 242 |
| 791 | 3300046518 | Ga0495631_0015619 | Ga0495631_0015619_2071_2817 | 242 |
| 792 | 3300046519 | Ga0495632_0000403 | Ga0495632_0000403_32835_33581 | 242 |
| 793 | 3300046519 | Ga0495632_0004394 | Ga0495632_0004394_3435_4181 | 242 |
| 794 | 3300046520 | Ga0495637_0000430 | Ga0495637_0000430_19307_20053 | 242 |
| 795 | 3300046520 | Ga0495637_0009837 | Ga0495637_0009837_10_756 | 242 |
| 796 | 3300046520 | Ga0495637_0010156 | Ga0495637_0010156_3628_4374 | 242 |
| 797 | 3300046522 | Ga0495643_0000108 | Ga0495643_0000108_87196_87942 | 242 |
| 798 | 3300046522 | Ga0495643_0000255 | Ga0495643_0000255_62189_62935 | 242 |
| 799 | 3300046522 | Ga0495643_0000716 | Ga0495643_0000716_34151_34897 | 242 |
| 800 | 3300046522 | Ga0495643_0001683 | Ga0495643_0001683_11485_12231 | 242 |
| 801 | 3300046522 | Ga0495643_0020799 | Ga0495643_0020799_1384_2130 | 242 |
| 802 | 3300046522 | Ga0495643_0049091 | Ga0495643_0049091_722_1468 | 242 |
| 803 | 3300046522 | Ga0495643_0067644 | Ga0495643_0067644_1037_1783 | 242 |
| 804 | 3300046523 | Ga0495644_0005344 | Ga0495644_0005344_1492_2238 | 242 |
| 805 | 3300046523 | Ga0495644_0020071 | Ga0495644_0020071_1762_2508 | 242 |
| 806 | 3300046523 | Ga0495644_0026066 | Ga0495644_0026066_1345_2091 | 242 |
| 807 | 3300046524 | Ga0495648_0000006 | Ga0495648_0000006_280253_280999 | 242 |
| 808 | 3300046524 | Ga0495648_0000134 | Ga0495648_0000134_9397_10143 | 242 |
| 809 | 3300046524 | Ga0495648_0000841 | Ga0495648_0000841_17057_17803 | 242 |
| 810 | 3300046524 | Ga0495648_0023331 | Ga0495648_0023331_2879_3625 | 242 |
| 811 | 3300046524 | Ga0495648_0035462 | Ga0495648_0035462_935_1681 | 242 |
| 812 | 3300046524 | Ga0495648_0045577 | Ga0495648_0045577_1741_2487 | 242 |
| 813 | 3300046525 | Ga0495663_0003306 | Ga0495663_0003306_814_1560 | 242 |
| 814 | 3300046526 | Ga0495666_0009701 | Ga0495666_0009701_2045_2791 | 242 |
| 815 | 3300046526 | Ga0495666_0015888 | Ga0495666_0015888_2053_2799 | 242 |
| 816 | 3300046528 | Ga0495642_0002341 | Ga0495642_0002341_466_1212 | 242 |
| 817 | 3300046528 | Ga0495642_0002943 | Ga0495642_0002943_5456_6202 | 242 |
| 818 | 3300046528 | Ga0495642_0003138 | Ga0495642_0003138_5794_6540 | 242 |
| 819 | 3300046528 | Ga0495642_0004427 | Ga0495642_0004427_2652_3398 | 242 |
| 820 | 3300046529 | Ga0495652_0005760 | Ga0495652_0005760_4779_5525 | 242 |
| 821 | 3300046529 | Ga0495652_0140029 | Ga0495652_0140029_279_1025 | 242 |
| 822 | 3300046530 | Ga0495654_0000131 | Ga0495654_0000131_68963_69709 | 242 |
| 823 | 3300046530 | Ga0495654_0007219 | Ga0495654_0007219_236_982 | 242 |
| 824 | 3300046530 | Ga0495654_0024239 | Ga0495654_0024239_2200_2946 | 242 |
| 825 | 3300046531 | Ga0495665_0065133 | Ga0495665_0065133_859_1605 | 242 |
| 826 | 3300046535 | Ga0495586_0025907 | Ga0495586_0025907_2316_3062 | 242 |
| 827 | 3300046536 | Ga0495587_0083004 | Ga0495587_0083004_852_1598 | 242 |
| 828 | 3300046538 | Ga0495609_0000136 | Ga0495609_0000136_20680_21426 | 242 |
| 829 | 3300046538 | Ga0495609_0001765 | Ga0495609_0001765_2870_3616 | 242 |
| 830 | 3300046538 | Ga0495609_0006092 | Ga0495609_0006092_2423_3169 | 242 |
| 831 | 3300046538 | Ga0495609_0026224 | Ga0495609_0026224_521_1267 | 242 |
| 832 | 3300046539 | Ga0495621_0109696 | Ga0495621_0109696_264_1016 | 242 |
| 833 | 3300046542 | Ga0495597_0000091 | Ga0495597_0000091_45508_46254 | 242 |
| 834 | 3300046542 | Ga0495597_0000223 | Ga0495597_0000223_12766_13512 | 242 |
| 835 | 3300046542 | Ga0495597_0000882 | Ga0495597_0000882_3096_3842 | 242 |
| 836 | 3300046542 | Ga0495597_0001469 | Ga0495597_0001469_7014_7760 | 242 |
| 837 | 3300046542 | Ga0495597_0007404 | Ga0495597_0007404_2642_3388 | 242 |
| 838 | 3300046542 | Ga0495597_0034443 | Ga0495597_0034443_816_1562 | 242 |
| 839 | 3300046542 | Ga0495597_0052294 | Ga0495597_0052294_470_1216 | 242 |
| 840 | 3300046543 | Ga0495645_0016449 | Ga0495645_0016449_1731_2477 | 242 |
| 841 | 3300046543 | Ga0495645_0055606 | Ga0495645_0055606_1784_2536 | 242 |
| 842 | 3300046557 | Ga0495622_0005626 | Ga0495622_0005626_3214_3960 | 242 |
| 843 | 3300046558 | Ga0495633_0001545 | Ga0495633_0001545_1352_2098 | 242 |
| 844 | 3300046558 | Ga0495633_0002191 | Ga0495633_0002191_7379_8125 | 242 |
| 845 | 3300046558 | Ga0495633_0002981 | Ga0495633_0002981_3157_3903 | 242 |
| 846 | 3300046558 | Ga0495633_0003195 | Ga0495633_0003195_4267_5013 | 242 |
| 847 | 3300046558 | Ga0495633_0015631 | Ga0495633_0015631_1226_1972 | 242 |
| 848 | 3300046558 | Ga0495633_0148610 | Ga0495633_0148610_235_981 | 242 |
| 849 | 3300046558 | Ga0495633_0168873 | Ga0495633_0168873_161_907 | 242 |
| 850 | 3300046615 | Ga0495656_0000675 | Ga0495656_0000675_7392_8138 | 242 |
| 851 | 3300046615 | Ga0495656_0037159 | Ga0495656_0037159_1020_1766 | 242 |
| 852 | 3300046616 | Ga0495668_0000029 | Ga0495668_0000029_88487_89233 | 242 |
| 853 | 3300046616 | Ga0495668_0000119 | Ga0495668_0000119_56079_56825 | 242 |
| 854 | 3300046616 | Ga0495668_0000209 | Ga0495668_0000209_9029_9775 | 242 |
| 855 | 3300046616 | Ga0495668_0003302 | Ga0495668_0003302_1026_1772 | 242 |
| 856 | 3300046616 | Ga0495668_0022417 | Ga0495668_0022417_1518_2264 | 242 |
| 857 | 3300046648 | Ga0495611_0015040 | Ga0495611_0015040_1113_1859 | 242 |
| 858 | 3300046648 | Ga0495611_0018009 | Ga0495611_0018009_1657_2403 | 242 |
| 859 | 3300046660 | Ga0495625_0000871 | Ga0495625_0000871_6632_7378 | 242 |
| 860 | 3300046660 | Ga0495625_0001309 | Ga0495625_0001309_19881_20627 | 242 |
| 861 | 3300046660 | Ga0495625_0001595 | Ga0495625_0001595_19528_20274 | 242 |
| 862 | 3300046660 | Ga0495625_0007432 | Ga0495625_0007432_440_1186 | 242 |
| 863 | 3300046660 | Ga0495625_0007978 | Ga0495625_0007978_2766_3512 | 242 |
| 864 | 3300046660 | Ga0495625_0010041 | Ga0495625_0010041_6872_7618 | 242 |
| 865 | 3300046660 | Ga0495625_0015358 | Ga0495625_0015358_2899_3645 | 242 |
| 866 | 3300046664 | Ga0495659_0001898 | Ga0495659_0001898_669_1415 | 242 |
| 867 | 3300046664 | Ga0495659_0002191 | Ga0495659_0002191_452_1198 | 242 |
| 868 | 3300046664 | Ga0495659_0044416 | Ga0495659_0044416_241_987 | 242 |
| 869 | 3300046665 | Ga0495661_0000979 | Ga0495661_0000979_13637_14383 | 242 |
| 870 | 3300046665 | Ga0495661_0007457 | Ga0495661_0007457_6855_7601 | 242 |
| 871 | 3300046665 | Ga0495661_0013316 | Ga0495661_0013316_13_759 | 242 |
| 872 | 3300046665 | Ga0495661_0055997 | Ga0495661_0055997_848_1594 | 242 |
| 873 | 3300046674 | Ga0495588_0077315 | Ga0495588_0077315_238_984 | 242 |
| 874 | 3300046675 | Ga0495657_0041222 | Ga0495657_0041222_2348_3094 | 242 |
| 875 | 3300046678 | Ga0495599_0003657 | Ga0495599_0003657_7801_8547 | 242 |
| 876 | 3300046678 | Ga0495599_0071047 | Ga0495599_0071047_250_996 | 242 |
| 877 | 3300046679 | Ga0495623_0000743 | Ga0495623_0000743_4804_5550 | 242 |
| 878 | 3300046680 | Ga0495646_0005231 | Ga0495646_0005231_6255_7001 | 242 |
| 879 | 3300046680 | Ga0495646_0161407 | Ga0495646_0161407_130_876 | 242 |
| 880 | 3300046683 | Ga0495658_0073811 | Ga0495658_0073811_719_1465 | 242 |
| 881 | 3300046684 | Ga0495669_0001117 | Ga0495669_0001117_274_1020 | 242 |
| 882 | 3300046689 | Ga0495613_0117767 | Ga0495613_0117767_870_1622 | 242 |
| 883 | 3300046690 | Ga0495624_0036851 | Ga0495624_0036851_2344_3090 | 242 |
| 884 | 3300046690 | Ga0495624_0062485 | Ga0495624_0062485_568_1314 | 242 |
| 885 | 3300046691 | Ga0495670_0016780 | Ga0495670_0016780_2769_3515 | 242 |
| 886 | 3300046691 | Ga0495670_0035008 | Ga0495670_0035008_613_1359 | 242 |
| 887 | 3300046691 | Ga0495670_0063015 | Ga0495670_0063015_991_1737 | 242 |
| 888 | 3300046691 | Ga0495670_0064268 | Ga0495670_0064268_919_1665 | 242 |
| 889 | 3300046691 | Ga0495670_0074575 | Ga0495670_0074575_27_773 | 242 |
| 890 | 3300046692 | Ga0495671_0000106 | Ga0495671_0000106_1028_1774 | 242 |
| 891 | 3300046692 | Ga0495671_0022032 | Ga0495671_0022032_1082_1828 | 242 |
| 892 | 3300046692 | Ga0495671_0051785 | Ga0495671_0051785_1029_1775 | 242 |
| 893 | 3300046692 | Ga0495671_0111413 | Ga0495671_0111413_157_903 | 242 |
| 894 | 3300046694 | Ga0495649_0014906 | Ga0495649_0014906_3046_3792 | 242 |
| 895 | 3300046694 | Ga0495649_0015177 | Ga0495649_0015177_2958_3704 | 242 |
| 896 | 3300046809 | Ga0495600_0000340 | Ga0495600_0000340_20961_21707 | 242 |
| 897 | 3300046810 | Ga0495660_0001854 | Ga0495660_0001854_2656_3402 | 242 |
| 898 | 3300046810 | Ga0495660_0015627 | Ga0495660_0015627_718_1464 | 242 |
| 899 | 3300046810 | Ga0495660_0016122 | Ga0495660_0016122_1042_1788 | 242 |
| 900 | 3300046810 | Ga0495660_0073796 | Ga0495660_0073796_894_1640 | 242 |
| 901 | 3300047315 | Ga0495581_0175579 | Ga0495581_0175579_77_823 | 242 |
| 902 | 3300047317 | Ga0495604_0085636 | Ga0495604_0085636_1460_2206 | 242 |
| 903 | 3300047317 | Ga0495604_0227925 | Ga0495604_0227925_259_1005 | 242 |
| 904 | 3300047318 | Ga0495636_0000933 | Ga0495636_0000933_6919_7665 | 242 |
| 905 | 3300047318 | Ga0495636_0002175 | Ga0495636_0002175_2097_2843 | 242 |
| 906 | 3300047318 | Ga0495636_0006937 | Ga0495636_0006937_1236_1982 | 242 |
| 907 | 3300047319 | Ga0495674_0032572 | Ga0495674_0032572_1364_2110 | 242 |
| 908 | 3300047320 | Ga0495672_0000088 | Ga0495672_0000088_54835_55581 | 242 |
| 909 | 3300047321 | Ga0495676_0028858 | Ga0495676_0028858_3006_3752 | 242 |
| 910 | 3300047321 | Ga0495676_0094213 | Ga0495676_0094213_1242_1988 | 242 |
| 911 | 3300047322 | Ga0495680_0183159 | Ga0495680_0183159_541_1287 | 242 |
| 912 | 3300047323 | Ga0495683_0000125 | Ga0495683_0000125_16221_16967 | 242 |
| 913 | 3300047323 | Ga0495683_0000892 | Ga0495683_0000892_11787_12533 | 242 |
| 914 | 3300047323 | Ga0495683_0018689 | Ga0495683_0018689_652_1398 | 242 |
| 915 | 3300047443 | Ga0495687_000042 | Ga0495687_000042_86893_87639 | 242 |
| 916 | 3300047443 | Ga0495687_003687 | Ga0495687_003687_2404_3150 | 242 |
| 917 | 3300047443 | Ga0495687_009013 | Ga0495687_009013_734_1480 | 242 |
| 918 | 3300047443 | Ga0495687_011544 | Ga0495687_011544_3338_4084 | 242 |
| 919 | 3300047444 | Ga0495675_0008756 | Ga0495675_0008756_4993_5739 | 242 |
| 920 | 3300047445 | Ga0495677_0006078 | Ga0495677_0006078_1952_2698 | 242 |
| 921 | 3300047445 | Ga0495677_0019510 | Ga0495677_0019510_1071_1817 | 242 |
| 922 | 3300047445 | Ga0495677_0102268 | Ga0495677_0102268_235_981 | 242 |
| 923 | 3300047447 | Ga0495685_000523 | Ga0495685_000523_8699_9445 | 242 |
| 924 | 3300047447 | Ga0495685_001719 | Ga0495685_001719_3040_3786 | 242 |
| 925 | 3300047469 | Ga0495673_0000009 | Ga0495673_0000009_81391_82137 | 242 |
| 926 | 3300047469 | Ga0495673_0000185 | Ga0495673_0000185_88275_89021 | 242 |
| 927 | 3300047469 | Ga0495673_0007424 | Ga0495673_0007424_266_1012 | 242 |
| 928 | 3300047470 | Ga0495681_0000951 | Ga0495681_0000951_20944_21690 | 242 |
| 929 | 3300047470 | Ga0495681_0001142 | Ga0495681_0001142_14020_14766 | 242 |
| 930 | 3300047470 | Ga0495681_0010879 | Ga0495681_0010879_474_1220 | 242 |
| 931 | 3300047472 | Ga0495686_0000212 | Ga0495686_0000212_90166_90912 | 242 |
| 932 | 3300047472 | Ga0495686_0001207 | Ga0495686_0001207_26265_27011 | 242 |
| 933 | 3300047472 | Ga0495686_0004528 | Ga0495686_0004528_4043_4789 | 242 |
| 934 | 3300047472 | Ga0495686_0115612 | Ga0495686_0115612_751_1497 | 242 |
| 935 | 3300047472 | Ga0495686_0147370 | Ga0495686_0147370_587_1333 | 242 |
| 936 | 3300047673 | Ga0495593_0001579 | Ga0495593_0001579_10373_11119 | 242 |
| 937 | 3300047673 | Ga0495593_0009011 | Ga0495593_0009011_2224_2970 | 242 |
| 938 | 3300048088 | Ga0495602_0059604 | Ga0495602_0059604_131_877 | 242 |
| 939 | 3300048088 | Ga0495602_0168608 | Ga0495602_0168608_514_1260 | 242 |
| 940 | 3300048091 | Ga0495626_0000667 | Ga0495626_0000667_8710_9456 | 242 |
| 941 | 3300048091 | Ga0495626_0001829 | Ga0495626_0001829_14801_15547 | 242 |
| 942 | 3300048091 | Ga0495626_0008166 | Ga0495626_0008166_681_1427 | 242 |
| 943 | 3300048091 | Ga0495626_0024848 | Ga0495626_0024848_1472_2218 | 242 |
| 944 | 3300048091 | Ga0495626_0084997 | Ga0495626_0084997_218_964 | 242 |
| 945 | 3300048904 | Ga0496101_0136173 | Ga0496101_0136173_1050_1796 | 242 |
| 946 | 3300048905 | Ga0496102_0001181 | Ga0496102_0001181_4804_5550 | 242 |
| 947 | 3300048906 | Ga0496103_0212373 | Ga0496103_0212373_417_1163 | 242 |
| 948 | 3300048907 | Ga0496104_0040104 | Ga0496104_0040104_2323_3069 | 242 |
| 949 | 3300048908 | Ga0496105_0037751 | Ga0496105_0037751_2196_2942 | 242 |
| 950 | 3300048909 | Ga0496106_0190134 | Ga0496106_0190134_327_1073 | 242 |
| 951 | 3300048910 | Ga0496107_0086074 | Ga0496107_0086074_1462_2208 | 242 |
| 952 | 3300048910 | Ga0496107_0113128 | Ga0496107_0113128_294_1040 | 242 |
| 953 | 3300048911 | Ga0496108_0056737 | Ga0496108_0056737_1141_1887 | 242 |
| 954 | 3300048912 | Ga0496109_0082777 | Ga0496109_0082777_464_1210 | 242 |
| 955 | 3300048913 | Ga0496110_0021592 | Ga0496110_0021592_3029_3775 | 242 |
| 956 | 3300048914 | Ga0496111_0003127 | Ga0496111_0003127_5378_6124 | 242 |
| 957 | 3300048917 | Ga0496114_0005135 | Ga0496114_0005135_268_1014 | 242 |
| 958 | 3300048917 | Ga0496114_0101555 | Ga0496114_0101555_1569_2321 | 242 |
| 959 | 3300048918 | Ga0496115_0068854 | Ga0496115_0068854_1069_1815 | 242 |
| 960 | 3300048919 | Ga0496116_0024641 | Ga0496116_0024641_2593_3339 | 242 |
| 961 | 3300048920 | Ga0496117_0000005 | Ga0496117_0000005_358486_359232 | 242 |
| 962 | 3300048920 | Ga0496117_0016121 | Ga0496117_0016121_2014_2766 | 242 |
| 963 | 3300048921 | Ga0496118_0000022 | Ga0496118_0000022_79371_80117 | 242 |
| 964 | 3300048921 | Ga0496118_0014998 | Ga0496118_0014998_1044_1796 | 242 |
| 965 | 3300048924 | Ga0496121_0009122 | Ga0496121_0009122_4200_4946 | 242 |
| 966 | 3300048924 | Ga0496121_0102810 | Ga0496121_0102810_1166_1912 | 242 |
| 967 | 3300048925 | Ga0496122_0000968 | Ga0496122_0000968_37285_38031 | 242 |
| 968 | 3300048925 | Ga0496122_0006223 | Ga0496122_0006223_8455_9201 | 242 |
| 969 | 3300048925 | Ga0496122_0009051 | Ga0496122_0009051_9265_10008 | 242 |
| 970 | 3300048925 | Ga0496122_0267623 | Ga0496122_0267623_141_890 | 242 |
| 971 | 3300048926 | Ga0496123_0002475 | Ga0496123_0002475_2311_3057 | 242 |
| 972 | 3300048926 | Ga0496123_0012980 | Ga0496123_0012980_4876_5622 | 242 |
| 973 | 3300048926 | Ga0496123_0048162 | Ga0496123_0048162_1438_2181 | 242 |
| 974 | 3300048927 | Ga0496124_0001001 | Ga0496124_0001001_6456_7202 | 242 |
| 975 | 3300048927 | Ga0496124_0036741 | Ga0496124_0036741_975_1721 | 242 |
| 976 | 3300048927 | Ga0496124_0081285 | Ga0496124_0081285_1687_2430 | 242 |
| 977 | 3300048927 | Ga0496124_0169625 | Ga0496124_0169625_882_1628 | 242 |
| 978 | 3300048928 | Ga0496125_0001086 | Ga0496125_0001086_27556_28302 | 242 |
| 979 | 3300048928 | Ga0496125_0003905 | Ga0496125_0003905_13489_14235 | 242 |
| 980 | 3300048928 | Ga0496125_0007199 | Ga0496125_0007199_4698_5441 | 242 |
| 981 | 3300048928 | Ga0496125_0018481 | Ga0496125_0018481_2009_2761 | 242 |
| 982 | 3300048928 | Ga0496125_0075761 | Ga0496125_0075761_230_976 | 242 |
| 983 | 3300048929 | Ga0496126_0006515 | Ga0496126_0006515_2930_3676 | 242 |
| 984 | 3300048929 | Ga0496126_0075641 | Ga0496126_0075641_1790_2533 | 242 |
| 985 | 3300049459 | Ga0495678_000149 | Ga0495678_000149_13379_14125 | 242 |
| 986 | 3300049459 | Ga0495678_000259 | Ga0495678_000259_14369_15115 | 242 |
| 987 | 3300049459 | Ga0495678_005168 | Ga0495678_005168_2543_3289 | 242 |
| 988 | 3300049460 | Ga0495682_0000585 | Ga0495682_0000585_9750_10496 | 242 |
| 989 | 3300049460 | Ga0495682_0000819 | Ga0495682_0000819_5949_6695 | 242 |
| 990 | 3300049460 | Ga0495682_0002024 | Ga0495682_0002024_7083_7829 | 242 |
| 991 | 3300049532 | Ga0501316_007077 | Ga0501316_007077_32_778 | 242 |
| 992 | 3300049568 | Ga0501031_0275151 | Ga0501031_0275151_105_854 | 242 |
| 993 | 3300049572 | Ga0501036_0136855 | Ga0501036_0136855_200_949 | 242 |
| 994 | 3300049575 | Ga0501039_0157376 | Ga0501039_0157376_283_1032 | 242 |
| 995 | 3300049576 | Ga0501040_0007105 | Ga0501040_0007105_5010_5759 | 242 |
| 996 | 3300049579 | Ga0501043_0322791 | Ga0501043_0322791_257_1006 | 242 |
| 997 | 3300049582 | Ga0501048_0007051 | Ga0501048_0007051_7112_7861 | 242 |
| 998 | 3300049588 | Ga0501072_0002698 | Ga0501072_0002698_3310_4059 | 242 |
| 999 | 3300049591 | Ga0501075_0004622 | Ga0501075_0004622_8545_9294 | 242 |
| 1000 | 3300049592 | Ga0501076_0000088 | Ga0501076_0000088_45261_46010 | 242 |
| 1001 | 3300049593 | Ga0501077_0040395 | Ga0501077_0040395_953_1702 | 242 |
| 1002 | 3300049667 | Ga0501230_000829 | Ga0501230_000829_2203_2949 | 242 |
| 1003 | 3300049671 | Ga0501238_005139 | Ga0501238_005139_31_777 | 242 |
| 1004 | 3300049741 | Ga0501079_0001059 | Ga0501079_0001059_9453_10202 | 242 |
| 1005 | 3300049743 | Ga0501081_0010465 | Ga0501081_0010465_3502_4251 | 242 |
| 1006 | 3300049766 | Ga0501269_000164 | Ga0501269_000164_1568_2314 | 242 |
| 1007 | 3300049775 | Ga0501279_002426 | Ga0501279_002426_1101_1847 | 242 |
| 1008 | 3300049822 | Ga0501035_0514817 | Ga0501035_0514817_110_859 | 242 |
| 1009 | 3300049823 | Ga0501044_0000185 | Ga0501044_0000185_20039_20788 | 242 |
| 1010 | 3300049824 | Ga0501045_0004039 | Ga0501045_0004039_869_1618 | 242 |
| 1011 | 3300050491 | nmdc:mga00v17_126051_c1 | nmdc:mga00v17_126051_c1_609_1361 | 242 |
| 1012 | 3300050512 | nmdc:mga0n895_378667_c1 | nmdc:mga0n895_378667_c1_262_1008 | 242 |
| 1013 | 3300053077 | Ga0495601_0002072 | Ga0495601_0002072_1096_1842 | 242 |
| 1014 | 3300053085 | Ga0495619_0128040 | Ga0495619_0128040_128_880 | 242 |
| 1015 | 3300053125 | Ga0500618_000557 | Ga0500618_000557_3067_3813 | 242 |
| 1016 | 3300053125 | Ga0500618_003629 | Ga0500618_003629_2637_3440 | 242 |
| 1017 | 3300053141 | Ga0500574_002040 | Ga0500574_002040_896_1642 | 242 |
| 1018 | 3300053145 | Ga0500586_000137 | Ga0500586_000137_3479_4225 | 242 |
| 1019 | 3300053154 | Ga0500619_000170 | Ga0500619_000170_12506_13252 | 242 |
| 1020 | 3300053154 | Ga0500619_000263 | Ga0500619_000263_4064_4807 | 242 |
| 1021 | 3300060353 | Ga0501082_0011645 | Ga0501082_0011645_4413_5162 | 242 |
| 1022 | 3300061734 | Ga0530510_0001266 | Ga0530510_0001266_876_1625 | 242 |
| 1023 | iso_pu_bacteria | 2765235838 | 2765567347 | 242 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ezn-assembly1.cif.gz_A | crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b | 0.992 | 1 | 235 |
| 1e59-assembly1.cif.gz_A-2 | e.coli cofactor-dependent phosphoglycerate mutase complexed with vanadate | 0.9911 | 1 | 238 |
| 3fdz-assembly1.cif.gz_B | crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b with bound 2,3-diphosphoglyceric acid and 3-phosphoglyceric acid | 0.9904 | 1 | 229 |
| 5um0-assembly1.cif.gz_D | crystal structure of 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase from neisseria gonorrhoeae | 0.9903 | 1 | 228 |
| 5vve-assembly1.cif.gz_A | crystal structure of phosphoglycerate mutase from naegleria fowleri | 0.9869 | 2 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P36623_9_210_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9873 | 4 | 229 | 3.40.50.1240 |
| af_P36623_9_210_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9777 | 4 | 229 | 3.40.50.1240 |
| 1riiA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9658 | 2 | 242 | 3.40.50.1240 |
| 1riiA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.954 | 2 | 242 | 3.40.50.1240 |
| af_Q8T8W6_17_267_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9473 | 2 | 239 | 3.40.50.1240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A259JAP8-F1-model_v4 | deleted | 0.9974 | 1 | 227 |
|
| AF-A0A4Q6DXN7-F1-model_v4 | 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC 5.4.2.11) | 0.9952 | 1 | 226 |
GO:0006094
GO:0006096 GO:0046538 |
| AF-A0A150H3G3-F1-model_v4 | Phosphoglycerate mutase (EC 5.4.2.11) | 0.9952 | 2 | 229 |
GO:0006096
GO:0046538 |
| AF-A0A7X6WPX0-F1-model_v4 | deleted | 0.9952 | 25 | 229 |
|
| AF-C6E639-F1-model_v4 | 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (BPG-dependent PGAM) (PGAM) (Phosphoglyceromutase) (dPGM) (EC 5.4.2.11) | 0.9951 | 1 | 229 |
GO:0006094
GO:0006096 GO:0046538 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar