F488393

General Info

Members Datasets Scaffolds Average Seq Length
1021 381 986 540

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0017465|Ga0316584_0017465_1453_3045
Length 530
Sequence LTAPLSHPLDRHGITTAATIHANLGTAQLVEHAVSNGEGRLAAHGPLVVETGEFTGRSAKDKYIVRDGVTEHTVWWGDVNQPMSSEHFDALKADFLSALGAKEKLYVADLFGGSQKDHRVNVRVINELAWHNLFAHTMLVRPDAKDLDEFVPEYTVIDLPSFVADPERHGCRSETVIAVSFSEKLILIGGTGYAGEMKKSVFGILNFLLPPKGVMPMHCSANIGPDGKTAVFFGLSGTGKTTLSADPGRTLIGDDEHGWSDTAVFNFEGGCYAKMIRLSAEAEPEIYATTRMFGTVLENVVMDEASRELDLDDPSLAENSRGAYPIDFIPNTSEENLGPTPSNVIMLTADAFGVLPPIARLTPDQAMYHFLSGYTAKVAGTEIGVTEPEATFSTCFGAPFMPRHPSVYGNLLKERIAKGGVSCWLVNTGWTGGKYGVGKRMPIKETRALLNAALDGSLNNVEFRKDPNFGFDVPVAVPGVDSSILDPRSTWADTDDYDRTAQKLVQLFVNNFEQFADHVDESVRQAAPAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
5 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
6 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
7 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
8 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
9 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
10 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
11 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
12 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
13 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
14 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
15 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
16 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
17 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
18 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
19 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
20 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
21 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
22 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
23 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
24 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
25 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
26 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
27 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
28 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
29 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
30 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
31 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
32 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
33 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
34 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
35 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
36 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
37 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
38 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
39 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
40 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
41 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
42 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
43 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
44 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
45 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
46 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
47 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
48 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
49 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
50 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
51 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
52 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
53 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
54 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
55 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
56 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
57 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
58 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
59 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
60 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
61 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
62 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
63 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
64 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
65 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
66 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
67 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
68 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
69 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
70 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
71 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
72 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
73 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
74 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
75 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
76 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
77 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
78 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
79 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
80 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
81 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
82 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
83 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
86 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
87 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
88 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
89 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
90 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
91 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
92 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
93 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
94 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
95 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
96 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
97 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
101 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
102 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
107 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
108 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
109 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
110 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
111 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
112 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
113 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
114 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
115 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
116 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
117 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
118 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
119 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
120 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
121 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
122 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
123 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
124 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
150 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
151 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
153 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
154 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
155 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
158 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
159 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
219 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
225 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
226 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
227 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
228 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
238 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
250 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
251 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
252 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
253 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
254 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
255 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
256 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
257 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
258 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
259 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
262 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
263 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
264 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
265 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
266 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
267 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
268 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
269 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
270 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
271 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
272 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
275 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
276 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
277 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
278 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
279 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
280 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
281 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
282 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
283 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
286 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
287 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
290 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
291 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
307 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
308 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
309 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
310 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
311 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
312 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
313 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
314 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
315 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
316 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
317 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
319 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
320 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
321 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
327 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
328 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
329 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
330 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
331 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
332 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
333 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
334 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
335 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
336 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
337 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
338 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
339 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
340 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
341 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
342 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
343 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
344 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
347 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
348 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
349 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
350 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
353 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
354 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
355 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
356 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
357 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
358 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
359 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
360 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
361 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
362 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
363 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
364 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
365 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
366 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
367 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
370 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
371 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
372 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
373 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
374 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
375 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
376 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
377 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
378 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
380 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
381 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.18
Metatranscriptomes 0.39
Isolates 3.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.99
Nodule 0
Rhizoplane 5.29
Rhizosphere 78.55
Stem 0
Stem Tuber 0
Unclassified 6.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2381042 2162886007 Bacteria 7708
2 SwRhRL2b_contig_878851 2162886007 Bacteria 43540
3 ARcpr5yngRDRAFT_c001944 3300000043 Bacteria 2208
4 JGI24736J21556_1000415 3300001904 Bacteria 8028
5 JGI24736J21556_1002014 3300001904 Bacteria 3612
6 JGI24741J21665_1000020 3300001915 Bacteria 37657
7 JGI24741J21665_1002181 3300001915 Bacteria 5196
8 JGI24752J21851_1000014 3300001976 Bacteria 19299
9 JGI24740J21852_10001751 3300001979 Bacteria 9977
10 JGI24740J21852_10003682 3300001979 Bacteria 6675
11 JGI24740J21852_10005611 3300001979 Bacteria 5286
12 JGI24739J22299_10001047 3300001989 Bacteria 10271
13 JGI24739J22299_10006253 3300001989 Bacteria 4495
14 JGI24737J22298_10000015 3300001990 Bacteria 49821
15 JGI24737J22298_10001361 3300001990 Bacteria 8661
16 JGI24735J21928_10000711 3300002067 Bacteria 11788
17 JGI24735J21928_10001925 3300002067 Bacteria 7285
18 JGI24735J21928_10003716 3300002067 Bacteria 5177
19 JGI24750J21931_1000311 3300002070 Bacteria 8392
20 JGI24748J21848_1000058 3300002074 Bacteria 46055
21 JGI24738J21930_10000387 3300002075 Bacteria 12278
22 JGI24738J21930_10001330 3300002075 Bacteria 6900
23 JGI24749J21850_1000021 3300002076 Bacteria 30737
24 JGI24034J26672_10000050 3300002239 Bacteria 53117
25 JGI24751J29686_10000080 3300002459 Bacteria 54264
26 JGI24751J29686_10000192 3300002459 Bacteria 26926
27 JGI25152J39213_1005835 3300002773 Bacteria 3490
28 JGI25150J39212_1000319 3300002774 Bacteria 23638
29 JGI25153J46596_10000999 3300003215 Bacteria 17177
30 JGI25153J46596_10012183 3300003215 Bacteria 3736
31 Ga0055526_1000760 3300003771 Bacteria 24068
32 Ga0055537_1000317 3300003773 Bacteria 32918
33 Ga0055537_1001489 3300003773 Bacteria 9020
34 Ga0055537_1002474 3300003773 Bacteria 6179
35 Ga0055524_1000149 3300003775 Bacteria 82511
36 Ga0055536_1001571 3300003781 Bacteria 13660
37 Ga0055534_1005555 3300003784 Bacteria 3344
38 Ga0055530_10000005 3300003791 Bacteria 206625
39 Ga0055530_10000060 3300003791 Bacteria 95767
40 Ga0055540_1004881 3300003792 Bacteria 5866
41 Ga0055531_10000049 3300003794 Bacteria 130662
42 Ga0055531_10004473 3300003794 Bacteria 8502
43 Ga0055531_10007837 3300003794 Bacteria 5746
44 Ga0055531_10009294 3300003794 Bacteria 5045
45 Ga0065165_1001158 3300005262 Bacteria 30746
46 Ga0065165_1002598 3300005262 Bacteria 14805
47 Ga0065704_10000191 3300005289 Bacteria 318191
48 Ga0065704_10001918 3300005289 Bacteria 15286
49 Ga0065704_10002532 3300005289 Bacteria 5058
50 Ga0065704_10070424 3300005289 Bacteria 25504
51 Ga0065712_10068171 3300005290 Bacteria 13481
52 Ga0065715_10121438 3300005293 Bacteria 2230
53 Ga0065707_10005245 3300005295 Bacteria 4046
54 Ga0065707_10081716 3300005295 Bacteria 73074
55 Ga0065707_10084323 3300005295 Bacteria 7346
56 Ga0065707_10096989 3300005295 Bacteria 3214
57 Ga0070658_10000001 3300005327 Bacteria 856789
58 Ga0070658_10000346 3300005327 Bacteria 40223
59 Ga0070658_10003793 3300005327 Bacteria 12379
60 Ga0070658_10018251 3300005327 Bacteria 5615
61 Ga0070658_10048053 3300005327 Bacteria 3454
62 Ga0070658_10049173 3300005327 Bacteria 3415
63 Ga0070658_10069849 3300005327 Bacteria 2874
64 Ga0070658_10088700 3300005327 Bacteria 2547
65 Ga0070683_100022268 3300005329 Bacteria 5661
66 Ga0070683_100071276 3300005329 Bacteria 3242
67 Ga0070683_100073958 3300005329 Bacteria 3182
68 Ga0070690_100000159 3300005330 Bacteria 34513
69 Ga0070690_100034329 3300005330 Bacteria 3178
70 Ga0070670_100000031 3300005331 Bacteria 159070
71 Ga0070670_100001267 3300005331 Bacteria 20126
72 Ga0070670_100001683 3300005331 Bacteria 17959
73 Ga0070670_100004563 3300005331 Bacteria 11617
74 Ga0070670_100008579 3300005331 Bacteria 8717
75 Ga0070670_100008763 3300005331 Bacteria 8637
76 Ga0070670_100013186 3300005331 Bacteria 7080
77 Ga0070670_100017279 3300005331 Bacteria 6188
78 Ga0070670_100108759 3300005331 Bacteria 2389
79 Ga0070670_100147018 3300005331 Bacteria 2039
80 Ga0070677_10000121 3300005333 Bacteria 26015
81 Ga0068869_100002541 3300005334 Bacteria 11013
82 Ga0070666_10000002 3300005335 Bacteria 478684
83 Ga0070666_10000589 3300005335 Bacteria 21952
84 Ga0070666_10009729 3300005335 Bacteria 6006
85 Ga0070666_10023181 3300005335 Bacteria 4038
86 Ga0070666_10070361 3300005335 Bacteria 2380
87 Ga0068868_100007180 3300005338 Bacteria 7915
88 Ga0068868_100102849 3300005338 Bacteria 2313
89 Ga0070660_100000048 3300005339 Bacteria 69472
90 Ga0070660_100000061 3300005339 Bacteria 63766
91 Ga0070660_100001167 3300005339 Bacteria 17757
92 Ga0070660_100005280 3300005339 Bacteria 8932
93 Ga0070660_100019123 3300005339 Bacteria 5014
94 Ga0070689_100064407 3300005340 Bacteria 2853
95 Ga0070661_100010200 3300005344 Bacteria 6526
96 Ga0070661_100024164 3300005344 Bacteria 4358
97 Ga0070661_100053552 3300005344 Bacteria 2954
98 Ga0070692_10013757 3300005345 Bacteria 3781
99 Ga0070668_100000006 3300005347 Bacteria 176486
100 Ga0070668_100000012 3300005347 Bacteria 117937
101 Ga0070668_100003316 3300005347 Bacteria 11877
102 Ga0070668_100013778 3300005347 Bacteria 6039
103 Ga0070668_100014071 3300005347 Bacteria 5981
104 Ga0070669_100000015 3300005353 Bacteria 197597
105 Ga0070669_100000042 3300005353 Bacteria 123396
106 Ga0070669_100000055 3300005353 Bacteria 111488
107 Ga0070669_100001258 3300005353 Bacteria 18395
108 Ga0070669_100002274 3300005353 Bacteria 13933
109 Ga0070669_100002309 3300005353 Bacteria 13799
110 Ga0070669_100002547 3300005353 Bacteria 13172
111 Ga0070669_100008852 3300005353 Bacteria 7182
112 Ga0070669_100061893 3300005353 Bacteria 2751
113 Ga0070675_100000487 3300005354 Bacteria 27135
114 Ga0070675_100008232 3300005354 Bacteria 8089
115 Ga0070675_100009413 3300005354 Bacteria 7601
116 Ga0070671_100000010 3300005355 Bacteria 202799
117 Ga0070671_100000066 3300005355 Bacteria 70998
118 Ga0070671_100002199 3300005355 Bacteria 15059
119 Ga0070671_100004238 3300005355 Bacteria 11351
120 Ga0070671_100004664 3300005355 Bacteria 10873
121 Ga0070671_100016348 3300005355 Bacteria 6000
122 Ga0070671_100020459 3300005355 Bacteria 5397
123 Ga0070671_100034019 3300005355 Bacteria 4218
124 Ga0070671_100049709 3300005355 Bacteria 3488
125 Ga0070671_100157713 3300005355 Bacteria 1917
126 Ga0070674_100007181 3300005356 Bacteria 6557
127 Ga0070674_100116314 3300005356 Bacteria 1973
128 Ga0070673_100000046 3300005364 Bacteria 50435
129 Ga0070673_100000926 3300005364 Bacteria 16587
130 Ga0070673_100021743 3300005364 Bacteria 4658
131 Ga0070673_100122880 3300005364 Bacteria 2168
132 Ga0070688_100000701 3300005365 Bacteria 16516
133 Ga0070659_100000001 3300005366 Bacteria 576390
134 Ga0070659_100000833 3300005366 Bacteria 22486
135 Ga0070667_100000003 3300005367 Bacteria 447715
136 Ga0070667_100000016 3300005367 Bacteria 237028
137 Ga0070667_100000038 3300005367 Bacteria 171914
138 Ga0070667_100000396 3300005367 Bacteria 47159
139 Ga0070667_100002247 3300005367 Bacteria 17006
140 Ga0070667_100006418 3300005367 Bacteria 9774
141 Ga0070667_100057015 3300005367 Bacteria 3300
142 Ga0070667_100112523 3300005367 Bacteria 2361
143 Ga0070714_100015883 3300005435 Bacteria 6068
144 Ga0070663_100005530 3300005455 Bacteria 7519
145 Ga0070663_100032815 3300005455 Bacteria 3583
146 Ga0070678_100008901 3300005456 Bacteria 6043
147 Ga0070678_100039163 3300005456 Bacteria 3341
148 Ga0070662_100000391 3300005457 Bacteria 26178
149 Ga0070662_100002528 3300005457 Bacteria 11273
150 Ga0070662_100004908 3300005457 Bacteria 8495
151 Ga0070662_100005390 3300005457 Bacteria 8167
152 Ga0070662_100006946 3300005457 Bacteria 7325
153 Ga0070662_100010219 3300005457 Bacteria 6153
154 Ga0070662_100013093 3300005457 Bacteria 5513
155 Ga0070681_10021524 3300005458 Bacteria 6462
156 Ga0068867_100002495 3300005459 Bacteria 12930
157 Ga0068867_100012914 3300005459 Bacteria 5910
158 Ga0068867_100013381 3300005459 Bacteria 5812
159 Ga0068867_100018201 3300005459 Bacteria 4992
160 Ga0070685_10000023 3300005466 Bacteria 102548
161 Ga0070684_100015958 3300005535 Bacteria 6133
162 Ga0070684_100032382 3300005535 Bacteria 4455
163 Ga0068853_100000764 3300005539 Bacteria 22317
164 Ga0068853_100002364 3300005539 Bacteria 14106
165 Ga0068853_100011737 3300005539 Bacteria 7120
166 Ga0068853_100019489 3300005539 Bacteria 5625
167 Ga0068853_100038510 3300005539 Bacteria 4073
168 Ga0068853_100048866 3300005539 Bacteria 3634
169 Ga0068853_100071790 3300005539 Bacteria 3015
170 Ga0070672_100002251 3300005543 Bacteria 12167
171 Ga0070672_100005075 3300005543 Bacteria 8685
172 Ga0070686_100000003 3300005544 Bacteria 308397
173 Ga0070665_100000036 3300005548 Bacteria 314603
174 Ga0070665_100000075 3300005548 Bacteria 189496
175 Ga0070665_100000107 3300005548 Bacteria 156048
176 Ga0070665_100000705 3300005548 Bacteria 44568
177 Ga0070665_100017020 3300005548 Bacteria 7289
178 Ga0070665_100020206 3300005548 Bacteria 6687
179 Ga0070665_100020609 3300005548 Bacteria 6624
180 Ga0070665_100027294 3300005548 Bacteria 5750
181 Ga0070665_100041899 3300005548 Bacteria 4603
182 Ga0068855_100000318 3300005563 Bacteria 60020
183 Ga0068855_100007587 3300005563 Bacteria 13122
184 Ga0068855_100011156 3300005563 Bacteria 10850
185 Ga0068855_100092728 3300005563 Bacteria 3483
186 Ga0070664_100001286 3300005564 Bacteria 20075
187 Ga0070664_100002719 3300005564 Bacteria 14275
188 Ga0070664_100007861 3300005564 Bacteria 8614
189 Ga0070664_100027928 3300005564 Bacteria 4693
190 Ga0070664_100028012 3300005564 Bacteria 4685
191 Ga0070664_100038260 3300005564 Bacteria 4037
192 Ga0068857_100008844 3300005577 Bacteria 8723
193 Ga0068857_100061759 3300005577 Bacteria 3329
194 Ga0068854_100000494 3300005578 Bacteria 24007
195 Ga0068854_100001685 3300005578 Bacteria 13460
196 Ga0068854_100025551 3300005578 Bacteria 4054
197 Ga0068854_100042423 3300005578 Bacteria 3220
198 Ga0068856_100007003 3300005614 Bacteria 11013
199 Ga0068856_100023109 3300005614 Bacteria 6047
200 Ga0068856_100061441 3300005614 Bacteria 3711
201 Ga0068856_100102017 3300005614 Bacteria 2862
202 Ga0068852_100001901 3300005616 Bacteria 14205
203 Ga0068852_100019408 3300005616 Bacteria 5380
204 Ga0068852_100022300 3300005616 Bacteria 5076
205 Ga0068859_100000068 3300005617 Bacteria 96701
206 Ga0068859_100003549 3300005617 Bacteria 15886
207 Ga0068859_100008593 3300005617 Bacteria 10325
208 Ga0068859_100032839 3300005617 Bacteria 5214
209 Ga0068859_100051689 3300005617 Bacteria 4131
210 Ga0068859_100090863 3300005617 Bacteria 3104
211 Ga0068859_100102860 3300005617 Bacteria 2914
212 Ga0068864_100000188 3300005618 Bacteria 56337
213 Ga0068864_100000248 3300005618 Bacteria 48142
214 Ga0068864_100000339 3300005618 Bacteria 41252
215 Ga0068864_100003036 3300005618 Bacteria 13866
216 Ga0068864_100006681 3300005618 Bacteria 9445
217 Ga0068864_100011537 3300005618 Bacteria 7300
218 Ga0068864_100011656 3300005618 Bacteria 7260
219 Ga0068864_100011788 3300005618 Bacteria 7221
220 Ga0068864_100016371 3300005618 Bacteria 6173
221 Ga0068861_100000968 3300005719 Bacteria 17516
222 Ga0068861_100004123 3300005719 Bacteria 9749
223 Ga0068861_100014384 3300005719 Bacteria 5554
224 Ga0068861_100026908 3300005719 Bacteria 4185
225 Ga0068861_100171550 3300005719 Bacteria 1798
226 Ga0068863_100000034 3300005841 Bacteria 168359
227 Ga0068863_100000318 3300005841 Bacteria 48923
228 Ga0068863_100000535 3300005841 Bacteria 38753
229 Ga0068863_100001229 3300005841 Bacteria 25559
230 Ga0068863_100001802 3300005841 Bacteria 21263
231 Ga0068863_100002834 3300005841 Bacteria 17170
232 Ga0068863_100005094 3300005841 Bacteria 12962
233 Ga0068863_100006405 3300005841 Bacteria 11540
234 Ga0068863_100008251 3300005841 Bacteria 10177
235 Ga0068863_100014352 3300005841 Bacteria 7629
236 Ga0068863_100033388 3300005841 Bacteria 4902
237 Ga0068863_100064667 3300005841 Bacteria 3459
238 Ga0068863_100088446 3300005841 Bacteria 2935
239 Ga0068858_100000688 3300005842 Bacteria 35297
240 Ga0068858_100000911 3300005842 Bacteria 30658
241 Ga0068858_100001148 3300005842 Bacteria 27405
242 Ga0068858_100001791 3300005842 Bacteria 21917
243 Ga0068858_100001843 3300005842 Bacteria 21605
244 Ga0068858_100013165 3300005842 Bacteria 7797
245 Ga0068858_100015659 3300005842 Bacteria 7132
246 Ga0068858_100017819 3300005842 Bacteria 6650
247 Ga0068858_100056971 3300005842 Bacteria 3612
248 Ga0068860_100000001 3300005843 Bacteria 703043
249 Ga0068860_100000008 3300005843 Bacteria 427367
250 Ga0068860_100000068 3300005843 Bacteria 179208
251 Ga0068860_100000256 3300005843 Bacteria 78477
252 Ga0068860_100002412 3300005843 Bacteria 19607
253 Ga0068860_100002747 3300005843 Bacteria 18315
254 Ga0068860_100012538 3300005843 Bacteria 8346
255 Ga0068860_100018987 3300005843 Bacteria 6676
256 Ga0068860_100028188 3300005843 Bacteria 5406
257 Ga0068860_100039618 3300005843 Bacteria 4507
258 Ga0068862_100000006 3300005844 Bacteria 346828
259 Ga0068862_100000088 3300005844 Bacteria 109244
260 Ga0068862_100000092 3300005844 Bacteria 106896
261 Ga0068862_100000620 3300005844 Bacteria 36954
262 Ga0068862_100003636 3300005844 Bacteria 13191
263 Ga0068862_100010829 3300005844 Bacteria 7533
264 Ga0068862_100017674 3300005844 Bacteria 5936
265 Ga0068862_100018008 3300005844 Bacteria 5885
266 Ga0068862_100022595 3300005844 Bacteria 5263
267 Ga0068862_100069418 3300005844 Bacteria 3042
268 Ga0081539_10044092 3300005985 Bacteria 2577
269 Ga0075365_10010228 3300006038 Bacteria 5452
270 Ga0075368_10000074 3300006042 Bacteria 23851
271 Ga0075363_100009825 3300006048 Bacteria 4511
272 Ga0075364_10017883 3300006051 Bacteria 4433
273 Ga0075364_10026599 3300006051 Bacteria 3691
274 Ga0075432_10008434 3300006058 Bacteria 3516
275 Ga0075362_10009768 3300006177 Bacteria 3722
276 Ga0075367_10001673 3300006178 Bacteria 9680
277 Ga0075367_10005332 3300006178 Bacteria 6368
278 Ga0075369_10006044 3300006186 Bacteria 4562
279 Ga0075370_10038986 3300006353 Bacteria 2676
280 Ga0068871_100006907 3300006358 Bacteria 8084
281 Ga0068871_100007948 3300006358 Bacteria 7605
282 Ga0068871_100009459 3300006358 Bacteria 7064
283 Ga0075430_100138273 3300006846 Bacteria 2029
284 Ga0075431_100040222 3300006847 Bacteria 4818
285 Ga0097620_100000068 3300006931 Bacteria 96701
286 Ga0097620_100003549 3300006931 Bacteria 15886
287 Ga0097620_100008593 3300006931 Bacteria 10325
288 Ga0097620_100015011 3300006931 Bacteria 7775
289 Ga0097620_100032839 3300006931 Bacteria 5214
290 Ga0097620_100051689 3300006931 Bacteria 4131
291 Ga0097620_100090853 3300006931 Bacteria 3104
292 Ga0097620_100102867 3300006931 Bacteria 2914
293 Ga0105250_10001326 3300009092 Bacteria 13524
294 Ga0105240_10068043 3300009093 Bacteria 4412
295 Ga0105245_10004863 3300009098 Bacteria 11828
296 Ga0105245_10012964 3300009098 Bacteria 7267
297 Ga0105245_10038453 3300009098 Bacteria 4257
298 Ga0105247_10006552 3300009101 Bacteria 7201
299 Ga0105247_10010078 3300009101 Bacteria 5726
300 Ga0105247_10011458 3300009101 Bacteria 5345
301 Ga0114129_10033552 3300009147 Bacteria 7254
302 Ga0105243_10151945 3300009148 Bacteria 1987
303 Ga0105241_10000478 3300009174 Bacteria 30203
304 Ga0105242_10077215 3300009176 Bacteria 2778
305 Ga0105248_10000066 3300009177 Bacteria 121254
306 Ga0105248_10000071 3300009177 Bacteria 118281
307 Ga0105248_10000135 3300009177 Bacteria 85668
308 Ga0105248_10001282 3300009177 Bacteria 28057
309 Ga0105248_10003049 3300009177 Bacteria 18581
310 Ga0105248_10004287 3300009177 Bacteria 15777
311 Ga0105248_10013575 3300009177 Bacteria 8969
312 Ga0105248_10018690 3300009177 Bacteria 7663
313 Ga0105248_10053518 3300009177 Bacteria 4529
314 Ga0105248_10072624 3300009177 Bacteria 3867
315 Ga0105237_10031128 3300009545 Bacteria 5411
316 Ga0105238_10063284 3300009551 Bacteria 3699
317 Ga0105238_10170636 3300009551 Bacteria 2151
318 Ga0105249_10000026 3300009553 Bacteria 232053
319 Ga0105249_10000100 3300009553 Bacteria 119358
320 Ga0105249_10106527 3300009553 Bacteria 2645
321 Ga0105148_100261 3300009978 Bacteria 7162
322 Ga0105239_10132192 3300010375 Bacteria 2777
323 Ga0105246_10000273 3300011119 Bacteria 26935
324 Ga0157371_10000458 3300013102 Bacteria 50035
325 Ga0157371_10007513 3300013102 Bacteria 8819
326 Ga0157370_10125127 3300013104 Bacteria 2400
327 Ga0157378_10001242 3300013297 Bacteria 23038
328 Ga0157378_10200460 3300013297 Bacteria 1887
329 Ga0163162_10004777 3300013306 Bacteria 13080
330 Ga0163162_10013372 3300013306 Bacteria 8015
331 Ga0163162_10015345 3300013306 Bacteria 7484
332 Ga0163162_10022616 3300013306 Bacteria 6197
333 Ga0163162_10023002 3300013306 Bacteria 6147
334 Ga0163162_10027151 3300013306 Bacteria 5660
335 Ga0157372_10004194 3300013307 Bacteria 15426
336 Ga0157372_10045540 3300013307 Bacteria 4867
337 Ga0157375_10055574 3300013308 Bacteria 3904
338 Ga0157375_10087888 3300013308 Bacteria 3161
339 Ga0157375_10096542 3300013308 Bacteria 3028
340 Ga0163163_10000995 3300014325 Bacteria 23981
341 Ga0163163_10002903 3300014325 Bacteria 14499
342 Ga0163163_10034083 3300014325 Bacteria 4929
343 Ga0157380_10001048 3300014326 Bacteria 17689
344 Ga0157380_10002655 3300014326 Bacteria 12118
345 Ga0157380_10003323 3300014326 Bacteria 11035
346 Ga0157380_10006460 3300014326 Bacteria 8258
347 Ga0157380_10008128 3300014326 Bacteria 7475
348 Ga0157379_10004123 3300014968 Bacteria 12399
349 Ga0157379_10005617 3300014968 Bacteria 10779
350 Ga0157379_10027613 3300014968 Bacteria 5054
351 Ga0183363_1001 3300015690 Bacteria 611534
352 Ga0163161_10000008 3300017792 Bacteria 294642
353 Ga0163161_10003797 3300017792 Bacteria 10589
354 Ga0163161_10046782 3300017792 Bacteria 3122
355 Ga0206353_12066863 3300020082 Bacteria 22106
356 Ga0213873_10000015 3300021358 Bacteria 131343
357 Ga0213876_10000005 3300021384 Bacteria 727326
358 Ga0213876_10001213 3300021384 Bacteria 16270
359 Ga0213875_10000401 3300021388 Bacteria 38122
360 Ga0207672_1000500 3300025223 Bacteria 4889
361 Ga0209147_101541 3300025229 Bacteria 7956
362 Ga0207425_1000022 3300025245 Bacteria 355305
363 Ga0209129_1000573 3300025258 Bacteria 25384
364 Ga0209565_1000010 3300025263 Bacteria 687724
365 Ga0209565_1000099 3300025263 Bacteria 131080
366 Ga0209673_1001990 3300025273 Bacteria 15816
367 Ga0209673_1007473 3300025273 Bacteria 5028
368 Ga0209675_1000245 3300025291 Bacteria 53738
369 Ga0209676_1000557 3300025292 Bacteria 56440
370 Ga0209676_1000881 3300025292 Bacteria 38438
371 Ga0209676_1001901 3300025292 Bacteria 17006
372 Ga0209676_1014918 3300025292 Bacteria 2889
373 Ga0209025_1001210 3300025294 Bacteria 36189
374 Ga0209025_1034240 3300025294 Bacteria 2325
375 Ga0209758_1000004 3300025297 Bacteria 1375322
376 Ga0209758_1016223 3300025297 Bacteria 3797
377 Ga0209050_1000001 3300025298 Bacteria 3563507
378 Ga0209050_1000010 3300025298 Bacteria 980454
379 Ga0209050_1000017 3300025298 Bacteria 728928
380 Ga0209256_1000034 3300025299 Bacteria 388475
381 Ga0209051_1000450 3300025303 Bacteria 54435
382 Ga0209257_1000009 3300025304 Bacteria 1205047
383 Ga0209257_1000113 3300025304 Bacteria 233523
384 Ga0209257_1000872 3300025304 Bacteria 42806
385 Ga0209257_1000921 3300025304 Bacteria 40974
386 Ga0209257_1001176 3300025304 Bacteria 33109
387 Ga0209257_1002733 3300025304 Bacteria 16751
388 Ga0209257_1006958 3300025304 Bacteria 7051
389 Ga0207697_10000004 3300025315 Bacteria 90016
390 Ga0207697_10000250 3300025315 Bacteria 29574
391 Ga0207697_10001021 3300025315 Bacteria 15675
392 Ga0207696_1011753 3300025711 Bacteria 3134
393 Ga0207713_1001941 3300025735 Bacteria 15635
394 Ga0207713_1010814 3300025735 Bacteria 5017
395 Ga0207682_10002256 3300025893 Bacteria 8689
396 Ga0207682_10050615 3300025893 Bacteria 1718
397 Ga0207710_10007666 3300025900 Bacteria 4566
398 Ga0207710_10017260 3300025900 Bacteria 3061
399 Ga0207710_10023328 3300025900 Bacteria 2658
400 Ga0207688_10000994 3300025901 Bacteria 14453
401 Ga0207680_10000004 3300025903 Bacteria 827324
402 Ga0207680_10016625 3300025903 Bacteria 3868
403 Ga0207647_10000153 3300025904 Bacteria 54496
404 Ga0207647_10022203 3300025904 Bacteria 4221
405 Ga0207647_10022445 3300025904 Bacteria 4191
406 Ga0207647_10051972 3300025904 Bacteria 2530
407 Ga0207705_10000002 3300025909 Bacteria 2046852
408 Ga0207705_10000131 3300025909 Bacteria 81639
409 Ga0207705_10000537 3300025909 Bacteria 31974
410 Ga0207705_10001553 3300025909 Bacteria 18222
411 Ga0207705_10003226 3300025909 Bacteria 12416
412 Ga0207705_10005122 3300025909 Bacteria 9827
413 Ga0207705_10009316 3300025909 Bacteria 7140
414 Ga0207705_10013718 3300025909 Bacteria 5847
415 Ga0207705_10019589 3300025909 Bacteria 4837
416 Ga0207705_10052094 3300025909 Bacteria 2945
417 Ga0207705_10054965 3300025909 Bacteria 2870
418 Ga0207705_10070795 3300025909 Bacteria 2528
419 Ga0207707_10015128 3300025912 Bacteria 6717
420 Ga0207707_10045508 3300025912 Bacteria 3824
421 Ga0207695_10021776 3300025913 Bacteria 7302
422 Ga0207671_10025636 3300025914 Bacteria 4427
423 Ga0207660_10004720 3300025917 Bacteria 8874
424 Ga0207657_10000181 3300025919 Bacteria 65099
425 Ga0207657_10000391 3300025919 Bacteria 46247
426 Ga0207657_10000811 3300025919 Bacteria 33015
427 Ga0207657_10006930 3300025919 Bacteria 11679
428 Ga0207657_10009507 3300025919 Bacteria 9762
429 Ga0207657_10015686 3300025919 Bacteria 7328
430 Ga0207657_10016312 3300025919 Bacteria 7167
431 Ga0207657_10077244 3300025919 Bacteria 2807
432 Ga0207649_10001955 3300025920 Bacteria 11752
433 Ga0207649_10006461 3300025920 Bacteria 6367
434 Ga0207649_10009943 3300025920 Bacteria 5214
435 Ga0207649_10039189 3300025920 Bacteria 2871
436 Ga0207652_10012124 3300025921 Bacteria 6963
437 Ga0207652_10014430 3300025921 Bacteria 6399
438 Ga0207681_10000001 3300025923 Bacteria 1105841
439 Ga0207681_10000002 3300025923 Bacteria 985597
440 Ga0207681_10000069 3300025923 Bacteria 92959
441 Ga0207681_10009746 3300025923 Bacteria 5878
442 Ga0207681_10025053 3300025923 Bacteria 3833
443 Ga0207681_10038744 3300025923 Bacteria 3160
444 Ga0207681_10054292 3300025923 Bacteria 2723
445 Ga0207681_10064571 3300025923 Bacteria 2528
446 Ga0207681_10064810 3300025923 Bacteria 2524
447 Ga0207694_10029607 3300025924 Bacteria 4178
448 Ga0207650_10000055 3300025925 Bacteria 158325
449 Ga0207650_10000969 3300025925 Bacteria 21577
450 Ga0207650_10001212 3300025925 Bacteria 18926
451 Ga0207650_10002248 3300025925 Bacteria 13488
452 Ga0207650_10003061 3300025925 Bacteria 11523
453 Ga0207650_10003163 3300025925 Bacteria 11341
454 Ga0207650_10004868 3300025925 Bacteria 9173
455 Ga0207650_10016491 3300025925 Bacteria 5165
456 Ga0207650_10021723 3300025925 Bacteria 4538
457 Ga0207650_10024587 3300025925 Bacteria 4283
458 Ga0207650_10057305 3300025925 Bacteria 2897
459 Ga0207659_10001482 3300025926 Bacteria 13991
460 Ga0207659_10004037 3300025926 Bacteria 8857
461 Ga0207659_10008772 3300025926 Bacteria 6297
462 Ga0207659_10035773 3300025926 Bacteria 3435
463 Ga0207700_10036947 3300025928 Bacteria 3533
464 Ga0207644_10000002 3300025931 Bacteria 942221
465 Ga0207644_10000087 3300025931 Bacteria 67315
466 Ga0207644_10000340 3300025931 Bacteria 30290
467 Ga0207644_10000389 3300025931 Bacteria 28599
468 Ga0207644_10002973 3300025931 Bacteria 10914
469 Ga0207644_10003017 3300025931 Bacteria 10833
470 Ga0207644_10004808 3300025931 Bacteria 8798
471 Ga0207644_10005364 3300025931 Bacteria 8364
472 Ga0207644_10007241 3300025931 Bacteria 7221
473 Ga0207644_10009606 3300025931 Bacteria 6352
474 Ga0207644_10025852 3300025931 Bacteria 4039
475 Ga0207690_10000001 3300025932 Bacteria 807539
476 Ga0207690_10000002 3300025932 Bacteria 807473
477 Ga0207690_10000003 3300025932 Bacteria 783011
478 Ga0207690_10000004 3300025932 Bacteria 746138
479 Ga0207690_10004241 3300025932 Bacteria 8468
480 Ga0207690_10060455 3300025932 Bacteria 2571
481 Ga0207706_10000194 3300025933 Bacteria 67452
482 Ga0207706_10001611 3300025933 Bacteria 22395
483 Ga0207706_10001775 3300025933 Bacteria 21183
484 Ga0207706_10004919 3300025933 Bacteria 12496
485 Ga0207706_10013591 3300025933 Bacteria 7396
486 Ga0207706_10014236 3300025933 Bacteria 7211
487 Ga0207706_10014348 3300025933 Bacteria 7181
488 Ga0207706_10016990 3300025933 Bacteria 6565
489 Ga0207706_10029595 3300025933 Bacteria 4888
490 Ga0207706_10053746 3300025933 Bacteria 3555
491 Ga0207670_10043642 3300025936 Bacteria 2963
492 Ga0207669_10003957 3300025937 Bacteria 6466
493 Ga0207669_10059755 3300025937 Bacteria 2333
494 Ga0207691_10003366 3300025940 Bacteria 15559
495 Ga0207691_10005114 3300025940 Bacteria 12658
496 Ga0207691_10020930 3300025940 Bacteria 6182
497 Ga0207691_10087767 3300025940 Bacteria 2790
498 Ga0207691_10137706 3300025940 Bacteria 2152
499 Ga0207711_10000046 3300025941 Bacteria 153238
500 Ga0207711_10002576 3300025941 Bacteria 16129
501 Ga0207711_10003882 3300025941 Bacteria 12863
502 Ga0207711_10012213 3300025941 Bacteria 7142
503 Ga0207711_10015275 3300025941 Bacteria 6374
504 Ga0207711_10016234 3300025941 Bacteria 6184
505 Ga0207711_10017997 3300025941 Bacteria 5872
506 Ga0207711_10029685 3300025941 Bacteria 4613
507 Ga0207711_10038361 3300025941 Bacteria 4073
508 Ga0207689_10000094 3300025942 Bacteria 71733
509 Ga0207661_10017379 3300025944 Bacteria 5321
510 Ga0207661_10022719 3300025944 Bacteria 4730
511 Ga0207679_10002042 3300025945 Bacteria 12522
512 Ga0207679_10003444 3300025945 Bacteria 9762
513 Ga0207679_10004747 3300025945 Bacteria 8462
514 Ga0207679_10019755 3300025945 Bacteria 4534
515 Ga0207679_10022413 3300025945 Bacteria 4300
516 Ga0207667_10000282 3300025949 Bacteria 69790
517 Ga0207667_10027494 3300025949 Bacteria 6190
518 Ga0207667_10027860 3300025949 Bacteria 6142
519 Ga0207667_10031460 3300025949 Bacteria 5729
520 Ga0207667_10106545 3300025949 Bacteria 2891
521 Ga0207651_10001348 3300025960 Bacteria 11100
522 Ga0207651_10006159 3300025960 Bacteria 6241
523 Ga0207651_10006765 3300025960 Bacteria 6042
524 Ga0207651_10017217 3300025960 Bacteria 4262
525 Ga0207651_10039726 3300025960 Bacteria 3106
526 Ga0207712_10000001 3300025961 Bacteria 750309
527 Ga0207712_10000008 3300025961 Bacteria 527957
528 Ga0207712_10005663 3300025961 Bacteria 7881
529 Ga0207712_10042891 3300025961 Bacteria 3118
530 Ga0207668_10000060 3300025972 Bacteria 89732
531 Ga0207668_10000110 3300025972 Bacteria 58891
532 Ga0207668_10000769 3300025972 Bacteria 19619
533 Ga0207668_10012881 3300025972 Bacteria 5132
534 Ga0207668_10018603 3300025972 Bacteria 4376
535 Ga0207668_10019497 3300025972 Bacteria 4290
536 Ga0207640_10001024 3300025981 Bacteria 15466
537 Ga0207640_10008015 3300025981 Bacteria 5837
538 Ga0207640_10009891 3300025981 Bacteria 5353
539 Ga0207658_10000002 3300025986 Bacteria 1364188
540 Ga0207658_10000029 3300025986 Bacteria 171928
541 Ga0207658_10000213 3300025986 Bacteria 60739
542 Ga0207658_10001284 3300025986 Bacteria 19875
543 Ga0207658_10001650 3300025986 Bacteria 17032
544 Ga0207658_10005201 3300025986 Bacteria 8956
545 Ga0207658_10009836 3300025986 Bacteria 6493
546 Ga0207658_10009999 3300025986 Bacteria 6448
547 Ga0207658_10025001 3300025986 Bacteria 4179
548 Ga0207658_10065107 3300025986 Bacteria 2736
549 Ga0207658_10080325 3300025986 Bacteria 2497
550 Ga0207658_10172413 3300025986 Bacteria 1783
551 Ga0207677_10000110 3300026023 Bacteria 66525
552 Ga0207677_10015525 3300026023 Bacteria 4483
553 Ga0207677_10042819 3300026023 Bacteria 3005
554 Ga0207703_10000717 3300026035 Bacteria 32692
555 Ga0207703_10001432 3300026035 Bacteria 21786
556 Ga0207703_10004575 3300026035 Bacteria 11339
557 Ga0207703_10005684 3300026035 Bacteria 10009
558 Ga0207703_10007899 3300026035 Bacteria 8412
559 Ga0207703_10008344 3300026035 Bacteria 8188
560 Ga0207703_10008355 3300026035 Bacteria 8184
561 Ga0207703_10009335 3300026035 Bacteria 7710
562 Ga0207703_10016697 3300026035 Bacteria 5726
563 Ga0207703_10025377 3300026035 Bacteria 4661
564 Ga0207703_10087942 3300026035 Bacteria 2606
565 Ga0207639_10000649 3300026041 Bacteria 23939
566 Ga0207639_10001311 3300026041 Bacteria 16818
567 Ga0207639_10001653 3300026041 Bacteria 15010
568 Ga0207639_10007752 3300026041 Bacteria 7336
569 Ga0207639_10029754 3300026041 Bacteria 4001
570 Ga0207639_10095058 3300026041 Bacteria 2394
571 Ga0207678_10000271 3300026067 Bacteria 47011
572 Ga0207678_10000587 3300026067 Bacteria 33282
573 Ga0207678_10004806 3300026067 Bacteria 12134
574 Ga0207678_10007492 3300026067 Bacteria 9646
575 Ga0207678_10011154 3300026067 Bacteria 7893
576 Ga0207678_10017387 3300026067 Bacteria 6313
577 Ga0207702_10000811 3300026078 Bacteria 33140
578 Ga0207702_10010616 3300026078 Bacteria 7697
579 Ga0207702_10041239 3300026078 Bacteria 3870
580 Ga0207702_10180157 3300026078 Bacteria 1945
581 Ga0207641_10000057 3300026088 Bacteria 168603
582 Ga0207641_10000091 3300026088 Bacteria 127567
583 Ga0207641_10000102 3300026088 Bacteria 122366
584 Ga0207641_10000342 3300026088 Bacteria 56068
585 Ga0207641_10002687 3300026088 Bacteria 16222
586 Ga0207641_10002980 3300026088 Bacteria 15314
587 Ga0207641_10003152 3300026088 Bacteria 14783
588 Ga0207641_10007862 3300026088 Bacteria 8849
589 Ga0207641_10029253 3300026088 Bacteria 4554
590 Ga0207641_10060259 3300026088 Bacteria 3235
591 Ga0207648_10000104 3300026089 Bacteria 81717
592 Ga0207648_10002737 3300026089 Bacteria 18733
593 Ga0207648_10003545 3300026089 Bacteria 16326
594 Ga0207648_10018393 3300026089 Bacteria 6330
595 Ga0207648_10043276 3300026089 Bacteria 3953
596 Ga0207676_10000004 3300026095 Bacteria 725417
597 Ga0207676_10000184 3300026095 Bacteria 55154
598 Ga0207676_10000604 3300026095 Bacteria 29483
599 Ga0207676_10002954 3300026095 Bacteria 12127
600 Ga0207676_10003007 3300026095 Bacteria 12023
601 Ga0207676_10003310 3300026095 Bacteria 11436
602 Ga0207676_10003565 3300026095 Bacteria 10997
603 Ga0207676_10035653 3300026095 Bacteria 3778
604 Ga0207674_10001996 3300026116 Bacteria 25880
605 Ga0207674_10007306 3300026116 Bacteria 12871
606 Ga0207674_10008119 3300026116 Bacteria 12167
607 Ga0207674_10008156 3300026116 Bacteria 12145
608 Ga0207674_10010461 3300026116 Bacteria 10507
609 Ga0207674_10013773 3300026116 Bacteria 8949
610 Ga0207675_100000016 3300026118 Bacteria 126353
611 Ga0207675_100000435 3300026118 Bacteria 40580
612 Ga0207675_100000818 3300026118 Bacteria 30959
613 Ga0207675_100001590 3300026118 Bacteria 22733
614 Ga0207675_100003186 3300026118 Bacteria 16096
615 Ga0207675_100019269 3300026118 Bacteria 6364
616 Ga0207675_100022444 3300026118 Bacteria 5878
617 Ga0207675_100042911 3300026118 Bacteria 4223
618 Ga0207683_10042498 3300026121 Bacteria 3970
619 Ga0207698_10014014 3300026142 Bacteria 5312
620 Ga0207698_10019539 3300026142 Bacteria 4641
621 Ga0207698_10022477 3300026142 Bacteria 4384
622 Ga0209813_10000093 3300027866 Bacteria 33306
623 Ga0209974_10006494 3300027876 Bacteria 4080
624 Ga0207428_10046362 3300027907 Bacteria 3496
625 Ga0268266_10000042 3300028379 Bacteria 316826
626 Ga0268266_10000133 3300028379 Bacteria 143210
627 Ga0268266_10000354 3300028379 Bacteria 70983
628 Ga0268266_10000468 3300028379 Bacteria 58386
629 Ga0268266_10004851 3300028379 Bacteria 12769
630 Ga0268266_10008187 3300028379 Bacteria 9328
631 Ga0268266_10010333 3300028379 Bacteria 8167
632 Ga0268266_10018696 3300028379 Bacteria 5904
633 Ga0268266_10046227 3300028379 Bacteria 3727
634 Ga0268266_10137207 3300028379 Bacteria 2192
635 Ga0268265_10000002 3300028380 Bacteria 1035381
636 Ga0268265_10000091 3300028380 Bacteria 115237
637 Ga0268265_10000145 3300028380 Bacteria 89267
638 Ga0268265_10000260 3300028380 Bacteria 60001
639 Ga0268265_10001372 3300028380 Bacteria 20680
640 Ga0268265_10003169 3300028380 Bacteria 11962
641 Ga0268265_10004650 3300028380 Bacteria 9476
642 Ga0268265_10009026 3300028380 Bacteria 6744
643 Ga0268265_10011653 3300028380 Bacteria 5946
644 Ga0268265_10012998 3300028380 Bacteria 5653
645 Ga0268265_10014104 3300028380 Bacteria 5447
646 Ga0268265_10022561 3300028380 Bacteria 4425
647 Ga0268264_10000006 3300028381 Bacteria 827324
648 Ga0268264_10000010 3300028381 Bacteria 596543
649 Ga0268264_10000018 3300028381 Bacteria 495324
650 Ga0268264_10000087 3300028381 Bacteria 236696
651 Ga0268264_10000103 3300028381 Bacteria 222439
652 Ga0268264_10000425 3300028381 Bacteria 58711
653 Ga0268264_10001804 3300028381 Bacteria 19568
654 Ga0268264_10002419 3300028381 Bacteria 16426
655 Ga0268264_10010046 3300028381 Bacteria 7834
656 Ga0268264_10028009 3300028381 Bacteria 4608
657 Ga0268264_10046251 3300028381 Bacteria 3614
658 Ga0268264_10088785 3300028381 Bacteria 2661
659 Ga0307408_100040705 3300031548 Bacteria 3291
660 Ga0307408_100052891 3300031548 Bacteria 2931
661 Ga0307408_100097525 3300031548 Bacteria 2233
662 Ga0307508_10005528 3300031616 Bacteria 12006
663 Ga0307508_10080130 3300031616 Bacteria 2847
664 Ga0307405_10010703 3300031731 Bacteria 4769
665 Ga0307405_10022524 3300031731 Bacteria 3563
666 Ga0307405_10069610 3300031731 Bacteria 2256
667 Ga0307413_10001042 3300031824 Bacteria 10040
668 Ga0307413_10012378 3300031824 Bacteria 4244
669 Ga0307413_10013512 3300031824 Bacteria 4108
670 Ga0307413_10035331 3300031824 Bacteria 2865
671 Ga0307413_10071058 3300031824 Bacteria 2191
672 Ga0307413_10123956 3300031824 Bacteria 1755
673 Ga0307410_10004118 3300031852 Bacteria 7450
674 Ga0307410_10016554 3300031852 Bacteria 4400
675 Ga0307410_10022347 3300031852 Bacteria 3907
676 Ga0307410_10049287 3300031852 Bacteria 2826
677 Ga0307410_10052350 3300031852 Bacteria 2757
678 Ga0307410_10055748 3300031852 Bacteria 2684
679 Ga0307410_10055785 3300031852 Bacteria 2683
680 Ga0307406_10010899 3300031901 Bacteria 5140
681 Ga0307406_10055147 3300031901 Bacteria 2539
682 Ga0307407_10062180 3300031903 Bacteria 2185
683 Ga0307407_10074787 3300031903 Bacteria 2028
684 Ga0307407_10077002 3300031903 Bacteria 2004
685 Ga0307412_10001412 3300031911 Bacteria 13375
686 Ga0307412_10003919 3300031911 Bacteria 8289
687 Ga0307412_10040833 3300031911 Bacteria 3003
688 Ga0307412_10056319 3300031911 Bacteria 2619
689 Ga0307412_10058445 3300031911 Bacteria 2579
690 Ga0307409_100010865 3300031995 Bacteria 5697
691 Ga0307409_100025354 3300031995 Bacteria 4157
692 Ga0307409_100057154 3300031995 Bacteria 3021
693 Ga0307409_100077486 3300031995 Bacteria 2670
694 Ga0307416_100005969 3300032002 Bacteria 7568
695 Ga0307416_100021093 3300032002 Bacteria 4669
696 Ga0307416_100039417 3300032002 Bacteria 3657
697 Ga0307416_100130056 3300032002 Bacteria 2264
698 Ga0307416_100144250 3300032002 Bacteria 2170
699 Ga0307414_10000230 3300032004 Bacteria 36506
700 Ga0307414_10002011 3300032004 Bacteria 10559
701 Ga0307414_10005482 3300032004 Bacteria 6991
702 Ga0307414_10007276 3300032004 Bacteria 6217
703 Ga0307414_10015338 3300032004 Bacteria 4626
704 Ga0307414_10032371 3300032004 Bacteria 3441
705 Ga0307414_10065819 3300032004 Bacteria 2587
706 Ga0307414_10069197 3300032004 Bacteria 2536
707 Ga0307411_10015806 3300032005 Bacteria 4252
708 Ga0307411_10017646 3300032005 Bacteria 4074
709 Ga0307411_10017807 3300032005 Bacteria 4060
710 Ga0307411_10049763 3300032005 Bacteria 2725
711 Ga0307411_10059882 3300032005 Bacteria 2526
712 Ga0307411_10061655 3300032005 Bacteria 2497
713 Ga0307411_10062989 3300032005 Bacteria 2476
714 Ga0307411_10105305 3300032005 Bacteria 2005
715 Ga0307415_100001168 3300032126 Bacteria 12279
716 Ga0307415_100021846 3300032126 Bacteria 3941
717 Ga0307415_100029330 3300032126 Bacteria 3514
718 Ga0307415_100031961 3300032126 Bacteria 3398
719 Ga0307510_10003707 3300033180 Bacteria 17860
720 Ga0373943_0003208 3300035170 Bacteria 7421
721 Ga0373935_0027403 3300035692 Bacteria 3521
722 Ga0373935_0096905 3300035692 Bacteria 1939
723 Ga0373947_0047947 3300035725 Bacteria 2562
724 Ga0316584_0017465 3300036712 Bacteria 5159
725 Ga0395899_0002090 3300037312 Bacteria 16385
726 Ga0395899_0011079 3300037312 Bacteria 6906
727 Ga0395899_0013169 3300037312 Bacteria 6325
728 Ga0395899_0114950 3300037312 Bacteria 1932
729 Ga0395900_0004149 3300037418 Bacteria 15419
730 Ga0395900_0031168 3300037418 Bacteria 5476
731 Ga0395900_0032675 3300037418 Bacteria 5351
732 Ga0395900_0060471 3300037418 Bacteria 3898
733 Ga0395900_0073994 3300037418 Bacteria 3503
734 Ga0395898_0012526 3300037466 Bacteria 8771
735 Ga0395898_0017336 3300037466 Bacteria 7357
736 Ga0395898_0052866 3300037466 Bacteria 3968
737 Ga0395898_0076029 3300037466 Bacteria 3243
738 Ga0395898_0086371 3300037466 Bacteria 3023
739 Ga0395898_0157699 3300037466 Bacteria 2171
740 Ga0395905_0000193 3300037471 Bacteria 96667
741 Ga0395905_0003054 3300037471 Bacteria 18136
742 Ga0395905_0004969 3300037471 Bacteria 13697
743 Ga0395905_0029464 3300037471 Bacteria 5171
744 Ga0395905_0089060 3300037471 Bacteria 2892
745 Ga0395905_0109362 3300037471 Bacteria 2595
746 Ga0395905_0181388 3300037471 Bacteria 1976
747 Ga0436364_0484549 3300037853 Bacteria 37401
748 Ga0395901_0001182 3300038443 Bacteria 27756
749 Ga0395901_0004785 3300038443 Bacteria 13663
750 Ga0395901_0025716 3300038443 Bacteria 6043
751 Ga0395901_0062262 3300038443 Bacteria 3883
752 Ga0395901_0085298 3300038443 Bacteria 3301
753 Ga0395901_0179426 3300038443 Bacteria 2221
754 Ga0395901_0182776 3300038443 Bacteria 2199
755 Ga0436365_0668445 3300039437 Bacteria 24471
756 Ga0436365_0853458 3300039437 Bacteria 6825
757 Ga0436362_0284509 3300039453 Bacteria 45469
758 Ga0439461_0000364 3300041410 Bacteria 6457
759 Ga0439465_0000704 3300041413 Bacteria 10276
760 Ga0439465_0012388 3300041413 Bacteria 2667
761 Ga0439432_001242 3300042006 Bacteria 9640
762 Ga0439457_004158 3300042014 Bacteria 3817
763 Ga0439462_0008277 3300042015 Bacteria 2617
764 Ga0450912_000714 3300042116 Bacteria 1776
765 Ga0439434_0005349 3300042435 Bacteria 3757
766 Ga0466961_0009058 3300044693 Bacteria 6348
767 Ga0466963_0012590 3300044694 Bacteria 5182
768 Ga0466971_0002752 3300044719 Bacteria 7431
769 Ga0451576_0000007 3300045051 Bacteria 782228
770 Ga0466958_0001341 3300045836 Bacteria 11619
771 Ga0466967_0128101 3300045976 Bacteria 2353
772 Ga0495627_000167 3300046453 Bacteria 74800
773 Ga0495627_000217 3300046453 Bacteria 62536
774 Ga0495650_0000559 3300046471 Bacteria 52755
775 Ga0495650_0008074 3300046471 Bacteria 6211
776 Ga0495596_0000233 3300046500 Bacteria 37690
777 Ga0495607_0015908 3300046501 Bacteria 4864
778 Ga0495583_0000260 3300046506 Bacteria 86495
779 Ga0495606_0000235 3300046507 Bacteria 98069
780 Ga0495606_0035039 3300046507 Bacteria 3437
781 Ga0495610_0000030 3300046512 Bacteria 265950
782 Ga0495610_0000127 3300046512 Bacteria 84143
783 Ga0495616_0000022 3300046513 Bacteria 149720
784 Ga0495632_0000076 3300046519 Bacteria 101121
785 Ga0495632_0021408 3300046519 Bacteria 3484
786 Ga0495637_0002289 3300046520 Bacteria 10607
787 Ga0495643_0000009 3300046522 Bacteria 344767
788 Ga0495643_0000746 3300046522 Bacteria 36916
789 Ga0495643_0006640 3300046522 Bacteria 7592
790 Ga0495648_0000026 3300046524 Bacteria 232162
791 Ga0495648_0005225 3300046524 Bacteria 10856
792 Ga0495663_0000023 3300046525 Bacteria 105104
793 Ga0495663_0000975 3300046525 Bacteria 9481
794 Ga0495654_0000194 3300046530 Bacteria 59637
795 Ga0495598_0000610 3300046537 Bacteria 6760
796 Ga0495609_0030341 3300046538 Bacteria 2461
797 Ga0495621_0000010 3300046539 Bacteria 39172
798 Ga0495621_0007030 3300046539 Bacteria 3315
799 Ga0495633_0000136 3300046558 Bacteria 97314
800 Ga0495633_0001163 3300046558 Bacteria 21130
801 Ga0495633_0005728 3300046558 Bacteria 7510
802 Ga0495668_0000004 3300046616 Bacteria 574236
803 Ga0495668_0005823 3300046616 Bacteria 8238
804 Ga0495668_0007759 3300046616 Bacteria 6808
805 Ga0495625_0000729 3300046660 Bacteria 46117
806 Ga0495625_0010834 3300046660 Bacteria 7500
807 Ga0495625_0034320 3300046660 Bacteria 3745
808 Ga0495669_0005836 3300046684 Bacteria 5135
809 Ga0495669_0038592 3300046684 Bacteria 2115
810 Ga0495670_0000004 3300046691 Bacteria 310086
811 Ga0495671_0000013 3300046692 Bacteria 344767
812 Ga0495671_0000139 3300046692 Bacteria 63631
813 Ga0495673_0000066 3300047469 Bacteria 221478
814 Ga0495681_0000011 3300047470 Bacteria 201843
815 Ga0495681_0000042 3300047470 Bacteria 116324
816 Ga0495681_0002227 3300047470 Bacteria 13958
817 Ga0495686_0025230 3300047472 Bacteria 3899
818 Ga0495615_0000025 3300048090 Bacteria 49753
819 Ga0495626_0012404 3300048091 Bacteria 4468
820 Ga0496100_0019893 3300048903 Bacteria 4015
821 Ga0496100_0045726 3300048903 Bacteria 2811
822 Ga0496102_0000043 3300048905 Bacteria 189201
823 Ga0496102_0000998 3300048905 Bacteria 26613
824 Ga0496102_0004522 3300048905 Bacteria 11750
825 Ga0496102_0038873 3300048905 Bacteria 4297
826 Ga0496103_0000133 3300048906 Bacteria 78740
827 Ga0496103_0000201 3300048906 Bacteria 59837
828 Ga0496103_0009525 3300048906 Bacteria 5751
829 Ga0496103_0013050 3300048906 Bacteria 4925
830 Ga0496104_0000078 3300048907 Bacteria 100203
831 Ga0496104_0017309 3300048907 Bacteria 6560
832 Ga0496105_0000241 3300048908 Bacteria 36833
833 Ga0496105_0005919 3300048908 Bacteria 9331
834 Ga0496105_0099749 3300048908 Bacteria 2398
835 Ga0496106_0002700 3300048909 Bacteria 13158
836 Ga0496106_0003227 3300048909 Bacteria 12209
837 Ga0496106_0042593 3300048909 Bacteria 3405
838 Ga0496107_0007192 3300048910 Bacteria 7667
839 Ga0496107_0011807 3300048910 Bacteria 6098
840 Ga0496107_0012495 3300048910 Bacteria 5926
841 Ga0496107_0071001 3300048910 Bacteria 2530
842 Ga0496108_0002029 3300048911 Bacteria 16208
843 Ga0496108_0004360 3300048911 Bacteria 11380
844 Ga0496108_0006530 3300048911 Bacteria 9457
845 Ga0496108_0008130 3300048911 Bacteria 8506
846 Ga0496108_0044071 3300048911 Bacteria 3725
847 Ga0496109_0004600 3300048912 Bacteria 11514
848 Ga0496109_0008938 3300048912 Bacteria 8536
849 Ga0496109_0014993 3300048912 Bacteria 6746
850 Ga0496109_0024508 3300048912 Bacteria 5364
851 Ga0496109_0084654 3300048912 Bacteria 2926
852 Ga0496110_0003943 3300048913 Bacteria 11413
853 Ga0496110_0006209 3300048913 Bacteria 9432
854 Ga0496110_0006236 3300048913 Bacteria 9401
855 Ga0496110_0011114 3300048913 Bacteria 7354
856 Ga0496110_0087861 3300048913 Bacteria 2776
857 Ga0496111_0013500 3300048914 Bacteria 5562
858 Ga0496111_0014957 3300048914 Bacteria 5315
859 Ga0496111_0023348 3300048914 Bacteria 4340
860 Ga0496111_0114788 3300048914 Bacteria 1985
861 Ga0496112_0014138 3300048915 Bacteria 7393
862 Ga0496112_0021605 3300048915 Bacteria 6122
863 Ga0496112_0062776 3300048915 Bacteria 3665
864 Ga0496112_0076839 3300048915 Bacteria 3302
865 Ga0496112_0116575 3300048915 Bacteria 2641
866 Ga0496113_0003327 3300048916 Bacteria 9598
867 Ga0496113_0040762 3300048916 Bacteria 3423
868 Ga0496113_0071744 3300048916 Bacteria 2634
869 Ga0496114_0020555 3300048917 Bacteria 5358
870 Ga0496114_0048461 3300048917 Bacteria 3534
871 Ga0496114_0051260 3300048917 Bacteria 3436
872 Ga0496115_0000504 3300048918 Bacteria 30605
873 Ga0496116_0000028 3300048919 Bacteria 424086
874 Ga0496116_0000682 3300048919 Bacteria 44118
875 Ga0496117_0000104 3300048920 Bacteria 189201
876 Ga0496117_0003203 3300048920 Bacteria 19356
877 Ga0496117_0021921 3300048920 Bacteria 5144
878 Ga0496118_0000080 3300048921 Bacteria 189201
879 Ga0496118_0018225 3300048921 Bacteria 6343
880 Ga0496118_0025704 3300048921 Bacteria 5039
881 Ga0496119_0000114 3300048922 Bacteria 114495
882 Ga0496120_0000266 3300048923 Bacteria 87412
883 Ga0496121_0000021 3300048924 Bacteria 478544
884 Ga0496121_0000520 3300048924 Bacteria 73411
885 Ga0496121_0000731 3300048924 Bacteria 60609
886 Ga0496121_0001018 3300048924 Bacteria 50054
887 Ga0496121_0016625 3300048924 Bacteria 7581
888 Ga0496122_0005756 3300048925 Bacteria 14594
889 Ga0496122_0005810 3300048925 Bacteria 14503
890 Ga0496122_0019036 3300048925 Bacteria 6298
891 Ga0496123_0001678 3300048926 Bacteria 29639
892 Ga0496123_0009221 3300048926 Bacteria 8921
893 Ga0496123_0017201 3300048926 Bacteria 5832
894 Ga0496124_0000093 3300048927 Bacteria 189201
895 Ga0496124_0003121 3300048927 Bacteria 20560
896 Ga0496124_0003580 3300048927 Bacteria 18883
897 Ga0496124_0004225 3300048927 Bacteria 16906
898 Ga0496124_0008108 3300048927 Bacteria 11033
899 Ga0496124_0128771 3300048927 Bacteria 2013
900 Ga0496125_0006013 3300048928 Bacteria 13276
901 Ga0496125_0021035 3300048928 Bacteria 6098
902 Ga0496125_0024152 3300048928 Bacteria 5594
903 Ga0496125_0035203 3300048928 Bacteria 4399
904 Ga0496126_0000079 3300048929 Bacteria 222463
905 Ga0496126_0000173 3300048929 Bacteria 146490
906 Ga0496126_0005189 3300048929 Bacteria 15051
907 Ga0501307_002712 3300049162 Bacteria 1677
908 Ga0501290_000042 3300049513 Bacteria 16627
909 Ga0501292_000005 3300049515 Bacteria 147536
910 Ga0501294_000049 3300049517 Bacteria 12363
911 Ga0501317_002272 3300049533 Bacteria 1794
912 Ga0501032_0024236 3300049569 Bacteria 4191
913 Ga0501034_0002130 3300049571 Bacteria 24593
914 Ga0501034_0053982 3300049571 Bacteria 4046
915 Ga0501036_0010046 3300049572 Bacteria 7798
916 Ga0501037_0014284 3300049573 Bacteria 5852
917 Ga0501069_0050106 3300049585 Bacteria 2322
918 Ga0501070_0018814 3300049586 Bacteria 5794
919 Ga0501206_000476 3300049653 Bacteria 4839
920 Ga0501207_001528 3300049654 Bacteria 2903
921 Ga0501222_000183 3300049662 Bacteria 11236
922 Ga0501223_000205 3300049663 Bacteria 15152
923 Ga0501223_001035 3300049663 Bacteria 6564
924 Ga0501224_000028 3300049664 Bacteria 53596
925 Ga0501227_002874 3300049665 Bacteria 3779
926 Ga0501233_003691 3300049668 Bacteria 2764
927 Ga0501235_001607 3300049669 Bacteria 4843
928 Ga0501249_000294 3300049679 Bacteria 14101
929 Ga0501249_006567 3300049679 Bacteria 2391
930 Ga0501257_000016 3300049686 Bacteria 49821
931 Ga0501258_001149 3300049687 Bacteria 2087
932 Ga0501221_000663 3300049704 Bacteria 5515
933 Ga0501225_0001120 3300049705 Bacteria 8398
934 Ga0501225_0001850 3300049705 Bacteria 6639
935 Ga0501234_002566 3300049707 Bacteria 2859
936 Ga0501279_000020 3300049775 Bacteria 58285
937 Ga0501280_000025 3300049776 Bacteria 49396
938 Ga0501282_000036 3300049778 Bacteria 17537
939 Ga0501044_0013271 3300049823 Bacteria 8919
940 Ga0501226_000146 3300049853 Bacteria 13414
941 nmdc:mga03683_448_c1 3300050489 Bacteria 11870
942 nmdc:mga03n38_15852_c1 3300050490 Bacteria 2919
943 nmdc:mga00v17_12785_c1 3300050491 Bacteria 4638
944 nmdc:mga00v17_7556_c1 3300050491 Bacteria 5805
945 nmdc:mga0yw44_9045_c1 3300050492 Bacteria 5008
946 nmdc:mga0k408_8774_c1 3300050493 Bacteria 5441
947 nmdc:mga06z11_168_c1 3300050494 Bacteria 25790
948 nmdc:mga06z11_482_c1 3300050494 Bacteria 14695
949 nmdc:mga04h51_189_c1 3300050495 Bacteria 16836
950 nmdc:mga07m45_55_c1 3300050496 Bacteria 47453
951 nmdc:mga0qj67_3093_c1 3300050509 Bacteria 11964
952 nmdc:mga0sz30_15843_c1 3300050516 Bacteria 2984
953 Ga0500643_000001 3300053087 Bacteria 1440111
954 Ga0500643_000167 3300053087 Bacteria 64874
955 Ga0500643_000523 3300053087 Bacteria 27013
956 Ga0500643_007597 3300053087 Bacteria 4347
957 Ga0500566_0001889 3300053094 Bacteria 12327
958 Ga0500556_0000040 3300053104 Bacteria 137489
959 Ga0500592_000074 3300053116 Bacteria 25290
960 Ga0500607_000354 3300053121 Bacteria 43487
961 Ga0500607_001619 3300053121 Bacteria 19861
962 Ga0500608_008713 3300053122 Bacteria 4276
963 Ga0500618_001172 3300053125 Bacteria 12656
964 Ga0500642_0000003 3300053130 Bacteria 544899
965 Ga0500655_001426 3300053133 Bacteria 4538
966 Ga0500658_0000887 3300053134 Bacteria 12284
967 Ga0500559_0001553 3300053136 Bacteria 12848
968 Ga0500568_0000708 3300053139 Bacteria 23914
969 Ga0500568_0012994 3300053139 Bacteria 3810
970 Ga0500573_0000019 3300053140 Bacteria 173601
971 Ga0500604_0000004 3300053151 Bacteria 146374
972 Ga0500616_0000195 3300053153 Bacteria 99188
973 Ga0500616_0000893 3300053153 Bacteria 32769
974 Ga0500616_0003996 3300053153 Bacteria 10763
975 Ga0500622_0000145 3300053156 Bacteria 75417
976 Ga0500624_000012 3300053157 Bacteria 165895
977 Ga0500624_000092 3300053157 Bacteria 43880
978 Ga0500627_0000126 3300053158 Bacteria 23656
979 Ga0500627_0000254 3300053158 Bacteria 15182
980 Ga0500627_0000423 3300053158 Bacteria 11458
981 Ga0500567_000039 3300053723 Bacteria 27122
982 Ga0500625_000021 3300053729 Bacteria 83503
983 Ga0500645_002312 3300053730 Bacteria 8598
984 Ga0500645_002526 3300053730 Bacteria 8075
985 Ga0587077_005217 3300059493 Bacteria 1765
986 Ga0466962_0002983 3300061719 Bacteria 8076

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100022444 Ga0207675_1000224443 514
2 3300006846 Ga0075430_100138273 Ga0075430_1001382732 515
3 3300014326 Ga0157380_10001048 Ga0157380_100010486 515
4 3300031548 Ga0307408_100040705 Ga0307408_1000407052 515
5 3300031731 Ga0307405_10022524 Ga0307405_100225242 515
6 3300031824 Ga0307413_10071058 Ga0307413_100710582 515
7 3300031852 Ga0307410_10022347 Ga0307410_100223473 515
8 3300031903 Ga0307407_10074787 Ga0307407_100747871 515
9 3300031995 Ga0307409_100077486 Ga0307409_1000774862 515
10 3300032002 Ga0307416_100039417 Ga0307416_1000394173 515
11 3300032004 Ga0307414_10032371 Ga0307414_100323712 515
12 3300050509 nmdc:mga0qj67_3093_c1 nmdc:mga0qj67_3093_c1_435_2018 515
13 3300037466 Ga0395898_0157699 Ga0395898_0157699_322_1956 517
14 3300038443 Ga0395901_0025716 Ga0395901_0025716_1659_3293 517
15 3300046524 Ga0495648_0005225 Ga0495648_0005225_7579_9132 517
16 3300048919 Ga0496116_0000028 Ga0496116_0000028_105742_107358 518
17 3300048925 Ga0496122_0019036 Ga0496122_0019036_166_1782 518
18 3300048926 Ga0496123_0001678 Ga0496123_0001678_27988_29604 518
19 3300048927 Ga0496124_0003121 Ga0496124_0003121_14810_16426 518
20 3300048927 Ga0496124_0003580 Ga0496124_0003580_8046_9662 518
21 3300048928 Ga0496125_0024152 Ga0496125_0024152_3648_5264 518
22 3300048929 Ga0496126_0000079 Ga0496126_0000079_135461_137077 518
23 3300046558 Ga0495633_0000136 Ga0495633_0000136_75313_76914 519
24 3300049585 Ga0501069_0050106 Ga0501069_0050106_242_1888 521
25 3300003771 Ga0055526_1000760 Ga0055526_100076022 522
26 3300003773 Ga0055537_1001489 Ga0055537_10014893 522
27 3300003773 Ga0055537_1002474 Ga0055537_10024743 522
28 3300009177 Ga0105248_10003049 Ga0105248_1000304919 522
29 3300009177 Ga0105248_10004287 Ga0105248_1000428713 522
30 3300025273 Ga0209673_1007473 Ga0209673_10074733 522
31 3300039437 Ga0436365_0853458 Ga0436365_0853458_2103_3716 522
32 3300048915 Ga0496112_0021605 Ga0496112_0021605_1655_3268 522
33 3300048916 Ga0496113_0071744 Ga0496113_0071744_966_2579 522
34 iso_pu_bacteria 2896184354 2896184364 522
35 iso_pu_bacteria 2896253425 2896254919 523
36 iso_pu_bacteria 2643221588 2643951819 524
37 3300037312 Ga0395899_0013169 Ga0395899_0013169_2666_4309 525
38 3300037418 Ga0395900_0060471 Ga0395900_0060471_1618_3261 525
39 3300037466 Ga0395898_0052866 Ga0395898_0052866_1773_3416 525
40 3300048924 Ga0496121_0016625 Ga0496121_0016625_3381_4958 525
41 3300045051 Ga0451576_0000007 Ga0451576_0000007_752235_753848 526
42 iso_pu_bacteria 2643221563 2643836319 526
43 iso_pu_bacteria 2643221608 2644052795 526
44 iso_pu_bacteria 2775507255 2778123442 526
45 iso_pu_bacteria 2848297114 2848298468 526
46 iso_pu_bacteria 2852653556 2852653930 526
47 iso_pu_bacteria 2852680915 2852682674 526
48 3300009098 Ga0105245_10038453 Ga0105245_100384534 527
49 3300009177 Ga0105248_10000135 Ga0105248_1000013571 527
50 3300025931 Ga0207644_10003017 Ga0207644_100030174 527
51 3300025941 Ga0207711_10015275 Ga0207711_100152753 527
52 3300026088 Ga0207641_10060259 Ga0207641_100602592 527
53 3300026095 Ga0207676_10003007 Ga0207676_100030075 527
54 3300031548 Ga0307408_100097525 Ga0307408_1000975251 527
55 3300031824 Ga0307413_10123956 Ga0307413_101239561 527
56 3300031852 Ga0307410_10055748 Ga0307410_100557482 527
57 3300032005 Ga0307411_10062989 Ga0307411_100629892 527
58 3300032126 Ga0307415_100031961 Ga0307415_1000319613 527
59 3300046525 Ga0495663_0000975 Ga0495663_0000975_3465_5087 527
60 3300046537 Ga0495598_0000610 Ga0495598_0000610_3085_4707 527
61 3300046539 Ga0495621_0000010 Ga0495621_0000010_21196_22818 527
62 3300046558 Ga0495633_0005728 Ga0495633_0005728_3798_5420 527
63 3300048903 Ga0496100_0045726 Ga0496100_0045726_1132_2775 527
64 3300048909 Ga0496106_0003227 Ga0496106_0003227_5622_7265 527
65 3300048910 Ga0496107_0011807 Ga0496107_0011807_437_2080 527
66 3300048913 Ga0496110_0011114 Ga0496110_0011114_4743_6386 527
67 iso_pu_bacteria 2599185354 2600200357 527
68 iso_pu_bacteria 2643221606 2644043449 527
69 iso_pu_bacteria 2643221671 2644393608 527
70 iso_pu_bacteria 2751185897 2753763831 527
71 3300001904 JGI24736J21556_1002014 JGI24736J21556_10020141 528
72 3300005293 Ga0065715_10121438 Ga0065715_101214382 528
73 3300005327 Ga0070658_10000346 Ga0070658_1000034624 528
74 3300005331 Ga0070670_100004563 Ga0070670_1000045631 528
75 3300005331 Ga0070670_100013186 Ga0070670_1000131863 528
76 3300005339 Ga0070660_100000061 Ga0070660_10000006147 528
77 3300005344 Ga0070661_100010200 Ga0070661_1000102002 528
78 3300005353 Ga0070669_100002309 Ga0070669_1000023095 528
79 3300005354 Ga0070675_100009413 Ga0070675_1000094135 528
80 3300005355 Ga0070671_100004238 Ga0070671_1000042386 528
81 3300005355 Ga0070671_100020459 Ga0070671_1000204595 528
82 3300005356 Ga0070674_100007181 Ga0070674_1000071815 528
83 3300005364 Ga0070673_100122880 Ga0070673_1001228801 528
84 3300005457 Ga0070662_100002528 Ga0070662_1000025282 528
85 3300005459 Ga0068867_100012914 Ga0068867_1000129142 528
86 3300005459 Ga0068867_100013381 Ga0068867_1000133814 528
87 3300005543 Ga0070672_100005075 Ga0070672_10000507510 528
88 3300005548 Ga0070665_100041899 Ga0070665_1000418993 528
89 3300005563 Ga0068855_100000318 Ga0068855_10000031835 528
90 3300005578 Ga0068854_100025551 Ga0068854_1000255513 528
91 3300005614 Ga0068856_100102017 Ga0068856_1001020173 528
92 3300005719 Ga0068861_100014384 Ga0068861_1000143845 528
93 3300005844 Ga0068862_100010829 Ga0068862_1000108299 528
94 3300006847 Ga0075431_100040222 Ga0075431_1000402224 528
95 3300009551 Ga0105238_10063284 Ga0105238_100632844 528
96 3300009551 Ga0105238_10170636 Ga0105238_101706362 528
97 3300009553 Ga0105249_10106527 Ga0105249_101065272 528
98 3300013102 Ga0157371_10000458 Ga0157371_1000045854 528
99 3300013306 Ga0163162_10027151 Ga0163162_100271512 528
100 3300013308 Ga0157375_10087888 Ga0157375_100878882 528
101 3300014326 Ga0157380_10002655 Ga0157380_100026555 528
102 3300014326 Ga0157380_10008128 Ga0157380_100081285 528
103 3300017792 Ga0163161_10046782 Ga0163161_100467823 528
104 3300025315 Ga0207697_10001021 Ga0207697_1000102113 528
105 3300025904 Ga0207647_10022445 Ga0207647_100224453 528
106 3300025904 Ga0207647_10051972 Ga0207647_100519722 528
107 3300025909 Ga0207705_10000131 Ga0207705_1000013124 528
108 3300025909 Ga0207705_10003226 Ga0207705_1000322613 528
109 3300025919 Ga0207657_10000181 Ga0207657_1000018128 528
110 3300025919 Ga0207657_10006930 Ga0207657_100069303 528
111 3300025920 Ga0207649_10001955 Ga0207649_100019552 528
112 3300025923 Ga0207681_10054292 Ga0207681_100542922 528
113 3300025924 Ga0207694_10029607 Ga0207694_100296074 528
114 3300025925 Ga0207650_10003163 Ga0207650_1000316311 528
115 3300025925 Ga0207650_10004868 Ga0207650_100048683 528
116 3300025926 Ga0207659_10035773 Ga0207659_100357733 528
117 3300025931 Ga0207644_10009606 Ga0207644_100096064 528
118 3300025933 Ga0207706_10004919 Ga0207706_100049193 528
119 3300025937 Ga0207669_10059755 Ga0207669_100597552 528
120 3300025940 Ga0207691_10020930 Ga0207691_100209303 528
121 3300025940 Ga0207691_10137706 Ga0207691_101377062 528
122 3300025949 Ga0207667_10000282 Ga0207667_1000028215 528
123 3300025949 Ga0207667_10027860 Ga0207667_100278607 528
124 3300025960 Ga0207651_10006159 Ga0207651_100061591 528
125 3300025960 Ga0207651_10039726 Ga0207651_100397262 528
126 3300025972 Ga0207668_10012881 Ga0207668_100128814 528
127 3300025986 Ga0207658_10009999 Ga0207658_100099991 528
128 3300026067 Ga0207678_10007492 Ga0207678_100074926 528
129 3300026089 Ga0207648_10003545 Ga0207648_100035457 528
130 3300026089 Ga0207648_10043276 Ga0207648_100432763 528
131 3300026118 Ga0207675_100003186 Ga0207675_10000318615 528
132 3300027876 Ga0209974_10006494 Ga0209974_100064942 528
133 3300028379 Ga0268266_10046227 Ga0268266_100462273 528
134 3300028380 Ga0268265_10022561 Ga0268265_100225614 528
135 3300031824 Ga0307413_10013512 Ga0307413_100135122 528
136 3300031824 Ga0307413_10035331 Ga0307413_100353313 528
137 3300031852 Ga0307410_10049287 Ga0307410_100492872 528
138 3300031903 Ga0307407_10062180 Ga0307407_100621802 528
139 3300031911 Ga0307412_10058445 Ga0307412_100584452 528
140 3300031995 Ga0307409_100025354 Ga0307409_1000253543 528
141 3300031995 Ga0307409_100057154 Ga0307409_1000571542 528
142 3300032004 Ga0307414_10005482 Ga0307414_100054825 528
143 3300032004 Ga0307414_10015338 Ga0307414_100153383 528
144 3300032005 Ga0307411_10017646 Ga0307411_100176462 528
145 3300032005 Ga0307411_10017807 Ga0307411_100178074 528
146 3300037312 Ga0395899_0011079 Ga0395899_0011079_3385_5016 528
147 3300037466 Ga0395898_0086371 Ga0395898_0086371_477_2123 528
148 3300037471 Ga0395905_0003054 Ga0395905_0003054_9509_11116 528
149 3300037471 Ga0395905_0181388 Ga0395905_0181388_151_1803 528
150 3300038443 Ga0395901_0001182 Ga0395901_0001182_2238_3845 528
151 3300038443 Ga0395901_0182776 Ga0395901_0182776_129_1775 528
152 3300046616 Ga0495668_0005823 Ga0495668_0005823_609_2312 528
153 3300046684 Ga0495669_0005836 Ga0495669_0005836_3210_4850 528
154 3300046684 Ga0495669_0038592 Ga0495669_0038592_148_1851 528
155 3300048911 Ga0496108_0004360 Ga0496108_0004360_4751_6403 528
156 3300048911 Ga0496108_0006530 Ga0496108_0006530_948_2588 528
157 3300048912 Ga0496109_0024508 Ga0496109_0024508_719_2371 528
158 3300048912 Ga0496109_0084654 Ga0496109_0084654_118_1725 528
159 3300048913 Ga0496110_0006209 Ga0496110_0006209_567_2219 528
160 3300048915 Ga0496112_0076839 Ga0496112_0076839_1575_3227 528
161 3300048917 Ga0496114_0048461 Ga0496114_0048461_1340_2947 528
162 3300049654 Ga0501207_001528 Ga0501207_001528_1194_2801 528
163 3300049679 Ga0501249_006567 Ga0501249_006567_292_1899 528
164 3300049687 Ga0501258_001149 Ga0501258_001149_116_1723 528
165 3300053121 Ga0500607_001619 Ga0500607_001619_3002_4600 528
166 iso_pu_bacteria 8057101203 8057103277 528
167 3300005295 Ga0065707_10096989 Ga0065707_100969892 529
168 3300005327 Ga0070658_10000001 Ga0070658_10000001509 529
169 3300005333 Ga0070677_10000121 Ga0070677_1000012118 529
170 3300005339 Ga0070660_100000048 Ga0070660_10000004815 529
171 3300020082 Ga0206353_12066863 Ga0206353_1206686317 529
172 3300021358 Ga0213873_10000015 Ga0213873_1000001563 529
173 3300021384 Ga0213876_10000005 Ga0213876_10000005673 529
174 3300021384 Ga0213876_10001213 Ga0213876_1000121312 529
175 3300025909 Ga0207705_10000002 Ga0207705_100000021370 529
176 3300025919 Ga0207657_10000391 Ga0207657_1000039115 529
177 3300036712 Ga0316584_0017465 Ga0316584_0017465_1453_3045 529
178 3300039437 Ga0436365_0668445 Ga0436365_0668445_15694_17346 529
179 3300039453 Ga0436362_0284509 Ga0436362_0284509_33059_34699 529
180 3300053133 Ga0500655_001426 Ga0500655_001426_976_2601 529
181 3300053157 Ga0500624_000092 Ga0500624_000092_15710_17311 529
182 iso_pu_bacteria 2510917021 2511125726 529
183 iso_pu_bacteria 2512564014 2512645659 529
184 iso_pu_bacteria 2808606401 2809062552 529
185 iso_pu_bacteria 2808606404 2809078764 529
186 iso_pu_bacteria 2808606405 2809082941 529
187 iso_pu_bacteria 2880518877 2880521643 529
188 iso_pu_bacteria 2895880812 2895884265 529
189 iso_pu_bacteria 2919709256 2919709856 529
190 iso_pu_bacteria 8054302542 8054305891 529
191 3300001904 JGI24736J21556_1000415 JGI24736J21556_10004155 530
192 3300001915 JGI24741J21665_1000020 JGI24741J21665_100002029 530
193 3300001979 JGI24740J21852_10003682 JGI24740J21852_100036823 530
194 3300001989 JGI24739J22299_10006253 JGI24739J22299_100062532 530
195 3300001990 JGI24737J22298_10001361 JGI24737J22298_100013619 530
196 3300002067 JGI24735J21928_10000711 JGI24735J21928_100007114 530
197 3300002075 JGI24738J21930_10001330 JGI24738J21930_100013304 530
198 3300003781 Ga0055536_1001571 Ga0055536_10015718 530
199 3300003784 Ga0055534_1005555 Ga0055534_10055553 530
200 3300003791 Ga0055530_10000005 Ga0055530_10000005169 530
201 3300003794 Ga0055531_10004473 Ga0055531_100044735 530
202 3300003794 Ga0055531_10009294 Ga0055531_100092942 530
203 3300005289 Ga0065704_10001918 Ga0065704_1000191816 530
204 3300005295 Ga0065707_10005245 Ga0065707_100052453 530
205 3300005327 Ga0070658_10088700 Ga0070658_100887001 530
206 3300005331 Ga0070670_100001683 Ga0070670_1000016836 530
207 3300005335 Ga0070666_10000589 Ga0070666_1000058919 530
208 3300005339 Ga0070660_100019123 Ga0070660_1000191231 530
209 3300005347 Ga0070668_100000012 Ga0070668_10000001227 530
210 3300005353 Ga0070669_100000042 Ga0070669_10000004224 530
211 3300005355 Ga0070671_100000010 Ga0070671_10000001023 530
212 3300005366 Ga0070659_100000001 Ga0070659_100000001481 530
213 3300005367 Ga0070667_100000038 Ga0070667_10000003827 530
214 3300005455 Ga0070663_100005530 Ga0070663_1000055304 530
215 3300005539 Ga0068853_100002364 Ga0068853_1000023647 530
216 3300005539 Ga0068853_100019489 Ga0068853_1000194893 530
217 3300005539 Ga0068853_100048866 Ga0068853_1000488662 530
218 3300005548 Ga0070665_100000075 Ga0070665_10000007535 530
219 3300005563 Ga0068855_100092728 Ga0068855_1000927283 530
220 3300005564 Ga0070664_100028012 Ga0070664_1000280123 530
221 3300005614 Ga0068856_100007003 Ga0068856_1000070039 530
222 3300005841 Ga0068863_100000318 Ga0068863_10000031827 530
223 3300005841 Ga0068863_100002834 Ga0068863_1000028349 530
224 3300005842 Ga0068858_100001148 Ga0068858_10000114810 530
225 3300005843 Ga0068860_100028188 Ga0068860_1000281882 530
226 3300005844 Ga0068862_100000620 Ga0068862_10000062030 530
227 3300009101 Ga0105247_10006552 Ga0105247_100065523 530
228 3300009101 Ga0105247_10011458 Ga0105247_100114583 530
229 3300009174 Ga0105241_10000478 Ga0105241_1000047828 530
230 3300009545 Ga0105237_10031128 Ga0105237_100311285 530
231 3300009978 Ga0105148_100261 Ga0105148_1002614 530
232 3300013306 Ga0163162_10015345 Ga0163162_100153459 530
233 3300014968 Ga0157379_10005617 Ga0157379_100056177 530
234 3300017792 Ga0163161_10003797 Ga0163161_100037973 530
235 3300025291 Ga0209675_1000245 Ga0209675_100024541 530
236 3300025292 Ga0209676_1000557 Ga0209676_100055746 530
237 3300025292 Ga0209676_1000881 Ga0209676_100088121 530
238 3300025292 Ga0209676_1001901 Ga0209676_10019018 530
239 3300025294 Ga0209025_1034240 Ga0209025_10342402 530
240 3300025298 Ga0209050_1000017 Ga0209050_100001730 530
241 3300025304 Ga0209257_1000113 Ga0209257_10001139 530
242 3300025304 Ga0209257_1001176 Ga0209257_10011763 530
243 3300025304 Ga0209257_1002733 Ga0209257_100273313 530
244 3300025315 Ga0207697_10000004 Ga0207697_1000000429 530
245 3300025900 Ga0207710_10017260 Ga0207710_100172603 530
246 3300025900 Ga0207710_10023328 Ga0207710_100233282 530
247 3300025904 Ga0207647_10022203 Ga0207647_100222033 530
248 3300025909 Ga0207705_10019589 Ga0207705_100195892 530
249 3300025913 Ga0207695_10021776 Ga0207695_100217768 530
250 3300025914 Ga0207671_10025636 Ga0207671_100256361 530
251 3300025919 Ga0207657_10015686 Ga0207657_100156864 530
252 3300025920 Ga0207649_10039189 Ga0207649_100391893 530
253 3300025923 Ga0207681_10000002 Ga0207681_10000002343 530
254 3300025925 Ga0207650_10000969 Ga0207650_1000096916 530
255 3300025926 Ga0207659_10008772 Ga0207659_100087723 530
256 3300025931 Ga0207644_10000002 Ga0207644_10000002341 530
257 3300025932 Ga0207690_10000001 Ga0207690_1000000195 530
258 3300025932 Ga0207690_10000002 Ga0207690_1000000295 530
259 3300025932 Ga0207690_10000003 Ga0207690_1000000395 530
260 3300025932 Ga0207690_10000004 Ga0207690_1000000495 530
261 3300025933 Ga0207706_10014236 Ga0207706_100142364 530
262 3300025940 Ga0207691_10087767 Ga0207691_100877672 530
263 3300025949 Ga0207667_10027494 Ga0207667_100274944 530
264 3300025961 Ga0207712_10005663 Ga0207712_100056635 530
265 3300025972 Ga0207668_10000769 Ga0207668_100007695 530
266 3300025986 Ga0207658_10000029 Ga0207658_1000002927 530
267 3300026023 Ga0207677_10000110 Ga0207677_1000011062 530
268 3300026035 Ga0207703_10009335 Ga0207703_100093353 530
269 3300026041 Ga0207639_10000649 Ga0207639_1000064911 530
270 3300026041 Ga0207639_10001311 Ga0207639_100013118 530
271 3300026067 Ga0207678_10000271 Ga0207678_1000027112 530
272 3300026078 Ga0207702_10000811 Ga0207702_100008112 530
273 3300026088 Ga0207641_10000091 Ga0207641_1000009127 530
274 3300026088 Ga0207641_10002980 Ga0207641_100029808 530
275 3300026116 Ga0207674_10007306 Ga0207674_100073067 530
276 3300026116 Ga0207674_10010461 Ga0207674_100104619 530
277 3300026118 Ga0207675_100001590 Ga0207675_1000015906 530
278 3300026142 Ga0207698_10014014 Ga0207698_100140142 530
279 3300028379 Ga0268266_10000468 Ga0268266_1000046823 530
280 3300028380 Ga0268265_10000260 Ga0268265_1000026044 530
281 3300028380 Ga0268265_10009026 Ga0268265_100090266 530
282 3300028381 Ga0268264_10000010 Ga0268264_10000010557 530
283 3300028381 Ga0268264_10088785 Ga0268264_100887852 530
284 3300031548 Ga0307408_100052891 Ga0307408_1000528911 530
285 3300031731 Ga0307405_10069610 Ga0307405_100696102 530
286 3300031852 Ga0307410_10016554 Ga0307410_100165542 530
287 3300031911 Ga0307412_10001412 Ga0307412_100014128 530
288 3300031911 Ga0307412_10040833 Ga0307412_100408332 530
289 3300032004 Ga0307414_10000230 Ga0307414_1000023029 530
290 3300032004 Ga0307414_10002011 Ga0307414_100020115 530
291 3300032004 Ga0307414_10007276 Ga0307414_100072764 530
292 3300032005 Ga0307411_10061655 Ga0307411_100616552 530
293 3300042116 Ga0450912_000714 Ga0450912_000714_14_1609 530
294 3300046471 Ga0495650_0008074 Ga0495650_0008074_1277_2872 530
295 3300046506 Ga0495583_0000260 Ga0495583_0000260_59819_61522 530
296 3300046513 Ga0495616_0000022 Ga0495616_0000022_47580_49175 530
297 3300046524 Ga0495648_0000026 Ga0495648_0000026_168821_170524 530
298 3300046692 Ga0495671_0000139 Ga0495671_0000139_24975_26678 530
299 3300047469 Ga0495673_0000066 Ga0495673_0000066_24974_26677 530
300 3300048911 Ga0496108_0002029 Ga0496108_0002029_13674_15290 530
301 3300048912 Ga0496109_0014993 Ga0496109_0014993_2900_4495 530
302 3300048913 Ga0496110_0087861 Ga0496110_0087861_100_1716 530
303 3300048915 Ga0496112_0116575 Ga0496112_0116575_525_2162 530
304 3300048924 Ga0496121_0000731 Ga0496121_0000731_31932_33548 530
305 3300048927 Ga0496124_0008108 Ga0496124_0008108_6575_8191 530
306 3300048927 Ga0496124_0128771 Ga0496124_0128771_160_1776 530
307 3300048928 Ga0496125_0006013 Ga0496125_0006013_3604_5220 530
308 3300048928 Ga0496125_0035203 Ga0496125_0035203_1747_3363 530
309 3300049571 Ga0501034_0002130 Ga0501034_0002130_8227_9852 530
310 3300049571 Ga0501034_0053982 Ga0501034_0053982_686_2317 530
311 3300049586 Ga0501070_0018814 Ga0501070_0018814_2760_4403 530
312 3300049663 Ga0501223_001035 Ga0501223_001035_4779_6404 530
313 3300049664 Ga0501224_000028 Ga0501224_000028_47127_48752 530
314 3300049668 Ga0501233_003691 Ga0501233_003691_195_1820 530
315 3300049705 Ga0501225_0001850 Ga0501225_0001850_215_1840 530
316 3300049707 Ga0501234_002566 Ga0501234_002566_235_1860 530
317 3300049853 Ga0501226_000146 Ga0501226_000146_11685_13310 530
318 3300053139 Ga0500568_0000708 Ga0500568_0000708_4779_6425 530
319 3300053139 Ga0500568_0012994 Ga0500568_0012994_781_2382 530
320 3300053151 Ga0500604_0000004 Ga0500604_0000004_87339_88985 530
321 3300053153 Ga0500616_0000195 Ga0500616_0000195_50642_52288 530
322 3300053157 Ga0500624_000012 Ga0500624_000012_92710_94311 530
323 3300053158 Ga0500627_0000126 Ga0500627_0000126_19971_21572 530
324 iso_pu_bacteria 2643221622 2644126664 530
325 iso_pu_bacteria 2738541275 2738711566 530
326 iso_pu_bacteria 2738541301 2738849991 530
327 iso_pu_bacteria 2738541304 2738865720 530
328 iso_pu_bacteria 2738543022 2739298238 530
329 iso_pu_bacteria 2738543033 2739359916 530
330 iso_pu_bacteria 2739367664 2739649106 530
331 iso_pu_bacteria 2739367865 2740027579 530
332 iso_pu_bacteria 2928100450 2928104184 530
333 iso_pu_bacteria 2928959182 2928961649 530
334 3300001915 JGI24741J21665_1002181 JGI24741J21665_10021814 531
335 3300001976 JGI24752J21851_1000014 JGI24752J21851_10000143 531
336 3300001979 JGI24740J21852_10001751 JGI24740J21852_100017514 531
337 3300001979 JGI24740J21852_10005611 JGI24740J21852_100056115 531
338 3300001989 JGI24739J22299_10001047 JGI24739J22299_100010475 531
339 3300001990 JGI24737J22298_10000015 JGI24737J22298_100000153 531
340 3300002067 JGI24735J21928_10001925 JGI24735J21928_100019254 531
341 3300002067 JGI24735J21928_10003716 JGI24735J21928_100037164 531
342 3300002070 JGI24750J21931_1000311 JGI24750J21931_10003115 531
343 3300002074 JGI24748J21848_1000058 JGI24748J21848_100005842 531
344 3300002075 JGI24738J21930_10000387 JGI24738J21930_100003875 531
345 3300002076 JGI24749J21850_1000021 JGI24749J21850_100002128 531
346 3300002239 JGI24034J26672_10000050 JGI24034J26672_100000506 531
347 3300002459 JGI24751J29686_10000192 JGI24751J29686_100001929 531
348 3300005290 Ga0065712_10068171 Ga0065712_1006817114 531
349 3300005295 Ga0065707_10081716 Ga0065707_1008171619 531
350 3300005295 Ga0065707_10084323 Ga0065707_100843232 531
351 3300005327 Ga0070658_10018251 Ga0070658_100182513 531
352 3300005327 Ga0070658_10048053 Ga0070658_100480533 531
353 3300005327 Ga0070658_10069849 Ga0070658_100698491 531
354 3300005329 Ga0070683_100022268 Ga0070683_1000222684 531
355 3300005329 Ga0070683_100071276 Ga0070683_1000712763 531
356 3300005329 Ga0070683_100073958 Ga0070683_1000739583 531
357 3300005330 Ga0070690_100000159 Ga0070690_10000015922 531
358 3300005330 Ga0070690_100034329 Ga0070690_1000343292 531
359 3300005331 Ga0070670_100000031 Ga0070670_10000003123 531
360 3300005331 Ga0070670_100001267 Ga0070670_10000126717 531
361 3300005331 Ga0070670_100008579 Ga0070670_1000085799 531
362 3300005331 Ga0070670_100008763 Ga0070670_1000087632 531
363 3300005331 Ga0070670_100017279 Ga0070670_1000172792 531
364 3300005331 Ga0070670_100108759 Ga0070670_1001087592 531
365 3300005331 Ga0070670_100147018 Ga0070670_1001470181 531
366 3300005334 Ga0068869_100002541 Ga0068869_1000025413 531
367 3300005335 Ga0070666_10000002 Ga0070666_10000002236 531
368 3300005335 Ga0070666_10023181 Ga0070666_100231813 531
369 3300005335 Ga0070666_10070361 Ga0070666_100703612 531
370 3300005338 Ga0068868_100007180 Ga0068868_1000071806 531
371 3300005338 Ga0068868_100102849 Ga0068868_1001028491 531
372 3300005339 Ga0070660_100001167 Ga0070660_10000116719 531
373 3300005339 Ga0070660_100005280 Ga0070660_1000052804 531
374 3300005340 Ga0070689_100064407 Ga0070689_1000644073 531
375 3300005344 Ga0070661_100024164 Ga0070661_1000241643 531
376 3300005344 Ga0070661_100053552 Ga0070661_1000535522 531
377 3300005345 Ga0070692_10013757 Ga0070692_100137573 531
378 3300005347 Ga0070668_100000006 Ga0070668_100000006138 531
379 3300005347 Ga0070668_100003316 Ga0070668_1000033167 531
380 3300005347 Ga0070668_100014071 Ga0070668_1000140715 531
381 3300005353 Ga0070669_100000015 Ga0070669_100000015130 531
382 3300005353 Ga0070669_100000055 Ga0070669_10000005542 531
383 3300005353 Ga0070669_100008852 Ga0070669_1000088522 531
384 3300005353 Ga0070669_100061893 Ga0070669_1000618931 531
385 3300005354 Ga0070675_100000487 Ga0070675_1000004877 531
386 3300005354 Ga0070675_100008232 Ga0070675_10000823210 531
387 3300005355 Ga0070671_100002199 Ga0070671_1000021995 531
388 3300005355 Ga0070671_100004664 Ga0070671_1000046645 531
389 3300005355 Ga0070671_100016348 Ga0070671_1000163484 531
390 3300005355 Ga0070671_100049709 Ga0070671_1000497093 531
391 3300005355 Ga0070671_100157713 Ga0070671_1001577131 531
392 3300005356 Ga0070674_100116314 Ga0070674_1001163141 531
393 3300005364 Ga0070673_100000046 Ga0070673_10000004653 531
394 3300005364 Ga0070673_100000926 Ga0070673_10000092611 531
395 3300005364 Ga0070673_100021743 Ga0070673_1000217433 531
396 3300005365 Ga0070688_100000701 Ga0070688_10000070114 531
397 3300005366 Ga0070659_100000833 Ga0070659_10000083317 531
398 3300005367 Ga0070667_100000003 Ga0070667_10000000395 531
399 3300005367 Ga0070667_100000016 Ga0070667_100000016212 531
400 3300005367 Ga0070667_100000396 Ga0070667_10000039632 531
401 3300005367 Ga0070667_100006418 Ga0070667_1000064187 531
402 3300005367 Ga0070667_100057015 Ga0070667_1000570151 531
403 3300005367 Ga0070667_100112523 Ga0070667_1001125233 531
404 3300005435 Ga0070714_100015883 Ga0070714_1000158835 531
405 3300005456 Ga0070678_100008901 Ga0070678_1000089015 531
406 3300005456 Ga0070678_100039163 Ga0070678_1000391633 531
407 3300005457 Ga0070662_100000391 Ga0070662_10000039116 531
408 3300005457 Ga0070662_100004908 Ga0070662_1000049082 531
409 3300005457 Ga0070662_100005390 Ga0070662_1000053903 531
410 3300005457 Ga0070662_100006946 Ga0070662_1000069462 531
411 3300005457 Ga0070662_100013093 Ga0070662_1000130935 531
412 3300005458 Ga0070681_10021524 Ga0070681_100215246 531
413 3300005459 Ga0068867_100002495 Ga0068867_1000024958 531
414 3300005459 Ga0068867_100018201 Ga0068867_1000182015 531
415 3300005466 Ga0070685_10000023 Ga0070685_1000002312 531
416 3300005535 Ga0070684_100015958 Ga0070684_1000159583 531
417 3300005535 Ga0070684_100032382 Ga0070684_1000323822 531
418 3300005539 Ga0068853_100000764 Ga0068853_10000076418 531
419 3300005539 Ga0068853_100011737 Ga0068853_1000117373 531
420 3300005539 Ga0068853_100038510 Ga0068853_1000385103 531
421 3300005539 Ga0068853_100071790 Ga0068853_1000717902 531
422 3300005543 Ga0070672_100002251 Ga0070672_1000022513 531
423 3300005544 Ga0070686_100000003 Ga0070686_100000003132 531
424 3300005548 Ga0070665_100000036 Ga0070665_100000036102 531
425 3300005548 Ga0070665_100000705 Ga0070665_10000070517 531
426 3300005548 Ga0070665_100017020 Ga0070665_1000170205 531
427 3300005548 Ga0070665_100020609 Ga0070665_1000206098 531
428 3300005563 Ga0068855_100011156 Ga0068855_1000111563 531
429 3300005564 Ga0070664_100001286 Ga0070664_10000128614 531
430 3300005564 Ga0070664_100002719 Ga0070664_10000271916 531
431 3300005564 Ga0070664_100007861 Ga0070664_1000078615 531
432 3300005564 Ga0070664_100027928 Ga0070664_1000279283 531
433 3300005564 Ga0070664_100038260 Ga0070664_1000382603 531
434 3300005577 Ga0068857_100008844 Ga0068857_1000088446 531
435 3300005577 Ga0068857_100061759 Ga0068857_1000617593 531
436 3300005578 Ga0068854_100001685 Ga0068854_10000168513 531
437 3300005578 Ga0068854_100042423 Ga0068854_1000424234 531
438 3300005614 Ga0068856_100023109 Ga0068856_1000231095 531
439 3300005614 Ga0068856_100061441 Ga0068856_1000614413 531
440 3300005616 Ga0068852_100001901 Ga0068852_10000190113 531
441 3300005616 Ga0068852_100019408 Ga0068852_1000194084 531
442 3300005616 Ga0068852_100022300 Ga0068852_1000223003 531
443 3300005617 Ga0068859_100000068 Ga0068859_10000006867 531
444 3300005617 Ga0068859_100003549 Ga0068859_1000035494 531
445 3300005617 Ga0068859_100008593 Ga0068859_10000859310 531
446 3300005617 Ga0068859_100032839 Ga0068859_1000328392 531
447 3300005617 Ga0068859_100051689 Ga0068859_1000516893 531
448 3300005617 Ga0068859_100090863 Ga0068859_1000908631 531
449 3300005617 Ga0068859_100102860 Ga0068859_1001028603 531
450 3300005618 Ga0068864_100000188 Ga0068864_10000018825 531
451 3300005618 Ga0068864_100000248 Ga0068864_10000024823 531
452 3300005618 Ga0068864_100000339 Ga0068864_1000003399 531
453 3300005618 Ga0068864_100006681 Ga0068864_1000066812 531
454 3300005618 Ga0068864_100011537 Ga0068864_1000115373 531
455 3300005618 Ga0068864_100011656 Ga0068864_1000116565 531
456 3300005618 Ga0068864_100011788 Ga0068864_1000117883 531
457 3300005618 Ga0068864_100016371 Ga0068864_1000163713 531
458 3300005719 Ga0068861_100004123 Ga0068861_1000041238 531
459 3300005719 Ga0068861_100026908 Ga0068861_1000269083 531
460 3300005719 Ga0068861_100171550 Ga0068861_1001715501 531
461 3300005841 Ga0068863_100000034 Ga0068863_10000003447 531
462 3300005841 Ga0068863_100000535 Ga0068863_1000005359 531
463 3300005841 Ga0068863_100001229 Ga0068863_1000012292 531
464 3300005841 Ga0068863_100005094 Ga0068863_1000050944 531
465 3300005841 Ga0068863_100006405 Ga0068863_1000064058 531
466 3300005841 Ga0068863_100008251 Ga0068863_10000825111 531
467 3300005841 Ga0068863_100014352 Ga0068863_1000143526 531
468 3300005841 Ga0068863_100088446 Ga0068863_1000884462 531
469 3300005842 Ga0068858_100000688 Ga0068858_10000068824 531
470 3300005842 Ga0068858_100000911 Ga0068858_1000009113 531
471 3300005842 Ga0068858_100001791 Ga0068858_1000017916 531
472 3300005842 Ga0068858_100001843 Ga0068858_10000184322 531
473 3300005842 Ga0068858_100013165 Ga0068858_1000131656 531
474 3300005842 Ga0068858_100017819 Ga0068858_1000178195 531
475 3300005843 Ga0068860_100000001 Ga0068860_100000001238 531
476 3300005843 Ga0068860_100000068 Ga0068860_10000006893 531
477 3300005843 Ga0068860_100000256 Ga0068860_10000025641 531
478 3300005843 Ga0068860_100002412 Ga0068860_10000241215 531
479 3300005843 Ga0068860_100002747 Ga0068860_10000274721 531
480 3300005843 Ga0068860_100018987 Ga0068860_1000189876 531
481 3300005844 Ga0068862_100000006 Ga0068862_100000006177 531
482 3300005844 Ga0068862_100000088 Ga0068862_10000008839 531
483 3300005844 Ga0068862_100000092 Ga0068862_10000009232 531
484 3300005844 Ga0068862_100003636 Ga0068862_1000036367 531
485 3300005844 Ga0068862_100017674 Ga0068862_1000176743 531
486 3300005844 Ga0068862_100022595 Ga0068862_1000225954 531
487 3300005844 Ga0068862_100069418 Ga0068862_1000694182 531
488 3300005985 Ga0081539_10044092 Ga0081539_100440922 531
489 3300006358 Ga0068871_100006907 Ga0068871_1000069075 531
490 3300006358 Ga0068871_100007948 Ga0068871_1000079483 531
491 3300006358 Ga0068871_100009459 Ga0068871_1000094596 531
492 3300006931 Ga0097620_100000068 Ga0097620_10000006867 531
493 3300006931 Ga0097620_100003549 Ga0097620_1000035494 531
494 3300006931 Ga0097620_100008593 Ga0097620_1000085933 531
495 3300006931 Ga0097620_100032839 Ga0097620_1000328392 531
496 3300006931 Ga0097620_100051689 Ga0097620_1000516891 531
497 3300006931 Ga0097620_100090853 Ga0097620_1000908531 531
498 3300006931 Ga0097620_100102867 Ga0097620_1001028673 531
499 3300009093 Ga0105240_10068043 Ga0105240_100680433 531
500 3300009098 Ga0105245_10004863 Ga0105245_100048634 531
501 3300009098 Ga0105245_10012964 Ga0105245_100129643 531
502 3300009101 Ga0105247_10010078 Ga0105247_100100783 531
503 3300009148 Ga0105243_10151945 Ga0105243_101519452 531
504 3300009176 Ga0105242_10077215 Ga0105242_100772152 531
505 3300009177 Ga0105248_10000066 Ga0105248_1000006690 531
506 3300009177 Ga0105248_10000071 Ga0105248_1000007160 531
507 3300009177 Ga0105248_10001282 Ga0105248_100012828 531
508 3300009177 Ga0105248_10013575 Ga0105248_100135758 531
509 3300009177 Ga0105248_10018690 Ga0105248_100186903 531
510 3300009177 Ga0105248_10053518 Ga0105248_100535184 531
511 3300009553 Ga0105249_10000026 Ga0105249_10000026235 531
512 3300009553 Ga0105249_10000100 Ga0105249_1000010032 531
513 3300010375 Ga0105239_10132192 Ga0105239_101321922 531
514 3300013102 Ga0157371_10007513 Ga0157371_1000751310 531
515 3300013104 Ga0157370_10125127 Ga0157370_101251272 531
516 3300013297 Ga0157378_10001242 Ga0157378_1000124216 531
517 3300013297 Ga0157378_10200460 Ga0157378_102004601 531
518 3300013306 Ga0163162_10004777 Ga0163162_1000477711 531
519 3300013306 Ga0163162_10013372 Ga0163162_100133724 531
520 3300013306 Ga0163162_10023002 Ga0163162_100230025 531
521 3300013307 Ga0157372_10004194 Ga0157372_1000419415 531
522 3300013307 Ga0157372_10045540 Ga0157372_100455402 531
523 3300013308 Ga0157375_10055574 Ga0157375_100555743 531
524 3300013308 Ga0157375_10096542 Ga0157375_100965422 531
525 3300014325 Ga0163163_10000995 Ga0163163_100009959 531
526 3300014325 Ga0163163_10002903 Ga0163163_100029034 531
527 3300014325 Ga0163163_10034083 Ga0163163_100340833 531
528 3300014326 Ga0157380_10003323 Ga0157380_1000332313 531
529 3300014326 Ga0157380_10006460 Ga0157380_100064606 531
530 3300014968 Ga0157379_10004123 Ga0157379_100041235 531
531 3300014968 Ga0157379_10027613 Ga0157379_100276131 531
532 3300015690 Ga0183363_1001 Ga0183363_1001339 531
533 3300017792 Ga0163161_10000008 Ga0163161_1000000872 531
534 3300021388 Ga0213875_10000401 Ga0213875_100004019 531
535 3300025223 Ga0207672_1000500 Ga0207672_10005004 531
536 3300025315 Ga0207697_10000250 Ga0207697_1000025022 531
537 3300025711 Ga0207696_1011753 Ga0207696_10117532 531
538 3300025893 Ga0207682_10002256 Ga0207682_100022569 531
539 3300025893 Ga0207682_10050615 Ga0207682_100506151 531
540 3300025900 Ga0207710_10007666 Ga0207710_100076665 531
541 3300025901 Ga0207688_10000994 Ga0207688_100009945 531
542 3300025903 Ga0207680_10000004 Ga0207680_10000004624 531
543 3300025903 Ga0207680_10016625 Ga0207680_100166253 531
544 3300025904 Ga0207647_10000153 Ga0207647_1000015340 531
545 3300025909 Ga0207705_10001553 Ga0207705_1000155315 531
546 3300025909 Ga0207705_10005122 Ga0207705_100051228 531
547 3300025909 Ga0207705_10009316 Ga0207705_100093164 531
548 3300025909 Ga0207705_10013718 Ga0207705_100137183 531
549 3300025909 Ga0207705_10052094 Ga0207705_100520941 531
550 3300025909 Ga0207705_10054965 Ga0207705_100549652 531
551 3300025909 Ga0207705_10070795 Ga0207705_100707952 531
552 3300025912 Ga0207707_10015128 Ga0207707_100151283 531
553 3300025912 Ga0207707_10045508 Ga0207707_100455083 531
554 3300025917 Ga0207660_10004720 Ga0207660_100047208 531
555 3300025919 Ga0207657_10000811 Ga0207657_1000081113 531
556 3300025919 Ga0207657_10009507 Ga0207657_100095079 531
557 3300025919 Ga0207657_10016312 Ga0207657_100163122 531
558 3300025919 Ga0207657_10077244 Ga0207657_100772442 531
559 3300025920 Ga0207649_10006461 Ga0207649_100064613 531
560 3300025920 Ga0207649_10009943 Ga0207649_100099433 531
561 3300025921 Ga0207652_10014430 Ga0207652_100144303 531
562 3300025923 Ga0207681_10000001 Ga0207681_10000001852 531
563 3300025923 Ga0207681_10000069 Ga0207681_1000006942 531
564 3300025923 Ga0207681_10038744 Ga0207681_100387442 531
565 3300025923 Ga0207681_10064571 Ga0207681_100645712 531
566 3300025923 Ga0207681_10064810 Ga0207681_100648101 531
567 3300025925 Ga0207650_10000055 Ga0207650_1000005523 531
568 3300025925 Ga0207650_10001212 Ga0207650_100012128 531
569 3300025925 Ga0207650_10002248 Ga0207650_1000224810 531
570 3300025925 Ga0207650_10003061 Ga0207650_100030613 531
571 3300025925 Ga0207650_10016491 Ga0207650_100164912 531
572 3300025925 Ga0207650_10021723 Ga0207650_100217235 531
573 3300025925 Ga0207650_10024587 Ga0207650_100245874 531
574 3300025925 Ga0207650_10057305 Ga0207650_100573052 531
575 3300025926 Ga0207659_10001482 Ga0207659_1000148210 531
576 3300025926 Ga0207659_10004037 Ga0207659_100040375 531
577 3300025928 Ga0207700_10036947 Ga0207700_100369474 531
578 3300025931 Ga0207644_10000389 Ga0207644_1000038927 531
579 3300025931 Ga0207644_10002973 Ga0207644_100029735 531
580 3300025931 Ga0207644_10004808 Ga0207644_100048087 531
581 3300025931 Ga0207644_10005364 Ga0207644_100053642 531
582 3300025931 Ga0207644_10025852 Ga0207644_100258523 531
583 3300025932 Ga0207690_10004241 Ga0207690_100042413 531
584 3300025932 Ga0207690_10060455 Ga0207690_100604552 531
585 3300025933 Ga0207706_10000194 Ga0207706_1000019421 531
586 3300025933 Ga0207706_10001775 Ga0207706_100017759 531
587 3300025933 Ga0207706_10013591 Ga0207706_100135915 531
588 3300025933 Ga0207706_10014348 Ga0207706_100143486 531
589 3300025933 Ga0207706_10016990 Ga0207706_100169904 531
590 3300025933 Ga0207706_10029595 Ga0207706_100295954 531
591 3300025933 Ga0207706_10053746 Ga0207706_100537463 531
592 3300025936 Ga0207670_10043642 Ga0207670_100436423 531
593 3300025937 Ga0207669_10003957 Ga0207669_100039573 531
594 3300025940 Ga0207691_10003366 Ga0207691_1000336613 531
595 3300025940 Ga0207691_10005114 Ga0207691_1000511414 531
596 3300025941 Ga0207711_10000046 Ga0207711_1000004633 531
597 3300025941 Ga0207711_10002576 Ga0207711_100025764 531
598 3300025941 Ga0207711_10003882 Ga0207711_100038829 531
599 3300025941 Ga0207711_10017997 Ga0207711_100179973 531
600 3300025941 Ga0207711_10029685 Ga0207711_100296853 531
601 3300025941 Ga0207711_10038361 Ga0207711_100383613 531
602 3300025942 Ga0207689_10000094 Ga0207689_1000009459 531
603 3300025944 Ga0207661_10017379 Ga0207661_100173793 531
604 3300025944 Ga0207661_10022719 Ga0207661_100227191 531
605 3300025945 Ga0207679_10002042 Ga0207679_1000204214 531
606 3300025945 Ga0207679_10003444 Ga0207679_1000344410 531
607 3300025945 Ga0207679_10004747 Ga0207679_100047475 531
608 3300025945 Ga0207679_10019755 Ga0207679_100197552 531
609 3300025945 Ga0207679_10022413 Ga0207679_100224133 531
610 3300025949 Ga0207667_10106545 Ga0207667_101065453 531
611 3300025960 Ga0207651_10001348 Ga0207651_100013485 531
612 3300025960 Ga0207651_10006765 Ga0207651_100067653 531
613 3300025960 Ga0207651_10017217 Ga0207651_100172173 531
614 3300025961 Ga0207712_10000001 Ga0207712_10000001498 531
615 3300025961 Ga0207712_10000008 Ga0207712_10000008100 531
616 3300025961 Ga0207712_10042891 Ga0207712_100428912 531
617 3300025972 Ga0207668_10000060 Ga0207668_100000603 531
618 3300025972 Ga0207668_10000110 Ga0207668_1000011010 531
619 3300025981 Ga0207640_10008015 Ga0207640_100080153 531
620 3300025981 Ga0207640_10009891 Ga0207640_100098915 531
621 3300025986 Ga0207658_10000002 Ga0207658_10000002995 531
622 3300025986 Ga0207658_10000213 Ga0207658_1000021358 531
623 3300025986 Ga0207658_10001284 Ga0207658_1000128416 531
624 3300025986 Ga0207658_10005201 Ga0207658_1000520111 531
625 3300025986 Ga0207658_10065107 Ga0207658_100651072 531
626 3300025986 Ga0207658_10080325 Ga0207658_100803252 531
627 3300025986 Ga0207658_10172413 Ga0207658_101724132 531
628 3300026023 Ga0207677_10015525 Ga0207677_100155252 531
629 3300026023 Ga0207677_10042819 Ga0207677_100428193 531
630 3300026035 Ga0207703_10000717 Ga0207703_1000071712 531
631 3300026035 Ga0207703_10001432 Ga0207703_1000143221 531
632 3300026035 Ga0207703_10005684 Ga0207703_1000568410 531
633 3300026035 Ga0207703_10007899 Ga0207703_100078995 531
634 3300026035 Ga0207703_10008344 Ga0207703_100083447 531
635 3300026035 Ga0207703_10008355 Ga0207703_100083553 531
636 3300026041 Ga0207639_10001653 Ga0207639_1000165310 531
637 3300026041 Ga0207639_10007752 Ga0207639_100077526 531
638 3300026041 Ga0207639_10029754 Ga0207639_100297543 531
639 3300026041 Ga0207639_10095058 Ga0207639_100950582 531
640 3300026067 Ga0207678_10000587 Ga0207678_1000058731 531
641 3300026067 Ga0207678_10004806 Ga0207678_100048065 531
642 3300026067 Ga0207678_10011154 Ga0207678_100111545 531
643 3300026078 Ga0207702_10010616 Ga0207702_100106169 531
644 3300026078 Ga0207702_10041239 Ga0207702_100412393 531
645 3300026078 Ga0207702_10180157 Ga0207702_101801571 531
646 3300026088 Ga0207641_10000057 Ga0207641_1000005746 531
647 3300026088 Ga0207641_10000342 Ga0207641_100003424 531
648 3300026088 Ga0207641_10002687 Ga0207641_1000268713 531
649 3300026088 Ga0207641_10003152 Ga0207641_100031524 531
650 3300026088 Ga0207641_10007862 Ga0207641_1000786210 531
651 3300026089 Ga0207648_10000104 Ga0207648_1000010449 531
652 3300026089 Ga0207648_10002737 Ga0207648_1000273724 531
653 3300026089 Ga0207648_10018393 Ga0207648_100183934 531
654 3300026095 Ga0207676_10000004 Ga0207676_10000004144 531
655 3300026095 Ga0207676_10000184 Ga0207676_1000018437 531
656 3300026095 Ga0207676_10000604 Ga0207676_1000060414 531
657 3300026095 Ga0207676_10002954 Ga0207676_100029543 531
658 3300026095 Ga0207676_10003310 Ga0207676_100033105 531
659 3300026095 Ga0207676_10003565 Ga0207676_100035654 531
660 3300026095 Ga0207676_10035653 Ga0207676_100356532 531
661 3300026116 Ga0207674_10001996 Ga0207674_1000199615 531
662 3300026116 Ga0207674_10008119 Ga0207674_1000811915 531
663 3300026116 Ga0207674_10008156 Ga0207674_1000815614 531
664 3300026116 Ga0207674_10013773 Ga0207674_100137738 531
665 3300026118 Ga0207675_100000435 Ga0207675_10000043533 531
666 3300026118 Ga0207675_100000818 Ga0207675_10000081824 531
667 3300026118 Ga0207675_100019269 Ga0207675_1000192693 531
668 3300026118 Ga0207675_100042911 Ga0207675_1000429113 531
669 3300026121 Ga0207683_10042498 Ga0207683_100424983 531
670 3300026142 Ga0207698_10019539 Ga0207698_100195393 531
671 3300026142 Ga0207698_10022477 Ga0207698_100224772 531
672 3300028379 Ga0268266_10000042 Ga0268266_10000042237 531
673 3300028379 Ga0268266_10000133 Ga0268266_1000013390 531
674 3300028379 Ga0268266_10004851 Ga0268266_100048515 531
675 3300028379 Ga0268266_10010333 Ga0268266_100103333 531
676 3300028380 Ga0268265_10000002 Ga0268265_10000002902 531
677 3300028380 Ga0268265_10000091 Ga0268265_1000009175 531
678 3300028380 Ga0268265_10000145 Ga0268265_1000014529 531
679 3300028380 Ga0268265_10001372 Ga0268265_100013724 531
680 3300028380 Ga0268265_10003169 Ga0268265_100031695 531
681 3300028380 Ga0268265_10011653 Ga0268265_100116533 531
682 3300028380 Ga0268265_10014104 Ga0268265_100141043 531
683 3300028381 Ga0268264_10000006 Ga0268264_10000006624 531
684 3300028381 Ga0268264_10000087 Ga0268264_10000087214 531
685 3300028381 Ga0268264_10000103 Ga0268264_10000103138 531
686 3300028381 Ga0268264_10000425 Ga0268264_1000042573 531
687 3300028381 Ga0268264_10001804 Ga0268264_100018045 531
688 3300031616 Ga0307508_10005528 Ga0307508_100055283 531
689 3300031731 Ga0307405_10010703 Ga0307405_100107034 531
690 3300031824 Ga0307413_10001042 Ga0307413_100010422 531
691 3300031824 Ga0307413_10012378 Ga0307413_100123784 531
692 3300031852 Ga0307410_10004118 Ga0307410_100041183 531
693 3300031852 Ga0307410_10052350 Ga0307410_100523502 531
694 3300031852 Ga0307410_10055785 Ga0307410_100557852 531
695 3300031901 Ga0307406_10010899 Ga0307406_100108991 531
696 3300031901 Ga0307406_10055147 Ga0307406_100551472 531
697 3300031903 Ga0307407_10077002 Ga0307407_100770021 531
698 3300031911 Ga0307412_10003919 Ga0307412_100039199 531
699 3300031911 Ga0307412_10056319 Ga0307412_100563192 531
700 3300031995 Ga0307409_100010865 Ga0307409_1000108653 531
701 3300032002 Ga0307416_100005969 Ga0307416_1000059699 531
702 3300032002 Ga0307416_100021093 Ga0307416_1000210931 531
703 3300032002 Ga0307416_100130056 Ga0307416_1001300562 531
704 3300032002 Ga0307416_100144250 Ga0307416_1001442502 531
705 3300032004 Ga0307414_10065819 Ga0307414_100658192 531
706 3300032004 Ga0307414_10069197 Ga0307414_100691972 531
707 3300032005 Ga0307411_10015806 Ga0307411_100158062 531
708 3300032005 Ga0307411_10049763 Ga0307411_100497633 531
709 3300032126 Ga0307415_100001168 Ga0307415_1000011688 531
710 3300032126 Ga0307415_100029330 Ga0307415_1000293301 531
711 3300033180 Ga0307510_10003707 Ga0307510_100037073 531
712 3300035170 Ga0373943_0003208 Ga0373943_0003208_2419_4059 531
713 3300035692 Ga0373935_0027403 Ga0373935_0027403_824_2461 531
714 3300035692 Ga0373935_0096905 Ga0373935_0096905_247_1887 531
715 3300035725 Ga0373947_0047947 Ga0373947_0047947_777_2417 531
716 3300037312 Ga0395899_0002090 Ga0395899_0002090_12057_13700 531
717 3300037312 Ga0395899_0114950 Ga0395899_0114950_31_1668 531
718 3300037418 Ga0395900_0004149 Ga0395900_0004149_5994_7637 531
719 3300037418 Ga0395900_0031168 Ga0395900_0031168_1951_3666 531
720 3300037418 Ga0395900_0032675 Ga0395900_0032675_2356_3999 531
721 3300037418 Ga0395900_0073994 Ga0395900_0073994_396_2096 531
722 3300037466 Ga0395898_0012526 Ga0395898_0012526_3701_5344 531
723 3300037466 Ga0395898_0017336 Ga0395898_0017336_5174_6817 531
724 3300037466 Ga0395898_0076029 Ga0395898_0076029_406_2121 531
725 3300037471 Ga0395905_0000193 Ga0395905_0000193_64264_65901 531
726 3300037471 Ga0395905_0004969 Ga0395905_0004969_10000_11643 531
727 3300037471 Ga0395905_0029464 Ga0395905_0029464_2864_4507 531
728 3300037471 Ga0395905_0089060 Ga0395905_0089060_1202_2854 531
729 3300037471 Ga0395905_0109362 Ga0395905_0109362_20_1720 531
730 3300037853 Ga0436364_0484549 Ga0436364_0484549_25718_27328 531
731 3300038443 Ga0395901_0004785 Ga0395901_0004785_4520_6163 531
732 3300038443 Ga0395901_0062262 Ga0395901_0062262_1976_3616 531
733 3300038443 Ga0395901_0085298 Ga0395901_0085298_1236_2879 531
734 3300038443 Ga0395901_0179426 Ga0395901_0179426_226_1824 531
735 3300044693 Ga0466961_0009058 Ga0466961_0009058_4344_6041 531
736 3300044694 Ga0466963_0012590 Ga0466963_0012590_2517_4214 531
737 3300044719 Ga0466971_0002752 Ga0466971_0002752_5303_7000 531
738 3300045836 Ga0466958_0001341 Ga0466958_0001341_4954_6651 531
739 3300045976 Ga0466967_0128101 Ga0466967_0128101_471_2168 531
740 3300046507 Ga0495606_0000235 Ga0495606_0000235_72319_73929 531
741 3300046530 Ga0495654_0000194 Ga0495654_0000194_52949_54571 531
742 3300046539 Ga0495621_0007030 Ga0495621_0007030_884_2524 531
743 3300046616 Ga0495668_0007759 Ga0495668_0007759_1107_2729 531
744 3300046660 Ga0495625_0010834 Ga0495625_0010834_2429_4036 531
745 3300046691 Ga0495670_0000004 Ga0495670_0000004_249494_251110 531
746 3300047472 Ga0495686_0025230 Ga0495686_0025230_882_2480 531
747 3300048905 Ga0496102_0000043 Ga0496102_0000043_146393_147991 531
748 3300048905 Ga0496102_0004522 Ga0496102_0004522_9643_11241 531
749 3300048906 Ga0496103_0000133 Ga0496103_0000133_41211_42809 531
750 3300048906 Ga0496103_0013050 Ga0496103_0013050_2285_3883 531
751 3300048909 Ga0496106_0042593 Ga0496106_0042593_1679_3277 531
752 3300048910 Ga0496107_0007192 Ga0496107_0007192_614_2320 531
753 3300048910 Ga0496107_0071001 Ga0496107_0071001_450_2081 531
754 3300048911 Ga0496108_0008130 Ga0496108_0008130_6301_7941 531
755 3300048912 Ga0496109_0004600 Ga0496109_0004600_6361_8001 531
756 3300048913 Ga0496110_0003943 Ga0496110_0003943_3897_5531 531
757 3300048913 Ga0496110_0006236 Ga0496110_0006236_5005_6645 531
758 3300048914 Ga0496111_0013500 Ga0496111_0013500_3918_5552 531
759 3300048914 Ga0496111_0023348 Ga0496111_0023348_1432_3138 531
760 3300048914 Ga0496111_0114788 Ga0496111_0114788_334_1974 531
761 3300048915 Ga0496112_0014138 Ga0496112_0014138_3297_5003 531
762 3300048915 Ga0496112_0062776 Ga0496112_0062776_1381_3021 531
763 3300048916 Ga0496113_0040762 Ga0496113_0040762_61_1701 531
764 3300048917 Ga0496114_0020555 Ga0496114_0020555_2838_4472 531
765 3300048917 Ga0496114_0051260 Ga0496114_0051260_1207_2907 531
766 3300048919 Ga0496116_0000682 Ga0496116_0000682_32494_34092 531
767 3300048920 Ga0496117_0000104 Ga0496117_0000104_146393_147991 531
768 3300048920 Ga0496117_0021921 Ga0496117_0021921_2284_3882 531
769 3300048921 Ga0496118_0000080 Ga0496118_0000080_41211_42809 531
770 3300048924 Ga0496121_0001018 Ga0496121_0001018_44135_45829 531
771 3300048927 Ga0496124_0000093 Ga0496124_0000093_41211_42809 531
772 3300049162 Ga0501307_002712 Ga0501307_002712_18_1622 531
773 3300049513 Ga0501290_000042 Ga0501290_000042_8809_10455 531
774 3300049515 Ga0501292_000005 Ga0501292_000005_88781_90427 531
775 3300049517 Ga0501294_000049 Ga0501294_000049_2764_4410 531
776 3300049533 Ga0501317_002272 Ga0501317_002272_71_1717 531
777 3300049653 Ga0501206_000476 Ga0501206_000476_2658_4304 531
778 3300049662 Ga0501222_000183 Ga0501222_000183_937_2583 531
779 3300049663 Ga0501223_000205 Ga0501223_000205_7568_9214 531
780 3300049665 Ga0501227_002874 Ga0501227_002874_951_2597 531
781 3300049669 Ga0501235_001607 Ga0501235_001607_2238_3884 531
782 3300049679 Ga0501249_000294 Ga0501249_000294_2894_4498 531
783 3300049686 Ga0501257_000016 Ga0501257_000016_19495_21114 531
784 3300049704 Ga0501221_000663 Ga0501221_000663_2513_4159 531
785 3300049705 Ga0501225_0001120 Ga0501225_0001120_3425_5071 531
786 3300049775 Ga0501279_000020 Ga0501279_000020_26329_27975 531
787 3300049776 Ga0501280_000025 Ga0501280_000025_31699_33345 531
788 3300049778 Ga0501282_000036 Ga0501282_000036_5955_7601 531
789 3300053087 Ga0500643_000523 Ga0500643_000523_5646_7244 531
790 3300053087 Ga0500643_007597 Ga0500643_007597_771_2381 531
791 3300053116 Ga0500592_000074 Ga0500592_000074_9209_10807 531
792 3300053140 Ga0500573_0000019 Ga0500573_0000019_62262_63881 531
793 3300053153 Ga0500616_0003996 Ga0500616_0003996_6748_8346 531
794 3300053158 Ga0500627_0000254 Ga0500627_0000254_9571_11169 531
795 3300053158 Ga0500627_0000423 Ga0500627_0000423_2498_4120 531
796 3300059493 Ga0587077_005217 Ga0587077_005217_71_1669 531
797 3300061719 Ga0466962_0002983 Ga0466962_0002983_2589_4286 531
798 3300005578 Ga0068854_100000494 Ga0068854_10000049412 532
799 3300025981 Ga0207640_10001024 Ga0207640_1000102412 532
800 3300032005 Ga0307411_10059882 Ga0307411_100598823 532
801 3300032005 Ga0307411_10105305 Ga0307411_101053051 532
802 3300032126 Ga0307415_100021846 Ga0307415_1000218464 532
803 3300048090 Ga0495615_0000025 Ga0495615_0000025_11716_13320 532
804 3300048925 Ga0496122_0005810 Ga0496122_0005810_135_1739 532
805 3300048926 Ga0496123_0009221 Ga0496123_0009221_7164_8768 532
806 2162886007 SwRhRL2b_contig_878851 SwRhRL2b_0744.00004110 533
807 3300002459 JGI24751J29686_10000080 JGI24751J29686_1000008020 533
808 3300005289 Ga0065704_10000191 Ga0065704_10000191257 533
809 3300005327 Ga0070658_10003793 Ga0070658_100037933 533
810 3300005327 Ga0070658_10049173 Ga0070658_100491732 533
811 3300005335 Ga0070666_10009729 Ga0070666_100097294 533
812 3300005353 Ga0070669_100001258 Ga0070669_10000125818 533
813 3300005353 Ga0070669_100002547 Ga0070669_1000025474 533
814 3300005355 Ga0070671_100000066 Ga0070671_10000006644 533
815 3300005455 Ga0070663_100032815 Ga0070663_1000328151 533
816 3300005457 Ga0070662_100010219 Ga0070662_1000102195 533
817 3300005548 Ga0070665_100000107 Ga0070665_10000010788 533
818 3300005548 Ga0070665_100027294 Ga0070665_1000272943 533
819 3300005563 Ga0068855_100007587 Ga0068855_10000758711 533
820 3300005618 Ga0068864_100003036 Ga0068864_1000030368 533
821 3300005841 Ga0068863_100001802 Ga0068863_1000018025 533
822 3300005841 Ga0068863_100033388 Ga0068863_1000333882 533
823 3300005841 Ga0068863_100064667 Ga0068863_1000646671 533
824 3300005842 Ga0068858_100056971 Ga0068858_1000569711 533
825 3300005843 Ga0068860_100000008 Ga0068860_100000008173 533
826 3300005843 Ga0068860_100012538 Ga0068860_10001253810 533
827 3300006038 Ga0075365_10010228 Ga0075365_100102283 533
828 3300006042 Ga0075368_10000074 Ga0075368_100000743 533
829 3300006048 Ga0075363_100009825 Ga0075363_1000098253 533
830 3300006051 Ga0075364_10017883 Ga0075364_100178832 533
831 3300006051 Ga0075364_10026599 Ga0075364_100265993 533
832 3300006177 Ga0075362_10009768 Ga0075362_100097683 533
833 3300006178 Ga0075367_10001673 Ga0075367_1000167310 533
834 3300006178 Ga0075367_10005332 Ga0075367_100053323 533
835 3300006186 Ga0075369_10006044 Ga0075369_100060443 533
836 3300006353 Ga0075370_10038986 Ga0075370_100389863 533
837 3300009147 Ga0114129_10033552 Ga0114129_100335523 533
838 3300011119 Ga0105246_10000273 Ga0105246_1000027330 533
839 3300025229 Ga0209147_101541 Ga0209147_1015416 533
840 3300025735 Ga0207713_1001941 Ga0207713_100194113 533
841 3300025909 Ga0207705_10000537 Ga0207705_1000053716 533
842 3300025921 Ga0207652_10012124 Ga0207652_100121243 533
843 3300025923 Ga0207681_10009746 Ga0207681_100097462 533
844 3300025923 Ga0207681_10025053 Ga0207681_100250533 533
845 3300025931 Ga0207644_10000087 Ga0207644_1000008732 533
846 3300025931 Ga0207644_10000340 Ga0207644_100003407 533
847 3300025933 Ga0207706_10001611 Ga0207706_100016114 533
848 3300025941 Ga0207711_10012213 Ga0207711_100122133 533
849 3300025949 Ga0207667_10031460 Ga0207667_100314604 533
850 3300025986 Ga0207658_10009836 Ga0207658_100098367 533
851 3300025986 Ga0207658_10025001 Ga0207658_100250012 533
852 3300026035 Ga0207703_10004575 Ga0207703_100045756 533
853 3300026035 Ga0207703_10025377 Ga0207703_100253773 533
854 3300026035 Ga0207703_10087942 Ga0207703_100879423 533
855 3300026067 Ga0207678_10017387 Ga0207678_100173871 533
856 3300026088 Ga0207641_10000102 Ga0207641_1000010296 533
857 3300026088 Ga0207641_10029253 Ga0207641_100292532 533
858 3300027866 Ga0209813_10000093 Ga0209813_100000938 533
859 3300028379 Ga0268266_10000354 Ga0268266_100003543 533
860 3300028379 Ga0268266_10018696 Ga0268266_100186964 533
861 3300028380 Ga0268265_10012998 Ga0268265_100129984 533
862 3300028381 Ga0268264_10000018 Ga0268264_10000018360 533
863 3300028381 Ga0268264_10002419 Ga0268264_1000241916 533
864 3300028381 Ga0268264_10010046 Ga0268264_100100461 533
865 3300028381 Ga0268264_10046251 Ga0268264_100462511 533
866 3300031616 Ga0307508_10080130 Ga0307508_100801303 533
867 3300046453 Ga0495627_000167 Ga0495627_000167_61818_63419 533
868 3300046453 Ga0495627_000217 Ga0495627_000217_27733_29343 533
869 3300046471 Ga0495650_0000559 Ga0495650_0000559_45327_46937 533
870 3300046500 Ga0495596_0000233 Ga0495596_0000233_9794_11527 533
871 3300046501 Ga0495607_0015908 Ga0495607_0015908_531_2138 533
872 3300046507 Ga0495606_0035039 Ga0495606_0035039_294_1910 533
873 3300046512 Ga0495610_0000030 Ga0495610_0000030_123108_124718 533
874 3300046512 Ga0495610_0000127 Ga0495610_0000127_56519_58162 533
875 3300046519 Ga0495632_0000076 Ga0495632_0000076_1507_3153 533
876 3300046519 Ga0495632_0021408 Ga0495632_0021408_483_2099 533
877 3300046520 Ga0495637_0002289 Ga0495637_0002289_1510_3156 533
878 3300046522 Ga0495643_0000009 Ga0495643_0000009_30617_32263 533
879 3300046522 Ga0495643_0000746 Ga0495643_0000746_32007_33614 533
880 3300046522 Ga0495643_0006640 Ga0495643_0006640_1968_3575 533
881 3300046525 Ga0495663_0000023 Ga0495663_0000023_97969_99615 533
882 3300046538 Ga0495609_0030341 Ga0495609_0030341_290_2023 533
883 3300046558 Ga0495633_0001163 Ga0495633_0001163_13995_15641 533
884 3300046660 Ga0495625_0034320 Ga0495625_0034320_171_1904 533
885 3300046692 Ga0495671_0000013 Ga0495671_0000013_30617_32263 533
886 3300047470 Ga0495681_0000011 Ga0495681_0000011_124778_126388 533
887 3300047470 Ga0495681_0000042 Ga0495681_0000042_76798_78441 533
888 3300047470 Ga0495681_0002227 Ga0495681_0002227_7538_9184 533
889 3300048091 Ga0495626_0012404 Ga0495626_0012404_2340_3956 533
890 3300048903 Ga0496100_0019893 Ga0496100_0019893_817_2658 533
891 3300048905 Ga0496102_0038873 Ga0496102_0038873_959_2581 533
892 3300048906 Ga0496103_0009525 Ga0496103_0009525_2022_3644 533
893 3300048907 Ga0496104_0017309 Ga0496104_0017309_1532_3154 533
894 3300048908 Ga0496105_0005919 Ga0496105_0005919_1220_2821 533
895 3300048908 Ga0496105_0099749 Ga0496105_0099749_433_2055 533
896 3300048909 Ga0496106_0002700 Ga0496106_0002700_6458_8299 533
897 3300048910 Ga0496107_0012495 Ga0496107_0012495_368_2209 533
898 3300048911 Ga0496108_0044071 Ga0496108_0044071_794_2635 533
899 3300048912 Ga0496109_0008938 Ga0496109_0008938_1073_2695 533
900 3300048914 Ga0496111_0014957 Ga0496111_0014957_1002_2624 533
901 3300048916 Ga0496113_0003327 Ga0496113_0003327_3648_5270 533
902 3300048918 Ga0496115_0000504 Ga0496115_0000504_28890_30500 533
903 3300048921 Ga0496118_0018225 Ga0496118_0018225_4373_5974 533
904 3300048921 Ga0496118_0025704 Ga0496118_0025704_2179_3792 533
905 3300048924 Ga0496121_0000520 Ga0496121_0000520_59464_61065 533
906 3300048928 Ga0496125_0021035 Ga0496125_0021035_3411_5024 533
907 3300050489 nmdc:mga03683_448_c1 nmdc:mga03683_448_c1_8821_10434 533
908 3300050490 nmdc:mga03n38_15852_c1 nmdc:mga03n38_15852_c1_913_2526 533
909 3300050491 nmdc:mga00v17_12785_c1 nmdc:mga00v17_12785_c1_1807_3423 533
910 3300050491 nmdc:mga00v17_7556_c1 nmdc:mga00v17_7556_c1_2507_4120 533
911 3300050492 nmdc:mga0yw44_9045_c1 nmdc:mga0yw44_9045_c1_3376_4989 533
912 3300050494 nmdc:mga06z11_168_c1 nmdc:mga06z11_168_c1_8826_10427 533
913 3300050494 nmdc:mga06z11_482_c1 nmdc:mga06z11_482_c1_316_1929 533
914 3300050495 nmdc:mga04h51_189_c1 nmdc:mga04h51_189_c1_6425_8026 533
915 3300050496 nmdc:mga07m45_55_c1 nmdc:mga07m45_55_c1_19999_21612 533
916 3300050516 nmdc:mga0sz30_15843_c1 nmdc:mga0sz30_15843_c1_579_2192 533
917 3300053087 Ga0500643_000001 Ga0500643_000001_739911_741512 533
918 3300053104 Ga0500556_0000040 Ga0500556_0000040_30797_32434 533
919 3300053130 Ga0500642_0000003 Ga0500642_0000003_158100_159737 533
920 3300053153 Ga0500616_0000893 Ga0500616_0000893_20112_21713 533
921 3300053730 Ga0500645_002312 Ga0500645_002312_2253_3890 533
922 iso_pu_bacteria 2818991438 2819553072 533
923 2162886007 SwRhRL2b_contig_2381042 SwRhRL2b_0606.00001490 534
924 3300000043 ARcpr5yngRDRAFT_c001944 ARcpr5yngRDRAFT_0019441 534
925 3300002773 JGI25152J39213_1005835 JGI25152J39213_10058352 534
926 3300002774 JGI25150J39212_1000319 JGI25150J39212_100031915 534
927 3300003215 JGI25153J46596_10000999 JGI25153J46596_100009995 534
928 3300003215 JGI25153J46596_10012183 JGI25153J46596_100121831 534
929 3300003773 Ga0055537_1000317 Ga0055537_100031718 534
930 3300003775 Ga0055524_1000149 Ga0055524_100014976 534
931 3300003791 Ga0055530_10000060 Ga0055530_1000006039 534
932 3300003792 Ga0055540_1004881 Ga0055540_10048814 534
933 3300003794 Ga0055531_10000049 Ga0055531_1000004953 534
934 3300003794 Ga0055531_10007837 Ga0055531_100078375 534
935 3300005262 Ga0065165_1001158 Ga0065165_10011583 534
936 3300005262 Ga0065165_1002598 Ga0065165_10025982 534
937 3300005289 Ga0065704_10002532 Ga0065704_100025326 534
938 3300005289 Ga0065704_10070424 Ga0065704_1007042411 534
939 3300005347 Ga0070668_100013778 Ga0070668_1000137781 534
940 3300005353 Ga0070669_100002274 Ga0070669_1000022743 534
941 3300005355 Ga0070671_100034019 Ga0070671_1000340193 534
942 3300005367 Ga0070667_100002247 Ga0070667_10000224715 534
943 3300005548 Ga0070665_100020206 Ga0070665_1000202064 534
944 3300005719 Ga0068861_100000968 Ga0068861_10000096811 534
945 3300005842 Ga0068858_100015659 Ga0068858_1000156593 534
946 3300005843 Ga0068860_100039618 Ga0068860_1000396183 534
947 3300005844 Ga0068862_100018008 Ga0068862_1000180084 534
948 3300006058 Ga0075432_10008434 Ga0075432_100084343 534
949 3300006931 Ga0097620_100015011 Ga0097620_1000150118 534
950 3300009092 Ga0105250_10001326 Ga0105250_1000132611 534
951 3300009177 Ga0105248_10072624 Ga0105248_100726242 534
952 3300013306 Ga0163162_10022616 Ga0163162_100226163 534
953 3300025245 Ga0207425_1000022 Ga0207425_1000022295 534
954 3300025258 Ga0209129_1000573 Ga0209129_100057314 534
955 3300025263 Ga0209565_1000010 Ga0209565_1000010250 534
956 3300025263 Ga0209565_1000099 Ga0209565_100009987 534
957 3300025273 Ga0209673_1001990 Ga0209673_100199012 534
958 3300025292 Ga0209676_1014918 Ga0209676_10149183 534
959 3300025294 Ga0209025_1001210 Ga0209025_100121018 534
960 3300025297 Ga0209758_1000004 Ga0209758_1000004922 534
961 3300025297 Ga0209758_1016223 Ga0209758_10162233 534
962 3300025298 Ga0209050_1000001 Ga0209050_10000012922 534
963 3300025298 Ga0209050_1000010 Ga0209050_1000010548 534
964 3300025299 Ga0209256_1000034 Ga0209256_1000034106 534
965 3300025303 Ga0209051_1000450 Ga0209051_100045019 534
966 3300025304 Ga0209257_1000009 Ga0209257_1000009568 534
967 3300025304 Ga0209257_1000872 Ga0209257_100087225 534
968 3300025304 Ga0209257_1000921 Ga0209257_100092126 534
969 3300025304 Ga0209257_1006958 Ga0209257_10069588 534
970 3300025735 Ga0207713_1010814 Ga0207713_10108141 534
971 3300025931 Ga0207644_10007241 Ga0207644_100072415 534
972 3300025941 Ga0207711_10016234 Ga0207711_100162343 534
973 3300025972 Ga0207668_10018603 Ga0207668_100186031 534
974 3300025972 Ga0207668_10019497 Ga0207668_100194973 534
975 3300025986 Ga0207658_10001650 Ga0207658_1000165015 534
976 3300026035 Ga0207703_10016697 Ga0207703_100166972 534
977 3300026118 Ga0207675_100000016 Ga0207675_10000001698 534
978 3300027907 Ga0207428_10046362 Ga0207428_100463621 534
979 3300028379 Ga0268266_10008187 Ga0268266_100081873 534
980 3300028379 Ga0268266_10137207 Ga0268266_101372072 534
981 3300028380 Ga0268265_10004650 Ga0268265_100046504 534
982 3300028381 Ga0268264_10028009 Ga0268264_100280093 534
983 3300041410 Ga0439461_0000364 Ga0439461_0000364_1610_3223 534
984 3300041413 Ga0439465_0000704 Ga0439465_0000704_3728_5341 534
985 3300041413 Ga0439465_0012388 Ga0439465_0012388_516_2129 534
986 3300042006 Ga0439432_001242 Ga0439432_001242_7141_8754 534
987 3300042014 Ga0439457_004158 Ga0439457_004158_35_1648 534
988 3300042015 Ga0439462_0008277 Ga0439462_0008277_361_1974 534
989 3300042435 Ga0439434_0005349 Ga0439434_0005349_525_2138 534
990 3300046616 Ga0495668_0000004 Ga0495668_0000004_397289_398929 534
991 3300046660 Ga0495625_0000729 Ga0495625_0000729_14837_16477 534
992 3300048905 Ga0496102_0000998 Ga0496102_0000998_21898_23502 534
993 3300048906 Ga0496103_0000201 Ga0496103_0000201_21767_23371 534
994 3300048907 Ga0496104_0000078 Ga0496104_0000078_66548_68152 534
995 3300048908 Ga0496105_0000241 Ga0496105_0000241_30593_32197 534
996 3300048920 Ga0496117_0003203 Ga0496117_0003203_14513_16117 534
997 3300048922 Ga0496119_0000114 Ga0496119_0000114_66548_68152 534
998 3300048923 Ga0496120_0000266 Ga0496120_0000266_31341_32945 534
999 3300048924 Ga0496121_0000021 Ga0496121_0000021_384782_386476 534
1000 3300048925 Ga0496122_0005756 Ga0496122_0005756_3485_5089 534
1001 3300048926 Ga0496123_0017201 Ga0496123_0017201_46_1650 534
1002 3300048927 Ga0496124_0004225 Ga0496124_0004225_4308_5912 534
1003 3300048929 Ga0496126_0000173 Ga0496126_0000173_71249_72853 534
1004 3300048929 Ga0496126_0005189 Ga0496126_0005189_7560_9176 534
1005 3300049569 Ga0501032_0024236 Ga0501032_0024236_2513_4144 534
1006 3300049572 Ga0501036_0010046 Ga0501036_0010046_1472_3103 534
1007 3300049573 Ga0501037_0014284 Ga0501037_0014284_4019_5650 534
1008 3300049823 Ga0501044_0013271 Ga0501044_0013271_5840_7456 534
1009 3300050493 nmdc:mga0k408_8774_c1 nmdc:mga0k408_8774_c1_2846_4450 534
1010 3300053087 Ga0500643_000167 Ga0500643_000167_30837_32453 534
1011 3300053094 Ga0500566_0001889 Ga0500566_0001889_7645_9261 534
1012 3300053121 Ga0500607_000354 Ga0500607_000354_19538_21145 534
1013 3300053122 Ga0500608_008713 Ga0500608_008713_239_1852 534
1014 3300053125 Ga0500618_001172 Ga0500618_001172_825_2447 534
1015 3300053134 Ga0500658_0000887 Ga0500658_0000887_8227_9840 534
1016 3300053136 Ga0500559_0001553 Ga0500559_0001553_2628_4235 534
1017 3300053156 Ga0500622_0000145 Ga0500622_0000145_47242_48852 534
1018 3300053723 Ga0500567_000039 Ga0500567_000039_9264_10877 534
1019 3300053729 Ga0500625_000021 Ga0500625_000021_33090_34817 534
1020 3300053730 Ga0500645_002526 Ga0500645_002526_3936_5549 534
1021 iso_pu_bacteria 2643221560 2643820503 534

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01293

PEPCK_ATP

Phosphoenolpyruvate carboxykinase

18

483

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pc9-assembly2.cif.gz_B crystal structure of atp-dependent phosphoenolpyruvate carboxykinase from thermus thermophilus hb8 0.9649 8 531
2pc9-assembly2.cif.gz_B crystal structure of atp-dependent phosphoenolpyruvate carboxykinase from thermus thermophilus hb8 0.9594 8 531
1ii2-assembly1.cif.gz_B crystal structure of phosphoenolpyruvate carboxykinase (pepck) from trypanosoma cruzi 0.9554 17 534
1xkv-assembly1.cif.gz_A crystal structure of atp-dependent phosphoenolpyruvate carboxykinase from thermus thermophilus hb8 0.9544 8 534
1xkv-assembly1.cif.gz_A crystal structure of atp-dependent phosphoenolpyruvate carboxykinase from thermus thermophilus hb8 0.9526 8 534
ID Description Score Start End Superfamily
af_A4I2Y7_62_174_3.40.449.10 Alpha Beta;3-Layer(aba) Sandwich;Phosphoenolpyruvate Carboxykinase; domain 1;Phosphoenolpyruvate Carboxykinase, domain 1 0.9689 77 187 3.40.449.10
af_A0A1D6JWH6_180_340_3.40.449.10 Alpha Beta;3-Layer(aba) Sandwich;Phosphoenolpyruvate Carboxykinase; domain 1;Phosphoenolpyruvate Carboxykinase, domain 1 0.9594 62 205 3.40.449.10
af_Q2G1W2_22_214_3.40.449.10 Alpha Beta;3-Layer(aba) Sandwich;Phosphoenolpyruvate Carboxykinase; domain 1;Phosphoenolpyruvate Carboxykinase, domain 1 0.9588 23 213 3.40.449.10
1ii2A01 Alpha Beta;3-Layer(aba) Sandwich;Phosphoenolpyruvate Carboxykinase; domain 1;Phosphoenolpyruvate Carboxykinase, domain 1 0.9581 17 206 3.40.449.10
af_A0A1D6FBU2_97_203_3.40.449.10 Alpha Beta;3-Layer(aba) Sandwich;Phosphoenolpyruvate Carboxykinase; domain 1;Phosphoenolpyruvate Carboxykinase, domain 1 0.9547 81 178 3.40.449.10
ID Description Score Start End GO Terms
AF-A0A7W1KMX3-F1-model_v4 Phosphoenolpyruvate carboxykinase (ATP) 0.9871 442 532 GO:0004612
GO:0005524
GO:0005829
GO:0006094
GO:0016301
AF-A0A3D2LFL4-F1-model_v4 deleted 0.9786 5 214
AF-A0A352HA49-F1-model_v4 deleted 0.9767 400 533
AF-A0A3N5MZM6-F1-model_v4 Phosphoenolpyruvate carboxykinase (ATP) 0.9765 20 209 GO:0004612
GO:0005524
GO:0005829
GO:0006094
GO:0016301
AF-A0A7V9EIM8-F1-model_v4 Phosphoenolpyruvate carboxykinase (ATP) 0.9754 442 534 GO:0004612
GO:0005524
GO:0005829
GO:0006094
GO:0016301

Feature Viewer

pLDDT pTM Quality
85.89 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map