F488394

General Info

Members Datasets Scaffolds Average Seq Length
1021 487 777 263

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0029841|Ga0316584_0029841_2942_3844
Length 300
Sequence VCAVSSTGGSALPVLTGAAGDRPVMSMPMPLKRLKLHGFNNLTKSLSFNIYDVCYTDSAEQRAAYIAYIDEAYNAERLTAILNDVANIIGATVLNVARQDYEPQGASVTLLIAEEPPAAETISNSATPGPLPEAVVGHLDKSHITVHTYPESHPHNGISTFRADIDVSTCGLISPLKALNYLIHAVESDIVTMDYRVRGFTRDVRGRKHFVDHNISSIQNYLSRDTKNRYQMLDVNVYQENLFHTKMVVSDFRLDDYLFCVDSSQLSDKEQGRIRRLVRREMMEIFYGRNLGRDLGVGES

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2511231007 Pseudomonas sp. GM18 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231012 Pseudomonas sp. GM33 Isolate Nodule
10 2511231014 Pseudomonas sp. GM48 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231017 Pseudomonas sp. GM55 Isolate Nodule
13 2511231018 Pseudomonas sp. GM60 Isolate Nodule
14 2511231019 Pseudomonas sp. GM67 Isolate Nodule
15 2511231020 Pseudomonas sp. GM74 Isolate Nodule
16 2511231023 Pseudomonas sp. GM80 Isolate Nodule
17 2511231031 Pseudomonas sp. GM16 Isolate Nodule
18 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
19 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
20 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
21 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
22 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
23 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
24 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
25 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
26 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
27 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
28 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
29 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
30 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
31 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
32 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
33 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
34 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
35 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
36 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
37 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
38 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
39 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
40 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
41 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
42 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
43 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
44 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
45 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
46 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
47 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
48 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
49 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
50 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
51 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
52 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
53 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
54 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
55 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
56 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
57 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
58 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
59 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
60 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
61 2738543010 Bacillus sp. YR335 Isolate Unclassified
62 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
63 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
64 2738543017 Bacillus sp. OV186 Isolate Unclassified
65 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
66 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
67 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
68 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
69 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
70 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
71 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
72 2773857673 Pseudomonas sp. 443 Isolate Unclassified
73 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
74 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
75 2784132063 Pseudomonas sp. 424 Isolate Unclassified
76 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
77 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
78 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
79 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
80 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
81 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
82 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
83 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
84 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
85 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
86 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
87 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
88 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
89 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
90 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
91 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
92 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
93 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
94 2818991441 Niallia circulans 3243 Isolate Rhizosphere
95 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
96 2818991459 Paenibacillus sp. 597 Isolate Unclassified
97 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
98 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
99 2842682962 Bacillus sp. R-72492 Isolate Unclassified
100 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
101 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
102 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
103 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
104 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
105 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
106 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
107 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
108 2847085930 Erwinia persicina B64 Isolate Bulb
109 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
110 2849139964 Bacillus sp. R-71875 Isolate Unclassified
111 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
112 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
113 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
114 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
115 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
116 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
117 2857581216 Bacillus sp. R-71922 Isolate Unclassified
118 2857586860 Bacillus sp. R-71935 Isolate Unclassified
119 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
120 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
121 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
122 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
123 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
124 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
125 2865014394 Pantoea sp. R-71966 Isolate Unclassified
126 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
127 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
128 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
129 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
130 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
131 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
132 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
133 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
134 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
135 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
136 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
137 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
138 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
139 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
140 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
141 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
142 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
143 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
144 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
145 2904504865 Serratia marcescens 1822 Isolate Unclassified
146 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
147 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
148 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
149 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
150 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
151 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
152 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
153 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
154 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
155 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
156 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
157 2919150387 Rahnella aceris 1817 Isolate Unclassified
158 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
159 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
160 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
161 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
162 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
163 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
164 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
165 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
166 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
167 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
168 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
169 2927143783 Rahnella sp. 2050 Isolate Unclassified
170 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
171 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
172 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
173 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
174 2932406140 Serratia sp. 2723 Isolate Rhizosphere
175 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
176 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
177 2937967321 Serratia sp. YC16 Isolate Unclassified
178 2939577877 Serratia sp. 509 Isolate Rhizosphere
179 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
180 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
181 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
182 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
183 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
184 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
185 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
186 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
187 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
188 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
189 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
190 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
191 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
192 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
193 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
194 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
195 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
196 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
197 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
198 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
199 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
200 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
201 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
202 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
203 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
204 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
205 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
206 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
207 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
208 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
209 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
210 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
211 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
212 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
213 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
214 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
215 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
216 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
217 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
218 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
219 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
220 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
221 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
222 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
223 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
224 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
225 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
226 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
227 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
228 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
229 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
230 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
231 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
232 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
233 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
234 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
235 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
236 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
237 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
238 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
239 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
240 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
241 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
242 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
243 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
244 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
245 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
246 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
247 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
248 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
249 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
250 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
251 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
252 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
253 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
254 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
255 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
256 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
257 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
258 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
259 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
260 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
261 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
262 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
263 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
264 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
265 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
266 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
267 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
268 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
269 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
270 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
271 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
272 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
273 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
274 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
275 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
276 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
277 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
278 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
284 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
285 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
287 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
288 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
289 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
290 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
291 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
292 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
294 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
309 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
310 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
311 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
312 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
313 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
314 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
315 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
317 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
318 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
319 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
320 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
321 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
322 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
323 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
324 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
325 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
326 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
327 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
328 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
329 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
330 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
331 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
332 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
333 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
334 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
335 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
336 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
337 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
338 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
345 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
346 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
347 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
348 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
349 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
350 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
351 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
352 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
353 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
354 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
355 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
356 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
357 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
358 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
359 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
360 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
361 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
362 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
363 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
364 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
365 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
366 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
367 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
368 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
369 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
370 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
371 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
372 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
373 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
374 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
375 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
376 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
377 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
378 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
379 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
380 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
381 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
382 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
383 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
384 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
385 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
386 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
387 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
388 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
389 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
390 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
391 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
392 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
393 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
394 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
395 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
396 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
397 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
398 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
399 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
400 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
401 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
402 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
403 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
404 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
405 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
406 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
407 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
408 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
409 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
410 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
411 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
412 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
413 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
414 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
415 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
416 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
417 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
418 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
419 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
420 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
421 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
422 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
423 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
424 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
425 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
426 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
427 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
428 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
429 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
430 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
431 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
432 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
433 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
434 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
435 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
436 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
437 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
438 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
439 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
440 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
441 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
442 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
443 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
444 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
445 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
457 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
458 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
459 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
460 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
462 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
463 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
464 640753048 Serratia proteamaculans 568 Isolate Endosphere
465 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
466 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
467 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
468 8004592986 Serratia sp. S119 Isolate Unclassified
469 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
470 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
471 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
472 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
473 8022792930 Bacillus sp. Xin Isolate Rhizosphere
474 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
475 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
476 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
477 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
478 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
479 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
480 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
481 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
482 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
483 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
484 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
485 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
486 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
487 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.46
Metatranscriptomes 2.64
Isolates 23.9

Biome Distribution

Category Percentage (%)
Aerial Root 0.59
Bulb 0.1
Endosphere 6.46
Nodule 2.64
Rhizoplane 2.84
Rhizosphere 64.25
Stem 0
Stem Tuber 0.39
Unclassified 22.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_179258 2162886007 Bacteria 1077
2 SwRhRL2b_contig_1896067 2162886007 Bacteria 1832
3 SwRhRL2b_contig_2697100 2162886007 Bacteria 1070
4 SwRhRL2b_contig_3444256 2162886007 Bacteria 1185
5 SwRhRL2b_contig_419289 2162886007 Bacteria 3003
6 JGI24739J22299_10000061 3300001989 Bacteria 30056
7 JGI25162J39368_1000006 3300002737 Bacteria 405267
8 JGI25162J39368_1000659 3300002737 Bacteria 24396
9 JGI25163J39215_1000001 3300002771 Bacteria 314282
10 JGI25163J39215_1000382 3300002771 Bacteria 14268
11 JGI25164J39214_1000001 3300002772 Bacteria 477015
12 JGI25164J39214_1000410 3300002772 Bacteria 24396
13 JGI25152J39213_1000194 3300002773 Bacteria 41017
14 JGI25159J45721_1022814 3300002987 Bacteria 1148
15 JGI25151J46595_10005255 3300003187 Bacteria 6715
16 JGI25151J46595_10007869 3300003187 Bacteria 5178
17 JGI25151J46595_10025601 3300003187 Bacteria 2397
18 JGI25151J46595_10029530 3300003187 Bacteria 2169
19 JGI25165J46597_1000774 3300003214 Bacteria 24396
20 Ga0055538_1000004 3300003751 Bacteria 615646
21 Ga0055538_1000672 3300003751 Bacteria 10604
22 Ga0055539_1000004 3300003752 Bacteria 615646
23 Ga0055533_1000007 3300003756 Bacteria 615646
24 Ga0055532_1000088 3300003758 Bacteria 106291
25 Ga0055525_1000007 3300003759 Bacteria 615646
26 Ga0055536_1020486 3300003781 Bacteria 2040
27 Ga0055530_10000832 3300003791 Bacteria 25491
28 Ga0055540_1000533 3300003792 Bacteria 28667
29 Ga0055531_10000286 3300003794 Bacteria 51010
30 Ga0055531_10001251 3300003794 Bacteria 19278
31 Ga0055541_1000004 3300003841 Bacteria 615646
32 Ga0058692_1000183 3300003856 Bacteria 38266
33 Ga0058692_1000306 3300003856 Bacteria 24787
34 Ga0058692_1000311 3300003856 Bacteria 24338
35 Ga0058692_1003055 3300003856 Bacteria 5338
36 Ga0058692_1003813 3300003856 Bacteria 4582
37 Ga0058692_1005138 3300003856 Bacteria 3767
38 Ga0058692_1008820 3300003856 Bacteria 2585
39 Ga0058692_1008822 3300003856 Bacteria 2585
40 Ga0058692_1020408 3300003856 Bacteria 1394
41 Ga0065714_10000513 3300005288 Bacteria 4119
42 Ga0065704_10001139 3300005289 Bacteria 16584
43 Ga0065704_10001780 3300005289 Bacteria 9988
44 Ga0065704_10009771 3300005289 Bacteria 2536
45 Ga0065704_10073626 3300005289 Bacteria 6944
46 Ga0065704_10090987 3300005289 Bacteria 2749
47 Ga0065712_10001345 3300005290 Bacteria 12716
48 Ga0065712_10068271 3300005290 Bacteria 12282
49 Ga0070676_10115339 3300005328 Bacteria 1678
50 Ga0070668_100085212 3300005347 Bacteria 2483
51 Ga0070669_100003634 3300005353 Bacteria 11125
52 Ga0070659_100376372 3300005366 Bacteria 1195
53 Ga0070662_100032682 3300005457 Bacteria 3657
54 Ga0070665_100009321 3300005548 Bacteria 9935
55 Ga0070665_100141643 3300005548 Bacteria 2408
56 Ga0070665_100460010 3300005548 Bacteria 1282
57 Ga0068857_100000004 3300005577 Bacteria 171895
58 Ga0068851_10043982 3300005834 Bacteria 2253
59 Ga0081455_10099386 3300005937 Bacteria 2340
60 Ga0081455_10257171 3300005937 Bacteria 1273
61 Ga0075365_10227209 3300006038 Bacteria 1310
62 Ga0075364_10002478 3300006051 Bacteria 10335
63 Ga0075364_10002674 3300006051 Bacteria 10002
64 Ga0079104_1000406 3300006946 Bacteria 49721
65 Ga0079104_1001044 3300006946 Bacteria 21144
66 Ga0079104_1005238 3300006946 Bacteria 5236
67 Ga0079104_1006147 3300006946 Bacteria 4621
68 Ga0079104_1012465 3300006946 Bacteria 2668
69 Ga0105251_10000595 3300009011 Bacteria 33132
70 Ga0105251_10001239 3300009011 Bacteria 22107
71 Ga0105251_10002260 3300009011 Bacteria 15297
72 Ga0105251_10008398 3300009011 Bacteria 6217
73 Ga0105251_10009331 3300009011 Bacteria 5802
74 Ga0105251_10015024 3300009011 Bacteria 4248
75 Ga0105251_10016560 3300009011 Bacteria 3979
76 Ga0105251_10018026 3300009011 Bacteria 3766
77 Ga0105251_10033934 3300009011 Bacteria 2529
78 Ga0105251_10035432 3300009011 Bacteria 2462
79 Ga0105251_10063505 3300009011 Bacteria 1732
80 Ga0105244_10000023 3300009036 Bacteria 233110
81 Ga0105244_10000713 3300009036 Bacteria 28708
82 Ga0105244_10001414 3300009036 Bacteria 19428
83 Ga0105244_10001617 3300009036 Bacteria 17859
84 Ga0105244_10004325 3300009036 Bacteria 9821
85 Ga0105244_10010532 3300009036 Bacteria 5602
86 Ga0105244_10013293 3300009036 Bacteria 4818
87 Ga0105244_10025204 3300009036 Bacteria 3236
88 Ga0105244_10047701 3300009036 Bacteria 2195
89 Ga0105244_10050091 3300009036 Bacteria 2131
90 Ga0105244_10074544 3300009036 Bacteria 1688
91 Ga0105250_10000042 3300009092 Bacteria 130495
92 Ga0105250_10000378 3300009092 Bacteria 33263
93 Ga0105250_10001245 3300009092 Bacteria 14110
94 Ga0105250_10003232 3300009092 Bacteria 7768
95 Ga0105250_10030333 3300009092 Bacteria 2174
96 Ga0105250_10074922 3300009092 Bacteria 1369
97 Ga0105240_10252210 3300009093 Bacteria 2040
98 Ga0105247_10000223 3300009101 Bacteria 54349
99 Ga0105243_10002183 3300009148 Bacteria 16513
100 Ga0105243_10055572 3300009148 Bacteria 3146
101 Ga0105243_10197003 3300009148 Bacteria 1764
102 Ga0105243_10297212 3300009148 Bacteria 1462
103 Ga0105241_10000006 3300009174 Bacteria 373608
104 Ga0105241_10434644 3300009174 Bacteria 1158
105 Ga0105239_10268243 3300010375 Bacteria 1919
106 Ga0105246_10005186 3300011119 Bacteria 7919
107 Ga0105246_10010294 3300011119 Bacteria 5779
108 Ga0105246_10013672 3300011119 Bacteria 5093
109 Ga0105246_10020546 3300011119 Bacteria 4237
110 Ga0105246_10027407 3300011119 Bacteria 3732
111 Ga0105246_10105547 3300011119 Bacteria 2059
112 Ga0157345_1000681 3300012498 Bacteria 2780
113 Ga0157373_10003696 3300013100 Bacteria 11578
114 Ga0157373_10013207 3300013100 Bacteria 6062
115 Ga0157373_10062449 3300013100 Bacteria 2639
116 Ga0157371_10000020 3300013102 Bacteria 304987
117 Ga0157371_10000800 3300013102 Bacteria 36092
118 Ga0157371_10002582 3300013102 Bacteria 17186
119 Ga0157371_10005708 3300013102 Bacteria 10433
120 Ga0157371_10026573 3300013102 Bacteria 4206
121 Ga0157371_10115385 3300013102 Bacteria 1907
122 Ga0157371_10219407 3300013102 Bacteria 1365
123 Ga0157371_10260022 3300013102 Bacteria 1251
124 Ga0157370_10000142 3300013104 Bacteria 87393
125 Ga0157370_10001229 3300013104 Bacteria 32093
126 Ga0157370_10002701 3300013104 Bacteria 21260
127 Ga0157370_10126670 3300013104 Bacteria 2383
128 Ga0157369_10008578 3300013105 Bacteria 11721
129 Ga0157369_10010151 3300013105 Bacteria 10747
130 Ga0157369_10012225 3300013105 Bacteria 9747
131 Ga0163162_10018952 3300013306 Bacteria 6749
132 Ga0163162_10025666 3300013306 Bacteria 5825
133 Ga0163162_10440660 3300013306 Bacteria 1435
134 Ga0157372_10002392 3300013307 Bacteria 20313
135 Ga0157372_10012060 3300013307 Bacteria 9205
136 Ga0157372_10335072 3300013307 Bacteria 1762
137 Ga0182008_10055446 3300014497 Bacteria 1960
138 Ga0182008_10147394 3300014497 Bacteria 1179
139 Ga0182006_1004458 3300015261 Bacteria 6900
140 Ga0182006_1005580 3300015261 Bacteria 5970
141 Ga0182006_1006250 3300015261 Bacteria 5551
142 Ga0182005_1004563 3300015265 Bacteria 4452
143 Ga0182005_1013120 3300015265 Bacteria 2333
144 Ga0183366_1003 3300015679 Bacteria 453474
145 Ga0183370_1003 3300015680 Bacteria 454044
146 Ga0183369_1005 3300015685 Bacteria 453680
147 Ga0183368_1006 3300015687 Bacteria 551576
148 Ga0163161_10000050 3300017792 Bacteria 125396
149 Ga0163161_10035907 3300017792 Bacteria 3548
150 Ga0163161_10067649 3300017792 Bacteria 2609
151 Ga0163161_10106308 3300017792 Bacteria 2094
152 Ga0209760_100044 3300025207 Bacteria 111537
153 Ga0209760_100155 3300025207 Bacteria 41538
154 Ga0209784_100001 3300025224 Bacteria 3600592
155 Ga0209784_100325 3300025224 Bacteria 24276
156 Ga0209566_100001 3300025225 Bacteria 3600765
157 Ga0209566_100108 3300025225 Bacteria 119382
158 Ga0209566_100155 3300025225 Bacteria 77547
159 Ga0209674_100002 3300025226 Bacteria 3600592
160 Ga0209147_100058 3300025229 Bacteria 252750
161 Ga0209563_100008 3300025230 Bacteria 1554545
162 Ga0209563_100863 3300025230 Bacteria 9009
163 Ga0207427_100002 3300025231 Bacteria 1355321
164 Ga0207427_100006 3300025231 Bacteria 785415
165 Ga0209437_100013 3300025233 Bacteria 785457
166 Ga0209437_100046 3300025233 Bacteria 405293
167 Ga0209437_100063 3300025233 Bacteria 335477
168 Ga0209437_101051 3300025233 Bacteria 9178
169 Ga0209677_100004 3300025253 Bacteria 1554545
170 Ga0209759_1010700 3300025256 Bacteria 2669
171 Ga0209129_1000008 3300025258 Bacteria 640959
172 Ga0209233_1000022 3300025261 Bacteria 785415
173 Ga0209233_1001000 3300025261 Bacteria 12086
174 Ga0209130_1002272 3300025284 Bacteria 9910
175 Ga0209676_1000015 3300025292 Bacteria 784458
176 Ga0209676_1000574 3300025292 Bacteria 55392
177 Ga0209676_1001175 3300025292 Bacteria 28332
178 Ga0209676_1055365 3300025292 Bacteria 1017
179 Ga0209025_1000801 3300025294 Bacteria 51045
180 Ga0209025_1001470 3300025294 Bacteria 30704
181 Ga0209025_1002760 3300025294 Bacteria 17742
182 Ga0209025_1005308 3300025294 Bacteria 10582
183 Ga0209050_1001031 3300025298 Bacteria 34644
184 Ga0209050_1005862 3300025298 Bacteria 7521
185 Ga0209051_1000041 3300025303 Bacteria 311155
186 Ga0209257_1000069 3300025304 Bacteria 339826
187 Ga0207656_10045750 3300025321 Bacteria 1874
188 Ga0207696_1000014 3300025711 Bacteria 517939
189 Ga0207696_1000027 3300025711 Bacteria 412783
190 Ga0207696_1000066 3300025711 Bacteria 231203
191 Ga0207696_1000319 3300025711 Bacteria 51975
192 Ga0207696_1000598 3300025711 Bacteria 27197
193 Ga0207696_1000663 3300025711 Bacteria 24393
194 Ga0207696_1001272 3300025711 Bacteria 14110
195 Ga0207696_1003590 3300025711 Bacteria 7005
196 Ga0207696_1005762 3300025711 Bacteria 5091
197 Ga0207696_1010946 3300025711 Bacteria 3299
198 Ga0207696_1020689 3300025711 Bacteria 2117
199 Ga0207655_1000017 3300025728 Bacteria 544403
200 Ga0207655_1000028 3300025728 Bacteria 437324
201 Ga0207655_1000056 3300025728 Bacteria 279166
202 Ga0207655_1000223 3300025728 Bacteria 96651
203 Ga0207655_1001041 3300025728 Bacteria 27873
204 Ga0207655_1001219 3300025728 Bacteria 24788
205 Ga0207655_1001446 3300025728 Bacteria 21992
206 Ga0207655_1001643 3300025728 Bacteria 19816
207 Ga0207655_1003013 3300025728 Bacteria 12894
208 Ga0207655_1005240 3300025728 Bacteria 8899
209 Ga0207655_1006410 3300025728 Bacteria 7801
210 Ga0207655_1007055 3300025728 Bacteria 7354
211 Ga0207655_1008271 3300025728 Bacteria 6624
212 Ga0207655_1008821 3300025728 Bacteria 6343
213 Ga0207655_1027648 3300025728 Bacteria 2697
214 Ga0207655_1030437 3300025728 Bacteria 2509
215 Ga0207655_1032019 3300025728 Bacteria 2411
216 Ga0207655_1033857 3300025728 Bacteria 2308
217 Ga0207655_1046600 3300025728 Bacteria 1798
218 Ga0207713_1000007 3300025735 Bacteria 564979
219 Ga0207713_1000048 3300025735 Bacteria 228272
220 Ga0207713_1000057 3300025735 Bacteria 217090
221 Ga0207713_1000164 3300025735 Bacteria 98195
222 Ga0207713_1000362 3300025735 Bacteria 49304
223 Ga0207713_1000420 3300025735 Bacteria 45109
224 Ga0207713_1001415 3300025735 Bacteria 19260
225 Ga0207713_1002240 3300025735 Bacteria 14314
226 Ga0207713_1005632 3300025735 Bacteria 7789
227 Ga0207713_1009623 3300025735 Bacteria 5426
228 Ga0207713_1012812 3300025735 Bacteria 4458
229 Ga0207713_1024793 3300025735 Bacteria 2785
230 Ga0207713_1038584 3300025735 Bacteria 2025
231 Ga0207713_1049913 3300025735 Bacteria 1674
232 Ga0207713_1054608 3300025735 Bacteria 1565
233 Ga0207713_1129300 3300025735 Bacteria 838
234 Ga0207710_10000007 3300025900 Bacteria 488292
235 Ga0207645_10191014 3300025907 Bacteria 1346
236 Ga0207654_10000008 3300025911 Bacteria 375871
237 Ga0207695_10186172 3300025913 Bacteria 1995
238 Ga0207681_10009669 3300025923 Bacteria 5898
239 Ga0207706_10006427 3300025933 Bacteria 10915
240 Ga0207706_10012888 3300025933 Bacteria 7610
241 Ga0207709_10000506 3300025935 Bacteria 34436
242 Ga0207709_10001680 3300025935 Bacteria 14910
243 Ga0207709_10019891 3300025935 Bacteria 3781
244 Ga0207678_10092768 3300026067 Bacteria 2580
245 Ga0207674_10000009 3300026116 Bacteria 202730
246 Ga0209281_1000016 3300027111 Bacteria 588107
247 Ga0209281_1000058 3300027111 Bacteria 300244
248 Ga0209281_1000060 3300027111 Bacteria 295683
249 Ga0209281_1000146 3300027111 Bacteria 169237
250 Ga0209281_1000260 3300027111 Bacteria 101875
251 Ga0209281_1000298 3300027111 Bacteria 90323
252 Ga0209281_1000891 3300027111 Bacteria 25418
253 Ga0209281_1003504 3300027111 Bacteria 5156
254 Ga0209281_1010011 3300027111 Bacteria 2194
255 Ga0209371_1000014 3300027312 Bacteria 661118
256 Ga0209371_1000030 3300027312 Bacteria 423605
257 Ga0209371_1000053 3300027312 Bacteria 264616
258 Ga0209371_1000096 3300027312 Bacteria 160552
259 Ga0209371_1000276 3300027312 Bacteria 59687
260 Ga0209371_1000300 3300027312 Bacteria 55324
261 Ga0209371_1000435 3300027312 Bacteria 42480
262 Ga0209371_1001319 3300027312 Bacteria 17337
263 Ga0209371_1001390 3300027312 Bacteria 16613
264 Ga0209371_1001468 3300027312 Bacteria 15875
265 Ga0209371_1002980 3300027312 Bacteria 8794
266 Ga0209371_1003617 3300027312 Bacteria 7375
267 Ga0209371_1004348 3300027312 Bacteria 6226
268 Ga0209371_1018900 3300027312 Bacteria 1736
269 Ga0209969_1012631 3300027360 Bacteria 1219
270 Ga0209995_1000634 3300027471 Bacteria 5417
271 Ga0209983_1000782 3300027665 Bacteria 6913
272 Ga0209971_1000459 3300027682 Bacteria 10808
273 Ga0209974_10001088 3300027876 Bacteria 9626
274 Ga0268266_10000307 3300028379 Bacteria 77625
275 Ga0268266_10002381 3300028379 Bacteria 20323
276 Ga0268266_10108839 3300028379 Bacteria 2453
277 Ga0268266_10483741 3300028379 Bacteria 1180
278 Ga0268256_1000012 3300030500 Bacteria 794553
279 Ga0268256_1000021 3300030500 Bacteria 542735
280 Ga0268256_1000025 3300030500 Bacteria 484317
281 Ga0268256_1000053 3300030500 Bacteria 264616
282 Ga0268256_1000086 3300030500 Bacteria 160533
283 Ga0268256_1000230 3300030500 Bacteria 59687
284 Ga0268256_1001193 3300030500 Bacteria 16613
285 Ga0268256_1001251 3300030500 Bacteria 15875
286 Ga0268256_1001533 3300030500 Bacteria 13631
287 Ga0268256_1002281 3300030500 Bacteria 9957
288 Ga0268256_1003295 3300030500 Bacteria 7410
289 Ga0268256_1004026 3300030500 Bacteria 6315
290 Ga0268256_1021167 3300030500 Bacteria 1736
291 Ga0316177_1153363 3300030731 Bacteria 3754
292 Ga0314311_1171705 3300030733 Bacteria 3858
293 Ga0316178_1009978 3300030735 Bacteria 23983
294 Ga0316183_1089672 3300030742 Bacteria 1835
295 Ga0316181_1195268 3300030744 Bacteria 1666
296 Ga0265331_10022548 3300031250 Bacteria 3212
297 Ga0265327_10000393 3300031251 Bacteria 82261
298 Ga0265327_10003818 3300031251 Bacteria 13925
299 Ga0265327_10009488 3300031251 Bacteria 7016
300 Ga0265327_10085252 3300031251 Bacteria 1551
301 Ga0265316_10001475 3300031344 Bacteria 25202
302 Ga0265316_10010827 3300031344 Bacteria 8286
303 Ga0307408_100004188 3300031548 Bacteria 9830
304 Ga0316575_10031837 3300031665 Bacteria 2065
305 Ga0316575_10034455 3300031665 Bacteria 1989
306 Ga0316579_10000764 3300031691 Bacteria 11024
307 Ga0316579_10000832 3300031691 Bacteria 10658
308 Ga0316579_10000866 3300031691 Bacteria 10471
309 Ga0316579_10005086 3300031691 Bacteria 5275
310 Ga0316579_10006802 3300031691 Bacteria 4683
311 Ga0316579_10011962 3300031691 Bacteria 3702
312 Ga0316579_10029923 3300031691 Bacteria 2486
313 Ga0316579_10079247 3300031691 Bacteria 1563
314 Ga0316579_10097985 3300031691 Bacteria 1403
315 Ga0316579_10205903 3300031691 Bacteria 951
316 Ga0265314_10201888 3300031711 Bacteria 1174
317 Ga0316576_10005252 3300031727 Bacteria 7883
318 Ga0316576_10018090 3300031727 Bacteria 4803
319 Ga0316576_10025690 3300031727 Bacteria 4125
320 Ga0316576_10036563 3300031727 Bacteria 3511
321 Ga0316576_10039565 3300031727 Bacteria 3385
322 Ga0316576_10056298 3300031727 Bacteria 2871
323 Ga0316576_10056991 3300031727 Bacteria 2855
324 Ga0316576_10067834 3300031727 Bacteria 2627
325 Ga0316576_10080683 3300031727 Bacteria 2413
326 Ga0316576_10109534 3300031727 Bacteria 2070
327 Ga0316576_10412245 3300031727 Bacteria 1000
328 Ga0316578_10000708 3300031728 Bacteria 12056
329 Ga0316578_10004427 3300031728 Bacteria 6634
330 Ga0316578_10006348 3300031728 Bacteria 5826
331 Ga0316578_10015990 3300031728 Bacteria 4050
332 Ga0316578_10018852 3300031728 Bacteria 3789
333 Ga0316578_10022900 3300031728 Bacteria 3490
334 Ga0316578_10030290 3300031728 Bacteria 3075
335 Ga0316578_10038051 3300031728 Bacteria 2773
336 Ga0316578_10059355 3300031728 Bacteria 2250
337 Ga0316578_10084927 3300031728 Bacteria 1886
338 Ga0316578_10123758 3300031728 Bacteria 1555
339 Ga0316578_10281481 3300031728 Bacteria 996
340 Ga0307405_10000248 3300031731 Bacteria 19649
341 Ga0316577_10001781 3300031733 Bacteria 10385
342 Ga0316577_10002393 3300031733 Bacteria 9283
343 Ga0316577_10008258 3300031733 Bacteria 5577
344 Ga0316577_10020992 3300031733 Bacteria 3621
345 Ga0316577_10024227 3300031733 Bacteria 3373
346 Ga0316577_10052266 3300031733 Bacteria 2279
347 Ga0316577_10085105 3300031733 Bacteria 1769
348 Ga0316577_10105491 3300031733 Bacteria 1581
349 Ga0316577_10135604 3300031733 Bacteria 1386
350 Ga0307406_10004204 3300031901 Bacteria 7840
351 Ga0307414_10032415 3300032004 Bacteria 3439
352 Ga0316583_10000732 3300032133 Bacteria 10221
353 Ga0316583_10002841 3300032133 Bacteria 6070
354 Ga0316583_10014978 3300032133 Bacteria 2791
355 Ga0316583_10015499 3300032133 Bacteria 2743
356 Ga0316583_10056945 3300032133 Bacteria 1373
357 Ga0316585_10000930 3300032137 Bacteria 7500
358 Ga0316585_10021392 3300032137 Bacteria 1986
359 Ga0316585_10022775 3300032137 Bacteria 1928
360 Ga0316585_10093532 3300032137 Bacteria 983
361 Ga0316580_10000571 3300032139 Bacteria 8632
362 Ga0316580_10001354 3300032139 Bacteria 6363
363 Ga0316580_10007878 3300032139 Bacteria 3181
364 Ga0316593_10000385 3300032168 Bacteria 7877
365 Ga0316593_10001920 3300032168 Bacteria 4768
366 Ga0316593_10003764 3300032168 Bacteria 3811
367 Ga0316593_10005777 3300032168 Bacteria 3295
368 Ga0316593_10016016 3300032168 Bacteria 2266
369 Ga0316593_10032512 3300032168 Bacteria 1704
370 Ga0316593_10044636 3300032168 Bacteria 1484
371 Ga0316593_10047692 3300032168 Bacteria 1441
372 Ga0316592_1008270 3300033524 Bacteria 2049
373 Ga0316586_1001708 3300033527 Bacteria 2598
374 Ga0316586_1011739 3300033527 Bacteria 1347
375 Ga0316588_1002169 3300033528 Bacteria 3383
376 Ga0316588_1015885 3300033528 Bacteria 1662
377 Ga0316587_1003873 3300033529 Bacteria 2130
378 Ga0316587_1011921 3300033529 Bacteria 1409
379 Ga0316587_1024496 3300033529 Bacteria 1044
380 Ga0316596_1002356 3300033541 Bacteria 4021
381 Ga0316596_1009573 3300033541 Bacteria 2326
382 Ga0316596_1015987 3300033541 Bacteria 1877
383 Ga0316596_1020019 3300033541 Bacteria 1700
384 Ga0316596_1033058 3300033541 Bacteria 1347
385 Ga0316596_1044267 3300033541 Bacteria 1172
386 Ga0316574_0000526 3300035398 Bacteria 15691
387 Ga0316574_0001797 3300035398 Bacteria 10438
388 Ga0316574_0003658 3300035398 Bacteria 7961
389 Ga0316574_0006602 3300035398 Bacteria 6284
390 Ga0316574_0008008 3300035398 Bacteria 5837
391 Ga0316574_0024772 3300035398 Bacteria 3595
392 Ga0316574_0024907 3300035398 Bacteria 3586
393 Ga0316574_0040121 3300035398 Bacteria 2881
394 Ga0316574_0040353 3300035398 Bacteria 2874
395 Ga0316574_0045189 3300035398 Bacteria 2727
396 Ga0316574_0050031 3300035398 Bacteria 2600
397 Ga0316574_0057258 3300035398 Bacteria 2440
398 Ga0316574_0061282 3300035398 Bacteria 2362
399 Ga0316574_0078434 3300035398 Bacteria 2094
400 Ga0316574_0138951 3300035398 Bacteria 1565
401 Ga0316574_0202070 3300035398 Bacteria 1276
402 Ga0316574_0256224 3300035398 Bacteria 1118
403 Ga0316574_0277532 3300035398 Bacteria 1068
404 Ga0316582_0001017 3300036647 Bacteria 11725
405 Ga0316582_0001397 3300036647 Bacteria 10537
406 Ga0316582_0002764 3300036647 Bacteria 8351
407 Ga0316582_0003814 3300036647 Bacteria 7490
408 Ga0316582_0005774 3300036647 Bacteria 6421
409 Ga0316582_0006041 3300036647 Bacteria 6313
410 Ga0316582_0008555 3300036647 Bacteria 5509
411 Ga0316582_0011379 3300036647 Bacteria 4914
412 Ga0316582_0011568 3300036647 Bacteria 4886
413 Ga0316582_0019086 3300036647 Bacteria 4006
414 Ga0316582_0025706 3300036647 Bacteria 3538
415 Ga0316582_0035735 3300036647 Bacteria 3071
416 Ga0316582_0043915 3300036647 Bacteria 2807
417 Ga0316582_0049146 3300036647 Bacteria 2668
418 Ga0316582_0050615 3300036647 Bacteria 2632
419 Ga0316582_0053755 3300036647 Bacteria 2562
420 Ga0316582_0169537 3300036647 Bacteria 1481
421 Ga0316582_0211346 3300036647 Bacteria 1325
422 Ga0316582_0343680 3300036647 Bacteria 1026
423 Ga0316582_0471825 3300036647 Bacteria 865
424 Ga0316584_0001979 3300036712 Bacteria 12787
425 Ga0316584_0008900 3300036712 Bacteria 6941
426 Ga0316584_0009487 3300036712 Bacteria 6759
427 Ga0316584_0012711 3300036712 Bacteria 5941
428 Ga0316584_0015347 3300036712 Bacteria 5477
429 Ga0316584_0015982 3300036712 Bacteria 5376
430 Ga0316584_0020856 3300036712 Bacteria 4758
431 Ga0316584_0022059 3300036712 Bacteria 4640
432 Ga0316584_0024898 3300036712 Bacteria 4384
433 Ga0316584_0028328 3300036712 Bacteria 4129
434 Ga0316584_0029841 3300036712 Bacteria 4026
435 Ga0316584_0057146 3300036712 Bacteria 2921
436 Ga0316584_0070421 3300036712 Bacteria 2621
437 Ga0316584_0108352 3300036712 Bacteria 2078
438 Ga0316584_0137624 3300036712 Bacteria 1822
439 Ga0316584_0156393 3300036712 Bacteria 1695
440 Ga0316584_0163229 3300036712 Bacteria 1654
441 Ga0316584_0169456 3300036712 Bacteria 1620
442 Ga0316584_0355740 3300036712 Bacteria 1050
443 Ga0316581_0000605 3300037588 Bacteria 7106
444 Ga0316581_0001282 3300037588 Bacteria 5581
445 Ga0316581_0013993 3300037588 Bacteria 2281
446 Ga0316581_0019495 3300037588 Bacteria 1979
447 Ga0316581_0037767 3300037588 Bacteria 1468
448 Ga0237819_00998 3300038705 Bacteria 8547
449 Ga0400484_23537 3300038725 Bacteria 13279
450 Ga0400490_46332 3300038726 Bacteria 6117
451 Ga0400490_50955 3300038726 Bacteria 4469
452 Ga0400485_04817 3300038735 Bacteria 2133
453 Ga0400488_18063 3300038741 Bacteria 3628
454 Ga0400488_23404 3300038741 Bacteria 1690
455 Ga0400486_10873 3300038742 Bacteria 1348
456 Ga0400486_27166 3300038742 Bacteria 3998
457 Ga0400483_017640 3300039062 Bacteria 9395
458 Ga0400483_039315 3300039062 Bacteria 4266
459 Ga0400483_070366 3300039062 Bacteria 2281
460 Ga0400483_193205 3300039062 Bacteria 4917
461 Ga0400483_284851 3300039062 Bacteria 2473
462 Ga0400489_94800 3300039093 Bacteria 4454
463 Ga0400487_62529 3300039110 Bacteria 2574
464 Ga0439436_0009790 3300041404 Bacteria 2934
465 Ga0439438_000003 3300041405 Bacteria 464587
466 Ga0439438_003055 3300041405 Bacteria 6881
467 Ga0439438_007793 3300041405 Bacteria 3618
468 Ga0439439_0005991 3300041406 Bacteria 2798
469 Ga0439447_000387 3300041407 Bacteria 16130
470 Ga0439447_001753 3300041407 Bacteria 7962
471 Ga0439447_006699 3300041407 Bacteria 3712
472 Ga0439447_016244 3300041407 Bacteria 2047
473 Ga0439466_0000107 3300041411 Bacteria 31816
474 Ga0439466_0002320 3300041411 Bacteria 7471
475 Ga0439466_0003915 3300041411 Bacteria 5742
476 Ga0439466_0013218 3300041411 Bacteria 3024
477 Ga0451853_3494193 3300041512 Bacteria 2357
478 Ga0439431_0000429 3300041997 Bacteria 8934
479 Ga0439431_0005059 3300041997 Bacteria 2907
480 Ga0439431_0011438 3300041997 Bacteria 2028
481 Ga0439433_0000804 3300041999 Bacteria 6199
482 Ga0439437_000864 3300042000 Bacteria 3151
483 Ga0439432_000568 3300042006 Bacteria 13848
484 Ga0439432_000616 3300042006 Bacteria 13400
485 Ga0439432_018713 3300042006 Bacteria 2312
486 Ga0439449_0000086 3300042007 Bacteria 30358
487 Ga0439452_000004 3300042010 Bacteria 764268
488 Ga0439452_000005 3300042010 Bacteria 646919
489 Ga0439452_000074 3300042010 Bacteria 88357
490 Ga0439452_001682 3300042010 Bacteria 8686
491 Ga0439452_003675 3300042010 Bacteria 5314
492 Ga0439452_004175 3300042010 Bacteria 4897
493 Ga0439452_010592 3300042010 Bacteria 2674
494 Ga0439462_0004980 3300042015 Bacteria 3260
495 Ga0439463_000657 3300042016 Bacteria 9599
496 Ga0439463_005527 3300042016 Bacteria 3141
497 Ga0450911_000330 3300042115 Bacteria 16996
498 Ga0450923_035777 3300042125 Bacteria 1028
499 Ga0450904_000169 3300042139 Bacteria 14258
500 Ga0450907_000034 3300042146 Bacteria 61803
501 Ga0450907_001447 3300042146 Bacteria 5129
502 Ga0439446_0003777 3300042156 Bacteria 3787
503 Ga0439446_0010581 3300042156 Bacteria 2487
504 Ga0439464_0009420 3300042439 Bacteria 2571
505 Ga0450893_0003734 3300042532 Bacteria 2409
506 Ga0451577_0000096 3300042876 Bacteria 195129
507 Ga0453684_0001083 3300044712 Bacteria 86721
508 Ga0453684_0003868 3300044712 Bacteria 32963
509 Ga0453684_0004281 3300044712 Bacteria 30458
510 Ga0453684_0016029 3300044712 Bacteria 11766
511 Ga0453684_0039530 3300044712 Bacteria 6426
512 Ga0453684_0073400 3300044712 Bacteria 4313
513 Ga0453684_0189408 3300044712 Bacteria 2408
514 Ga0453684_0300539 3300044712 Bacteria 1824
515 Ga0453684_0328156 3300044712 Bacteria 1731
516 Ga0451576_0274447 3300045051 Bacteria 1763
517 Ga0495627_000266 3300046453 Bacteria 53407
518 Ga0495627_002309 3300046453 Bacteria 9398
519 Ga0495591_000047 3300046458 Bacteria 140371
520 Ga0495591_000781 3300046458 Bacteria 22669
521 Ga0495591_004492 3300046458 Bacteria 6812
522 Ga0495591_007463 3300046458 Bacteria 4644
523 Ga0495591_029949 3300046458 Bacteria 1648
524 Ga0495638_0005629 3300046460 Bacteria 9236
525 Ga0495638_0076348 3300046460 Bacteria 2041
526 Ga0495650_0000004 3300046471 Bacteria 779487
527 Ga0495650_0000028 3300046471 Bacteria 473012
528 Ga0495650_0006996 3300046471 Bacteria 6888
529 Ga0495650_0010358 3300046471 Bacteria 5210
530 Ga0495650_0035387 3300046471 Bacteria 2199
531 Ga0495605_0000278 3300046474 Bacteria 57625
532 Ga0495605_0000930 3300046474 Bacteria 20030
533 Ga0495605_0006053 3300046474 Bacteria 6988
534 Ga0495605_0017501 3300046474 Bacteria 3855
535 Ga0495605_0032038 3300046474 Bacteria 2680
536 Ga0495585_0085228 3300046492 Bacteria 1707
537 Ga0495594_0000635 3300046499 Bacteria 18070
538 Ga0495607_0001037 3300046501 Bacteria 25477
539 Ga0495607_0001805 3300046501 Bacteria 18284
540 Ga0495607_0083259 3300046501 Bacteria 1752
541 Ga0495583_0000504 3300046506 Bacteria 56210
542 Ga0495583_0003618 3300046506 Bacteria 11573
543 Ga0495583_0122853 3300046506 Bacteria 1091
544 Ga0495606_0000631 3300046507 Bacteria 55444
545 Ga0495606_0000785 3300046507 Bacteria 48544
546 Ga0495606_0000954 3300046507 Bacteria 42555
547 Ga0495610_0007403 3300046512 Bacteria 7313
548 Ga0495616_0017184 3300046513 Bacteria 3991
549 Ga0495620_0000153 3300046515 Bacteria 56187
550 Ga0495620_0001468 3300046515 Bacteria 14106
551 Ga0495620_0022124 3300046515 Bacteria 3070
552 Ga0495631_0000885 3300046518 Bacteria 18745
553 Ga0495631_0008078 3300046518 Bacteria 5317
554 Ga0495637_0003816 3300046520 Bacteria 7920
555 Ga0495637_0092316 3300046520 Bacteria 1192
556 Ga0495643_0001069 3300046522 Bacteria 27292
557 Ga0495643_0024885 3300046522 Bacteria 3392
558 Ga0495644_0007545 3300046523 Bacteria 4193
559 Ga0495648_0003159 3300046524 Bacteria 14659
560 Ga0495648_0006054 3300046524 Bacteria 9924
561 Ga0495648_0009421 3300046524 Bacteria 7574
562 Ga0495648_0010621 3300046524 Bacteria 6997
563 Ga0495642_0000848 3300046528 Bacteria 14563
564 Ga0495642_0001368 3300046528 Bacteria 10903
565 Ga0495654_0000546 3300046530 Bacteria 30342
566 Ga0495654_0001218 3300046530 Bacteria 18240
567 Ga0495654_0001456 3300046530 Bacteria 16218
568 Ga0495654_0145543 3300046530 Bacteria 1052
569 Ga0495587_0010198 3300046536 Bacteria 5991
570 Ga0495609_0000166 3300046538 Bacteria 69064
571 Ga0495609_0045207 3300046538 Bacteria 1973
572 Ga0495597_0003210 3300046542 Bacteria 9734
573 Ga0495633_0000291 3300046558 Bacteria 57655
574 Ga0495656_0005423 3300046615 Bacteria 4402
575 Ga0495611_0008254 3300046648 Bacteria 4417
576 Ga0495661_0000294 3300046665 Bacteria 56661
577 Ga0495661_0079341 3300046665 Bacteria 1897
578 Ga0495623_0045526 3300046679 Bacteria 2787
579 Ga0495646_0104365 3300046680 Bacteria 1620
580 Ga0495669_0002337 3300046684 Bacteria 7770
581 Ga0495670_0014298 3300046691 Bacteria 3903
582 Ga0495671_0002990 3300046692 Bacteria 10507
583 Ga0495671_0112674 3300046692 Bacteria 1328
584 Ga0495649_0012306 3300046694 Bacteria 4985
585 Ga0495649_0031182 3300046694 Bacteria 2940
586 Ga0495649_0261235 3300046694 Bacteria 887
587 Ga0495589_0000028 3300046794 Bacteria 179523
588 Ga0495589_0000676 3300046794 Bacteria 22317
589 Ga0495660_0000013 3300046810 Bacteria 350283
590 Ga0495660_0000516 3300046810 Bacteria 31688
591 Ga0495660_0008552 3300046810 Bacteria 5992
592 Ga0495636_0048751 3300047318 Bacteria 1770
593 Ga0495672_0000029 3300047320 Bacteria 305231
594 Ga0495672_0000054 3300047320 Bacteria 230777
595 Ga0495672_0008309 3300047320 Bacteria 7686
596 Ga0495672_0084814 3300047320 Bacteria 1756
597 Ga0495683_0000196 3300047323 Bacteria 57478
598 Ga0495683_0001353 3300047323 Bacteria 16343
599 Ga0495683_0001587 3300047323 Bacteria 14649
600 Ga0495687_008219 3300047443 Bacteria 6008
601 Ga0495675_0045645 3300047444 Bacteria 2790
602 Ga0495679_000987 3300047446 Bacteria 17554
603 Ga0495679_026456 3300047446 Bacteria 1926
604 Ga0495673_0000047 3300047469 Bacteria 266522
605 Ga0495673_0000092 3300047469 Bacteria 187963
606 Ga0495673_0006592 3300047469 Bacteria 6808
607 Ga0495673_0007180 3300047469 Bacteria 6446
608 Ga0495673_0015070 3300047469 Bacteria 3996
609 Ga0495673_0046250 3300047469 Bacteria 1929
610 Ga0495681_0010573 3300047470 Bacteria 5580
611 Ga0495681_0011600 3300047470 Bacteria 5235
612 Ga0495681_0031723 3300047470 Bacteria 2670
613 Ga0495686_0067279 3300047472 Bacteria 2212
614 Ga0495626_0077596 3300048091 Bacteria 1480
615 Ga0496100_0112202 3300048903 Bacteria 1896
616 Ga0496101_0105686 3300048904 Bacteria 2113
617 Ga0496102_0003362 3300048905 Bacteria 13560
618 Ga0496102_0145276 3300048905 Bacteria 2226
619 Ga0496102_0352048 3300048905 Bacteria 1387
620 Ga0496102_0372192 3300048905 Bacteria 1344
621 Ga0496103_0108925 3300048906 Bacteria 1758
622 Ga0496104_0001075 3300048907 Bacteria 23321
623 Ga0496104_0011029 3300048907 Bacteria 8084
624 Ga0496104_0155030 3300048907 Bacteria 2199
625 Ga0496104_0300655 3300048907 Bacteria 1517
626 Ga0496105_0002003 3300048908 Bacteria 14699
627 Ga0496105_0067341 3300048908 Bacteria 2956
628 Ga0496105_0195630 3300048908 Bacteria 1652
629 Ga0496105_0346463 3300048908 Bacteria 1187
630 Ga0496116_0000009 3300048919 Bacteria 716119
631 Ga0496116_0000016 3300048919 Bacteria 555146
632 Ga0496116_0000214 3300048919 Bacteria 109085
633 Ga0496116_0000368 3300048919 Bacteria 69066
634 Ga0496116_0007736 3300048919 Bacteria 9455
635 Ga0496116_0009298 3300048919 Bacteria 8396
636 Ga0496116_0020768 3300048919 Bacteria 4974
637 Ga0496116_0026248 3300048919 Bacteria 4264
638 Ga0496116_0030775 3300048919 Bacteria 3851
639 Ga0496116_0030916 3300048919 Bacteria 3841
640 Ga0496116_0054852 3300048919 Bacteria 2622
641 Ga0496116_0252597 3300048919 Bacteria 876
642 Ga0496117_0000350 3300048920 Bacteria 81439
643 Ga0496117_0000753 3300048920 Bacteria 51060
644 Ga0496117_0000772 3300048920 Bacteria 50588
645 Ga0496117_0003500 3300048920 Bacteria 18205
646 Ga0496117_0004686 3300048920 Bacteria 14856
647 Ga0496117_0021006 3300048920 Bacteria 5304
648 Ga0496117_0022249 3300048920 Bacteria 5090
649 Ga0496117_0056339 3300048920 Bacteria 2738
650 Ga0496117_0083835 3300048920 Bacteria 2082
651 Ga0496118_0000821 3300048921 Bacteria 49444
652 Ga0496118_0001525 3300048921 Bacteria 34487
653 Ga0496118_0001665 3300048921 Bacteria 32618
654 Ga0496118_0002391 3300048921 Bacteria 25363
655 Ga0496118_0003425 3300048921 Bacteria 20012
656 Ga0496118_0022263 3300048921 Bacteria 5548
657 Ga0496118_0030448 3300048921 Bacteria 4503
658 Ga0496118_0076287 3300048921 Bacteria 2384
659 Ga0496118_0082275 3300048921 Bacteria 2256
660 Ga0496119_0000134 3300048922 Bacteria 104139
661 Ga0496119_0000171 3300048922 Bacteria 91583
662 Ga0496119_0000226 3300048922 Bacteria 78974
663 Ga0496119_0000516 3300048922 Bacteria 52621
664 Ga0496119_0002114 3300048922 Bacteria 22380
665 Ga0496119_0004720 3300048922 Bacteria 13398
666 Ga0496119_0005631 3300048922 Bacteria 11907
667 Ga0496119_0007240 3300048922 Bacteria 10041
668 Ga0496119_0008294 3300048922 Bacteria 9161
669 Ga0496119_0010529 3300048922 Bacteria 7766
670 Ga0496119_0012717 3300048922 Bacteria 6802
671 Ga0496119_0081167 3300048922 Bacteria 1868
672 Ga0496120_0000017 3300048923 Bacteria 269222
673 Ga0496120_0000032 3300048923 Bacteria 220255
674 Ga0496120_0000330 3300048923 Bacteria 78975
675 Ga0496120_0002452 3300048923 Bacteria 18740
676 Ga0496120_0002661 3300048923 Bacteria 17615
677 Ga0496120_0002723 3300048923 Bacteria 17271
678 Ga0496120_0003940 3300048923 Bacteria 12942
679 Ga0496120_0006300 3300048923 Bacteria 9143
680 Ga0496120_0010236 3300048923 Bacteria 6565
681 Ga0496120_0010281 3300048923 Bacteria 6546
682 Ga0496120_0010797 3300048923 Bacteria 6327
683 Ga0496120_0044727 3300048923 Bacteria 2570
684 Ga0496120_0073633 3300048923 Bacteria 1868
685 Ga0496121_0000336 3300048924 Bacteria 97792
686 Ga0496121_0003876 3300048924 Bacteria 20792
687 Ga0496121_0018475 3300048924 Bacteria 7028
688 Ga0496121_0023839 3300048924 Bacteria 5873
689 Ga0496121_0030318 3300048924 Bacteria 4968
690 Ga0496121_0067776 3300048924 Bacteria 2890
691 Ga0496121_0093404 3300048924 Bacteria 2342
692 Ga0496121_0106388 3300048924 Bacteria 2150
693 Ga0496121_0299097 3300048924 Bacteria 1093
694 Ga0496122_0000419 3300048925 Bacteria 89990
695 Ga0496122_0000481 3300048925 Bacteria 82890
696 Ga0496122_0004379 3300048925 Bacteria 17595
697 Ga0496122_0005594 3300048925 Bacteria 14872
698 Ga0496122_0006694 3300048925 Bacteria 13120
699 Ga0496122_0054239 3300048925 Bacteria 3013
700 Ga0496122_0088207 3300048925 Bacteria 2127
701 Ga0496122_0145243 3300048925 Bacteria 1475
702 Ga0496122_0183502 3300048925 Bacteria 1244
703 Ga0496123_0000385 3300048926 Bacteria 82890
704 Ga0496123_0000746 3300048926 Bacteria 52614
705 Ga0496123_0001433 3300048926 Bacteria 33269
706 Ga0496123_0001855 3300048926 Bacteria 27728
707 Ga0496123_0010008 3300048926 Bacteria 8449
708 Ga0496123_0015833 3300048926 Bacteria 6159
709 Ga0496123_0035253 3300048926 Bacteria 3568
710 Ga0496123_0096672 3300048926 Bacteria 1733
711 Ga0496123_0107489 3300048926 Bacteria 1604
712 Ga0496123_0122985 3300048926 Bacteria 1455
713 Ga0496124_0000096 3300048927 Bacteria 183847
714 Ga0496124_0000142 3300048927 Bacteria 147311
715 Ga0496124_0000305 3300048927 Bacteria 90763
716 Ga0496124_0000730 3300048927 Bacteria 53903
717 Ga0496124_0003010 3300048927 Bacteria 21078
718 Ga0496124_0009520 3300048927 Bacteria 9993
719 Ga0496124_0019237 3300048927 Bacteria 6364
720 Ga0496124_0022697 3300048927 Bacteria 5746
721 Ga0496124_0035850 3300048927 Bacteria 4334
722 Ga0496124_0052610 3300048927 Bacteria 3458
723 Ga0496124_0102495 3300048927 Bacteria 2316
724 Ga0496124_0120429 3300048927 Bacteria 2098
725 Ga0496124_0133459 3300048927 Bacteria 1969
726 Ga0496124_0161997 3300048927 Bacteria 1742
727 Ga0496124_0339903 3300048927 Bacteria 1066
728 Ga0496125_0000588 3300048928 Bacteria 61975
729 Ga0496125_0000943 3300048928 Bacteria 45676
730 Ga0496125_0002656 3300048928 Bacteria 22857
731 Ga0496125_0007084 3300048928 Bacteria 11972
732 Ga0496125_0009650 3300048928 Bacteria 9868
733 Ga0496125_0010612 3300048928 Bacteria 9306
734 Ga0496125_0018353 3300048928 Bacteria 6647
735 Ga0496125_0020228 3300048928 Bacteria 6251
736 Ga0496125_0027825 3300048928 Bacteria 5115
737 Ga0496125_0037210 3300048928 Bacteria 4233
738 Ga0496125_0076937 3300048928 Bacteria 2575
739 Ga0496126_0002156 3300048929 Bacteria 27382
740 Ga0496126_0002622 3300048929 Bacteria 23930
741 Ga0496126_0005699 3300048929 Bacteria 14110
742 Ga0496126_0008258 3300048929 Bacteria 11243
743 Ga0496126_0092164 3300048929 Bacteria 2663
744 Ga0496126_0117545 3300048929 Bacteria 2309
745 Ga0496126_0137644 3300048929 Bacteria 2104
746 Ga0496126_0174914 3300048929 Bacteria 1827
747 Ga0496126_0284585 3300048929 Bacteria 1368
748 Ga0495678_000268 3300049459 Bacteria 57604
749 Ga0495682_0000003 3300049460 Bacteria 515787
750 Ga0495682_0000198 3300049460 Bacteria 48570
751 Ga0495682_0000911 3300049460 Bacteria 18044
752 Ga0495682_0009119 3300049460 Bacteria 3886
753 Ga0501312_014756 3300049528 Bacteria 1101
754 Ga0501314_004384 3300049530 Bacteria 1169
755 Ga0501315_005738 3300049531 Bacteria 1357
756 Ga0501323_000644 3300049539 Bacteria 2688
757 Ga0501326_00333 3300049542 Bacteria 1814
758 Ga0501032_0137468 3300049569 Bacteria 1610
759 Ga0501034_0146959 3300049571 Bacteria 2334
760 Ga0501036_0571259 3300049572 Bacteria 939
761 Ga0501037_0002384 3300049573 Bacteria 13565
762 Ga0501037_0028134 3300049573 Bacteria 4152
763 Ga0501038_0001493 3300049574 Bacteria 21546
764 Ga0501038_0001625 3300049574 Bacteria 20909
765 Ga0501040_0000006 3300049576 Bacteria 97170
766 Ga0501069_0019876 3300049585 Bacteria 3634
767 Ga0501070_0015435 3300049586 Bacteria 6425
768 Ga0501070_0025309 3300049586 Bacteria 4977
769 Ga0501070_0112963 3300049586 Bacteria 2245
770 Ga0501074_0004461 3300049590 Bacteria 10015
771 Ga0501080_0001094 3300049742 Bacteria 22336
772 Ga0501080_0007575 3300049742 Bacteria 9815
773 Ga0501044_0034592 3300049823 Bacteria 5297
774 Ga0501226_000033 3300049853 Bacteria 72088
775 nmdc:mga00v17_51771_c1 3300050491 Bacteria 2497
776 nmdc:mga00v17_59361_c1 3300050491 Bacteria 2347
777 Ga0500621_000006 3300053126 Bacteria 245480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 2162886007 SwRhRL2b_contig_2697100 SwRhRL2b_0740.00002300 217
2 3300044712 Ga0453684_0189408 Ga0453684_0189408_197_910 236
3 3300009092 Ga0105250_10000042 Ga0105250_100000427 240
4 3300025711 Ga0207696_1000027 Ga0207696_1000027103 240
5 3300042010 Ga0439452_003675 Ga0439452_003675_982_1776 241
6 3300046460 Ga0495638_0076348 Ga0495638_0076348_192_986 241
7 3300046515 Ga0495620_0022124 Ga0495620_0022124_2042_2836 241
8 3300046694 Ga0495649_0031182 Ga0495649_0031182_599_1393 241
9 3300047446 Ga0495679_026456 Ga0495679_026456_422_1216 241
10 3300048922 Ga0496119_0004720 Ga0496119_0004720_3997_4791 241
11 3300048922 Ga0496119_0005631 Ga0496119_0005631_3075_3869 241
12 3300048923 Ga0496120_0002452 Ga0496120_0002452_3075_3869 241
13 3300048923 Ga0496120_0002723 Ga0496120_0002723_2175_2969 241
14 3300048927 Ga0496124_0000096 Ga0496124_0000096_131216_132010 241
15 3300002773 JGI25152J39213_1000194 JGI25152J39213_100019419 242
16 3300003856 Ga0058692_1005138 Ga0058692_10051383 242
17 3300003856 Ga0058692_1008820 Ga0058692_10088202 242
18 3300003856 Ga0058692_1008822 Ga0058692_10088222 242
19 3300005289 Ga0065704_10001780 Ga0065704_100017805 242
20 3300005289 Ga0065704_10009771 Ga0065704_100097713 242
21 3300005289 Ga0065704_10073626 Ga0065704_100736261 242
22 3300005366 Ga0070659_100376372 Ga0070659_1003763721 242
23 3300005548 Ga0070665_100009321 Ga0070665_1000093216 242
24 3300005548 Ga0070665_100141643 Ga0070665_1001416433 242
25 3300005577 Ga0068857_100000004 Ga0068857_10000000480 242
26 3300005834 Ga0068851_10043982 Ga0068851_100439822 242
27 3300006051 Ga0075364_10002478 Ga0075364_100024783 242
28 3300006051 Ga0075364_10002674 Ga0075364_100026746 242
29 3300006946 Ga0079104_1005238 Ga0079104_10052383 242
30 3300006946 Ga0079104_1006147 Ga0079104_10061472 242
31 3300006946 Ga0079104_1012465 Ga0079104_10124652 242
32 3300009011 Ga0105251_10015024 Ga0105251_100150241 242
33 3300009011 Ga0105251_10033934 Ga0105251_100339343 242
34 3300009011 Ga0105251_10035432 Ga0105251_100354323 242
35 3300009036 Ga0105244_10001617 Ga0105244_1000161712 242
36 3300009036 Ga0105244_10010532 Ga0105244_100105325 242
37 3300009036 Ga0105244_10047701 Ga0105244_100477013 242
38 3300009092 Ga0105250_10074922 Ga0105250_100749222 242
39 3300009093 Ga0105240_10252210 Ga0105240_102522103 242
40 3300009148 Ga0105243_10297212 Ga0105243_102972122 242
41 3300009174 Ga0105241_10434644 Ga0105241_104346442 242
42 3300010375 Ga0105239_10268243 Ga0105239_102682432 242
43 3300011119 Ga0105246_10027407 Ga0105246_100274074 242
44 3300013102 Ga0157371_10005708 Ga0157371_100057085 242
45 3300013102 Ga0157371_10026573 Ga0157371_100265734 242
46 3300013102 Ga0157371_10115385 Ga0157371_101153852 242
47 3300013102 Ga0157371_10260022 Ga0157371_102600221 242
48 3300013105 Ga0157369_10010151 Ga0157369_100101519 242
49 3300013307 Ga0157372_10002392 Ga0157372_100023928 242
50 3300015679 Ga0183366_1003 Ga0183366_100383 242
51 3300015680 Ga0183370_1003 Ga0183370_1003337 242
52 3300015685 Ga0183369_1005 Ga0183369_1005337 242
53 3300015687 Ga0183368_1006 Ga0183368_100682 242
54 3300025258 Ga0209129_1000008 Ga0209129_1000008506 242
55 3300025321 Ga0207656_10045750 Ga0207656_100457503 242
56 3300025711 Ga0207696_1003590 Ga0207696_10035904 242
57 3300025711 Ga0207696_1020689 Ga0207696_10206892 242
58 3300025728 Ga0207655_1000017 Ga0207655_1000017422 242
59 3300025728 Ga0207655_1000028 Ga0207655_1000028340 242
60 3300025728 Ga0207655_1001219 Ga0207655_10012193 242
61 3300025728 Ga0207655_1046600 Ga0207655_10466002 242
62 3300025735 Ga0207713_1000164 Ga0207713_100016480 242
63 3300025735 Ga0207713_1001415 Ga0207713_100141516 242
64 3300025735 Ga0207713_1012812 Ga0207713_10128122 242
65 3300025735 Ga0207713_1038584 Ga0207713_10385842 242
66 3300025735 Ga0207713_1049913 Ga0207713_10499132 242
67 3300025735 Ga0207713_1054608 Ga0207713_10546082 242
68 3300025735 Ga0207713_1129300 Ga0207713_11293001 242
69 3300025913 Ga0207695_10186172 Ga0207695_101861722 242
70 3300025935 Ga0207709_10019891 Ga0207709_100198913 242
71 3300026116 Ga0207674_10000009 Ga0207674_10000009104 242
72 3300027111 Ga0209281_1000146 Ga0209281_100014686 242
73 3300027111 Ga0209281_1000891 Ga0209281_100089110 242
74 3300027111 Ga0209281_1003504 Ga0209281_10035042 242
75 3300027312 Ga0209371_1000014 Ga0209371_100001473 242
76 3300027312 Ga0209371_1000030 Ga0209371_100003018 242
77 3300027312 Ga0209371_1001468 Ga0209371_100146814 242
78 3300027312 Ga0209371_1002980 Ga0209371_10029808 242
79 3300028379 Ga0268266_10000307 Ga0268266_1000030727 242
80 3300028379 Ga0268266_10108839 Ga0268266_101088393 242
81 3300030500 Ga0268256_1000021 Ga0268256_100002167 242
82 3300030500 Ga0268256_1000025 Ga0268256_100002571 242
83 3300030500 Ga0268256_1001251 Ga0268256_10012513 242
84 3300030500 Ga0268256_1002281 Ga0268256_10022816 242
85 3300041405 Ga0439438_000003 Ga0439438_000003_73502_74299 242
86 3300041405 Ga0439438_003055 Ga0439438_003055_3739_4548 242
87 3300041407 Ga0439447_016244 Ga0439447_016244_1063_1872 242
88 3300041512 Ga0451853_3494193 Ga0451853_3494193_833_1627 242
89 3300042006 Ga0439432_018713 Ga0439432_018713_1159_1956 242
90 3300042010 Ga0439452_000005 Ga0439452_000005_77714_78508 242
91 3300042010 Ga0439452_000074 Ga0439452_000074_10748_11542 242
92 3300042439 Ga0439464_0009420 Ga0439464_0009420_945_1739 242
93 3300046458 Ga0495591_000047 Ga0495591_000047_76972_77766 242
94 3300046471 Ga0495650_0000028 Ga0495650_0000028_56913_57707 242
95 3300046530 Ga0495654_0145543 Ga0495654_0145543_258_1007 242
96 3300048907 Ga0496104_0001075 Ga0496104_0001075_22043_22837 242
97 3300048908 Ga0496105_0067341 Ga0496105_0067341_1057_1851 242
98 3300048908 Ga0496105_0346463 Ga0496105_0346463_372_1166 242
99 3300048919 Ga0496116_0000214 Ga0496116_0000214_28607_29422 242
100 3300048919 Ga0496116_0020768 Ga0496116_0020768_3760_4554 242
101 3300048919 Ga0496116_0026248 Ga0496116_0026248_256_1050 242
102 3300048919 Ga0496116_0030916 Ga0496116_0030916_1785_2579 242
103 3300048919 Ga0496116_0054852 Ga0496116_0054852_981_1775 242
104 3300048919 Ga0496116_0252597 Ga0496116_0252597_17_781 242
105 3300048920 Ga0496117_0000753 Ga0496117_0000753_44304_45098 242
106 3300048920 Ga0496117_0021006 Ga0496117_0021006_887_1681 242
107 3300048920 Ga0496117_0056339 Ga0496117_0056339_1453_2247 242
108 3300048921 Ga0496118_0001665 Ga0496118_0001665_30847_31641 242
109 3300048921 Ga0496118_0076287 Ga0496118_0076287_261_1055 242
110 3300048921 Ga0496118_0082275 Ga0496118_0082275_34_828 242
111 3300048922 Ga0496119_0000134 Ga0496119_0000134_17941_18750 242
112 3300048922 Ga0496119_0000171 Ga0496119_0000171_12835_13629 242
113 3300048922 Ga0496119_0000516 Ga0496119_0000516_38381_39196 242
114 3300048922 Ga0496119_0007240 Ga0496119_0007240_6642_7436 242
115 3300048922 Ga0496119_0008294 Ga0496119_0008294_74_868 242
116 3300048922 Ga0496119_0081167 Ga0496119_0081167_361_1155 242
117 3300048923 Ga0496120_0000017 Ga0496120_0000017_85390_86199 242
118 3300048923 Ga0496120_0000032 Ga0496120_0000032_139798_140613 242
119 3300048923 Ga0496120_0006300 Ga0496120_0006300_5399_6193 242
120 3300048923 Ga0496120_0010281 Ga0496120_0010281_2140_2934 242
121 3300048923 Ga0496120_0044727 Ga0496120_0044727_803_1597 242
122 3300048923 Ga0496120_0073633 Ga0496120_0073633_361_1155 242
123 3300048924 Ga0496121_0018475 Ga0496121_0018475_423_1217 242
124 3300048924 Ga0496121_0023839 Ga0496121_0023839_3359_4153 242
125 3300048924 Ga0496121_0030318 Ga0496121_0030318_3464_4258 242
126 3300048924 Ga0496121_0093404 Ga0496121_0093404_1035_1829 242
127 3300048925 Ga0496122_0000419 Ga0496122_0000419_12200_12994 242
128 3300048925 Ga0496122_0006694 Ga0496122_0006694_894_1688 242
129 3300048925 Ga0496122_0145243 Ga0496122_0145243_662_1456 242
130 3300048925 Ga0496122_0183502 Ga0496122_0183502_31_825 242
131 3300048926 Ga0496123_0000746 Ga0496123_0000746_7068_7862 242
132 3300048926 Ga0496123_0001433 Ga0496123_0001433_22240_23034 242
133 3300048926 Ga0496123_0107489 Ga0496123_0107489_780_1574 242
134 3300048927 Ga0496124_0000142 Ga0496124_0000142_132601_133395 242
135 3300048927 Ga0496124_0009520 Ga0496124_0009520_8174_8968 242
136 3300048927 Ga0496124_0022697 Ga0496124_0022697_424_1218 242
137 3300048927 Ga0496124_0052610 Ga0496124_0052610_1640_2434 242
138 3300048927 Ga0496124_0102495 Ga0496124_0102495_46_792 242
139 3300048927 Ga0496124_0339903 Ga0496124_0339903_71_865 242
140 3300048928 Ga0496125_0002656 Ga0496125_0002656_19395_20189 242
141 3300048928 Ga0496125_0018353 Ga0496125_0018353_2982_3776 242
142 3300048928 Ga0496125_0027825 Ga0496125_0027825_3610_4404 242
143 3300048928 Ga0496125_0037210 Ga0496125_0037210_771_1565 242
144 3300048929 Ga0496126_0002156 Ga0496126_0002156_23658_24452 242
145 3300048929 Ga0496126_0002622 Ga0496126_0002622_2950_3744 242
146 3300048929 Ga0496126_0117545 Ga0496126_0117545_400_1194 242
147 3300048929 Ga0496126_0284585 Ga0496126_0284585_427_1221 242
148 3300050491 nmdc:mga00v17_51771_c1 nmdc:mga00v17_51771_c1_1015_1809 242
149 3300050491 nmdc:mga00v17_59361_c1 nmdc:mga00v17_59361_c1_441_1235 242
150 3300005937 Ga0081455_10099386 Ga0081455_100993862 243
151 3300009011 Ga0105251_10001239 Ga0105251_1000123920 243
152 3300009011 Ga0105251_10063505 Ga0105251_100635053 243
153 3300025735 Ga0207713_1000057 Ga0207713_100005790 243
154 3300046471 Ga0495650_0035387 Ga0495650_0035387_357_1151 243
155 3300048907 Ga0496104_0155030 Ga0496104_0155030_85_879 243
156 3300048908 Ga0496105_0195630 Ga0496105_0195630_705_1499 243
157 3300048920 Ga0496117_0083835 Ga0496117_0083835_924_1718 243
158 3300048922 Ga0496119_0010529 Ga0496119_0010529_3030_3824 243
159 3300048923 Ga0496120_0003940 Ga0496120_0003940_3719_4513 243
160 3300048929 Ga0496126_0174914 Ga0496126_0174914_159_953 243
161 3300003856 Ga0058692_1000183 Ga0058692_100018333 244
162 3300013307 Ga0157372_10335072 Ga0157372_103350722 244
163 3300027111 Ga0209281_1000058 Ga0209281_1000058201 244
164 3300027312 Ga0209371_1000053 Ga0209371_100005365 244
165 3300030500 Ga0268256_1000053 Ga0268256_1000053170 244
166 3300046458 Ga0495591_007463 Ga0495591_007463_3242_4036 244
167 3300046530 Ga0495654_0000546 Ga0495654_0000546_1513_2307 244
168 3300046694 Ga0495649_0012306 Ga0495649_0012306_1268_2062 244
169 3300047469 Ga0495673_0000047 Ga0495673_0000047_188638_189432 244
170 3300048904 Ga0496101_0105686 Ga0496101_0105686_662_1456 244
171 3300048927 Ga0496124_0120429 Ga0496124_0120429_707_1501 244
172 3300042876 Ga0451577_0000096 Ga0451577_0000096_20611_21390 245
173 3300044712 Ga0453684_0001083 Ga0453684_0001083_78389_79168 245
174 3300044712 Ga0453684_0300539 Ga0453684_0300539_556_1335 245
175 3300048921 Ga0496118_0002391 Ga0496118_0002391_13808_14602 245
176 3300036712 Ga0316584_0137624 Ga0316584_0137624_269_1105 246
177 3300006946 Ga0079104_1001044 Ga0079104_100104411 247
178 3300009011 Ga0105251_10008398 Ga0105251_100083984 247
179 3300009036 Ga0105244_10013293 Ga0105244_100132934 247
180 3300009101 Ga0105247_10000223 Ga0105247_1000022349 247
181 3300017792 Ga0163161_10000050 Ga0163161_1000005071 247
182 3300025711 Ga0207696_1000014 Ga0207696_100001451 247
183 3300025728 Ga0207655_1033857 Ga0207655_10338574 247
184 3300025735 Ga0207713_1000420 Ga0207713_10004203 247
185 3300025900 Ga0207710_10000007 Ga0207710_10000007386 247
186 3300027111 Ga0209281_1000298 Ga0209281_100029811 247
187 3300027312 Ga0209371_1000300 Ga0209371_100030040 247
188 3300027312 Ga0209371_1018900 Ga0209371_10189003 247
189 3300030500 Ga0268256_1000012 Ga0268256_1000012699 247
190 3300030500 Ga0268256_1021167 Ga0268256_10211673 247
191 3300046453 Ga0495627_000266 Ga0495627_000266_1886_2680 247
192 3300046794 Ga0495589_0000028 Ga0495589_0000028_123805_124599 247
193 3300048906 Ga0496103_0108925 Ga0496103_0108925_487_1281 247
194 3300048907 Ga0496104_0300655 Ga0496104_0300655_269_1063 247
195 3300048919 Ga0496116_0000009 Ga0496116_0000009_252556_253350 247
196 3300048920 Ga0496117_0003500 Ga0496117_0003500_6085_6879 247
197 3300048921 Ga0496118_0003425 Ga0496118_0003425_17740_18534 247
198 3300048926 Ga0496123_0015833 Ga0496123_0015833_3193_3987 247
199 3300048926 Ga0496123_0096672 Ga0496123_0096672_954_1700 247
200 3300009011 Ga0105251_10002260 Ga0105251_1000226011 248
201 3300009036 Ga0105244_10025204 Ga0105244_100252043 248
202 3300009092 Ga0105250_10000378 Ga0105250_1000037821 248
203 3300009148 Ga0105243_10002183 Ga0105243_100021833 248
204 3300025711 Ga0207696_1000066 Ga0207696_1000066118 248
205 3300025728 Ga0207655_1003013 Ga0207655_100301311 248
206 3300025735 Ga0207713_1000048 Ga0207713_100004890 248
207 3300025935 Ga0207709_10001680 Ga0207709_100016802 248
208 3300048929 Ga0496126_0137644 Ga0496126_0137644_1015_1809 248
209 3300003856 Ga0058692_1000311 Ga0058692_100031120 249
210 3300003856 Ga0058692_1003055 Ga0058692_10030553 249
211 3300003856 Ga0058692_1003813 Ga0058692_10038131 249
212 3300025225 Ga0209566_100155 Ga0209566_10015514 249
213 3300027312 Ga0209371_1000096 Ga0209371_100009665 249
214 3300027312 Ga0209371_1000435 Ga0209371_10004353 249
215 3300027312 Ga0209371_1001390 Ga0209371_10013904 249
216 3300030500 Ga0268256_1000086 Ga0268256_100008665 249
217 3300030500 Ga0268256_1001193 Ga0268256_100119314 249
218 3300030500 Ga0268256_1001533 Ga0268256_10015337 249
219 3300031728 Ga0316578_10059355 Ga0316578_100593552 249
220 3300036712 Ga0316584_0163229 Ga0316584_0163229_486_1370 249
221 3300001989 JGI24739J22299_10000061 JGI24739J22299_1000006120 250
222 3300009011 Ga0105251_10000595 Ga0105251_1000059520 250
223 3300009036 Ga0105244_10000713 Ga0105244_1000071319 250
224 3300013100 Ga0157373_10013207 Ga0157373_100132073 250
225 3300013102 Ga0157371_10002582 Ga0157371_1000258212 250
226 3300013104 Ga0157370_10000142 Ga0157370_1000014238 250
227 3300025728 Ga0207655_1006410 Ga0207655_10064104 250
228 3300025735 Ga0207713_1009623 Ga0207713_10096232 250
229 3300042010 Ga0439452_000004 Ga0439452_000004_690825_691634 250
230 3300048919 Ga0496116_0000368 Ga0496116_0000368_18523_19332 250
231 3300048920 Ga0496117_0000772 Ga0496117_0000772_16191_17000 250
232 3300048921 Ga0496118_0001525 Ga0496118_0001525_17460_18269 250
233 3300048927 Ga0496124_0019237 Ga0496124_0019237_1554_2363 250
234 3300006946 Ga0079104_1000406 Ga0079104_10004066 252
235 3300027111 Ga0209281_1000060 Ga0209281_100006039 252
236 iso_pu_bacteria 2554235469 2556065279 252
237 3300009011 Ga0105251_10016560 Ga0105251_100165601 253
238 3300009174 Ga0105241_10000006 Ga0105241_10000006309 253
239 3300013100 Ga0157373_10003696 Ga0157373_100036963 253
240 3300014497 Ga0182008_10055446 Ga0182008_100554463 253
241 3300025735 Ga0207713_1000362 Ga0207713_100036231 253
242 3300025911 Ga0207654_10000008 Ga0207654_10000008312 253
243 3300027111 Ga0209281_1000260 Ga0209281_100026046 253
244 3300031251 Ga0265327_10000393 Ga0265327_1000039354 253
245 3300031251 Ga0265327_10003818 Ga0265327_100038186 253
246 3300031251 Ga0265327_10085252 Ga0265327_100852521 253
247 3300031344 Ga0265316_10001475 Ga0265316_1000147515 253
248 iso_pu_bacteria 2932406140 2932407562 253
249 iso_pu_bacteria 2939577877 2939579472 253
250 3300036647 Ga0316582_0001017 Ga0316582_0001017_3212_4027 254
251 3300037588 Ga0316581_0019495 Ga0316581_0019495_207_1022 254
252 iso_pu_bacteria 2894510363 2894515209 254
253 iso_pu_bacteria 2989392574 2989392930 254
254 3300025292 Ga0209676_1055365 Ga0209676_10553651 255
255 3300044712 Ga0453684_0039530 Ga0453684_0039530_1452_2318 256
256 iso_pu_bacteria 2687453129 2687579648 256
257 3300003856 Ga0058692_1020408 Ga0058692_10204082 257
258 3300027312 Ga0209371_1003617 Ga0209371_10036175 257
259 3300030500 Ga0268256_1003295 Ga0268256_10032953 257
260 iso_pu_bacteria 8057160832 8057161087 257
261 3300003856 Ga0058692_1000306 Ga0058692_100030611 258
262 3300027312 Ga0209371_1000276 Ga0209371_100027611 258
263 3300030500 Ga0268256_1000230 Ga0268256_100023011 258
264 3300036647 Ga0316582_0019086 Ga0316582_0019086_612_1400 258
265 iso_pu_bacteria 2511231012 2511304585 258
266 iso_pu_bacteria 2511231014 2511313565 258
267 iso_pu_bacteria 2511231015 2511318343 258
268 iso_pu_bacteria 2511231017 2511331346 258
269 iso_pu_bacteria 2511231020 2511351442 258
270 iso_pu_bacteria 2643221589 2643955944 258
271 iso_pu_bacteria 2643221602 2644020738 258
272 iso_pu_bacteria 2738543004 2739198755 258
273 iso_pu_bacteria 2738543015 2739261482 258
274 iso_pu_bacteria 2857465823 2857468285 258
275 iso_pu_bacteria 2904550169 2904555452 258
276 iso_pu_bacteria 2919456309 2919457249 258
277 iso_pu_bacteria 2939636861 2939642178 258
278 iso_pu_bacteria 8001522603 8001525688 258
279 iso_pu_bacteria 8056125926 8056131304 258
280 3300025225 Ga0209566_100108 Ga0209566_10010887 259
281 3300048919 Ga0496116_0030775 Ga0496116_0030775_257_1063 259
282 3300048920 Ga0496117_0004686 Ga0496117_0004686_9554_10360 259
283 3300048921 Ga0496118_0022263 Ga0496118_0022263_2008_2814 259
284 3300048922 Ga0496119_0012717 Ga0496119_0012717_5780_6586 259
285 3300048923 Ga0496120_0010236 Ga0496120_0010236_3857_4663 259
286 3300048924 Ga0496121_0067776 Ga0496121_0067776_947_1753 259
287 3300048924 Ga0496121_0106388 Ga0496121_0106388_983_1789 259
288 3300048924 Ga0496121_0299097 Ga0496121_0299097_214_1053 259
289 3300048925 Ga0496122_0088207 Ga0496122_0088207_761_1567 259
290 3300048926 Ga0496123_0010008 Ga0496123_0010008_6040_6846 259
291 3300048927 Ga0496124_0161997 Ga0496124_0161997_750_1556 259
292 3300048928 Ga0496125_0000588 Ga0496125_0000588_10341_11147 259
293 3300048929 Ga0496126_0008258 Ga0496126_0008258_4683_5489 259
294 3300049542 Ga0501326_00333 Ga0501326_00333_618_1424 259
295 iso_pu_bacteria 2510065053 2510283153 259
296 iso_pu_bacteria 2510065055 2510293818 259
297 iso_pu_bacteria 2510065058 2510310567 259
298 iso_pu_bacteria 2511231007 2511274452 259
299 iso_pu_bacteria 2511231010 2511290925 259
300 iso_pu_bacteria 2511231011 2511296881 259
301 iso_pu_bacteria 2511231018 2511337416 259
302 iso_pu_bacteria 2511231019 2511341779 259
303 iso_pu_bacteria 2511231023 2511372529 259
304 iso_pu_bacteria 2511231031 2511415804 259
305 iso_pu_bacteria 2512564039 2512734209 259
306 iso_pu_bacteria 2554235132 2554813024 259
307 iso_pu_bacteria 2563366752 2563928459 259
308 iso_pu_bacteria 2599185155 2599330860 259
309 iso_pu_bacteria 2599185188 2599502350 259
310 iso_pu_bacteria 2599185300 2599933952 259
311 iso_pu_bacteria 2599185307 2599975274 259
312 iso_pu_bacteria 2600255283 2601628559 259
313 iso_pu_bacteria 2600255318 2601801092 259
314 iso_pu_bacteria 2603880185 2606073186 259
315 iso_pu_bacteria 2603880199 2606125980 259
316 iso_pu_bacteria 2606217733 2608383491 259
317 iso_pu_bacteria 2623620443 2624483105 259
318 iso_pu_bacteria 2623620446 2624494636 259
319 iso_pu_bacteria 2643221633 2644186247 259
320 iso_pu_bacteria 2713897148 2715750126 259
321 iso_pu_bacteria 2713897149 2715756527 259
322 iso_pu_bacteria 2718217725 2718636306 259
323 iso_pu_bacteria 2721755693 2723602904 259
324 iso_pu_bacteria 2728369359 2730138890 259
325 iso_pu_bacteria 2738541271 2738690347 259
326 iso_pu_bacteria 2738541299 2738839829 259
327 iso_pu_bacteria 2738543010 2739230773 259
328 iso_pu_bacteria 2738543016 2739266121 259
329 iso_pu_bacteria 2738543020 2739289805 259
330 iso_pu_bacteria 2738543021 2739295117 259
331 iso_pu_bacteria 2738543025 2739312816 259
332 iso_pu_bacteria 2751185905 2753809638 259
333 iso_pu_bacteria 2773857672 2774131158 259
334 iso_pu_bacteria 2773857673 2774135871 259
335 iso_pu_bacteria 2784132063 2784262124 259
336 iso_pu_bacteria 2791355520 2794598535 259
337 iso_pu_bacteria 2802428803 2802436553 259
338 iso_pu_bacteria 2808606373 2808906414 259
339 iso_pu_bacteria 2808606377 2808932280 259
340 iso_pu_bacteria 2808606379 2808941958 259
341 iso_pu_bacteria 2808606381 2808954401 259
342 iso_pu_bacteria 2808606382 2808960829 259
343 iso_pu_bacteria 2811994881 2812369143 259
344 iso_pu_bacteria 2818991441 2819568062 259
345 iso_pu_bacteria 2818991456 2819654827 259
346 iso_pu_bacteria 2826581358 2826582162 259
347 iso_pu_bacteria 2842805378 2842808020 259
348 iso_pu_bacteria 2842815866 2842821161 259
349 iso_pu_bacteria 2842832357 2842833157 259
350 iso_pu_bacteria 2842843487 2842845396 259
351 iso_pu_bacteria 2842849001 2842852488 259
352 iso_pu_bacteria 2842854478 2842855315 259
353 iso_pu_bacteria 2852657418 2852662551 259
354 iso_pu_bacteria 2860339153 2860341410 259
355 iso_pu_bacteria 2864997549 2865001417 259
356 iso_pu_bacteria 2878029506 2878035043 259
357 iso_pu_bacteria 2880230671 2880235685 259
358 iso_pu_bacteria 2887630918 2887633425 259
359 iso_pu_bacteria 2889276214 2889278867 259
360 iso_pu_bacteria 2889295896 2889298427 259
361 iso_pu_bacteria 2904518522 2904519255 259
362 iso_pu_bacteria 2904595352 2904598544 259
363 iso_pu_bacteria 2907202186 2907207696 259
364 iso_pu_bacteria 2913036834 2913042253 259
365 iso_pu_bacteria 2917832318 2917836430 259
366 iso_pu_bacteria 2919063839 2919065872 259
367 iso_pu_bacteria 2919125081 2919126548 259
368 iso_pu_bacteria 2919385768 2919389494 259
369 iso_pu_bacteria 2919481497 2919486679 259
370 iso_pu_bacteria 2919487758 2919488460 259
371 iso_pu_bacteria 2919697872 2919700870 259
372 iso_pu_bacteria 2923519811 2923523224 259
373 iso_pu_bacteria 2931396565 2931397760 259
374 iso_pu_bacteria 2936361878 2936362176 259
375 iso_pu_bacteria 2939702853 2939704550 259
376 iso_pu_bacteria 2969304461 2969309871 259
377 iso_pu_bacteria 2974289157 2974294382 259
378 iso_pu_bacteria 2974298342 2974302773 259
379 iso_pu_bacteria 2981284811 2981289174 259
380 iso_pu_bacteria 2981289755 2981293990 259
381 iso_pu_bacteria 2981980479 2981984755 259
382 iso_pu_bacteria 2981985349 2981989683 259
383 iso_pu_bacteria 2984499530 2984499641 259
384 iso_pu_bacteria 2990196909 2990197029 259
385 iso_pu_bacteria 2996706504 2996707655 259
386 iso_pu_bacteria 2998139840 2998145097 259
387 iso_pu_bacteria 3006978542 3006979763 259
388 iso_pu_bacteria 3007511990 3007516888 259
389 iso_pu_bacteria 3007718800 3007720032 259
390 iso_pu_bacteria 3007855910 3007858125 259
391 iso_pu_bacteria 3007861166 3007866558 259
392 iso_pu_bacteria 3007866637 3007867053 259
393 iso_pu_bacteria 648028048 648169233 259
394 iso_pu_bacteria 8002317523 8002322936 259
395 iso_pu_bacteria 8011350971 8011353567 259
396 iso_pu_bacteria 8019775933 8019777978 259
397 iso_pu_bacteria 8029995093 8029995799 259
398 iso_pu_bacteria 8046991243 8046994496 259
399 iso_pu_bacteria 8056143049 8056148462 259
400 iso_pu_bacteria 8056155041 8056160538 259
401 iso_pu_bacteria 8056166840 8056171471 259
402 iso_pu_bacteria 8056172158 8056177715 259
403 iso_pu_bacteria 8056177738 8056181699 259
404 iso_pu_bacteria 8056569372 8056570166 259
405 3300006038 Ga0075365_10227209 Ga0075365_102272091 260
406 3300012498 Ga0157345_1000681 Ga0157345_10006812 260
407 3300013306 Ga0163162_10018952 Ga0163162_100189523 260
408 3300025298 Ga0209050_1005862 Ga0209050_10058624 260
409 3300027111 Ga0209281_1000016 Ga0209281_100001612 260
410 3300032168 Ga0316593_10032512 Ga0316593_100325122 260
411 3300041406 Ga0439439_0005991 Ga0439439_0005991_1748_2557 260
412 3300041999 Ga0439433_0000804 Ga0439433_0000804_2190_2999 260
413 3300042007 Ga0439449_0000086 Ga0439449_0000086_13113_13922 260
414 3300042010 Ga0439452_010592 Ga0439452_010592_1154_1993 260
415 3300042015 Ga0439462_0004980 Ga0439462_0004980_1077_1886 260
416 3300042146 Ga0450907_001447 Ga0450907_001447_2193_3056 260
417 3300046460 Ga0495638_0005629 Ga0495638_0005629_470_1309 260
418 3300046474 Ga0495605_0006053 Ga0495605_0006053_155_946 260
419 3300046518 Ga0495631_0000885 Ga0495631_0000885_11994_12785 260
420 3300046520 Ga0495637_0092316 Ga0495637_0092316_18_857 260
421 3300046524 Ga0495648_0009421 Ga0495648_0009421_6076_6915 260
422 3300046528 Ga0495642_0000848 Ga0495642_0000848_6053_6892 260
423 3300047323 Ga0495683_0001587 Ga0495683_0001587_7901_8692 260
424 3300047443 Ga0495687_008219 Ga0495687_008219_391_1182 260
425 3300047469 Ga0495673_0006592 Ga0495673_0006592_5962_6753 260
426 3300048928 Ga0496125_0009650 Ga0496125_0009650_108_920 260
427 3300048928 Ga0496125_0010612 Ga0496125_0010612_4318_5130 260
428 3300048929 Ga0496126_0092164 Ga0496126_0092164_143_955 260
429 iso_pu_bacteria 2506520008 2506585445 260
430 iso_pu_bacteria 2585427591 2585827874 260
431 iso_pu_bacteria 2585427592 2585830887 260
432 iso_pu_bacteria 2599185299 2599928246 260
433 iso_pu_bacteria 2608642108 2608670416 260
434 iso_pu_bacteria 2648501693 2650900097 260
435 iso_pu_bacteria 2667528173 2671106390 260
436 iso_pu_bacteria 2684622997 2686354336 260
437 iso_pu_bacteria 2687453601 2689446837 260
438 iso_pu_bacteria 2706794495 2707100022 260
439 iso_pu_bacteria 2728369097 2729145136 260
440 iso_pu_bacteria 2772190666 2772440741 260
441 iso_pu_bacteria 2806310673 2807178726 260
442 iso_pu_bacteria 2808606414 2809124375 260
443 iso_pu_bacteria 2844528606 2844532491 260
444 iso_pu_bacteria 2846540461 2846541309 260
445 iso_pu_bacteria 2847085930 2847088993 260
446 iso_pu_bacteria 2847797336 2847801186 260
447 iso_pu_bacteria 2854601825 2854603730 260
448 iso_pu_bacteria 2855195626 2855196089 260
449 iso_pu_bacteria 2865014394 2865018270 260
450 iso_pu_bacteria 2869551831 2869556216 260
451 iso_pu_bacteria 2871272651 2871276923 260
452 iso_pu_bacteria 2881609920 2881613081 260
453 iso_pu_bacteria 2888366609 2888370840 260
454 iso_pu_bacteria 2888373701 2888376722 260
455 iso_pu_bacteria 2900051742 2900053372 260
456 iso_pu_bacteria 2904474040 2904474465 260
457 iso_pu_bacteria 2904504865 2904506967 260
458 iso_pu_bacteria 2908669403 2908673244 260
459 iso_pu_bacteria 2919150387 2919150811 260
460 iso_pu_bacteria 2927143783 2927145685 260
461 iso_pu_bacteria 2929297113 2929298163 260
462 iso_pu_bacteria 2932406140 2932406853 260
463 iso_pu_bacteria 2937967321 2937969326 260
464 iso_pu_bacteria 2939577877 2939579739 260
465 iso_pu_bacteria 2939602548 2939605253 260
466 iso_pu_bacteria 2945951305 2945954220 260
467 iso_pu_bacteria 2964375228 2964379481 260
468 iso_pu_bacteria 2978975091 2978976704 260
469 iso_pu_bacteria 2984494565 2984498013 260
470 iso_pu_bacteria 2990261002 2990264471 260
471 iso_pu_bacteria 3001267043 3001271322 260
472 iso_pu_bacteria 640753048 640939562 260
473 iso_pu_bacteria 8004592986 8004593641 260
474 iso_pu_bacteria 8015394850 8015398737 260
475 2162886007 SwRhRL2b_contig_3444256 SwRhRL2b_0719.00006680 261
476 3300002737 JGI25162J39368_1000659 JGI25162J39368_10006591 261
477 3300002771 JGI25163J39215_1000382 JGI25163J39215_100038216 261
478 3300002772 JGI25164J39214_1000410 JGI25164J39214_10004101 261
479 3300002987 JGI25159J45721_1022814 JGI25159J45721_10228141 261
480 3300003187 JGI25151J46595_10005255 JGI25151J46595_100052558 261
481 3300003187 JGI25151J46595_10007869 JGI25151J46595_100078694 261
482 3300003187 JGI25151J46595_10025601 JGI25151J46595_100256012 261
483 3300003187 JGI25151J46595_10029530 JGI25151J46595_100295302 261
484 3300003214 JGI25165J46597_1000774 JGI25165J46597_10007741 261
485 3300003751 Ga0055538_1000672 Ga0055538_10006727 261
486 3300003758 Ga0055532_1000088 Ga0055532_100008854 261
487 3300003781 Ga0055536_1020486 Ga0055536_10204862 261
488 3300003791 Ga0055530_10000832 Ga0055530_100008327 261
489 3300003792 Ga0055540_1000533 Ga0055540_100053322 261
490 3300003794 Ga0055531_10000286 Ga0055531_1000028640 261
491 3300003794 Ga0055531_10001251 Ga0055531_1000125113 261
492 3300005288 Ga0065714_10000513 Ga0065714_100005132 261
493 3300005289 Ga0065704_10090987 Ga0065704_100909873 261
494 3300005290 Ga0065712_10001345 Ga0065712_100013457 261
495 3300005290 Ga0065712_10068271 Ga0065712_100682714 261
496 3300005328 Ga0070676_10115339 Ga0070676_101153392 261
497 3300005353 Ga0070669_100003634 Ga0070669_1000036348 261
498 3300005457 Ga0070662_100032682 Ga0070662_1000326824 261
499 3300005548 Ga0070665_100460010 Ga0070665_1004600101 261
500 3300009011 Ga0105251_10018026 Ga0105251_100180263 261
501 3300009036 Ga0105244_10001414 Ga0105244_1000141413 261
502 3300009036 Ga0105244_10050091 Ga0105244_100500912 261
503 3300009036 Ga0105244_10074544 Ga0105244_100745442 261
504 3300009092 Ga0105250_10003232 Ga0105250_100032326 261
505 3300009092 Ga0105250_10030333 Ga0105250_100303333 261
506 3300009148 Ga0105243_10055572 Ga0105243_100555722 261
507 3300009148 Ga0105243_10197003 Ga0105243_101970032 261
508 3300011119 Ga0105246_10005186 Ga0105246_100051867 261
509 3300011119 Ga0105246_10010294 Ga0105246_100102946 261
510 3300011119 Ga0105246_10013672 Ga0105246_100136726 261
511 3300011119 Ga0105246_10105547 Ga0105246_101055472 261
512 3300013100 Ga0157373_10062449 Ga0157373_100624493 261
513 3300013102 Ga0157371_10000800 Ga0157371_1000080012 261
514 3300013102 Ga0157371_10219407 Ga0157371_102194072 261
515 3300013104 Ga0157370_10001229 Ga0157370_1000122915 261
516 3300013104 Ga0157370_10126670 Ga0157370_101266703 261
517 3300013105 Ga0157369_10008578 Ga0157369_100085787 261
518 3300013306 Ga0163162_10440660 Ga0163162_104406602 261
519 3300014497 Ga0182008_10147394 Ga0182008_101473942 261
520 3300015261 Ga0182006_1005580 Ga0182006_10055802 261
521 3300015265 Ga0182005_1004563 Ga0182005_10045636 261
522 3300015265 Ga0182005_1013120 Ga0182005_10131203 261
523 3300017792 Ga0163161_10067649 Ga0163161_100676492 261
524 3300017792 Ga0163161_10106308 Ga0163161_101063081 261
525 3300025207 Ga0209760_100155 Ga0209760_1001551 261
526 3300025224 Ga0209784_100325 Ga0209784_1003257 261
527 3300025229 Ga0209147_100058 Ga0209147_10005852 261
528 3300025230 Ga0209563_100863 Ga0209563_1008634 261
529 3300025231 Ga0207427_100006 Ga0207427_100006730 261
530 3300025233 Ga0209437_100013 Ga0209437_100013730 261
531 3300025233 Ga0209437_101051 Ga0209437_1010513 261
532 3300025256 Ga0209759_1010700 Ga0209759_10107002 261
533 3300025261 Ga0209233_1000022 Ga0209233_1000022730 261
534 3300025284 Ga0209130_1002272 Ga0209130_10022725 261
535 3300025292 Ga0209676_1000015 Ga0209676_1000015714 261
536 3300025292 Ga0209676_1000574 Ga0209676_100057431 261
537 3300025292 Ga0209676_1001175 Ga0209676_100117512 261
538 3300025294 Ga0209025_1000801 Ga0209025_100080130 261
539 3300025294 Ga0209025_1001470 Ga0209025_100147025 261
540 3300025294 Ga0209025_1002760 Ga0209025_10027604 261
541 3300025294 Ga0209025_1005308 Ga0209025_10053088 261
542 3300025298 Ga0209050_1001031 Ga0209050_100103112 261
543 3300025303 Ga0209051_1000041 Ga0209051_100004112 261
544 3300025304 Ga0209257_1000069 Ga0209257_1000069297 261
545 3300025711 Ga0207696_1000319 Ga0207696_100031912 261
546 3300025711 Ga0207696_1000663 Ga0207696_100066318 261
547 3300025711 Ga0207696_1005762 Ga0207696_10057626 261
548 3300025711 Ga0207696_1010946 Ga0207696_10109465 261
549 3300025728 Ga0207655_1001041 Ga0207655_100104122 261
550 3300025728 Ga0207655_1001446 Ga0207655_100144620 261
551 3300025728 Ga0207655_1001643 Ga0207655_100164312 261
552 3300025728 Ga0207655_1007055 Ga0207655_10070554 261
553 3300025728 Ga0207655_1008271 Ga0207655_10082716 261
554 3300025728 Ga0207655_1008821 Ga0207655_10088214 261
555 3300025728 Ga0207655_1027648 Ga0207655_10276484 261
556 3300025728 Ga0207655_1030437 Ga0207655_10304373 261
557 3300025728 Ga0207655_1032019 Ga0207655_10320192 261
558 3300025735 Ga0207713_1002240 Ga0207713_10022409 261
559 3300025735 Ga0207713_1005632 Ga0207713_10056324 261
560 3300025907 Ga0207645_10191014 Ga0207645_101910142 261
561 3300025923 Ga0207681_10009669 Ga0207681_100096692 261
562 3300025933 Ga0207706_10006427 Ga0207706_100064275 261
563 3300025935 Ga0207709_10000506 Ga0207709_1000050623 261
564 3300026067 Ga0207678_10092768 Ga0207678_100927684 261
565 3300027111 Ga0209281_1010011 Ga0209281_10100111 261
566 3300027360 Ga0209969_1012631 Ga0209969_10126311 261
567 3300027471 Ga0209995_1000634 Ga0209995_10006342 261
568 3300027665 Ga0209983_1000782 Ga0209983_10007823 261
569 3300027682 Ga0209971_1000459 Ga0209971_10004593 261
570 3300027876 Ga0209974_10001088 Ga0209974_1000108810 261
571 3300028379 Ga0268266_10002381 Ga0268266_100023819 261
572 3300030731 Ga0316177_1153363 Ga0316177_11533636 261
573 3300030733 Ga0314311_1171705 Ga0314311_11717054 261
574 3300030735 Ga0316178_1009978 Ga0316178_100997812 261
575 3300030744 Ga0316181_1195268 Ga0316181_11952682 261
576 3300031344 Ga0265316_10010827 Ga0265316_100108276 261
577 3300031548 Ga0307408_100004188 Ga0307408_1000041885 261
578 3300031665 Ga0316575_10034455 Ga0316575_100344552 261
579 3300031691 Ga0316579_10000764 Ga0316579_100007645 261
580 3300031691 Ga0316579_10005086 Ga0316579_100050866 261
581 3300031711 Ga0265314_10201888 Ga0265314_102018882 261
582 3300031727 Ga0316576_10067834 Ga0316576_100678341 261
583 3300031728 Ga0316578_10123758 Ga0316578_101237582 261
584 3300031731 Ga0307405_10000248 Ga0307405_100002489 261
585 3300031901 Ga0307406_10004204 Ga0307406_100042045 261
586 3300032004 Ga0307414_10032415 Ga0307414_100324152 261
587 3300032137 Ga0316585_10093532 Ga0316585_100935321 261
588 3300035398 Ga0316574_0277532 Ga0316574_0277532_129_923 261
589 3300036647 Ga0316582_0001397 Ga0316582_0001397_6733_7554 261
590 3300036647 Ga0316582_0008555 Ga0316582_0008555_2733_3521 261
591 3300036647 Ga0316582_0025706 Ga0316582_0025706_1834_2655 261
592 3300038705 Ga0237819_00998 Ga0237819_00998_5187_5981 261
593 3300041404 Ga0439436_0009790 Ga0439436_0009790_338_1132 261
594 3300041405 Ga0439438_007793 Ga0439438_007793_22_816 261
595 3300041407 Ga0439447_000387 Ga0439447_000387_4288_5082 261
596 3300041407 Ga0439447_006699 Ga0439447_006699_835_1701 261
597 3300041411 Ga0439466_0002320 Ga0439466_0002320_2291_3085 261
598 3300041411 Ga0439466_0003915 Ga0439466_0003915_3903_4697 261
599 3300041411 Ga0439466_0013218 Ga0439466_0013218_919_1761 261
600 3300041997 Ga0439431_0000429 Ga0439431_0000429_3348_4214 261
601 3300041997 Ga0439431_0005059 Ga0439431_0005059_1064_1906 261
602 3300041997 Ga0439431_0011438 Ga0439431_0011438_678_1472 261
603 3300042000 Ga0439437_000864 Ga0439437_000864_1311_2153 261
604 3300042006 Ga0439432_000568 Ga0439432_000568_5249_6091 261
605 3300042006 Ga0439432_000616 Ga0439432_000616_6570_7364 261
606 3300042010 Ga0439452_001682 Ga0439452_001682_764_1558 261
607 3300042010 Ga0439452_004175 Ga0439452_004175_347_1189 261
608 3300042016 Ga0439463_000657 Ga0439463_000657_1158_1952 261
609 3300042115 Ga0450911_000330 Ga0450911_000330_4424_5266 261
610 3300042125 Ga0450923_035777 Ga0450923_035777_53_847 261
611 3300042139 Ga0450904_000169 Ga0450904_000169_4038_4880 261
612 3300042156 Ga0439446_0003777 Ga0439446_0003777_2839_3681 261
613 3300042156 Ga0439446_0010581 Ga0439446_0010581_1387_2229 261
614 3300044712 Ga0453684_0328156 Ga0453684_0328156_907_1713 261
615 3300045051 Ga0451576_0274447 Ga0451576_0274447_531_1340 261
616 3300046453 Ga0495627_002309 Ga0495627_002309_6476_7342 261
617 3300046458 Ga0495591_000781 Ga0495591_000781_12479_13273 261
618 3300046458 Ga0495591_004492 Ga0495591_004492_269_1063 261
619 3300046471 Ga0495650_0006996 Ga0495650_0006996_4772_5566 261
620 3300046471 Ga0495650_0010358 Ga0495650_0010358_4027_4893 261
621 3300046474 Ga0495605_0000278 Ga0495605_0000278_46998_47864 261
622 3300046474 Ga0495605_0000930 Ga0495605_0000930_6428_7222 261
623 3300046474 Ga0495605_0017501 Ga0495605_0017501_2085_2879 261
624 3300046492 Ga0495585_0085228 Ga0495585_0085228_627_1421 261
625 3300046499 Ga0495594_0000635 Ga0495594_0000635_9570_10436 261
626 3300046501 Ga0495607_0001037 Ga0495607_0001037_9496_10290 261
627 3300046501 Ga0495607_0001805 Ga0495607_0001805_8001_8795 261
628 3300046501 Ga0495607_0083259 Ga0495607_0083259_386_1180 261
629 3300046506 Ga0495583_0000504 Ga0495583_0000504_45682_46548 261
630 3300046506 Ga0495583_0003618 Ga0495583_0003618_3123_3917 261
631 3300046506 Ga0495583_0122853 Ga0495583_0122853_233_1027 261
632 3300046507 Ga0495606_0000631 Ga0495606_0000631_14214_15008 261
633 3300046507 Ga0495606_0000785 Ga0495606_0000785_38268_39062 261
634 3300046512 Ga0495610_0007403 Ga0495610_0007403_1929_2795 261
635 3300046513 Ga0495616_0017184 Ga0495616_0017184_1213_2007 261
636 3300046515 Ga0495620_0000153 Ga0495620_0000153_9640_10506 261
637 3300046515 Ga0495620_0001468 Ga0495620_0001468_7675_8469 261
638 3300046518 Ga0495631_0008078 Ga0495631_0008078_2015_2881 261
639 3300046520 Ga0495637_0003816 Ga0495637_0003816_4423_5217 261
640 3300046522 Ga0495643_0001069 Ga0495643_0001069_14302_15096 261
641 3300046524 Ga0495648_0006054 Ga0495648_0006054_459_1253 261
642 3300046528 Ga0495642_0001368 Ga0495642_0001368_5944_6738 261
643 3300046530 Ga0495654_0001456 Ga0495654_0001456_10067_10933 261
644 3300046536 Ga0495587_0010198 Ga0495587_0010198_3264_4106 261
645 3300046538 Ga0495609_0000166 Ga0495609_0000166_58522_59388 261
646 3300046538 Ga0495609_0045207 Ga0495609_0045207_522_1316 261
647 3300046542 Ga0495597_0003210 Ga0495597_0003210_3751_4617 261
648 3300046558 Ga0495633_0000291 Ga0495633_0000291_9844_10710 261
649 3300046615 Ga0495656_0005423 Ga0495656_0005423_1342_2136 261
650 3300046648 Ga0495611_0008254 Ga0495611_0008254_2836_3702 261
651 3300046665 Ga0495661_0000294 Ga0495661_0000294_46317_47183 261
652 3300046665 Ga0495661_0079341 Ga0495661_0079341_62_883 261
653 3300046679 Ga0495623_0045526 Ga0495623_0045526_472_1314 261
654 3300046680 Ga0495646_0104365 Ga0495646_0104365_540_1382 261
655 3300046684 Ga0495669_0002337 Ga0495669_0002337_5367_6161 261
656 3300046691 Ga0495670_0014298 Ga0495670_0014298_2842_3708 261
657 3300046692 Ga0495671_0112674 Ga0495671_0112674_519_1313 261
658 3300046694 Ga0495649_0261235 Ga0495649_0261235_66_860 261
659 3300046794 Ga0495589_0000676 Ga0495589_0000676_5300_6166 261
660 3300046810 Ga0495660_0008552 Ga0495660_0008552_711_1577 261
661 3300047318 Ga0495636_0048751 Ga0495636_0048751_777_1571 261
662 3300047320 Ga0495672_0008309 Ga0495672_0008309_2160_2954 261
663 3300047320 Ga0495672_0084814 Ga0495672_0084814_391_1185 261
664 3300047323 Ga0495683_0000196 Ga0495683_0000196_9789_10655 261
665 3300047444 Ga0495675_0045645 Ga0495675_0045645_410_1252 261
666 3300047446 Ga0495679_000987 Ga0495679_000987_8789_9655 261
667 3300047469 Ga0495673_0007180 Ga0495673_0007180_3391_4257 261
668 3300047469 Ga0495673_0015070 Ga0495673_0015070_65_859 261
669 3300047469 Ga0495673_0046250 Ga0495673_0046250_391_1185 261
670 3300047470 Ga0495681_0010573 Ga0495681_0010573_1709_2503 261
671 3300047470 Ga0495681_0011600 Ga0495681_0011600_2693_3487 261
672 3300047470 Ga0495681_0031723 Ga0495681_0031723_1723_2589 261
673 3300047472 Ga0495686_0067279 Ga0495686_0067279_170_964 261
674 3300048091 Ga0495626_0077596 Ga0495626_0077596_165_959 261
675 3300048905 Ga0496102_0003362 Ga0496102_0003362_7866_8708 261
676 3300048905 Ga0496102_0352048 Ga0496102_0352048_336_1172 261
677 3300048905 Ga0496102_0372192 Ga0496102_0372192_459_1295 261
678 3300048919 Ga0496116_0007736 Ga0496116_0007736_79_921 261
679 3300048919 Ga0496116_0009298 Ga0496116_0009298_6000_6794 261
680 3300048920 Ga0496117_0022249 Ga0496117_0022249_887_1681 261
681 3300048921 Ga0496118_0030448 Ga0496118_0030448_288_1082 261
682 3300048924 Ga0496121_0003876 Ga0496121_0003876_9744_10538 261
683 3300048925 Ga0496122_0004379 Ga0496122_0004379_2970_3836 261
684 3300048925 Ga0496122_0054239 Ga0496122_0054239_1745_2581 261
685 3300048926 Ga0496123_0035253 Ga0496123_0035253_1701_2567 261
686 3300048926 Ga0496123_0122985 Ga0496123_0122985_172_1008 261
687 3300048927 Ga0496124_0000730 Ga0496124_0000730_43650_44444 261
688 3300048927 Ga0496124_0003010 Ga0496124_0003010_10845_11639 261
689 3300048927 Ga0496124_0133459 Ga0496124_0133459_364_1203 261
690 3300048928 Ga0496125_0020228 Ga0496125_0020228_3941_4759 261
691 3300048928 Ga0496125_0076937 Ga0496125_0076937_762_1601 261
692 3300049459 Ga0495678_000268 Ga0495678_000268_47075_47941 261
693 3300049460 Ga0495682_0000198 Ga0495682_0000198_38492_39286 261
694 3300049460 Ga0495682_0000911 Ga0495682_0000911_7864_8658 261
695 3300049460 Ga0495682_0009119 Ga0495682_0009119_2579_3373 261
696 3300049528 Ga0501312_014756 Ga0501312_014756_156_968 261
697 3300049530 Ga0501314_004384 Ga0501314_004384_302_1144 261
698 3300049531 Ga0501315_005738 Ga0501315_005738_490_1332 261
699 3300049539 Ga0501323_000644 Ga0501323_000644_427_1269 261
700 3300049571 Ga0501034_0146959 Ga0501034_0146959_1496_2290 261
701 3300049853 Ga0501226_000033 Ga0501226_000033_59357_60199 261
702 iso_pu_bacteria 2585428059 2587743491 261
703 iso_pu_bacteria 2593339131 2595090895 261
704 iso_pu_bacteria 2643221543 2643739498 261
705 iso_pu_bacteria 2643221676 2644423352 261
706 iso_pu_bacteria 2671180330 2672336083 261
707 iso_pu_bacteria 2738543017 2739271881 261
708 iso_pu_bacteria 2757320391 2757568519 261
709 iso_pu_bacteria 2775507177 2777763535 261
710 iso_pu_bacteria 2775507192 2777835747 261
711 iso_pu_bacteria 2808606361 2808858112 261
712 iso_pu_bacteria 2808606364 2808868943 261
713 iso_pu_bacteria 2808606376 2808925965 261
714 iso_pu_bacteria 2808606378 2808938283 261
715 iso_pu_bacteria 2808606380 2808948148 261
716 iso_pu_bacteria 2808606383 2808966597 261
717 iso_pu_bacteria 2808606389 2809001427 261
718 iso_pu_bacteria 2816332186 2816864662 261
719 iso_pu_bacteria 2818991459 2819669094 261
720 iso_pu_bacteria 2821111986 2821116025 261
721 iso_pu_bacteria 2842682962 2842683494 261
722 iso_pu_bacteria 2849139964 2849144767 261
723 iso_pu_bacteria 2857453340 2857453933 261
724 iso_pu_bacteria 2857460504 2857461138 261
725 iso_pu_bacteria 2857581216 2857581384 261
726 iso_pu_bacteria 2857586860 2857589306 261
727 iso_pu_bacteria 2857604169 2857607828 261
728 iso_pu_bacteria 2857609550 2857612343 261
729 iso_pu_bacteria 2864733723 2864739142 261
730 iso_pu_bacteria 2865002811 2865008688 261
731 iso_pu_bacteria 2885526491 2885530701 261
732 iso_pu_bacteria 2888578766 2888582577 261
733 iso_pu_bacteria 2889042446 2889044047 261
734 iso_pu_bacteria 2889049205 2889055214 261
735 iso_pu_bacteria 2904162308 2904166260 261
736 iso_pu_bacteria 2904490793 2904490934 261
737 iso_pu_bacteria 2904755435 2904762187 261
738 iso_pu_bacteria 2919160200 2919165895 261
739 iso_pu_bacteria 2919425241 2919429279 261
740 iso_pu_bacteria 2925326138 2925327209 261
741 iso_pu_bacteria 2929206907 2929211391 261
742 iso_pu_bacteria 2931384279 2931387503 261
743 iso_pu_bacteria 2936340661 2936342032 261
744 iso_pu_bacteria 2939679117 2939683747 261
745 iso_pu_bacteria 2945991243 2945993904 261
746 iso_pu_bacteria 2946053406 2946056669 261
747 iso_pu_bacteria 2956897341 2956900223 261
748 iso_pu_bacteria 2964375228 2964380341 261
749 iso_pu_bacteria 2971410472 2971416974 261
750 iso_pu_bacteria 2984504281 2984506899 261
751 iso_pu_bacteria 2984527788 2984528412 261
752 iso_pu_bacteria 2984532647 2984534519 261
753 iso_pu_bacteria 2988728565 2988731186 261
754 iso_pu_bacteria 3001272096 3001272243 261
755 iso_pu_bacteria 3006826541 3006831804 261
756 iso_pu_bacteria 3006973921 3006977485 261
757 iso_pu_bacteria 3006988479 3006992573 261
758 iso_pu_bacteria 8016728285 8016731047 261
759 iso_pu_bacteria 8022792930 8022795633 261
760 iso_pu_bacteria 8054795415 8054799854 261
761 iso_pu_bacteria 8056533031 8056536627 261
762 iso_pu_bacteria 8057582654 8057585187 261
763 iso_pu_bacteria 8057733483 8057733985 261
764 3300015261 Ga0182006_1004458 Ga0182006_10044587 262
765 3300031691 Ga0316579_10000832 Ga0316579_1000083210 262
766 3300031727 Ga0316576_10109534 Ga0316576_101095342 262
767 3300031728 Ga0316578_10015990 Ga0316578_100159903 262
768 3300031728 Ga0316578_10281481 Ga0316578_102814812 262
769 3300031733 Ga0316577_10024227 Ga0316577_100242273 262
770 3300032133 Ga0316583_10000732 Ga0316583_100007328 262
771 3300032137 Ga0316585_10000930 Ga0316585_100009308 262
772 3300032139 Ga0316580_10000571 Ga0316580_100005717 262
773 3300033529 Ga0316587_1011921 Ga0316587_10119212 262
774 3300033541 Ga0316596_1015987 Ga0316596_10159873 262
775 3300033541 Ga0316596_1033058 Ga0316596_10330582 262
776 3300033541 Ga0316596_1044267 Ga0316596_10442671 262
777 3300035398 Ga0316574_0024772 Ga0316574_0024772_224_1033 262
778 3300035398 Ga0316574_0024907 Ga0316574_0024907_1332_2132 262
779 3300035398 Ga0316574_0061282 Ga0316574_0061282_1010_1828 262
780 3300035398 Ga0316574_0202070 Ga0316574_0202070_210_1013 262
781 3300036647 Ga0316582_0050615 Ga0316582_0050615_1569_2378 262
782 3300036647 Ga0316582_0053755 Ga0316582_0053755_1087_1905 262
783 3300036712 Ga0316584_0015347 Ga0316584_0015347_1989_2792 262
784 3300036712 Ga0316584_0028328 Ga0316584_0028328_2014_2823 262
785 3300036712 Ga0316584_0070421 Ga0316584_0070421_1137_1955 262
786 3300036712 Ga0316584_0108352 Ga0316584_0108352_451_1269 262
787 3300039062 Ga0400483_039315 Ga0400483_039315_563_1375 262
788 3300044712 Ga0453684_0003868 Ga0453684_0003868_788_1579 262
789 3300049573 Ga0501037_0002384 Ga0501037_0002384_7154_7966 262
790 3300049576 Ga0501040_0000006 Ga0501040_0000006_20516_21337 262
791 3300049585 Ga0501069_0019876 Ga0501069_0019876_33_845 262
792 3300049586 Ga0501070_0025309 Ga0501070_0025309_674_1486 262
793 3300049586 Ga0501070_0112963 Ga0501070_0112963_995_1807 262
794 3300005937 Ga0081455_10257171 Ga0081455_102571711 263
795 3300031250 Ga0265331_10022548 Ga0265331_100225483 263
796 3300031251 Ga0265327_10009488 Ga0265327_100094884 263
797 3300031665 Ga0316575_10031837 Ga0316575_100318373 263
798 3300031691 Ga0316579_10000866 Ga0316579_100008667 263
799 3300031691 Ga0316579_10006802 Ga0316579_100068021 263
800 3300031691 Ga0316579_10011962 Ga0316579_100119624 263
801 3300031691 Ga0316579_10029923 Ga0316579_100299232 263
802 3300031691 Ga0316579_10079247 Ga0316579_100792473 263
803 3300031691 Ga0316579_10097985 Ga0316579_100979852 263
804 3300031691 Ga0316579_10205903 Ga0316579_102059031 263
805 3300031727 Ga0316576_10005252 Ga0316576_100052523 263
806 3300031727 Ga0316576_10018090 Ga0316576_100180904 263
807 3300031727 Ga0316576_10025690 Ga0316576_100256902 263
808 3300031727 Ga0316576_10036563 Ga0316576_100365633 263
809 3300031727 Ga0316576_10039565 Ga0316576_100395654 263
810 3300031727 Ga0316576_10056298 Ga0316576_100562983 263
811 3300031727 Ga0316576_10056991 Ga0316576_100569914 263
812 3300031727 Ga0316576_10080683 Ga0316576_100806832 263
813 3300031727 Ga0316576_10412245 Ga0316576_104122451 263
814 3300031728 Ga0316578_10000708 Ga0316578_100007083 263
815 3300031728 Ga0316578_10004427 Ga0316578_100044273 263
816 3300031728 Ga0316578_10006348 Ga0316578_1000634810 263
817 3300031728 Ga0316578_10018852 Ga0316578_100188523 263
818 3300031728 Ga0316578_10022900 Ga0316578_100229002 263
819 3300031728 Ga0316578_10030290 Ga0316578_100302902 263
820 3300031728 Ga0316578_10038051 Ga0316578_100380512 263
821 3300031728 Ga0316578_10084927 Ga0316578_100849272 263
822 3300031733 Ga0316577_10001781 Ga0316577_100017815 263
823 3300031733 Ga0316577_10002393 Ga0316577_100023935 263
824 3300031733 Ga0316577_10008258 Ga0316577_100082581 263
825 3300031733 Ga0316577_10020992 Ga0316577_100209922 263
826 3300031733 Ga0316577_10052266 Ga0316577_100522663 263
827 3300031733 Ga0316577_10085105 Ga0316577_100851052 263
828 3300031733 Ga0316577_10105491 Ga0316577_101054912 263
829 3300031733 Ga0316577_10135604 Ga0316577_101356042 263
830 3300032133 Ga0316583_10002841 Ga0316583_100028412 263
831 3300032133 Ga0316583_10014978 Ga0316583_100149781 263
832 3300032133 Ga0316583_10015499 Ga0316583_100154993 263
833 3300032133 Ga0316583_10056945 Ga0316583_100569453 263
834 3300032137 Ga0316585_10021392 Ga0316585_100213922 263
835 3300032137 Ga0316585_10022775 Ga0316585_100227752 263
836 3300032139 Ga0316580_10001354 Ga0316580_100013543 263
837 3300032139 Ga0316580_10007878 Ga0316580_100078782 263
838 3300032168 Ga0316593_10000385 Ga0316593_100003857 263
839 3300032168 Ga0316593_10001920 Ga0316593_100019202 263
840 3300032168 Ga0316593_10003764 Ga0316593_100037643 263
841 3300032168 Ga0316593_10005777 Ga0316593_100057773 263
842 3300032168 Ga0316593_10016016 Ga0316593_100160162 263
843 3300032168 Ga0316593_10044636 Ga0316593_100446362 263
844 3300032168 Ga0316593_10047692 Ga0316593_100476922 263
845 3300033524 Ga0316592_1008270 Ga0316592_10082702 263
846 3300033527 Ga0316586_1001708 Ga0316586_10017083 263
847 3300033527 Ga0316586_1011739 Ga0316586_10117392 263
848 3300033528 Ga0316588_1002169 Ga0316588_10021693 263
849 3300033528 Ga0316588_1015885 Ga0316588_10158852 263
850 3300033529 Ga0316587_1003873 Ga0316587_10038732 263
851 3300033529 Ga0316587_1024496 Ga0316587_10244962 263
852 3300033541 Ga0316596_1002356 Ga0316596_10023563 263
853 3300033541 Ga0316596_1009573 Ga0316596_10095732 263
854 3300033541 Ga0316596_1020019 Ga0316596_10200192 263
855 3300035398 Ga0316574_0000526 Ga0316574_0000526_7418_8212 263
856 3300035398 Ga0316574_0001797 Ga0316574_0001797_6612_7442 263
857 3300035398 Ga0316574_0003658 Ga0316574_0003658_6307_7131 263
858 3300035398 Ga0316574_0006602 Ga0316574_0006602_1668_2495 263
859 3300035398 Ga0316574_0008008 Ga0316574_0008008_114_914 263
860 3300035398 Ga0316574_0040121 Ga0316574_0040121_1158_1958 263
861 3300035398 Ga0316574_0040353 Ga0316574_0040353_42_857 263
862 3300035398 Ga0316574_0045189 Ga0316574_0045189_644_1456 263
863 3300035398 Ga0316574_0050031 Ga0316574_0050031_303_1139 263
864 3300035398 Ga0316574_0057258 Ga0316574_0057258_816_1628 263
865 3300035398 Ga0316574_0078434 Ga0316574_0078434_1054_1851 263
866 3300035398 Ga0316574_0138951 Ga0316574_0138951_307_1113 263
867 3300035398 Ga0316574_0256224 Ga0316574_0256224_130_978 263
868 3300036647 Ga0316582_0002764 Ga0316582_0002764_4004_4804 263
869 3300036647 Ga0316582_0003814 Ga0316582_0003814_971_1789 263
870 3300036647 Ga0316582_0005774 Ga0316582_0005774_277_1083 263
871 3300036647 Ga0316582_0006041 Ga0316582_0006041_875_1684 263
872 3300036647 Ga0316582_0011379 Ga0316582_0011379_2807_3643 263
873 3300036647 Ga0316582_0011568 Ga0316582_0011568_2316_3125 263
874 3300036647 Ga0316582_0035735 Ga0316582_0035735_909_1724 263
875 3300036647 Ga0316582_0043915 Ga0316582_0043915_1431_2267 263
876 3300036647 Ga0316582_0049146 Ga0316582_0049146_1378_2193 263
877 3300036647 Ga0316582_0169537 Ga0316582_0169537_533_1339 263
878 3300036647 Ga0316582_0211346 Ga0316582_0211346_434_1258 263
879 3300036647 Ga0316582_0343680 Ga0316582_0343680_131_943 263
880 3300036647 Ga0316582_0471825 Ga0316582_0471825_35_850 263
881 3300036712 Ga0316584_0001979 Ga0316584_0001979_5117_5947 263
882 3300036712 Ga0316584_0008900 Ga0316584_0008900_2777_3613 263
883 3300036712 Ga0316584_0009487 Ga0316584_0009487_5117_5935 263
884 3300036712 Ga0316584_0012711 Ga0316584_0012711_3974_4810 263
885 3300036712 Ga0316584_0015982 Ga0316584_0015982_533_1357 263
886 3300036712 Ga0316584_0020856 Ga0316584_0020856_3890_4702 263
887 3300036712 Ga0316584_0022059 Ga0316584_0022059_2740_3540 263
888 3300036712 Ga0316584_0024898 Ga0316584_0024898_1500_2315 263
889 3300036712 Ga0316584_0029841 Ga0316584_0029841_2942_3844 263
890 3300036712 Ga0316584_0057146 Ga0316584_0057146_1624_2445 263
891 3300036712 Ga0316584_0156393 Ga0316584_0156393_394_1200 263
892 3300036712 Ga0316584_0169456 Ga0316584_0169456_676_1515 263
893 3300036712 Ga0316584_0355740 Ga0316584_0355740_195_989 263
894 3300037588 Ga0316581_0000605 Ga0316581_0000605_3377_4192 263
895 3300037588 Ga0316581_0001282 Ga0316581_0001282_2711_3547 263
896 3300037588 Ga0316581_0013993 Ga0316581_0013993_979_1797 263
897 3300037588 Ga0316581_0037767 Ga0316581_0037767_510_1316 263
898 3300038725 Ga0400484_23537 Ga0400484_23537_9576_10391 263
899 3300038726 Ga0400490_46332 Ga0400490_46332_3619_4485 263
900 3300038726 Ga0400490_50955 Ga0400490_50955_1543_2358 263
901 3300038735 Ga0400485_04817 Ga0400485_04817_579_1394 263
902 3300038741 Ga0400488_18063 Ga0400488_18063_2213_3028 263
903 3300038741 Ga0400488_23404 Ga0400488_23404_623_1438 263
904 3300038742 Ga0400486_10873 Ga0400486_10873_28_831 263
905 3300038742 Ga0400486_27166 Ga0400486_27166_1374_2189 263
906 3300039062 Ga0400483_017640 Ga0400483_017640_5407_6222 263
907 3300039062 Ga0400483_070366 Ga0400483_070366_1389_2198 263
908 3300039062 Ga0400483_193205 Ga0400483_193205_3043_3858 263
909 3300039062 Ga0400483_284851 Ga0400483_284851_568_1377 263
910 3300039093 Ga0400489_94800 Ga0400489_94800_1972_2787 263
911 3300039110 Ga0400487_62529 Ga0400487_62529_1703_2518 263
912 3300044712 Ga0453684_0004281 Ga0453684_0004281_1096_1908 263
913 3300049569 Ga0501032_0137468 Ga0501032_0137468_641_1453 263
914 3300049572 Ga0501036_0571259 Ga0501036_0571259_40_852 263
915 3300049573 Ga0501037_0028134 Ga0501037_0028134_2253_3068 263
916 3300049574 Ga0501038_0001493 Ga0501038_0001493_20497_21312 263
917 3300049574 Ga0501038_0001625 Ga0501038_0001625_1508_2320 263
918 3300049586 Ga0501070_0015435 Ga0501070_0015435_65_880 263
919 3300049590 Ga0501074_0004461 Ga0501074_0004461_9055_9870 263
920 3300049742 Ga0501080_0001094 Ga0501080_0001094_8836_9648 263
921 3300049742 Ga0501080_0007575 Ga0501080_0007575_3374_4189 263
922 3300049823 Ga0501044_0034592 Ga0501044_0034592_2006_2818 263
923 iso_pu_bacteria 2690315857 2691331093 263
924 iso_pu_bacteria 2919534386 2919534654 263
925 iso_pu_bacteria 2919688452 2919689687 263
926 2162886007 SwRhRL2b_contig_179258 SwRhRL2b_0678.00006340 264
927 2162886007 SwRhRL2b_contig_1896067 SwRhRL2b_0655.00004970 264
928 2162886007 SwRhRL2b_contig_419289 SwRhRL2b_0947.00007360 264
929 3300002737 JGI25162J39368_1000006 JGI25162J39368_1000006229 264
930 3300002771 JGI25163J39215_1000001 JGI25163J39215_1000001130 264
931 3300002772 JGI25164J39214_1000001 JGI25164J39214_1000001298 264
932 3300003751 Ga0055538_1000004 Ga0055538_1000004428 264
933 3300003752 Ga0055539_1000004 Ga0055539_1000004130 264
934 3300003756 Ga0055533_1000007 Ga0055533_1000007428 264
935 3300003759 Ga0055525_1000007 Ga0055525_1000007428 264
936 3300003841 Ga0055541_1000004 Ga0055541_1000004428 264
937 3300005289 Ga0065704_10001139 Ga0065704_100011395 264
938 3300005347 Ga0070668_100085212 Ga0070668_1000852123 264
939 3300009011 Ga0105251_10009331 Ga0105251_100093315 264
940 3300009036 Ga0105244_10000023 Ga0105244_10000023154 264
941 3300009036 Ga0105244_10004325 Ga0105244_100043254 264
942 3300009092 Ga0105250_10001245 Ga0105250_100012456 264
943 3300011119 Ga0105246_10020546 Ga0105246_100205464 264
944 3300013102 Ga0157371_10000020 Ga0157371_10000020248 264
945 3300013104 Ga0157370_10002701 Ga0157370_1000270114 264
946 3300013105 Ga0157369_10012225 Ga0157369_100122254 264
947 3300013306 Ga0163162_10025666 Ga0163162_100256664 264
948 3300013307 Ga0157372_10012060 Ga0157372_100120606 264
949 3300015261 Ga0182006_1006250 Ga0182006_10062504 264
950 3300017792 Ga0163161_10035907 Ga0163161_100359072 264
951 3300025207 Ga0209760_100044 Ga0209760_10004439 264
952 3300025224 Ga0209784_100001 Ga0209784_100001421 264
953 3300025225 Ga0209566_100001 Ga0209566_100001421 264
954 3300025226 Ga0209674_100002 Ga0209674_100002421 264
955 3300025230 Ga0209563_100008 Ga0209563_100008424 264
956 3300025231 Ga0207427_100002 Ga0207427_100002856 264
957 3300025233 Ga0209437_100046 Ga0209437_100046226 264
958 3300025233 Ga0209437_100063 Ga0209437_100063241 264
959 3300025253 Ga0209677_100004 Ga0209677_100004424 264
960 3300025261 Ga0209233_1001000 Ga0209233_10010008 264
961 3300025711 Ga0207696_1000598 Ga0207696_100059825 264
962 3300025711 Ga0207696_1001272 Ga0207696_10012726 264
963 3300025728 Ga0207655_1000056 Ga0207655_100005646 264
964 3300025728 Ga0207655_1000223 Ga0207655_100022387 264
965 3300025728 Ga0207655_1005240 Ga0207655_10052401 264
966 3300025735 Ga0207713_1000007 Ga0207713_100000768 264
967 3300025735 Ga0207713_1024793 Ga0207713_10247934 264
968 3300025933 Ga0207706_10012888 Ga0207706_100128882 264
969 3300027312 Ga0209371_1001319 Ga0209371_100131913 264
970 3300027312 Ga0209371_1004348 Ga0209371_10043483 264
971 3300028379 Ga0268266_10483741 Ga0268266_104837412 264
972 3300030500 Ga0268256_1004026 Ga0268256_10040264 264
973 3300030742 Ga0316183_1089672 Ga0316183_10896722 264
974 3300041407 Ga0439447_001753 Ga0439447_001753_6324_7133 264
975 3300041411 Ga0439466_0000107 Ga0439466_0000107_3682_4491 264
976 3300042016 Ga0439463_005527 Ga0439463_005527_2091_2900 264
977 3300042146 Ga0450907_000034 Ga0450907_000034_10919_11728 264
978 3300042532 Ga0450893_0003734 Ga0450893_0003734_79_873 264
979 3300044712 Ga0453684_0016029 Ga0453684_0016029_3979_4797 264
980 3300044712 Ga0453684_0073400 Ga0453684_0073400_3081_3908 264
981 3300046458 Ga0495591_029949 Ga0495591_029949_489_1298 264
982 3300046471 Ga0495650_0000004 Ga0495650_0000004_487869_488663 264
983 3300046474 Ga0495605_0032038 Ga0495605_0032038_1776_2585 264
984 3300046507 Ga0495606_0000954 Ga0495606_0000954_21530_22339 264
985 3300046522 Ga0495643_0024885 Ga0495643_0024885_82_891 264
986 3300046523 Ga0495644_0007545 Ga0495644_0007545_3000_3809 264
987 3300046524 Ga0495648_0003159 Ga0495648_0003159_13649_14458 264
988 3300046524 Ga0495648_0010621 Ga0495648_0010621_4690_5499 264
989 3300046530 Ga0495654_0001218 Ga0495654_0001218_12472_13281 264
990 3300046692 Ga0495671_0002990 Ga0495671_0002990_2786_3595 264
991 3300046810 Ga0495660_0000013 Ga0495660_0000013_131443_132237 264
992 3300046810 Ga0495660_0000516 Ga0495660_0000516_27390_28199 264
993 3300047320 Ga0495672_0000029 Ga0495672_0000029_227684_228493 264
994 3300047320 Ga0495672_0000054 Ga0495672_0000054_156433_157242 264
995 3300047323 Ga0495683_0001353 Ga0495683_0001353_3133_3942 264
996 3300047469 Ga0495673_0000092 Ga0495673_0000092_76857_77666 264
997 3300048903 Ga0496100_0112202 Ga0496100_0112202_797_1606 264
998 3300048905 Ga0496102_0145276 Ga0496102_0145276_288_1097 264
999 3300048907 Ga0496104_0011029 Ga0496104_0011029_1598_2392 264
1000 3300048908 Ga0496105_0002003 Ga0496105_0002003_10088_10897 264
1001 3300048919 Ga0496116_0000016 Ga0496116_0000016_359165_359959 264
1002 3300048920 Ga0496117_0000350 Ga0496117_0000350_7417_8226 264
1003 3300048921 Ga0496118_0000821 Ga0496118_0000821_7417_8226 264
1004 3300048922 Ga0496119_0000226 Ga0496119_0000226_41863_42672 264
1005 3300048922 Ga0496119_0002114 Ga0496119_0002114_10385_11194 264
1006 3300048923 Ga0496120_0000330 Ga0496120_0000330_36304_37113 264
1007 3300048923 Ga0496120_0002661 Ga0496120_0002661_11188_11997 264
1008 3300048923 Ga0496120_0010797 Ga0496120_0010797_305_1099 264
1009 3300048924 Ga0496121_0000336 Ga0496121_0000336_69126_69935 264
1010 3300048925 Ga0496122_0000481 Ga0496122_0000481_41109_41903 264
1011 3300048925 Ga0496122_0005594 Ga0496122_0005594_635_1444 264
1012 3300048926 Ga0496123_0000385 Ga0496123_0000385_40988_41782 264
1013 3300048926 Ga0496123_0001855 Ga0496123_0001855_21339_22148 264
1014 3300048927 Ga0496124_0000305 Ga0496124_0000305_83418_84212 264
1015 3300048927 Ga0496124_0035850 Ga0496124_0035850_1422_2231 264
1016 3300048928 Ga0496125_0000943 Ga0496125_0000943_38705_39499 264
1017 3300048928 Ga0496125_0007084 Ga0496125_0007084_8133_8942 264
1018 3300048929 Ga0496126_0005699 Ga0496126_0005699_5722_6516 264
1019 3300049460 Ga0495682_0000003 Ga0495682_0000003_76731_77540 264
1020 3300053126 Ga0500621_000006 Ga0500621_000006_76732_77541 264
1021 iso_pu_bacteria 2916178963 2916179713 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02675

AdoMet_dc

S-adenosylmethionine decarboxylase

64

199

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iwc-assembly1.cif.gz_D t. maritima adometdc complex with s-adenosylmethionine methyl ester 0.9388 44 84
1tmi-assembly1.cif.gz_B structure of thermotoga maritima s63a non-processing mutant s-adenosylmethionine decarboxylase 0.8086 11 169
1tlu-assembly1.cif.gz_B crystal structure of thermotoga maritima s-adenosylmethionine decarboxylase 0.8075 11 169
1tlu-assembly1.cif.gz_B crystal structure of thermotoga maritima s-adenosylmethionine decarboxylase 0.7639 11 169
1tmi-assembly1.cif.gz_B structure of thermotoga maritima s63a non-processing mutant s-adenosylmethionine decarboxylase 0.7636 11 169
ID Description Score Start End Superfamily
af_P0A7F6_186_264_1.20.1270.220 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 1 186 264 1.20.1270.220
af_P0A7F6_186_264_1.20.1270.220 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.9876 186 264 1.20.1270.220
af_P0A7F6_32_185_3.60.90.10 Alpha Beta;4-Layer Sandwich;S-adenosylmethionine decarboxylase;S-adenosylmethionine decarboxylase 0.8819 33 185 3.60.90.10
af_P0A7F6_32_185_3.60.90.10 Alpha Beta;4-Layer Sandwich;S-adenosylmethionine decarboxylase;S-adenosylmethionine decarboxylase 0.8713 33 185 3.60.90.10
1tluB00 Alpha Beta;4-Layer Sandwich;S-adenosylmethionine decarboxylase;S-adenosylmethionine decarboxylase 0.8075 11 169 3.60.90.10
ID Description Score Start End GO Terms
AF-A0A3D5AXK9-F1-model_v4 Adenosylmethionine decarboxylase (EC 4.1.1.50) 0.9768 112 262 GO:0004014
GO:0005829
GO:0008295
AF-A0A6L2ZNF3-F1-model_v4 S-adenosylmethionine decarboxylase proenzyme (AdoMetDC) (SAMDC) (EC 4.1.1.50) [Cleaved into: S-adenosylmethionine decarboxylase beta chain; S-adenosylmethionine decarboxylase alpha chain] 0.9745 1 264 GO:0004014
GO:0005829
GO:0008295
AF-A0A6L2ZNF3-F1-model_v4 S-adenosylmethionine decarboxylase proenzyme (AdoMetDC) (SAMDC) (EC 4.1.1.50) [Cleaved into: S-adenosylmethionine decarboxylase beta chain; S-adenosylmethionine decarboxylase alpha chain] 0.9707 1 264 GO:0004014
GO:0005829
GO:0008295
AF-A0A3D5AXK9-F1-model_v4 Adenosylmethionine decarboxylase (EC 4.1.1.50) 0.9705 112 262 GO:0004014
GO:0005829
GO:0008295
AF-W1WS33-F1-model_v4 Adenosylmethionine decarboxylase (EC 4.1.1.50) 0.9682 32 264 GO:0004014
GO:0005829
GO:0008295

Feature Viewer

pLDDT pTM Quality
88.53 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map