F488300

General Info

Members Datasets Scaffolds Average Seq Length
1017 446 1004 281

Family's Representative Sequence

Representative Sequence 3300053177|Ga0500636_0017052|Ga0500636_0017052_782_1636
Length 284
Sequence MIIDSQVHAYEANTLKRPWDTVPNWPDHVTGDEMVAAMDKVGVDGAIFISAFSMYRYDASYAVEVQRAHPDRMAIVKPVDPDDPAVADVVADWKRTPGAVGIRIMLTPEHKPRTPDDPGLDRIARAAVQHDFPVNILCWGNLDQGTALIDRHPETRFILDHLGILQPRTKPAPEQPLQQPWADLPKVLALARRPNVVIKVSGACTLSKEPYPFPDIWDPLARVFDAWGFERCLWGTDWTRAFAVVNYEQAVKPFVETKRLSESERAMLMGGACAKAYGWSPKRG

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
4 2791355199
5 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
6 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
7 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
8 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
9 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
10 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
98 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
99 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
114 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
143 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
144 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
145 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
147 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
150 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
225 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
231 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
232 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
234 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
235 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
236 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
237 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
238 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
239 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
240 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
241 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
242 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
243 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
244 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
245 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
246 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
247 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
248 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
249 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
250 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
251 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
252 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
253 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
254 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
255 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
256 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
257 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
258 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
259 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
260 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
261 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
263 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
265 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
266 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
267 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
268 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
269 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
270 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
271 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
272 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
273 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
274 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
275 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
276 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
277 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
278 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
279 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
280 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
281 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
282 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
283 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
286 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
287 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
288 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
289 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
290 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
291 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
292 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
293 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
294 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
295 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
296 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
297 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
298 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
299 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
300 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
301 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
302 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
303 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
304 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
305 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
306 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
307 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
308 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
309 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
312 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
313 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
314 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
315 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
316 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
317 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
318 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
319 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
320 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
321 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
322 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
323 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
324 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
325 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
326 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
327 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
328 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
329 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
330 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
331 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
332 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
333 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
334 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
335 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
336 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
337 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
338 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
339 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
340 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
341 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
342 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
343 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
344 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
345 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
346 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
347 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
348 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
349 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
350 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
351 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
352 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
353 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
354 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
355 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
356 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
357 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
358 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
359 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
360 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
361 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
362 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
363 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
364 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
365 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
366 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
367 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
368 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
369 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
370 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
371 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
372 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
373 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
374 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
375 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
376 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
377 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
378 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
379 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
389 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
390 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
391 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
392 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
393 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
394 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
395 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
396 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
397 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
398 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
399 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
402 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
403 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
404 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
405 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
406 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
407 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
408 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
409 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
410 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
411 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
412 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
413 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
414 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
415 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
416 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
417 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
418 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
419 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
420 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
421 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
422 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
423 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
424 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
425 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
426 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
427 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
428 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
429 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
430 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
431 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
432 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
433 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
434 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
435 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
436 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
437 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
438 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
439 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
440 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
441 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
442 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
443 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
444 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
445 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
446 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 0.39
Isolates 1.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.59
Nodule 0.79
Rhizoplane 6.78
Rhizosphere 82.3
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000162 3300003203 Bacteria 29622
2 JGI25153J46596_10002866 3300003215 Bacteria 9797
3 JGI25404J52841_10001411 3300003659 Bacteria 4218
4 Ga0065712_10018464 3300005290 Bacteria 2120
5 Ga0065715_10168973 3300005293 Bacteria 1562
6 Ga0070676_10015138 3300005328 Bacteria 4252
7 Ga0070683_100000791 3300005329 Bacteria 23353
8 Ga0070683_100015757 3300005329 Bacteria 6645
9 Ga0070683_100044454 3300005329 Bacteria 4096
10 Ga0070690_100060130 3300005330 Bacteria 2445
11 Ga0070690_100276750 3300005330 Bacteria 1196
12 Ga0070670_100001030 3300005331 Bacteria 22062
13 Ga0070670_100007487 3300005331 Bacteria 9272
14 Ga0070670_100058179 3300005331 Bacteria 3318
15 Ga0068869_100002206 3300005334 Bacteria 11714
16 Ga0068869_100024561 3300005334 Bacteria 4174
17 Ga0068869_100369404 3300005334 Bacteria 1173
18 Ga0070666_10066982 3300005335 Bacteria 2438
19 Ga0070680_100002402 3300005336 Bacteria 13867
20 Ga0070680_100166702 3300005336 Bacteria 1852
21 Ga0070680_100384707 3300005336 Bacteria 1195
22 Ga0070682_100001262 3300005337 Bacteria 14373
23 Ga0068868_100000913 3300005338 Bacteria 20073
24 Ga0068868_100002406 3300005338 Bacteria 12953
25 Ga0068868_100184928 3300005338 Bacteria 1730
26 Ga0070660_100000335 3300005339 Bacteria 31181
27 Ga0070660_100007713 3300005339 Bacteria 7502
28 Ga0070689_100127552 3300005340 Bacteria 2037
29 Ga0070689_100301513 3300005340 Bacteria 1334
30 Ga0070691_10005617 3300005341 Bacteria 5712
31 Ga0070661_100002058 3300005344 Bacteria 13863
32 Ga0070661_100004972 3300005344 Bacteria 9154
33 Ga0070661_100007089 3300005344 Bacteria 7731
34 Ga0070661_100177216 3300005344 Bacteria 1621
35 Ga0070692_10355987 3300005345 Bacteria 911
36 Ga0070668_100006633 3300005347 Bacteria 8579
37 Ga0070668_100055643 3300005347 Bacteria 3054
38 Ga0070668_100211200 3300005347 Bacteria 1597
39 Ga0070669_100071085 3300005353 Bacteria 2574
40 Ga0070669_100101261 3300005353 Bacteria 2173
41 Ga0070675_100001929 3300005354 Bacteria 15345
42 Ga0070675_100002216 3300005354 Bacteria 14411
43 Ga0070675_100076889 3300005354 Bacteria 2777
44 Ga0070671_100005082 3300005355 Bacteria 10477
45 Ga0070671_100031325 3300005355 Bacteria 4392
46 Ga0070674_100014014 3300005356 Bacteria 4975
47 Ga0070674_100239269 3300005356 Bacteria 1420
48 Ga0070673_100004294 3300005364 Bacteria 8999
49 Ga0070673_100032903 3300005364 Bacteria 3909
50 Ga0070673_100077263 3300005364 Bacteria 2690
51 Ga0070673_100232277 3300005364 Bacteria 1600
52 Ga0070673_100333459 3300005364 Bacteria 1342
53 Ga0070659_100004245 3300005366 Bacteria 10230
54 Ga0070659_100209780 3300005366 Bacteria 1605
55 Ga0070667_100012473 3300005367 Bacteria 7032
56 Ga0070667_100136242 3300005367 Bacteria 2147
57 Ga0070667_100272937 3300005367 Bacteria 1517
58 Ga0070709_10009864 3300005434 Bacteria 5276
59 Ga0070709_10017830 3300005434 Bacteria 4079
60 Ga0070714_100005779 3300005435 Bacteria 9485
61 Ga0070714_100027828 3300005435 Bacteria 4684
62 Ga0070714_100246470 3300005435 Bacteria 1651
63 Ga0070714_100253500 3300005435 Bacteria 1628
64 Ga0070713_100007564 3300005436 Bacteria 7637
65 Ga0070713_100035562 3300005436 Bacteria 4011
66 Ga0070713_100109247 3300005436 Bacteria 2409
67 Ga0070713_100145452 3300005436 Bacteria 2103
68 Ga0070710_10000521 3300005437 Bacteria 18075
69 Ga0070710_10001560 3300005437 Bacteria 10830
70 Ga0070710_10066926 3300005437 Bacteria 2061
71 Ga0070710_10169158 3300005437 Bacteria 1361
72 Ga0070711_100009231 3300005439 Bacteria 6065
73 Ga0070711_100014060 3300005439 Bacteria 5036
74 Ga0070711_100049569 3300005439 Bacteria 2876
75 Ga0070705_100009249 3300005440 Bacteria 4895
76 Ga0070705_100013922 3300005440 Bacteria 4126
77 Ga0070700_100062043 3300005441 Bacteria 2360
78 Ga0070700_100084649 3300005441 Bacteria 2055
79 Ga0070694_100029203 3300005444 Bacteria 3597
80 Ga0070694_100368108 3300005444 Bacteria 1118
81 Ga0070708_100064166 3300005445 Bacteria 3290
82 Ga0070708_100184557 3300005445 Bacteria 1950
83 Ga0070708_100368691 3300005445 Bacteria 1354
84 Ga0070663_100006448 3300005455 Bacteria 7057
85 Ga0070663_100094486 3300005455 Bacteria 2220
86 Ga0070663_100238632 3300005455 Bacteria 1434
87 Ga0070663_100454869 3300005455 Bacteria 1056
88 Ga0070678_100000640 3300005456 Bacteria 17148
89 Ga0070678_100003210 3300005456 Bacteria 9073
90 Ga0070678_100549068 3300005456 Bacteria 1025
91 Ga0070662_100023019 3300005457 Bacteria 4275
92 Ga0070662_100041868 3300005457 Bacteria 3270
93 Ga0070662_100076697 3300005457 Bacteria 2478
94 Ga0070681_10089175 3300005458 Bacteria 3035
95 Ga0070681_10396293 3300005458 Bacteria 1292
96 Ga0070681_10445009 3300005458 Bacteria 1208
97 Ga0070681_10623070 3300005458 Bacteria 993
98 Ga0068867_100004506 3300005459 Bacteria 9789
99 Ga0068867_100065528 3300005459 Bacteria 2703
100 Ga0068867_100068789 3300005459 Bacteria 2643
101 Ga0070685_10140715 3300005466 Bacteria 1519
102 Ga0070706_100178535 3300005467 Bacteria 1982
103 Ga0070706_100225177 3300005467 Bacteria 1751
104 Ga0070706_100238099 3300005467 Bacteria 1699
105 Ga0070706_100252170 3300005467 Bacteria 1647
106 Ga0070706_100385076 3300005467 Bacteria 1306
107 Ga0070707_100071546 3300005468 Bacteria 3341
108 Ga0070707_100158548 3300005468 Bacteria 2204
109 Ga0070707_100298481 3300005468 Bacteria 1565
110 Ga0070698_100048147 3300005471 Bacteria 4356
111 Ga0070698_100093465 3300005471 Bacteria 2987
112 Ga0070698_100096482 3300005471 Bacteria 2933
113 Ga0070698_100113516 3300005471 Bacteria 2674
114 Ga0070698_100153464 3300005471 Bacteria 2249
115 Ga0070699_100041399 3300005518 Bacteria 3988
116 Ga0070699_100047275 3300005518 Bacteria 3723
117 Ga0070699_100084776 3300005518 Bacteria 2765
118 Ga0070699_100326413 3300005518 Bacteria 1380
119 Ga0070699_100382109 3300005518 Bacteria 1271
120 Ga0070679_100005011 3300005530 Bacteria 12222
121 Ga0070679_100026077 3300005530 Bacteria 5737
122 Ga0070679_100067501 3300005530 Bacteria 3566
123 Ga0070679_100078056 3300005530 Bacteria 3300
124 Ga0070679_100241516 3300005530 Bacteria 1763
125 Ga0070684_100009593 3300005535 Bacteria 7629
126 Ga0070684_100030692 3300005535 Bacteria 4569
127 Ga0070697_100256275 3300005536 Bacteria 1497
128 Ga0070697_100321683 3300005536 Bacteria 1332
129 Ga0068853_100005907 3300005539 Bacteria 9658
130 Ga0068853_100030633 3300005539 Bacteria 4546
131 Ga0068853_100206610 3300005539 Bacteria 1789
132 Ga0068853_100494130 3300005539 Bacteria 1155
133 Ga0070672_100000756 3300005543 Bacteria 19234
134 Ga0070672_100001321 3300005543 Bacteria 15281
135 Ga0070672_100045964 3300005543 Bacteria 3381
136 Ga0070672_100077910 3300005543 Bacteria 2651
137 Ga0070672_100331998 3300005543 Bacteria 1294
138 Ga0070695_100009784 3300005545 Bacteria 5711
139 Ga0070695_100010947 3300005545 Bacteria 5421
140 Ga0070695_100034299 3300005545 Bacteria 3181
141 Ga0070696_100006504 3300005546 Bacteria 7805
142 Ga0070696_100019857 3300005546 Bacteria 4555
143 Ga0070693_100000201 3300005547 Bacteria 28084
144 Ga0070693_100062384 3300005547 Bacteria 2169
145 Ga0070665_100056988 3300005548 Bacteria 3918
146 Ga0070704_100000395 3300005549 Bacteria 20026
147 Ga0070704_100001335 3300005549 Bacteria 13077
148 Ga0070704_100005399 3300005549 Bacteria 7442
149 Ga0068855_100001465 3300005563 Bacteria 29468
150 Ga0068855_100172656 3300005563 Bacteria 2447
151 Ga0068855_100226845 3300005563 Bacteria 2093
152 Ga0070664_100006519 3300005564 Bacteria 9412
153 Ga0070664_100039095 3300005564 Bacteria 3996
154 Ga0070664_100269003 3300005564 Bacteria 1535
155 Ga0068857_100086635 3300005577 Bacteria 2801
156 Ga0068857_100088251 3300005577 Bacteria 2774
157 Ga0068857_100104239 3300005577 Bacteria 2546
158 Ga0068854_100006822 3300005578 Bacteria 7282
159 Ga0068854_100027180 3300005578 Bacteria 3941
160 Ga0068856_100000513 3300005614 Bacteria 42640
161 Ga0068856_100001138 3300005614 Bacteria 27944
162 Ga0068856_100133819 3300005614 Bacteria 2484
163 Ga0070702_100099719 3300005615 Bacteria 1779
164 Ga0068852_100001088 3300005616 Bacteria 17948
165 Ga0068852_100003525 3300005616 Bacteria 10947
166 Ga0068852_100047281 3300005616 Bacteria 3670
167 Ga0068859_100112847 3300005617 Bacteria 2781
168 Ga0068859_100263614 3300005617 Bacteria 1815
169 Ga0068864_100013872 3300005618 Bacteria 6679
170 Ga0068864_100061767 3300005618 Bacteria 3245
171 Ga0068864_100082720 3300005618 Bacteria 2817
172 Ga0068864_100088756 3300005618 Bacteria 2723
173 Ga0068866_10061647 3300005718 Bacteria 1948
174 Ga0068866_10193962 3300005718 Bacteria 1209
175 Ga0068866_10302339 3300005718 Bacteria 1000
176 Ga0068861_100036662 3300005719 Bacteria 3642
177 Ga0068851_10012174 3300005834 Bacteria 4051
178 Ga0068870_10004585 3300005840 Bacteria 5956
179 Ga0068870_10039704 3300005840 Bacteria 2436
180 Ga0068863_100045502 3300005841 Bacteria 4165
181 Ga0068863_100080491 3300005841 Bacteria 3085
182 Ga0068863_100083763 3300005841 Bacteria 3022
183 Ga0068858_100028605 3300005842 Bacteria 5176
184 Ga0068858_100563949 3300005842 Bacteria 1103
185 Ga0068860_100000503 3300005843 Bacteria 48508
186 Ga0068860_100035583 3300005843 Bacteria 4775
187 Ga0068860_100094659 3300005843 Bacteria 2847
188 Ga0068860_100147155 3300005843 Bacteria 2267
189 Ga0068862_100025439 3300005844 Bacteria 4970
190 Ga0081455_10000022 3300005937 Bacteria 159620
191 Ga0081455_10000864 3300005937 Bacteria 39060
192 Ga0081455_10019456 3300005937 Bacteria 6423
193 Ga0081455_10020308 3300005937 Bacteria 6261
194 Ga0081538_10044258 3300005981 Bacteria 2780
195 Ga0081540_1000374 3300005983 Bacteria 44794
196 Ga0081540_1002045 3300005983 Bacteria 16821
197 Ga0081539_10001007 3300005985 Bacteria 52055
198 Ga0070717_10035339 3300006028 Bacteria 4045
199 Ga0070717_10065385 3300006028 Bacteria 3023
200 Ga0075365_10029929 3300006038 Bacteria 3483
201 Ga0075365_10042546 3300006038 Bacteria 2970
202 Ga0075365_10279407 3300006038 Bacteria 1175
203 Ga0075365_10332934 3300006038 Bacteria 1070
204 Ga0075368_10027879 3300006042 Bacteria 2180
205 Ga0075368_10095838 3300006042 Bacteria 1216
206 Ga0075363_100038980 3300006048 Bacteria 2499
207 Ga0075363_100085334 3300006048 Bacteria 1732
208 Ga0075364_10050605 3300006051 Bacteria 2712
209 Ga0075364_10125743 3300006051 Bacteria 1719
210 Ga0075364_10172107 3300006051 Bacteria 1464
211 Ga0075432_10030582 3300006058 Bacteria 1861
212 Ga0070715_10000603 3300006163 Bacteria 9492
213 Ga0070715_10254362 3300006163 Bacteria 919
214 Ga0070716_100031698 3300006173 Bacteria 2877
215 Ga0070716_100055965 3300006173 Bacteria 2260
216 Ga0070712_100003710 3300006175 Bacteria 9408
217 Ga0075362_10004593 3300006177 Bacteria 4975
218 Ga0075362_10033366 3300006177 Bacteria 2238
219 Ga0075362_10073325 3300006177 Bacteria 1567
220 Ga0075367_10008292 3300006178 Bacteria 5380
221 Ga0075367_10021431 3300006178 Bacteria 3611
222 Ga0075369_10008692 3300006186 Bacteria 3919
223 Ga0075369_10034929 3300006186 Bacteria 2135
224 Ga0075369_10129066 3300006186 Bacteria 1148
225 Ga0075366_10019315 3300006195 Bacteria 3941
226 Ga0075366_10091024 3300006195 Bacteria 1827
227 Ga0097621_100001375 3300006237 Bacteria 16725
228 Ga0097621_100005490 3300006237 Bacteria 8932
229 Ga0097621_100269539 3300006237 Bacteria 1496
230 Ga0068871_100001017 3300006358 Bacteria 18777
231 Ga0068871_100055451 3300006358 Bacteria 3217
232 Ga0075428_100008280 3300006844 Bacteria 11527
233 Ga0075428_100014675 3300006844 Bacteria 8702
234 Ga0075428_100022172 3300006844 Bacteria 7031
235 Ga0075428_100047019 3300006844 Bacteria 4740
236 Ga0075428_100059199 3300006844 Bacteria 4195
237 Ga0075428_100080660 3300006844 Bacteria 3551
238 Ga0075428_100133891 3300006844 Bacteria 2695
239 Ga0075428_100625905 3300006844 Bacteria 1149
240 Ga0075428_100746163 3300006844 Bacteria 1042
241 Ga0075430_100001172 3300006846 Bacteria 20997
242 Ga0075430_100008019 3300006846 Bacteria 8929
243 Ga0075431_100000109 3300006847 Bacteria 52399
244 Ga0075431_100005848 3300006847 Bacteria 12170
245 Ga0075431_100008045 3300006847 Bacteria 10521
246 Ga0075431_100011372 3300006847 Bacteria 8965
247 Ga0075431_100017008 3300006847 Bacteria 7385
248 Ga0075431_100050589 3300006847 Bacteria 4284
249 Ga0075431_100098586 3300006847 Bacteria 3017
250 Ga0075433_10004254 3300006852 Bacteria 11118
251 Ga0075433_10008732 3300006852 Bacteria 8084
252 Ga0075433_10033075 3300006852 Bacteria 4432
253 Ga0075433_10067251 3300006852 Bacteria 3145
254 Ga0075434_100010330 3300006871 Bacteria 8751
255 Ga0075434_100031443 3300006871 Bacteria 5234
256 Ga0075434_100175540 3300006871 Bacteria 2162
257 Ga0075434_100281163 3300006871 Bacteria 1684
258 Ga0075429_100000003 3300006880 Bacteria 130377
259 Ga0075429_100020823 3300006880 Bacteria 5692
260 Ga0075429_100061447 3300006880 Bacteria 3273
261 Ga0068865_100047363 3300006881 Bacteria 2954
262 Ga0068865_100112910 3300006881 Bacteria 2008
263 Ga0068865_100161512 3300006881 Bacteria 1710
264 Ga0075436_100000611 3300006914 Bacteria 23398
265 Ga0075436_100050850 3300006914 Bacteria 2860
266 Ga0097620_100112848 3300006931 Bacteria 2781
267 Ga0097620_100263626 3300006931 Bacteria 1815
268 Ga0075435_100003813 3300007076 Bacteria 10283
269 Ga0075435_100119046 3300007076 Bacteria 2202
270 Ga0099794_10009489 3300007265 Bacteria 4094
271 Ga0099795_10060195 3300007788 Bacteria 1407
272 Ga0105240_10044074 3300009093 Bacteria 5673
273 Ga0105240_10188913 3300009093 Bacteria 2424
274 Ga0111539_10000387 3300009094 Bacteria 54408
275 Ga0111539_10000684 3300009094 Bacteria 43895
276 Ga0111539_10037748 3300009094 Bacteria 5831
277 Ga0111539_10062968 3300009094 Bacteria 4389
278 Ga0111539_10078453 3300009094 Bacteria 3885
279 Ga0105245_10008214 3300009098 Bacteria 9127
280 Ga0105245_10187866 3300009098 Bacteria 1977
281 Ga0114129_10000425 3300009147 Bacteria 50146
282 Ga0114129_10005359 3300009147 Bacteria 18104
283 Ga0114129_10090068 3300009147 Bacteria 4253
284 Ga0114129_10101093 3300009147 Bacteria 3990
285 Ga0114129_10127814 3300009147 Bacteria 3493
286 Ga0114129_10332768 3300009147 Bacteria 2016
287 Ga0114129_10368526 3300009147 Bacteria 1899
288 Ga0114129_10426852 3300009147 Bacteria 1742
289 Ga0114129_10451566 3300009147 Bacteria 1686
290 Ga0114129_10504961 3300009147 Bacteria 1579
291 Ga0105243_10067067 3300009148 Bacteria 2888
292 Ga0105243_10181148 3300009148 Bacteria 1832
293 Ga0105243_10232271 3300009148 Bacteria 1637
294 Ga0105243_10562352 3300009148 Bacteria 1092
295 Ga0105243_10772503 3300009148 Bacteria 944
296 Ga0105241_10079079 3300009174 Bacteria 2571
297 Ga0105242_10272565 3300009176 Bacteria 1534
298 Ga0105242_10275776 3300009176 Bacteria 1525
299 Ga0105248_10088269 3300009177 Bacteria 3490
300 Ga0105248_10168955 3300009177 Bacteria 2465
301 Ga0105248_10485265 3300009177 Bacteria 1393
302 Ga0105237_10007319 3300009545 Bacteria 12102
303 Ga0105237_10043711 3300009545 Bacteria 4512
304 Ga0105237_10048539 3300009545 Bacteria 4267
305 Ga0105237_10213722 3300009545 Bacteria 1928
306 Ga0105249_10013696 3300009553 Bacteria 7161
307 Ga0105239_10126553 3300010375 Bacteria 2840
308 Ga0105239_10215689 3300010375 Bacteria 2152
309 Ga0157373_10001232 3300013100 Bacteria 19561
310 Ga0157371_10102647 3300013102 Bacteria 2029
311 Ga0157371_10266182 3300013102 Bacteria 1236
312 Ga0157370_10052997 3300013104 Bacteria 3871
313 Ga0157370_10055518 3300013104 Bacteria 3772
314 Ga0157370_10158080 3300013104 Bacteria 2109
315 Ga0157369_10004456 3300013105 Bacteria 16499
316 Ga0157369_10019805 3300013105 Bacteria 7530
317 Ga0157369_10610831 3300013105 Bacteria 1125
318 Ga0157374_10008483 3300013296 Bacteria 8789
319 Ga0157374_10050173 3300013296 Bacteria 3878
320 Ga0157374_10061756 3300013296 Bacteria 3510
321 Ga0157374_10100879 3300013296 Bacteria 2767
322 Ga0157374_10278033 3300013296 Bacteria 1652
323 Ga0157374_10679080 3300013296 Bacteria 1042
324 Ga0157378_10041710 3300013297 Bacteria 4072
325 Ga0157378_10073414 3300013297 Bacteria 3076
326 Ga0157378_10073485 3300013297 Bacteria 3074
327 Ga0157378_10207784 3300013297 Bacteria 1855
328 Ga0163162_10082024 3300013306 Bacteria 3296
329 Ga0163162_10103175 3300013306 Bacteria 2945
330 Ga0163162_10128132 3300013306 Bacteria 2646
331 Ga0157372_10000612 3300013307 Bacteria 39043
332 Ga0157372_10041944 3300013307 Bacteria 5060
333 Ga0157372_10212403 3300013307 Bacteria 2242
334 Ga0157375_10010239 3300013308 Bacteria 8248
335 Ga0157375_10055192 3300013308 Bacteria 3916
336 Ga0157375_10078073 3300013308 Bacteria 3343
337 Ga0157375_10343430 3300013308 Bacteria 1658
338 Ga0163163_10024216 3300014325 Bacteria 5775
339 Ga0163163_10050760 3300014325 Bacteria 4086
340 Ga0157380_10114633 3300014326 Bacteria 2271
341 Ga0182008_10021801 3300014497 Bacteria 3288
342 Ga0157379_10098375 3300014968 Bacteria 2626
343 Ga0157376_10016314 3300014969 Bacteria 5635
344 Ga0157376_10151953 3300014969 Bacteria 2089
345 Ga0157376_10215625 3300014969 Bacteria 1775
346 Ga0163161_10116625 3300017792 Bacteria 2002
347 Ga0163161_10189794 3300017792 Bacteria 1579
348 Ga0206356_10060346 3300020070 Bacteria 1096
349 Ga0213873_10019757 3300021358 Bacteria 1566
350 Ga0213874_10061093 3300021377 Bacteria 1180
351 Ga0213876_10003793 3300021384 Bacteria 8571
352 Ga0224712_10147600 3300022467 Bacteria 1040
353 Ga0224712_10150931 3300022467 Bacteria 1029
354 Ga0224572_1007000 3300024225 Bacteria 2055
355 Ga0209677_101915 3300025253 Bacteria 8379
356 Ga0209148_1006564 3300025254 Bacteria 2509
357 Ga0209233_1004436 3300025261 Bacteria 4772
358 Ga0209455_1003615 3300025272 Bacteria 5383
359 Ga0209455_1004331 3300025272 Bacteria 4686
360 Ga0209758_1006475 3300025297 Bacteria 8389
361 Ga0207656_10005307 3300025321 Bacteria 4547
362 Ga0207656_10024914 3300025321 Bacteria 2425
363 Ga0207656_10129390 3300025321 Bacteria 1181
364 Ga0207653_10003590 3300025885 Bacteria 4884
365 Ga0207682_10000949 3300025893 Bacteria 13441
366 Ga0207692_10001827 3300025898 Bacteria 8089
367 Ga0207692_10021921 3300025898 Bacteria 2931
368 Ga0207692_10112045 3300025898 Bacteria 1514
369 Ga0207680_10012253 3300025903 Bacteria 4363
370 Ga0207685_10002290 3300025905 Bacteria 4350
371 Ga0207685_10049722 3300025905 Bacteria 1612
372 Ga0207699_10027465 3300025906 Bacteria 3151
373 Ga0207699_10083256 3300025906 Bacteria 1989
374 Ga0207699_10132736 3300025906 Bacteria 1626
375 Ga0207645_10009046 3300025907 Bacteria 6912
376 Ga0207645_10189163 3300025907 Bacteria 1352
377 Ga0207643_10040490 3300025908 Bacteria 2624
378 Ga0207684_10001645 3300025910 Bacteria 23726
379 Ga0207684_10017949 3300025910 Bacteria 6063
380 Ga0207684_10019307 3300025910 Bacteria 5830
381 Ga0207684_10080444 3300025910 Bacteria 2772
382 Ga0207684_10195869 3300025910 Bacteria 1743
383 Ga0207654_10021309 3300025911 Bacteria 3445
384 Ga0207707_10000170 3300025912 Bacteria 68142
385 Ga0207707_10000555 3300025912 Bacteria 37837
386 Ga0207707_10258954 3300025912 Bacteria 1510
387 Ga0207695_10081975 3300025913 Bacteria 3263
388 Ga0207695_10452537 3300025913 Bacteria 1167
389 Ga0207671_10036016 3300025914 Bacteria 3670
390 Ga0207671_10071214 3300025914 Bacteria 2593
391 Ga0207671_10075808 3300025914 Bacteria 2516
392 Ga0207693_10006093 3300025915 Bacteria 9988
393 Ga0207693_10010348 3300025915 Bacteria 7571
394 Ga0207693_10036914 3300025915 Bacteria 3853
395 Ga0207693_10046726 3300025915 Bacteria 3401
396 Ga0207663_10005048 3300025916 Bacteria 6627
397 Ga0207663_10007145 3300025916 Bacteria 5771
398 Ga0207660_10007797 3300025917 Bacteria 6929
399 Ga0207660_10051731 3300025917 Bacteria 2921
400 Ga0207660_10139553 3300025917 Bacteria 1852
401 Ga0207660_10143522 3300025917 Bacteria 1827
402 Ga0207660_10296179 3300025917 Bacteria 1287
403 Ga0207657_10001106 3300025919 Bacteria 28608
404 Ga0207657_10225025 3300025919 Bacteria 1502
405 Ga0207649_10010165 3300025920 Bacteria 5166
406 Ga0207649_10017532 3300025920 Bacteria 4058
407 Ga0207649_10018651 3300025920 Bacteria 3951
408 Ga0207652_10004264 3300025921 Bacteria 11671
409 Ga0207652_10041977 3300025921 Bacteria 3890
410 Ga0207652_10045482 3300025921 Bacteria 3743
411 Ga0207646_10036612 3300025922 Bacteria 4428
412 Ga0207646_10162053 3300025922 Bacteria 2018
413 Ga0207681_10166003 3300025923 Bacteria 1669
414 Ga0207681_10512964 3300025923 Bacteria 983
415 Ga0207694_10054336 3300025924 Bacteria 3107
416 Ga0207694_10175659 3300025924 Bacteria 1735
417 Ga0207650_10007352 3300025925 Bacteria 7499
418 Ga0207659_10026148 3300025926 Bacteria 3935
419 Ga0207659_10097269 3300025926 Bacteria 2211
420 Ga0207687_10057049 3300025927 Bacteria 2742
421 Ga0207700_10013572 3300025928 Bacteria 5307
422 Ga0207700_10024377 3300025928 Bacteria 4186
423 Ga0207700_10117449 3300025928 Bacteria 2151
424 Ga0207700_10258138 3300025928 Bacteria 1491
425 Ga0207700_10515566 3300025928 Bacteria 1059
426 Ga0207664_10025824 3300025929 Bacteria 4431
427 Ga0207664_10047275 3300025929 Bacteria 3379
428 Ga0207664_10047750 3300025929 Bacteria 3364
429 Ga0207664_10150039 3300025929 Bacteria 1979
430 Ga0207664_10176266 3300025929 Bacteria 1833
431 Ga0207664_10188599 3300025929 Bacteria 1774
432 Ga0207644_10024145 3300025931 Bacteria 4171
433 Ga0207644_10041790 3300025931 Bacteria 3245
434 Ga0207644_10055972 3300025931 Bacteria 2845
435 Ga0207644_10320333 3300025931 Bacteria 1253
436 Ga0207690_10002071 3300025932 Bacteria 12292
437 Ga0207690_10285842 3300025932 Bacteria 1286
438 Ga0207706_10013378 3300025933 Bacteria 7463
439 Ga0207706_10053483 3300025933 Bacteria 3564
440 Ga0207706_10086601 3300025933 Bacteria 2754
441 Ga0207706_10177687 3300025933 Bacteria 1870
442 Ga0207706_10568223 3300025933 Bacteria 975
443 Ga0207686_10021531 3300025934 Bacteria 3702
444 Ga0207686_10050676 3300025934 Bacteria 2583
445 Ga0207709_10011247 3300025935 Bacteria 4937
446 Ga0207709_10021268 3300025935 Bacteria 3671
447 Ga0207709_10199122 3300025935 Bacteria 1429
448 Ga0207709_10487196 3300025935 Bacteria 960
449 Ga0207670_10095037 3300025936 Bacteria 2116
450 Ga0207670_10251610 3300025936 Bacteria 1366
451 Ga0207669_10017679 3300025937 Bacteria 3664
452 Ga0207669_10026910 3300025937 Bacteria 3137
453 Ga0207704_10027519 3300025938 Bacteria 3139
454 Ga0207704_10031936 3300025938 Bacteria 2973
455 Ga0207704_10409460 3300025938 Bacteria 1072
456 Ga0207704_10490779 3300025938 Bacteria 988
457 Ga0207665_10027175 3300025939 Bacteria 3780
458 Ga0207665_10221391 3300025939 Bacteria 1387
459 Ga0207665_10463737 3300025939 Bacteria 974
460 Ga0207691_10000521 3300025940 Bacteria 38291
461 Ga0207691_10013018 3300025940 Bacteria 7966
462 Ga0207691_10017685 3300025940 Bacteria 6758
463 Ga0207691_10128303 3300025940 Bacteria 2242
464 Ga0207711_10051920 3300025941 Bacteria 3512
465 Ga0207711_10107410 3300025941 Bacteria 2478
466 Ga0207689_10003550 3300025942 Bacteria 14259
467 Ga0207689_10079309 3300025942 Bacteria 2699
468 Ga0207661_10002623 3300025944 Bacteria 12375
469 Ga0207679_10000523 3300025945 Bacteria 25949
470 Ga0207679_10024346 3300025945 Bacteria 4150
471 Ga0207679_10092320 3300025945 Bacteria 2345
472 Ga0207679_10145361 3300025945 Bacteria 1922
473 Ga0207679_10244799 3300025945 Bacteria 1521
474 Ga0207667_10042230 3300025949 Bacteria 4848
475 Ga0207667_10053418 3300025949 Bacteria 4252
476 Ga0207667_10127732 3300025949 Bacteria 2619
477 Ga0207667_10297304 3300025949 Bacteria 1649
478 Ga0207651_10005670 3300025960 Bacteria 6440
479 Ga0207651_10028072 3300025960 Bacteria 3544
480 Ga0207651_10060806 3300025960 Bacteria 2624
481 Ga0207712_10006218 3300025961 Bacteria 7524
482 Ga0207712_10126562 3300025961 Bacteria 1941
483 Ga0207712_10465499 3300025961 Bacteria 1075
484 Ga0207668_10010781 3300025972 Bacteria 5535
485 Ga0207668_10032351 3300025972 Bacteria 3455
486 Ga0207668_10037486 3300025972 Bacteria 3245
487 Ga0207668_10118739 3300025972 Bacteria 1998
488 Ga0207668_10270481 3300025972 Bacteria 1389
489 Ga0207640_10011956 3300025981 Bacteria 4931
490 Ga0207640_10013130 3300025981 Bacteria 4738
491 Ga0207677_10004363 3300026023 Bacteria 7579
492 Ga0207677_10032031 3300026023 Bacteria 3375
493 Ga0207703_10149895 3300026035 Bacteria 2032
494 Ga0207703_10255363 3300026035 Bacteria 1582
495 Ga0207703_10381053 3300026035 Bacteria 1304
496 Ga0207703_10769933 3300026035 Bacteria 918
497 Ga0207639_10000950 3300026041 Bacteria 19642
498 Ga0207639_10037696 3300026041 Bacteria 3592
499 Ga0207639_10137781 3300026041 Bacteria 2029
500 Ga0207678_10011341 3300026067 Bacteria 7823
501 Ga0207678_10119607 3300026067 Bacteria 2248
502 Ga0207678_10210406 3300026067 Bacteria 1663
503 Ga0207708_10234827 3300026075 Bacteria 1473
504 Ga0207702_10000493 3300026078 Bacteria 44394
505 Ga0207702_10001780 3300026078 Bacteria 21210
506 Ga0207641_10018656 3300026088 Bacteria 5687
507 Ga0207641_10149247 3300026088 Bacteria 2116
508 Ga0207641_10154757 3300026088 Bacteria 2079
509 Ga0207641_10289975 3300026088 Bacteria 1542
510 Ga0207641_10342052 3300026088 Bacteria 1424
511 Ga0207648_10028734 3300026089 Bacteria 4929
512 Ga0207648_10042389 3300026089 Bacteria 3995
513 Ga0207648_10095401 3300026089 Bacteria 2602
514 Ga0207648_10147191 3300026089 Bacteria 2078
515 Ga0207676_10031026 3300026095 Bacteria 4016
516 Ga0207676_10047575 3300026095 Bacteria 3325
517 Ga0207676_10133644 3300026095 Bacteria 2113
518 Ga0207676_10259028 3300026095 Bacteria 1569
519 Ga0207676_10281306 3300026095 Bacteria 1511
520 Ga0207674_10001680 3300026116 Bacteria 28444
521 Ga0207674_10021630 3300026116 Bacteria 6925
522 Ga0207674_10026802 3300026116 Bacteria 6113
523 Ga0207674_10102499 3300026116 Bacteria 2842
524 Ga0207674_10558095 3300026116 Bacteria 1106
525 Ga0207675_100017359 3300026118 Bacteria 6719
526 Ga0207675_100041747 3300026118 Bacteria 4283
527 Ga0207675_100349091 3300026118 Bacteria 1450
528 Ga0207683_10000576 3300026121 Bacteria 33957
529 Ga0207683_10001256 3300026121 Bacteria 23013
530 Ga0207683_10033261 3300026121 Bacteria 4478
531 Ga0207683_10042020 3300026121 Bacteria 3993
532 Ga0207683_10092520 3300026121 Bacteria 2694
533 Ga0207683_10174145 3300026121 Bacteria 1950
534 Ga0207683_10306855 3300026121 Bacteria 1452
535 Ga0207698_10002415 3300026142 Bacteria 11059
536 Ga0207698_10007863 3300026142 Bacteria 6710
537 Ga0207698_10093056 3300026142 Bacteria 2474
538 Ga0207698_10145023 3300026142 Bacteria 2052
539 Ga0209967_1012739 3300027364 Bacteria 1189
540 Ga0209996_1004913 3300027395 Bacteria 1706
541 Ga0210000_1005050 3300027462 Bacteria 1914
542 Ga0209995_1000295 3300027471 Bacteria 7880
543 Ga0209968_1001353 3300027526 Bacteria 3718
544 Ga0209999_1002059 3300027543 Bacteria 3515
545 Ga0210002_1001677 3300027617 Bacteria 3159
546 Ga0209983_1000262 3300027665 Bacteria 10869
547 Ga0209588_1016656 3300027671 Bacteria 2271
548 Ga0209971_1000116 3300027682 Bacteria 23344
549 Ga0209966_1000058 3300027695 Bacteria 48823
550 Ga0209998_10000039 3300027717 Bacteria 52864
551 Ga0209813_10001121 3300027866 Bacteria 5976
552 Ga0209974_10000714 3300027876 Bacteria 11353
553 Ga0207428_10000348 3300027907 Bacteria 59998
554 Ga0207428_10005414 3300027907 Bacteria 11904
555 Ga0207428_10090326 3300027907 Bacteria 2379
556 Ga0207428_10093179 3300027907 Bacteria 2337
557 Ga0268266_10055562 3300028379 Bacteria 3404
558 Ga0268266_10102008 3300028379 Bacteria 2530
559 Ga0268265_10002346 3300028380 Bacteria 14354
560 Ga0268265_10006977 3300028380 Bacteria 7642
561 Ga0268265_10078256 3300028380 Bacteria 2600
562 Ga0268265_10083502 3300028380 Bacteria 2529
563 Ga0268264_10000185 3300028381 Bacteria 131374
564 Ga0268264_10026277 3300028381 Bacteria 4756
565 Ga0268264_10178140 3300028381 Bacteria 1928
566 Ga0265334_10055104 3300028573 Bacteria 1514
567 Ga0265338_10208844 3300028800 Bacteria 1467
568 Ga0265770_1013382 3300030878 Bacteria 1227
569 Ga0265330_10165085 3300031235 Bacteria 939
570 Ga0265320_10009525 3300031240 Bacteria 5854
571 Ga0265329_10040072 3300031242 Bacteria 1503
572 Ga0265340_10119704 3300031247 Bacteria 1212
573 Ga0265339_10015996 3300031249 Bacteria 4482
574 Ga0265339_10036309 3300031249 Bacteria 2759
575 Ga0265331_10029942 3300031250 Bacteria 2713
576 Ga0307509_10007409 3300031507 Bacteria 14339
577 Ga0307408_100498722 3300031548 Bacteria 1065
578 Ga0265313_10001065 3300031595 Bacteria 26573
579 Ga0307508_10188540 3300031616 Bacteria 1663
580 Ga0265314_10003957 3300031711 Bacteria 14046
581 Ga0265314_10039124 3300031711 Bacteria 3420
582 Ga0265314_10048272 3300031711 Bacteria 2989
583 Ga0265342_10029931 3300031712 Bacteria 3378
584 Ga0307516_10001211 3300031730 Bacteria 35950
585 Ga0307406_10323945 3300031901 Bacteria 1193
586 Ga0307412_10305653 3300031911 Bacteria 1259
587 Ga0307416_100078453 3300032002 Bacteria 2779
588 Ga0307416_100311421 3300032002 Bacteria 1571
589 Ga0307411_10074312 3300032005 Bacteria 2316
590 Ga0307415_100299448 3300032126 Bacteria 1331
591 Ga0307507_10030517 3300033179 Bacteria 5685
592 Ga0307510_10121750 3300033180 Bacteria 2311
593 Ga0373950_0030769 3300034818 Bacteria 992
594 Ga0373950_0034094 3300034818 Bacteria 953
595 Ga0373958_0033593 3300034819 Bacteria 1018
596 Ga0373959_0010657 3300034820 Bacteria 1610
597 Ga0373926_0003405 3300035083 Bacteria 5125
598 Ga0373928_0005693 3300035084 Bacteria 2382
599 Ga0373928_0054902 3300035084 Bacteria 950
600 Ga0373940_0019900 3300035088 Bacteria 1700
601 Ga0373944_0008596 3300035089 Bacteria 2757
602 Ga0373944_0009950 3300035089 Bacteria 2585
603 Ga0373951_0036276 3300035091 Bacteria 1176
604 Ga0373923_0015627 3300035111 Bacteria 2869
605 Ga0373932_0006898 3300035112 Bacteria 2697
606 Ga0373932_0042428 3300035112 Bacteria 1319
607 Ga0373936_0013775 3300035113 Bacteria 3086
608 Ga0373936_0050570 3300035113 Bacteria 1681
609 Ga0373936_0084743 3300035113 Bacteria 1323
610 Ga0373939_0007202 3300035114 Bacteria 2697
611 Ga0373941_0017752 3300035115 Bacteria 1955
612 Ga0373945_0059529 3300035116 Bacteria 1422
613 Ga0373953_0001311 3300035117 Bacteria 7125
614 Ga0373954_0007164 3300035118 Bacteria 4870
615 Ga0373954_0047564 3300035118 Bacteria 2008
616 Ga0373954_0155016 3300035118 Bacteria 1120
617 Ga0373956_0010752 3300035119 Bacteria 3758
618 Ga0373957_0010481 3300035120 Bacteria 3065
619 Ga0373960_0013848 3300035121 Bacteria 2031
620 Ga0373943_0014099 3300035170 Bacteria 3614
621 Ga0373943_0098316 3300035170 Bacteria 1526
622 Ga0373946_0001981 3300035171 Bacteria 7165
623 Ga0373955_0010295 3300035172 Bacteria 4411
624 Ga0373942_0011956 3300035207 Bacteria 2065
625 Ga0373942_0014880 3300035207 Bacteria 1889
626 Ga0373961_0016401 3300035241 Bacteria 1908
627 Ga0373961_0051323 3300035241 Bacteria 1224
628 Ga0373924_0004646 3300035410 Bacteria 4813
629 Ga0373931_0000166 3300035691 Bacteria 28738
630 Ga0373931_0046692 3300035691 Bacteria 2290
631 Ga0373931_0116701 3300035691 Bacteria 1521
632 Ga0373935_0014415 3300035692 Bacteria 4769
633 Ga0373935_0037944 3300035692 Bacteria 3015
634 Ga0373935_0135126 3300035692 Bacteria 1661
635 Ga0373927_0027559 3300035695 Bacteria 3708
636 Ga0373927_0074190 3300035695 Bacteria 2203
637 Ga0373927_0104601 3300035695 Bacteria 1843
638 Ga0373927_0178788 3300035695 Bacteria 1391
639 Ga0373927_0200298 3300035695 Bacteria 1311
640 Ga0373927_0286960 3300035695 Bacteria 1083
641 Ga0373933_0014326 3300035724 Bacteria 4409
642 Ga0373933_0243216 3300035724 Bacteria 1157
643 Ga0373947_0007294 3300035725 Bacteria 6400
644 Ga0373947_0161699 3300035725 Bacteria 1449
645 Ga0373937_0012706 3300036401 Bacteria 7410
646 Ga0373937_0049137 3300036401 Bacteria 3863
647 Ga0373937_0188488 3300036401 Bacteria 1938
648 Ga0373937_0334992 3300036401 Bacteria 1432
649 Ga0373937_0830278 3300036401 Bacteria 872
650 Ga0373925_0155550 3300037068 Bacteria 1798
651 Ga0373925_0157408 3300037068 Bacteria 1787
652 Ga0373925_0168444 3300037068 Bacteria 1728
653 Ga0395899_0012702 3300037312 Bacteria 6453
654 Ga0395899_0058617 3300037312 Bacteria 2840
655 Ga0395900_0002247 3300037418 Bacteria 21493
656 Ga0395900_0002271 3300037418 Bacteria 21357
657 Ga0395900_0035217 3300037418 Bacteria 5156
658 Ga0395900_0192052 3300037418 Bacteria 2071
659 Ga0395898_0004503 3300037466 Bacteria 15232
660 Ga0395898_0004746 3300037466 Bacteria 14792
661 Ga0395898_0347505 3300037466 Bacteria 1414
662 Ga0436364_1170705 3300037853 Bacteria 2407
663 Ga0395901_0001831 3300038443 Bacteria 21964
664 Ga0395901_0002599 3300038443 Bacteria 18294
665 Ga0395901_0003317 3300038443 Bacteria 16221
666 Ga0395901_0105356 3300038443 Bacteria 2960
667 Ga0395901_0318822 3300038443 Bacteria 1609
668 Ga0436365_0015071 3300039437 Bacteria 3942
669 Ga0436365_0026985 3300039437 Bacteria 2510
670 Ga0436365_0133331 3300039437 Bacteria 992
671 Ga0436365_0893854 3300039437 Bacteria 10457
672 Ga0436365_1367547 3300039437 Bacteria 1035
673 Ga0436365_1494838 3300039437 Bacteria 1286
674 Ga0436360_0097146 3300039438 Bacteria 1688
675 Ga0436360_0195957 3300039438 Bacteria 2724
676 Ga0436360_0399216 3300039438 Bacteria 2846
677 Ga0436360_0643054 3300039438 Bacteria 1790
678 Ga0436360_1082434 3300039438 Bacteria 4042
679 Ga0436361_0430054 3300039447 Bacteria 933
680 Ga0436361_0709860 3300039447 Bacteria 1001
681 Ga0436361_1154927 3300039447 Bacteria 2595
682 Ga0436363_0150716 3300039450 Bacteria 2267
683 Ga0436363_0251745 3300039450 Bacteria 6871
684 Ga0436363_0311273 3300039450 Bacteria 990
685 Ga0436363_1126738 3300039450 Bacteria 1168
686 Ga0436363_1628040 3300039450 Bacteria 1093
687 Ga0436362_0816695 3300039453 Bacteria 1586
688 Ga0436362_1139972 3300039453 Bacteria 5026
689 Ga0439453_0007398 3300041408 Bacteria 1741
690 Ga0451807_1812818 3300041486 Bacteria 1326
691 Ga0451853_3273381 3300041512 Bacteria 1808
692 Ga0439441_011458 3300042001 Bacteria 1504
693 Ga0439448_0000117 3300042005 Bacteria 14757
694 Ga0439432_054549 3300042006 Bacteria 1242
695 Ga0450889_001760 3300042144 Bacteria 2191
696 Ga0439459_0005360 3300042438 Bacteria 2104
697 Ga0439464_0048673 3300042439 Bacteria 1222
698 Ga0439460_0023223 3300042461 Bacteria 1708
699 Ga0451577_0002467 3300042876 Bacteria 21994
700 Ga0453683_0163557 3300044673 Bacteria 1408
701 Ga0453683_0302945 3300044673 Bacteria 1022
702 Ga0466963_0115634 3300044694 Bacteria 1843
703 Ga0466964_0010040 3300044706 Bacteria 3567
704 Ga0453684_0018119 3300044712 Bacteria 10840
705 Ga0453684_0222653 3300044712 Bacteria 2184
706 Ga0466957_0059024 3300044842 Bacteria 2351
707 Ga0466957_0141944 3300044842 Bacteria 1548
708 Ga0466957_0261151 3300044842 Bacteria 1154
709 Ga0466957_0299491 3300044842 Bacteria 1080
710 Ga0466959_0055755 3300045049 Bacteria 2884
711 Ga0451576_0003327 3300045051 Bacteria 22273
712 Ga0451576_0044978 3300045051 Bacteria 4651
713 Ga0451576_0085302 3300045051 Bacteria 3285
714 Ga0451576_0116389 3300045051 Bacteria 2783
715 Ga0451576_0172198 3300045051 Bacteria 2259
716 Ga0451576_0334666 3300045051 Bacteria 1585
717 Ga0451576_0774923 3300045051 Bacteria 1007
718 Ga0466967_0023923 3300045976 Bacteria 5014
719 Ga0466967_0072518 3300045976 Bacteria 3086
720 Ga0466967_0499599 3300045976 Bacteria 1193
721 Ga0495592_0094341 3300046454 Bacteria 2142
722 Ga0495592_0156824 3300046454 Bacteria 1569
723 Ga0495603_0069137 3300046455 Bacteria 2078
724 Ga0495603_0073435 3300046455 Bacteria 2010
725 Ga0495629_0015176 3300046459 Bacteria 5536
726 Ga0495638_0259989 3300046460 Bacteria 952
727 Ga0495651_0262351 3300046462 Bacteria 1175
728 Ga0495580_0014077 3300046472 Bacteria 6081
729 Ga0495580_0173129 3300046472 Bacteria 1492
730 Ga0495605_0084487 3300046474 Bacteria 1480
731 Ga0495639_0020871 3300046475 Bacteria 2864
732 Ga0495664_0026941 3300046477 Bacteria 3349
733 Ga0495594_0111015 3300046499 Bacteria 1546
734 Ga0495608_0017406 3300046511 Bacteria 4970
735 Ga0495608_0017855 3300046511 Bacteria 4903
736 Ga0495618_0024590 3300046514 Bacteria 3731
737 Ga0495628_0015875 3300046516 Bacteria 6286
738 Ga0495644_0017912 3300046523 Bacteria 2706
739 Ga0495644_0044869 3300046523 Bacteria 1663
740 Ga0495642_0087056 3300046528 Bacteria 1320
741 Ga0495652_0216325 3300046529 Bacteria 1442
742 Ga0495652_0314288 3300046529 Bacteria 1134
743 Ga0495665_0067470 3300046531 Bacteria 1887
744 Ga0495640_0028742 3300046533 Bacteria 4000
745 Ga0495640_0181464 3300046533 Bacteria 1341
746 Ga0495586_0003380 3300046535 Bacteria 8561
747 Ga0495587_0010837 3300046536 Bacteria 5786
748 Ga0495587_0107954 3300046536 Bacteria 1600
749 Ga0495598_0021039 3300046537 Bacteria 1730
750 Ga0495598_0094738 3300046537 Bacteria 979
751 Ga0495621_0042342 3300046539 Bacteria 1603
752 Ga0495645_0016548 3300046543 Bacteria 5269
753 Ga0495667_0049207 3300046559 Bacteria 2782
754 Ga0495667_0060016 3300046559 Bacteria 2495
755 Ga0495668_0202508 3300046616 Bacteria 1087
756 Ga0495634_0005618 3300046642 Bacteria 9615
757 Ga0495635_0076908 3300046663 Bacteria 2287
758 Ga0495659_0078021 3300046664 Bacteria 1252
759 Ga0495588_0230405 3300046674 Bacteria 977
760 Ga0495599_0027883 3300046678 Bacteria 3538
761 Ga0495646_0086302 3300046680 Bacteria 1820
762 Ga0495647_0000532 3300046681 Bacteria 11168
763 Ga0495600_0023789 3300046809 Bacteria 3942
764 Ga0495600_0063653 3300046809 Bacteria 2410
765 Ga0495581_0030073 3300047315 Bacteria 3149
766 Ga0495604_0069264 3300047317 Bacteria 2674
767 Ga0495604_0208844 3300047317 Bacteria 1350
768 Ga0495604_0233382 3300047317 Bacteria 1261
769 Ga0495674_0032010 3300047319 Bacteria 4773
770 Ga0495676_0027854 3300047321 Bacteria 4840
771 Ga0495676_0145830 3300047321 Bacteria 1691
772 Ga0495680_0041762 3300047322 Bacteria 3644
773 Ga0495680_0068580 3300047322 Bacteria 2709
774 Ga0495675_0011969 3300047444 Bacteria 5452
775 Ga0495684_0026568 3300047471 Bacteria 4449
776 Ga0495684_0079506 3300047471 Bacteria 2489
777 Ga0495686_0135476 3300047472 Bacteria 1457
778 Ga0495602_0007106 3300048088 Bacteria 11751
779 Ga0496100_0032236 3300048903 Bacteria 3265
780 Ga0496100_0091227 3300048903 Bacteria 2079
781 Ga0496100_0100688 3300048903 Bacteria 1991
782 Ga0496101_0023361 3300048904 Bacteria 4271
783 Ga0496101_0043473 3300048904 Bacteria 3211
784 Ga0496102_0010410 3300048905 Bacteria 8003
785 Ga0496102_0080745 3300048905 Bacteria 2996
786 Ga0496102_0192330 3300048905 Bacteria 1923
787 Ga0496102_0223265 3300048905 Bacteria 1776
788 Ga0496102_0246590 3300048905 Bacteria 1684
789 Ga0496104_0000358 3300048907 Bacteria 40736
790 Ga0496104_0013029 3300048907 Bacteria 7488
791 Ga0496104_0045750 3300048907 Bacteria 4117
792 Ga0496104_0082559 3300048907 Bacteria 3064
793 Ga0496104_0083875 3300048907 Bacteria 3040
794 Ga0496104_0099452 3300048907 Bacteria 2785
795 Ga0496104_0129640 3300048907 Bacteria 2422
796 Ga0496104_0197340 3300048907 Bacteria 1924
797 Ga0496104_0503717 3300048907 Bacteria 1122
798 Ga0496105_0014385 3300048908 Bacteria 6297
799 Ga0496105_0048427 3300048908 Bacteria 3508
800 Ga0496105_0054223 3300048908 Bacteria 3310
801 Ga0496105_0069047 3300048908 Bacteria 2920
802 Ga0496106_0010966 3300048909 Bacteria 6701
803 Ga0496106_0030363 3300048909 Bacteria 4031
804 Ga0496106_0200259 3300048909 Bacteria 1589
805 Ga0496106_0551911 3300048909 Bacteria 924
806 Ga0496107_0017835 3300048910 Bacteria 4996
807 Ga0496107_0019534 3300048910 Bacteria 4781
808 Ga0496107_0050042 3300048910 Bacteria 3012
809 Ga0496107_0056838 3300048910 Bacteria 2827
810 Ga0496107_0158153 3300048910 Bacteria 1678
811 Ga0496107_0161270 3300048910 Bacteria 1662
812 Ga0496108_0040364 3300048911 Bacteria 3890
813 Ga0496108_0045344 3300048911 Bacteria 3672
814 Ga0496108_0049184 3300048911 Bacteria 3526
815 Ga0496108_0101622 3300048911 Bacteria 2453
816 Ga0496108_0204292 3300048911 Bacteria 1714
817 Ga0496108_0277717 3300048911 Bacteria 1458
818 Ga0496109_0003211 3300048912 Bacteria 13608
819 Ga0496109_0021552 3300048912 Bacteria 5700
820 Ga0496109_0025246 3300048912 Bacteria 5293
821 Ga0496109_0029973 3300048912 Bacteria 4876
822 Ga0496109_0072899 3300048912 Bacteria 3155
823 Ga0496109_0244595 3300048912 Bacteria 1689
824 Ga0496109_0299142 3300048912 Bacteria 1517
825 Ga0496109_0330334 3300048912 Bacteria 1439
826 Ga0496109_0429726 3300048912 Bacteria 1248
827 Ga0496110_0004167 3300048913 Bacteria 11165
828 Ga0496110_0014947 3300048913 Bacteria 6453
829 Ga0496110_0021327 3300048913 Bacteria 5482
830 Ga0496110_0054188 3300048913 Bacteria 3527
831 Ga0496110_0275684 3300048913 Bacteria 1531
832 Ga0496111_0021427 3300048914 Bacteria 4513
833 Ga0496111_0025670 3300048914 Bacteria 4158
834 Ga0496111_0032087 3300048914 Bacteria 3744
835 Ga0496111_0070832 3300048914 Bacteria 2537
836 Ga0496112_0017288 3300048915 Bacteria 6772
837 Ga0496112_0064301 3300048915 Bacteria 3620
838 Ga0496112_0106883 3300048915 Bacteria 2768
839 Ga0496112_0261948 3300048915 Bacteria 1678
840 Ga0496112_0294047 3300048915 Bacteria 1570
841 Ga0496113_0055903 3300048916 Bacteria 2960
842 Ga0496114_0164730 3300048917 Bacteria 1929
843 Ga0496115_0003906 3300048918 Bacteria 10741
844 Ga0496115_0081649 3300048918 Bacteria 2633
845 Ga0496115_0154432 3300048918 Bacteria 1896
846 Ga0496115_0225357 3300048918 Bacteria 1546
847 Ga0496117_0110468 3300048920 Bacteria 1714
848 Ga0496118_0016521 3300048921 Bacteria 6768
849 Ga0496119_0108517 3300048922 Bacteria 1545
850 Ga0496120_0054274 3300048923 Bacteria 2272
851 Ga0496121_0000668 3300048924 Bacteria 64093
852 Ga0496121_0035985 3300048924 Bacteria 4421
853 Ga0496121_0063085 3300048924 Bacteria 3031
854 Ga0496124_0003401 3300048927 Bacteria 19546
855 Ga0496125_0190072 3300048928 Bacteria 1357
856 Ga0496126_0006242 3300048929 Bacteria 13320
857 Ga0496126_0015566 3300048929 Bacteria 7643
858 Ga0501033_0024046 3300049570 Bacteria 4597
859 Ga0501033_0028100 3300049570 Bacteria 4228
860 Ga0501034_0001484 3300049571 Bacteria 30939
861 Ga0501034_0004456 3300049571 Bacteria 15570
862 Ga0501038_0078548 3300049574 Bacteria 2785
863 Ga0501039_0018197 3300049575 Bacteria 5393
864 Ga0501039_0080131 3300049575 Bacteria 2541
865 Ga0501039_0122847 3300049575 Bacteria 2035
866 Ga0501040_0019560 3300049576 Bacteria 4505
867 Ga0501040_0032234 3300049576 Bacteria 3546
868 Ga0501041_0002404 3300049577 Bacteria 10600
869 Ga0501041_0008967 3300049577 Bacteria 5885
870 Ga0501041_0030715 3300049577 Bacteria 3243
871 Ga0501041_0211195 3300049577 Bacteria 1217
872 Ga0501042_0005575 3300049578 Bacteria 8109
873 Ga0501042_0219033 3300049578 Bacteria 1373
874 Ga0501042_0314131 3300049578 Bacteria 1132
875 Ga0501046_0106450 3300049580 Bacteria 2146
876 Ga0501047_0344693 3300049581 Bacteria 1327
877 Ga0501067_0059452 3300049583 Bacteria 2116
878 Ga0501068_0040625 3300049584 Bacteria 2793
879 Ga0501070_0069511 3300049586 Bacteria 2915
880 Ga0501070_0214174 3300049586 Bacteria 1581
881 Ga0501072_0183106 3300049588 Bacteria 1671
882 Ga0501074_0047671 3300049590 Bacteria 3096
883 Ga0501075_0012445 3300049591 Bacteria 6047
884 Ga0501075_0015379 3300049591 Bacteria 5491
885 Ga0501076_0011883 3300049592 Bacteria 6502
886 Ga0501076_0020356 3300049592 Bacteria 5078
887 Ga0501077_0036140 3300049593 Bacteria 3146
888 Ga0501079_0004657 3300049741 Bacteria 10161
889 Ga0501080_0007219 3300049742 Bacteria 10030
890 Ga0501080_0169417 3300049742 Bacteria 2014
891 Ga0501081_0000770 3300049743 Bacteria 18795
892 Ga0501035_0137942 3300049822 Bacteria 2122
893 Ga0501035_0466629 3300049822 Bacteria 1043
894 Ga0501044_0029952 3300049823 Bacteria 5738
895 Ga0501044_0052437 3300049823 Bacteria 4203
896 Ga0501044_0575339 3300049823 Bacteria 1021
897 Ga0501045_0067122 3300049824 Bacteria 2634
898 nmdc:mga03683_23583_c1 3300050489 Bacteria 2398
899 nmdc:mga03683_58258_c1 3300050489 Bacteria 1627
900 nmdc:mga03683_6258_c1 3300050489 Bacteria 4065
901 nmdc:mga03n38_120198_c1 3300050490 Bacteria 1290
902 nmdc:mga03n38_131368_c1 3300050490 Bacteria 1241
903 nmdc:mga00v17_157452_c1 3300050491 Bacteria 1461
904 nmdc:mga00v17_279191_c1 3300050491 Bacteria 1084
905 nmdc:mga0yw44_144645_c1 3300050492 Bacteria 1547
906 nmdc:mga0yw44_21824_c1 3300050492 Bacteria 3579
907 nmdc:mga0k408_12201_c1 3300050493 Bacteria 4695
908 nmdc:mga06z11_2002_c1 3300050494 Bacteria 7714
909 nmdc:mga04h51_1961_c1 3300050495 Bacteria 4799
910 nmdc:mga04h51_27778_c1 3300050495 Bacteria 1761
911 nmdc:mga07m45_40538_c1 3300050496 Bacteria 2605
912 nmdc:mga05p37_124989_c1 3300050507 Bacteria 3159
913 nmdc:mga05p37_268_c1 3300050507 Bacteria 53897
914 nmdc:mga05p37_293713_c1 3300050507 Bacteria 1934
915 nmdc:mga05p37_328420_c1 3300050507 Bacteria 1808
916 nmdc:mga05p37_33437_c1 3300050507 Bacteria 6298
917 nmdc:mga05p37_364116_c1 3300050507 Bacteria 1699
918 nmdc:mga05p37_397457_c1 3300050507 Bacteria 1610
919 nmdc:mga05p37_73435_c1 3300050507 Bacteria 4210
920 nmdc:mga05p37_77_c1 3300050507 Bacteria 86224
921 nmdc:mga05p37_95699_c1 3300050507 Bacteria 3658
922 nmdc:mga09592_12464_c1 3300050508 Bacteria 6926
923 nmdc:mga09592_140_c1 3300050508 Bacteria 48059
924 nmdc:mga09592_17731_c1 3300050508 Bacteria 5835
925 nmdc:mga0qj67_11947_c1 3300050509 Bacteria 6525
926 nmdc:mga0qj67_25259_c1 3300050509 Bacteria 4589
927 nmdc:mga0qj67_42245_c1 3300050509 Bacteria 3589
928 nmdc:mga0qj67_4986_c1 3300050509 Bacteria 9647
929 nmdc:mga06r32_10732_c1 3300050510 Bacteria 8250
930 nmdc:mga06r32_133_c1 3300050510 Bacteria 53973
931 nmdc:mga06r32_137946_c1 3300050510 Bacteria 2414
932 nmdc:mga06r32_34853_c1 3300050510 Bacteria 4748
933 nmdc:mga06r32_3616_c1 3300050510 Bacteria 13796
934 nmdc:mga06r32_61973_c1 3300050510 Bacteria 3602
935 nmdc:mga06r32_62760_c1 3300050510 Bacteria 3580
936 nmdc:mga06r32_7599_c1 3300050510 Bacteria 9744
937 nmdc:mga08y16_126145_c1 3300050511 Bacteria 2663
938 nmdc:mga08y16_146589_c1 3300050511 Bacteria 2454
939 nmdc:mga08y16_173809_c1 3300050511 Bacteria 2237
940 nmdc:mga08y16_348511_c1 3300050511 Bacteria 1521
941 nmdc:mga08y16_430888_c1 3300050511 Bacteria 1347
942 nmdc:mga08y16_5208_c1 3300050511 Bacteria 13581
943 nmdc:mga08y16_604_c1 3300050511 Bacteria 33484
944 nmdc:mga0n895_10909_c1 3300050512 Bacteria 8072
945 nmdc:mga0n895_112146_c1 3300050512 Bacteria 2744
946 nmdc:mga0n895_336813_c1 3300050512 Bacteria 1528
947 nmdc:mga0n895_6328_c1 3300050512 Bacteria 10039
948 nmdc:mga0rr50_104400_c1 3300050513 Bacteria 2232
949 nmdc:mga0rr50_156837_c1 3300050513 Bacteria 1844
950 nmdc:mga0rr50_522826_c1 3300050513 Bacteria 1010
951 nmdc:mga0rr50_70272_c1 3300050513 Bacteria 2668
952 nmdc:mga0rr50_71210_c1 3300050513 Bacteria 2652
953 nmdc:mga0rr50_7940_c1 3300050513 Bacteria 6584
954 nmdc:mga08x19_16429_c1 3300050514 Bacteria 4516
955 nmdc:mga08x19_1956_c1 3300050514 Bacteria 12595
956 nmdc:mga08x19_59784_c1 3300050514 Bacteria 2468
957 nmdc:mga08x19_96455_c1 3300050514 Bacteria 1957
958 nmdc:mga0a205_10383_c1 3300050515 Bacteria 8557
959 nmdc:mga0a205_11223_c1 3300050515 Bacteria 8244
960 nmdc:mga0a205_27624_c1 3300050515 Bacteria 5420
961 nmdc:mga0a205_285699_c1 3300050515 Bacteria 1525
962 nmdc:mga0a205_71646_c1 3300050515 Bacteria 3347
963 nmdc:mga0a205_99668_c1 3300050515 Bacteria 2804
964 nmdc:mga0sz30_51761_c1 3300050516 Bacteria 1743
965 Ga0495601_0009955 3300053077 Bacteria 5634
966 Ga0495601_0041808 3300053077 Bacteria 2874
967 Ga0495601_0243540 3300053077 Bacteria 1174
968 Ga0495612_0007865 3300053078 Bacteria 4347
969 Ga0495595_0014758 3300053084 Bacteria 3321
970 Ga0495595_0088653 3300053084 Bacteria 1482
971 Ga0495595_0187834 3300053084 Bacteria 1026
972 Ga0495619_0011890 3300053085 Bacteria 5481
973 Ga0495619_0035699 3300053085 Bacteria 3234
974 Ga0495619_0083605 3300053085 Bacteria 2153
975 Ga0495619_0134189 3300053085 Bacteria 1702
976 Ga0500566_0000131 3300053094 Bacteria 38186
977 Ga0500640_104280 3300053095 Bacteria 1166
978 Ga0500572_000369 3300053111 Bacteria 16000
979 Ga0500572_015069 3300053111 Bacteria 1943
980 Ga0500595_000286 3300053119 Bacteria 33353
981 Ga0500595_004482 3300053119 Bacteria 6256
982 Ga0500595_010217 3300053119 Bacteria 3740
983 Ga0500608_092183 3300053122 Bacteria 1414
984 Ga0500614_002288 3300053123 Bacteria 4305
985 Ga0500559_0000301 3300053136 Bacteria 37742
986 Ga0500559_0069392 3300053136 Bacteria 1584
987 Ga0500603_000193 3300053150 Bacteria 15937
988 Ga0500603_009964 3300053150 Bacteria 2136
989 Ga0500616_0000385 3300053153 Bacteria 61815
990 Ga0500630_018258 3300053159 Bacteria 3460
991 Ga0500638_000725 3300053162 Bacteria 8877
992 Ga0500638_154855 3300053162 Bacteria 1015
993 Ga0500639_006329 3300053163 Bacteria 6115
994 Ga0500636_0017052 3300053177 Bacteria 4284
995 Ga0500636_0057929 3300053177 Bacteria 2266
996 Ga0500637_0000135 3300053178 Bacteria 27083
997 Ga0500601_005824 3300053737 Bacteria 1354
998 Ga0501084_0142736 3300054114 Bacteria 2017
999 Ga0500661_005425 3300055283 Bacteria 2384
1000 Ga0590071_006828 3300059421 Bacteria 2706
1001 Ga0501082_0169733 3300060353 Bacteria 1896
1002 Ga0530510_0000216 3300061734 Bacteria 35741
1003 Ga0530510_0003154 3300061734 Bacteria 11320
1004 Ga0530510_0039593 3300061734 Bacteria 3403

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10266182 Ga0157371_102661822 239
2 3300036401 Ga0373937_0830278 Ga0373937_0830278_75_851 246
3 3300047317 Ga0495604_0208844 Ga0495604_0208844_555_1331 246
4 3300050490 nmdc:mga03n38_131368_c1 nmdc:mga03n38_131368_c1_312_1088 246
5 3300050494 nmdc:mga06z11_2002_c1 nmdc:mga06z11_2002_c1_847_1623 246
6 3300050495 nmdc:mga04h51_1961_c1 nmdc:mga04h51_1961_c1_156_932 246
7 3300005329 Ga0070683_100015757 Ga0070683_1000157576 261
8 3300005331 Ga0070670_100007487 Ga0070670_1000074872 261
9 3300005335 Ga0070666_10066982 Ga0070666_100669824 261
10 3300005338 Ga0068868_100000913 Ga0068868_10000091312 261
11 3300005344 Ga0070661_100004972 Ga0070661_1000049728 261
12 3300005345 Ga0070692_10355987 Ga0070692_103559871 261
13 3300005354 Ga0070675_100002216 Ga0070675_10000221611 261
14 3300005355 Ga0070671_100005082 Ga0070671_10000508211 261
15 3300005364 Ga0070673_100004294 Ga0070673_10000429411 261
16 3300005367 Ga0070667_100012473 Ga0070667_1000124734 261
17 3300005455 Ga0070663_100454869 Ga0070663_1004548691 261
18 3300005456 Ga0070678_100000640 Ga0070678_10000064011 261
19 3300005459 Ga0068867_100065528 Ga0068867_1000655282 261
20 3300005535 Ga0070684_100030692 Ga0070684_1000306924 261
21 3300005543 Ga0070672_100000756 Ga0070672_10000075612 261
22 3300005564 Ga0070664_100006519 Ga0070664_1000065192 261
23 3300005578 Ga0068854_100006822 Ga0068854_1000068222 261
24 3300005616 Ga0068852_100001088 Ga0068852_10000108813 261
25 3300005618 Ga0068864_100013872 Ga0068864_1000138722 261
26 3300005841 Ga0068863_100083763 Ga0068863_1000837632 261
27 3300005842 Ga0068858_100563949 Ga0068858_1005639491 261
28 3300006237 Ga0097621_100005490 Ga0097621_10000549011 261
29 3300006358 Ga0068871_100001017 Ga0068871_10000101710 261
30 3300013296 Ga0157374_10008483 Ga0157374_100084833 261
31 3300013308 Ga0157375_10055192 Ga0157375_100551922 261
32 3300025321 Ga0207656_10005307 Ga0207656_100053077 261
33 3300025920 Ga0207649_10017532 Ga0207649_100175323 261
34 3300025926 Ga0207659_10026148 Ga0207659_100261482 261
35 3300025931 Ga0207644_10041790 Ga0207644_100417902 261
36 3300025940 Ga0207691_10000521 Ga0207691_1000052119 261
37 3300025944 Ga0207661_10002623 Ga0207661_100026233 261
38 3300025945 Ga0207679_10024346 Ga0207679_100243463 261
39 3300025960 Ga0207651_10005670 Ga0207651_100056706 261
40 3300025981 Ga0207640_10011956 Ga0207640_100119562 261
41 3300026023 Ga0207677_10004363 Ga0207677_100043636 261
42 3300026088 Ga0207641_10154757 Ga0207641_101547572 261
43 3300026089 Ga0207648_10042389 Ga0207648_100423894 261
44 3300026095 Ga0207676_10047575 Ga0207676_100475752 261
45 3300026121 Ga0207683_10000576 Ga0207683_100005763 261
46 3300026142 Ga0207698_10002415 Ga0207698_1000241511 261
47 3300031730 Ga0307516_10001211 Ga0307516_1000121123 261
48 3300033180 Ga0307510_10121750 Ga0307510_101217502 261
49 iso_pu_bacteria 2513237141 2513888705 263
50 3300005329 Ga0070683_100000791 Ga0070683_10000079124 264
51 3300005330 Ga0070690_100060130 Ga0070690_1000601303 264
52 3300005331 Ga0070670_100001030 Ga0070670_1000010303 264
53 3300005334 Ga0068869_100024561 Ga0068869_1000245612 264
54 3300005338 Ga0068868_100002406 Ga0068868_1000024062 264
55 3300005338 Ga0068868_100184928 Ga0068868_1001849281 264
56 3300005340 Ga0070689_100127552 Ga0070689_1001275522 264
57 3300005344 Ga0070661_100007089 Ga0070661_1000070897 264
58 3300005353 Ga0070669_100101261 Ga0070669_1001012613 264
59 3300005354 Ga0070675_100001929 Ga0070675_10000192916 264
60 3300005355 Ga0070671_100031325 Ga0070671_1000313253 264
61 3300005356 Ga0070674_100239269 Ga0070674_1002392692 264
62 3300005364 Ga0070673_100032903 Ga0070673_1000329033 264
63 3300005364 Ga0070673_100232277 Ga0070673_1002322772 264
64 3300005366 Ga0070659_100209780 Ga0070659_1002097802 264
65 3300005367 Ga0070667_100136242 Ga0070667_1001362423 264
66 3300005441 Ga0070700_100062043 Ga0070700_1000620432 264
67 3300005455 Ga0070663_100238632 Ga0070663_1002386321 264
68 3300005456 Ga0070678_100003210 Ga0070678_1000032108 264
69 3300005457 Ga0070662_100076697 Ga0070662_1000766973 264
70 3300005459 Ga0068867_100068789 Ga0068867_1000687893 264
71 3300005466 Ga0070685_10140715 Ga0070685_101407152 264
72 3300005543 Ga0070672_100001321 Ga0070672_10000132117 264
73 3300005547 Ga0070693_100062384 Ga0070693_1000623842 264
74 3300005564 Ga0070664_100039095 Ga0070664_1000390953 264
75 3300005578 Ga0068854_100027180 Ga0068854_1000271803 264
76 3300005615 Ga0070702_100099719 Ga0070702_1000997192 264
77 3300005616 Ga0068852_100003525 Ga0068852_10000352511 264
78 3300005617 Ga0068859_100263614 Ga0068859_1002636141 264
79 3300005618 Ga0068864_100088756 Ga0068864_1000887562 264
80 3300005718 Ga0068866_10302339 Ga0068866_103023391 264
81 3300005834 Ga0068851_10012174 Ga0068851_100121743 264
82 3300005840 Ga0068870_10039704 Ga0068870_100397042 264
83 3300005841 Ga0068863_100080491 Ga0068863_1000804911 264
84 3300006237 Ga0097621_100001375 Ga0097621_10000137516 264
85 3300006358 Ga0068871_100055451 Ga0068871_1000554513 264
86 3300006881 Ga0068865_100047363 Ga0068865_1000473631 264
87 3300006931 Ga0097620_100263626 Ga0097620_1002636261 264
88 3300009098 Ga0105245_10187866 Ga0105245_101878661 264
89 3300009148 Ga0105243_10562352 Ga0105243_105623521 264
90 3300013296 Ga0157374_10050173 Ga0157374_100501732 264
91 3300013297 Ga0157378_10073414 Ga0157378_100734141 264
92 3300013297 Ga0157378_10207784 Ga0157378_102077842 264
93 3300013306 Ga0163162_10103175 Ga0163162_101031751 264
94 3300013308 Ga0157375_10010239 Ga0157375_100102397 264
95 3300014969 Ga0157376_10016314 Ga0157376_100163142 264
96 3300025321 Ga0207656_10024914 Ga0207656_100249141 264
97 3300025903 Ga0207680_10012253 Ga0207680_100122533 264
98 3300025907 Ga0207645_10189163 Ga0207645_101891632 264
99 3300025908 Ga0207643_10040490 Ga0207643_100404903 264
100 3300025920 Ga0207649_10018651 Ga0207649_100186513 264
101 3300025925 Ga0207650_10007352 Ga0207650_100073527 264
102 3300025926 Ga0207659_10097269 Ga0207659_100972692 264
103 3300025931 Ga0207644_10024145 Ga0207644_100241452 264
104 3300025931 Ga0207644_10320333 Ga0207644_103203332 264
105 3300025933 Ga0207706_10013378 Ga0207706_100133785 264
106 3300025933 Ga0207706_10086601 Ga0207706_100866011 264
107 3300025935 Ga0207709_10487196 Ga0207709_104871961 264
108 3300025936 Ga0207670_10251610 Ga0207670_102516102 264
109 3300025938 Ga0207704_10031936 Ga0207704_100319362 264
110 3300025940 Ga0207691_10017685 Ga0207691_100176857 264
111 3300025942 Ga0207689_10079309 Ga0207689_100793091 264
112 3300025945 Ga0207679_10092320 Ga0207679_100923202 264
113 3300025960 Ga0207651_10028072 Ga0207651_100280723 264
114 3300025961 Ga0207712_10126562 Ga0207712_101265621 264
115 3300025972 Ga0207668_10270481 Ga0207668_102704811 264
116 3300025981 Ga0207640_10013130 Ga0207640_100131303 264
117 3300026088 Ga0207641_10018656 Ga0207641_100186566 264
118 3300026088 Ga0207641_10289975 Ga0207641_102899752 264
119 3300026089 Ga0207648_10095401 Ga0207648_100954012 264
120 3300026095 Ga0207676_10031026 Ga0207676_100310263 264
121 3300026116 Ga0207674_10558095 Ga0207674_105580951 264
122 3300026118 Ga0207675_100349091 Ga0207675_1003490912 264
123 3300026121 Ga0207683_10001256 Ga0207683_1000125620 264
124 3300026121 Ga0207683_10306855 Ga0207683_103068551 264
125 3300026142 Ga0207698_10007863 Ga0207698_100078632 264
126 3300028380 Ga0268265_10078256 Ga0268265_100782562 264
127 3300041486 Ga0451807_1812818 Ga0451807_1812818_140_985 264
128 3300041512 Ga0451853_3273381 Ga0451853_3273381_526_1371 264
129 3300046474 Ga0495605_0084487 Ga0495605_0084487_244_1086 264
130 3300046528 Ga0495642_0087056 Ga0495642_0087056_250_1092 264
131 3300046539 Ga0495621_0042342 Ga0495621_0042342_653_1498 264
132 3300048903 Ga0496100_0100688 Ga0496100_0100688_987_1832 264
133 3300048905 Ga0496102_0192330 Ga0496102_0192330_666_1511 264
134 3300048907 Ga0496104_0083875 Ga0496104_0083875_689_1534 264
135 3300048909 Ga0496106_0200259 Ga0496106_0200259_240_1085 264
136 3300048911 Ga0496108_0045344 Ga0496108_0045344_657_1502 264
137 3300048912 Ga0496109_0429726 Ga0496109_0429726_224_1069 264
138 3300048913 Ga0496110_0014947 Ga0496110_0014947_3907_4752 264
139 iso_pu_bacteria 2513237101 2513695718 264
140 iso_pu_bacteria 2721755755 2723846966 264
141 iso_pu_bacteria 2791355199 2793084254 264
142 iso_pu_bacteria 2874604998 2874611069 264
143 iso_pu_bacteria 2876808645 2876811908 264
144 iso_pu_bacteria 2879110137 2879117368 264
145 iso_pu_bacteria 2922361189 2922362660 264
146 iso_pu_bacteria 2922386360 2922387526 264
147 iso_pu_bacteria 2929199973 2929202666 264
148 iso_pu_bacteria 8006964411 8006968463 264
149 iso_pu_bacteria 8006984368 8006984814 264
150 iso_pu_bacteria 8055909800 8055910238 264
151 3300044842 Ga0466957_0299491 Ga0466957_0299491_36_881 265
152 3300005468 Ga0070707_100298481 Ga0070707_1002984813 266
153 3300025910 Ga0207684_10080444 Ga0207684_100804444 266
154 3300031711 Ga0265314_10003957 Ga0265314_100039576 266
155 3300049578 Ga0501042_0219033 Ga0501042_0219033_302_1144 266
156 3300003659 JGI25404J52841_10001411 JGI25404J52841_100014115 267
157 3300005290 Ga0065712_10018464 Ga0065712_100184642 267
158 3300005364 Ga0070673_100077263 Ga0070673_1000772632 267
159 3300005436 Ga0070713_100007564 Ga0070713_1000075642 267
160 3300005456 Ga0070678_100549068 Ga0070678_1005490681 267
161 3300005467 Ga0070706_100385076 Ga0070706_1003850761 267
162 3300005617 Ga0068859_100112847 Ga0068859_1001128472 267
163 3300005981 Ga0081538_10044258 Ga0081538_100442582 267
164 3300005983 Ga0081540_1000374 Ga0081540_100037446 267
165 3300006028 Ga0070717_10035339 Ga0070717_100353392 267
166 3300006048 Ga0075363_100038980 Ga0075363_1000389802 267
167 3300006051 Ga0075364_10050605 Ga0075364_100506052 267
168 3300006173 Ga0070716_100055965 Ga0070716_1000559653 267
169 3300006177 Ga0075362_10033366 Ga0075362_100333662 267
170 3300006178 Ga0075367_10008292 Ga0075367_100082924 267
171 3300006195 Ga0075366_10091024 Ga0075366_100910242 267
172 3300006844 Ga0075428_100008280 Ga0075428_10000828011 267
173 3300006844 Ga0075428_100014675 Ga0075428_1000146757 267
174 3300006844 Ga0075428_100047019 Ga0075428_1000470195 267
175 3300006846 Ga0075430_100008019 Ga0075430_1000080196 267
176 3300006847 Ga0075431_100000109 Ga0075431_10000010918 267
177 3300006847 Ga0075431_100005848 Ga0075431_1000058484 267
178 3300006847 Ga0075431_100050589 Ga0075431_1000505892 267
179 3300006871 Ga0075434_100010330 Ga0075434_1000103304 267
180 3300006880 Ga0075429_100020823 Ga0075429_1000208232 267
181 3300006880 Ga0075429_100061447 Ga0075429_1000614472 267
182 3300006881 Ga0068865_100112910 Ga0068865_1001129102 267
183 3300006914 Ga0075436_100000611 Ga0075436_1000006118 267
184 3300006914 Ga0075436_100050850 Ga0075436_1000508502 267
185 3300006931 Ga0097620_100112848 Ga0097620_1001128482 267
186 3300007076 Ga0075435_100003813 Ga0075435_1000038133 267
187 3300009094 Ga0111539_10000684 Ga0111539_100006845 267
188 3300009094 Ga0111539_10078453 Ga0111539_100784533 267
189 3300009147 Ga0114129_10000425 Ga0114129_1000042515 267
190 3300009147 Ga0114129_10101093 Ga0114129_101010935 267
191 3300009147 Ga0114129_10504961 Ga0114129_105049612 267
192 3300014326 Ga0157380_10114633 Ga0157380_101146332 267
193 3300025893 Ga0207682_10000949 Ga0207682_1000094910 267
194 3300025928 Ga0207700_10024377 Ga0207700_100243774 267
195 3300025933 Ga0207706_10177687 Ga0207706_101776872 267
196 3300025937 Ga0207669_10017679 Ga0207669_100176792 267
197 3300025938 Ga0207704_10409460 Ga0207704_104094601 267
198 3300025938 Ga0207704_10490779 Ga0207704_104907791 267
199 3300025960 Ga0207651_10060806 Ga0207651_100608062 267
200 3300025972 Ga0207668_10118739 Ga0207668_101187392 267
201 3300026035 Ga0207703_10149895 Ga0207703_101498953 267
202 3300026075 Ga0207708_10234827 Ga0207708_102348271 267
203 3300026095 Ga0207676_10281306 Ga0207676_102813063 267
204 3300026121 Ga0207683_10092520 Ga0207683_100925202 267
205 3300027907 Ga0207428_10005414 Ga0207428_100054142 267
206 3300028380 Ga0268265_10006977 Ga0268265_100069774 267
207 3300035083 Ga0373926_0003405 Ga0373926_0003405_3323_4162 267
208 3300035084 Ga0373928_0005693 Ga0373928_0005693_1271_2107 267
209 3300035089 Ga0373944_0008596 Ga0373944_0008596_1299_2138 267
210 3300035089 Ga0373944_0009950 Ga0373944_0009950_1267_2106 267
211 3300035112 Ga0373932_0042428 Ga0373932_0042428_204_1040 267
212 3300035113 Ga0373936_0013775 Ga0373936_0013775_219_1058 267
213 3300035116 Ga0373945_0059529 Ga0373945_0059529_348_1187 267
214 3300035170 Ga0373943_0014099 Ga0373943_0014099_620_1459 267
215 3300035170 Ga0373943_0098316 Ga0373943_0098316_234_1073 267
216 3300035171 Ga0373946_0001981 Ga0373946_0001981_233_1072 267
217 3300035207 Ga0373942_0011956 Ga0373942_0011956_644_1480 267
218 3300035241 Ga0373961_0051323 Ga0373961_0051323_361_1197 267
219 3300035692 Ga0373935_0014415 Ga0373935_0014415_214_1053 267
220 3300035695 Ga0373927_0027559 Ga0373927_0027559_242_1081 267
221 3300035695 Ga0373927_0178788 Ga0373927_0178788_409_1248 267
222 3300035725 Ga0373947_0007294 Ga0373947_0007294_4942_5781 267
223 3300036401 Ga0373937_0334992 Ga0373937_0334992_193_1032 267
224 3300037068 Ga0373925_0157408 Ga0373925_0157408_534_1373 267
225 3300037068 Ga0373925_0168444 Ga0373925_0168444_236_1075 267
226 3300039438 Ga0436360_0643054 Ga0436360_0643054_141_980 267
227 3300039447 Ga0436361_0709860 Ga0436361_0709860_95_934 267
228 3300044706 Ga0466964_0010040 Ga0466964_0010040_2592_3437 267
229 3300044842 Ga0466957_0059024 Ga0466957_0059024_307_1152 267
230 3300045051 Ga0451576_0334666 Ga0451576_0334666_298_1143 267
231 3300045976 Ga0466967_0023923 Ga0466967_0023923_3451_4296 267
232 3300046454 Ga0495592_0156824 Ga0495592_0156824_136_975 267
233 3300046455 Ga0495603_0069137 Ga0495603_0069137_144_983 267
234 3300046459 Ga0495629_0015176 Ga0495629_0015176_1356_2204 267
235 3300046472 Ga0495580_0014077 Ga0495580_0014077_3704_4543 267
236 3300046475 Ga0495639_0020871 Ga0495639_0020871_823_1662 267
237 3300046499 Ga0495594_0111015 Ga0495594_0111015_85_924 267
238 3300046516 Ga0495628_0015875 Ga0495628_0015875_3781_4620 267
239 3300046529 Ga0495652_0216325 Ga0495652_0216325_149_988 267
240 3300046531 Ga0495665_0067470 Ga0495665_0067470_59_898 267
241 3300046535 Ga0495586_0003380 Ga0495586_0003380_131_970 267
242 3300046536 Ga0495587_0107954 Ga0495587_0107954_725_1564 267
243 3300046537 Ga0495598_0094738 Ga0495598_0094738_66_905 267
244 3300046559 Ga0495667_0049207 Ga0495667_0049207_1444_2283 267
245 3300046663 Ga0495635_0076908 Ga0495635_0076908_1044_1883 267
246 3300046678 Ga0495599_0027883 Ga0495599_0027883_107_946 267
247 3300046680 Ga0495646_0086302 Ga0495646_0086302_758_1597 267
248 3300046681 Ga0495647_0000532 Ga0495647_0000532_9427_10266 267
249 3300046809 Ga0495600_0063653 Ga0495600_0063653_811_1650 267
250 3300047315 Ga0495581_0030073 Ga0495581_0030073_1572_2411 267
251 3300047317 Ga0495604_0069264 Ga0495604_0069264_935_1774 267
252 3300047321 Ga0495676_0027854 Ga0495676_0027854_1427_2266 267
253 3300047444 Ga0495675_0011969 Ga0495675_0011969_837_1676 267
254 3300047471 Ga0495684_0026568 Ga0495684_0026568_279_1118 267
255 3300048907 Ga0496104_0000358 Ga0496104_0000358_7152_7994 267
256 3300048907 Ga0496104_0082559 Ga0496104_0082559_609_1457 267
257 3300048908 Ga0496105_0014385 Ga0496105_0014385_51_890 267
258 3300048908 Ga0496105_0069047 Ga0496105_0069047_853_1695 267
259 3300048911 Ga0496108_0049184 Ga0496108_0049184_1758_2606 267
260 3300048912 Ga0496109_0003211 Ga0496109_0003211_969_1817 267
261 3300048912 Ga0496109_0072899 Ga0496109_0072899_92_931 267
262 3300048913 Ga0496110_0021327 Ga0496110_0021327_4247_5095 267
263 3300048914 Ga0496111_0025670 Ga0496111_0025670_2177_3025 267
264 3300048915 Ga0496112_0017288 Ga0496112_0017288_4188_5036 267
265 3300048924 Ga0496121_0063085 Ga0496121_0063085_1610_2452 267
266 3300049570 Ga0501033_0024046 Ga0501033_0024046_3406_4248 267
267 3300049575 Ga0501039_0018197 Ga0501039_0018197_243_1082 267
268 3300049575 Ga0501039_0122847 Ga0501039_0122847_219_1061 267
269 3300049576 Ga0501040_0032234 Ga0501040_0032234_737_1579 267
270 3300049577 Ga0501041_0002404 Ga0501041_0002404_1405_2244 267
271 3300049577 Ga0501041_0030715 Ga0501041_0030715_578_1420 267
272 3300049578 Ga0501042_0005575 Ga0501042_0005575_2859_3698 267
273 3300049578 Ga0501042_0314131 Ga0501042_0314131_173_1012 267
274 3300049580 Ga0501046_0106450 Ga0501046_0106450_1228_2067 267
275 3300049583 Ga0501067_0059452 Ga0501067_0059452_1080_1925 267
276 3300049592 Ga0501076_0020356 Ga0501076_0020356_617_1456 267
277 3300049741 Ga0501079_0004657 Ga0501079_0004657_4483_5322 267
278 3300049742 Ga0501080_0169417 Ga0501080_0169417_1086_1925 267
279 3300050489 nmdc:mga03683_6258_c1 nmdc:mga03683_6258_c1_2651_3493 267
280 3300050491 nmdc:mga00v17_157452_c1 nmdc:mga00v17_157452_c1_458_1300 267
281 3300050493 nmdc:mga0k408_12201_c1 nmdc:mga0k408_12201_c1_1579_2421 267
282 3300050496 nmdc:mga07m45_40538_c1 nmdc:mga07m45_40538_c1_64_900 267
283 3300050507 nmdc:mga05p37_124989_c1 nmdc:mga05p37_124989_c1_1992_2840 267
284 3300050507 nmdc:mga05p37_268_c1 nmdc:mga05p37_268_c1_12956_13795 267
285 3300050507 nmdc:mga05p37_33437_c1 nmdc:mga05p37_33437_c1_12_851 267
286 3300050507 nmdc:mga05p37_397457_c1 nmdc:mga05p37_397457_c1_710_1549 267
287 3300050508 nmdc:mga09592_12464_c1 nmdc:mga09592_12464_c1_2160_2999 267
288 3300050509 nmdc:mga0qj67_11947_c1 nmdc:mga0qj67_11947_c1_3953_4792 267
289 3300050509 nmdc:mga0qj67_42245_c1 nmdc:mga0qj67_42245_c1_885_1736 267
290 3300050510 nmdc:mga06r32_10732_c1 nmdc:mga06r32_10732_c1_3212_4051 267
291 3300050510 nmdc:mga06r32_133_c1 nmdc:mga06r32_133_c1_38412_39251 267
292 3300050510 nmdc:mga06r32_137946_c1 nmdc:mga06r32_137946_c1_991_1836 267
293 3300050511 nmdc:mga08y16_146589_c1 nmdc:mga08y16_146589_c1_1292_2137 267
294 3300050511 nmdc:mga08y16_604_c1 nmdc:mga08y16_604_c1_28002_28841 267
295 3300050512 nmdc:mga0n895_10909_c1 nmdc:mga0n895_10909_c1_3111_3962 267
296 3300050513 nmdc:mga0rr50_522826_c1 nmdc:mga0rr50_522826_c1_141_986 267
297 3300050513 nmdc:mga0rr50_7940_c1 nmdc:mga0rr50_7940_c1_2973_3824 267
298 3300050514 nmdc:mga08x19_1956_c1 nmdc:mga08x19_1956_c1_2861_3712 267
299 3300050514 nmdc:mga08x19_59784_c1 nmdc:mga08x19_59784_c1_93_932 267
300 3300050514 nmdc:mga08x19_96455_c1 nmdc:mga08x19_96455_c1_855_1700 267
301 3300050515 nmdc:mga0a205_10383_c1 nmdc:mga0a205_10383_c1_3349_4200 267
302 3300053085 Ga0495619_0011890 Ga0495619_0011890_2822_3670 267
303 3300053153 Ga0500616_0000385 Ga0500616_0000385_48021_48857 267
304 3300053177 Ga0500636_0017052 Ga0500636_0017052_782_1636 267
305 3300053737 Ga0500601_005824 Ga0500601_005824_18_872 267
306 3300003203 JGI25406J46586_10000162 JGI25406J46586_100001629 268
307 3300003215 JGI25153J46596_10002866 JGI25153J46596_100028664 268
308 3300005293 Ga0065715_10168973 Ga0065715_101689732 268
309 3300005328 Ga0070676_10015138 Ga0070676_100151383 268
310 3300005329 Ga0070683_100044454 Ga0070683_1000444542 268
311 3300005330 Ga0070690_100276750 Ga0070690_1002767501 268
312 3300005331 Ga0070670_100058179 Ga0070670_1000581792 268
313 3300005334 Ga0068869_100002206 Ga0068869_10000220610 268
314 3300005334 Ga0068869_100369404 Ga0068869_1003694041 268
315 3300005336 Ga0070680_100002402 Ga0070680_10000240215 268
316 3300005336 Ga0070680_100166702 Ga0070680_1001667022 268
317 3300005336 Ga0070680_100384707 Ga0070680_1003847072 268
318 3300005337 Ga0070682_100001262 Ga0070682_1000012622 268
319 3300005339 Ga0070660_100000335 Ga0070660_1000003353 268
320 3300005339 Ga0070660_100007713 Ga0070660_1000077131 268
321 3300005340 Ga0070689_100301513 Ga0070689_1003015132 268
322 3300005341 Ga0070691_10005617 Ga0070691_100056176 268
323 3300005344 Ga0070661_100002058 Ga0070661_10000205812 268
324 3300005344 Ga0070661_100177216 Ga0070661_1001772162 268
325 3300005347 Ga0070668_100006633 Ga0070668_1000066336 268
326 3300005347 Ga0070668_100055643 Ga0070668_1000556432 268
327 3300005347 Ga0070668_100211200 Ga0070668_1002112003 268
328 3300005353 Ga0070669_100071085 Ga0070669_1000710851 268
329 3300005354 Ga0070675_100076889 Ga0070675_1000768891 268
330 3300005356 Ga0070674_100014014 Ga0070674_1000140142 268
331 3300005364 Ga0070673_100333459 Ga0070673_1003334592 268
332 3300005366 Ga0070659_100004245 Ga0070659_1000042454 268
333 3300005367 Ga0070667_100272937 Ga0070667_1002729371 268
334 3300005434 Ga0070709_10009864 Ga0070709_100098643 268
335 3300005434 Ga0070709_10017830 Ga0070709_100178304 268
336 3300005435 Ga0070714_100005779 Ga0070714_1000057796 268
337 3300005435 Ga0070714_100027828 Ga0070714_1000278286 268
338 3300005435 Ga0070714_100246470 Ga0070714_1002464701 268
339 3300005435 Ga0070714_100253500 Ga0070714_1002535002 268
340 3300005436 Ga0070713_100035562 Ga0070713_1000355622 268
341 3300005436 Ga0070713_100109247 Ga0070713_1001092472 268
342 3300005436 Ga0070713_100145452 Ga0070713_1001454525 268
343 3300005437 Ga0070710_10000521 Ga0070710_100005215 268
344 3300005437 Ga0070710_10001560 Ga0070710_100015605 268
345 3300005437 Ga0070710_10066926 Ga0070710_100669262 268
346 3300005437 Ga0070710_10169158 Ga0070710_101691581 268
347 3300005439 Ga0070711_100009231 Ga0070711_1000092314 268
348 3300005439 Ga0070711_100014060 Ga0070711_1000140603 268
349 3300005439 Ga0070711_100049569 Ga0070711_1000495692 268
350 3300005440 Ga0070705_100009249 Ga0070705_1000092492 268
351 3300005440 Ga0070705_100013922 Ga0070705_1000139225 268
352 3300005441 Ga0070700_100084649 Ga0070700_1000846493 268
353 3300005444 Ga0070694_100029203 Ga0070694_1000292034 268
354 3300005444 Ga0070694_100368108 Ga0070694_1003681082 268
355 3300005445 Ga0070708_100064166 Ga0070708_1000641663 268
356 3300005445 Ga0070708_100184557 Ga0070708_1001845572 268
357 3300005445 Ga0070708_100368691 Ga0070708_1003686912 268
358 3300005455 Ga0070663_100006448 Ga0070663_10000644812 268
359 3300005455 Ga0070663_100094486 Ga0070663_1000944862 268
360 3300005457 Ga0070662_100023019 Ga0070662_1000230193 268
361 3300005457 Ga0070662_100041868 Ga0070662_1000418682 268
362 3300005458 Ga0070681_10089175 Ga0070681_100891754 268
363 3300005458 Ga0070681_10396293 Ga0070681_103962931 268
364 3300005458 Ga0070681_10445009 Ga0070681_104450092 268
365 3300005458 Ga0070681_10623070 Ga0070681_106230701 268
366 3300005459 Ga0068867_100004506 Ga0068867_10000450611 268
367 3300005467 Ga0070706_100178535 Ga0070706_1001785351 268
368 3300005467 Ga0070706_100225177 Ga0070706_1002251772 268
369 3300005467 Ga0070706_100238099 Ga0070706_1002380991 268
370 3300005467 Ga0070706_100252170 Ga0070706_1002521703 268
371 3300005468 Ga0070707_100071546 Ga0070707_1000715463 268
372 3300005468 Ga0070707_100158548 Ga0070707_1001585481 268
373 3300005471 Ga0070698_100048147 Ga0070698_1000481475 268
374 3300005471 Ga0070698_100093465 Ga0070698_1000934652 268
375 3300005471 Ga0070698_100096482 Ga0070698_1000964823 268
376 3300005471 Ga0070698_100113516 Ga0070698_1001135163 268
377 3300005471 Ga0070698_100153464 Ga0070698_1001534642 268
378 3300005518 Ga0070699_100041399 Ga0070699_1000413992 268
379 3300005518 Ga0070699_100047275 Ga0070699_1000472752 268
380 3300005518 Ga0070699_100084776 Ga0070699_1000847762 268
381 3300005518 Ga0070699_100326413 Ga0070699_1003264132 268
382 3300005518 Ga0070699_100382109 Ga0070699_1003821091 268
383 3300005530 Ga0070679_100005011 Ga0070679_10000501114 268
384 3300005530 Ga0070679_100026077 Ga0070679_1000260777 268
385 3300005530 Ga0070679_100067501 Ga0070679_1000675012 268
386 3300005530 Ga0070679_100078056 Ga0070679_1000780563 268
387 3300005530 Ga0070679_100241516 Ga0070679_1002415162 268
388 3300005535 Ga0070684_100009593 Ga0070684_1000095932 268
389 3300005536 Ga0070697_100256275 Ga0070697_1002562752 268
390 3300005536 Ga0070697_100321683 Ga0070697_1003216832 268
391 3300005539 Ga0068853_100005907 Ga0068853_1000059074 268
392 3300005539 Ga0068853_100030633 Ga0068853_1000306332 268
393 3300005539 Ga0068853_100206610 Ga0068853_1002066102 268
394 3300005539 Ga0068853_100494130 Ga0068853_1004941301 268
395 3300005543 Ga0070672_100045964 Ga0070672_1000459643 268
396 3300005543 Ga0070672_100077910 Ga0070672_1000779105 268
397 3300005543 Ga0070672_100331998 Ga0070672_1003319982 268
398 3300005545 Ga0070695_100009784 Ga0070695_1000097846 268
399 3300005545 Ga0070695_100010947 Ga0070695_1000109474 268
400 3300005545 Ga0070695_100034299 Ga0070695_1000342992 268
401 3300005546 Ga0070696_100006504 Ga0070696_1000065046 268
402 3300005546 Ga0070696_100019857 Ga0070696_1000198575 268
403 3300005547 Ga0070693_100000201 Ga0070693_1000002014 268
404 3300005548 Ga0070665_100056988 Ga0070665_1000569883 268
405 3300005549 Ga0070704_100000395 Ga0070704_1000003956 268
406 3300005549 Ga0070704_100001335 Ga0070704_1000013352 268
407 3300005549 Ga0070704_100005399 Ga0070704_1000053996 268
408 3300005563 Ga0068855_100001465 Ga0068855_10000146518 268
409 3300005563 Ga0068855_100172656 Ga0068855_1001726563 268
410 3300005563 Ga0068855_100226845 Ga0068855_1002268452 268
411 3300005564 Ga0070664_100269003 Ga0070664_1002690031 268
412 3300005577 Ga0068857_100086635 Ga0068857_1000866352 268
413 3300005577 Ga0068857_100088251 Ga0068857_1000882511 268
414 3300005577 Ga0068857_100104239 Ga0068857_1001042392 268
415 3300005614 Ga0068856_100000513 Ga0068856_10000051317 268
416 3300005614 Ga0068856_100001138 Ga0068856_10000113815 268
417 3300005614 Ga0068856_100133819 Ga0068856_1001338193 268
418 3300005616 Ga0068852_100047281 Ga0068852_1000472813 268
419 3300005618 Ga0068864_100061767 Ga0068864_1000617672 268
420 3300005618 Ga0068864_100082720 Ga0068864_1000827202 268
421 3300005718 Ga0068866_10061647 Ga0068866_100616472 268
422 3300005718 Ga0068866_10193962 Ga0068866_101939622 268
423 3300005719 Ga0068861_100036662 Ga0068861_1000366623 268
424 3300005840 Ga0068870_10004585 Ga0068870_100045857 268
425 3300005841 Ga0068863_100045502 Ga0068863_1000455024 268
426 3300005842 Ga0068858_100028605 Ga0068858_1000286052 268
427 3300005843 Ga0068860_100000503 Ga0068860_10000050330 268
428 3300005843 Ga0068860_100035583 Ga0068860_1000355832 268
429 3300005843 Ga0068860_100094659 Ga0068860_1000946592 268
430 3300005843 Ga0068860_100147155 Ga0068860_1001471553 268
431 3300005844 Ga0068862_100025439 Ga0068862_1000254394 268
432 3300005937 Ga0081455_10000022 Ga0081455_10000022110 268
433 3300005937 Ga0081455_10000864 Ga0081455_1000086410 268
434 3300005937 Ga0081455_10019456 Ga0081455_100194567 268
435 3300005937 Ga0081455_10020308 Ga0081455_100203085 268
436 3300005983 Ga0081540_1002045 Ga0081540_100204510 268
437 3300005985 Ga0081539_10001007 Ga0081539_1000100728 268
438 3300006028 Ga0070717_10065385 Ga0070717_100653853 268
439 3300006038 Ga0075365_10029929 Ga0075365_100299293 268
440 3300006038 Ga0075365_10042546 Ga0075365_100425463 268
441 3300006038 Ga0075365_10279407 Ga0075365_102794072 268
442 3300006038 Ga0075365_10332934 Ga0075365_103329342 268
443 3300006042 Ga0075368_10027879 Ga0075368_100278791 268
444 3300006042 Ga0075368_10095838 Ga0075368_100958382 268
445 3300006048 Ga0075363_100085334 Ga0075363_1000853342 268
446 3300006051 Ga0075364_10125743 Ga0075364_101257432 268
447 3300006051 Ga0075364_10172107 Ga0075364_101721071 268
448 3300006058 Ga0075432_10030582 Ga0075432_100305822 268
449 3300006163 Ga0070715_10000603 Ga0070715_100006034 268
450 3300006163 Ga0070715_10254362 Ga0070715_102543621 268
451 3300006173 Ga0070716_100031698 Ga0070716_1000316983 268
452 3300006175 Ga0070712_100003710 Ga0070712_1000037108 268
453 3300006177 Ga0075362_10004593 Ga0075362_100045933 268
454 3300006177 Ga0075362_10073325 Ga0075362_100733252 268
455 3300006178 Ga0075367_10021431 Ga0075367_100214314 268
456 3300006186 Ga0075369_10008692 Ga0075369_100086923 268
457 3300006186 Ga0075369_10034929 Ga0075369_100349292 268
458 3300006186 Ga0075369_10129066 Ga0075369_101290661 268
459 3300006195 Ga0075366_10019315 Ga0075366_100193152 268
460 3300006237 Ga0097621_100269539 Ga0097621_1002695392 268
461 3300006844 Ga0075428_100022172 Ga0075428_1000221728 268
462 3300006844 Ga0075428_100059199 Ga0075428_1000591996 268
463 3300006844 Ga0075428_100080660 Ga0075428_1000806603 268
464 3300006844 Ga0075428_100133891 Ga0075428_1001338911 268
465 3300006844 Ga0075428_100625905 Ga0075428_1006259051 268
466 3300006844 Ga0075428_100746163 Ga0075428_1007461631 268
467 3300006846 Ga0075430_100001172 Ga0075430_10000117210 268
468 3300006847 Ga0075431_100008045 Ga0075431_10000804510 268
469 3300006847 Ga0075431_100011372 Ga0075431_1000113729 268
470 3300006847 Ga0075431_100017008 Ga0075431_1000170082 268
471 3300006847 Ga0075431_100098586 Ga0075431_1000985863 268
472 3300006852 Ga0075433_10004254 Ga0075433_100042542 268
473 3300006852 Ga0075433_10008732 Ga0075433_100087329 268
474 3300006852 Ga0075433_10033075 Ga0075433_100330752 268
475 3300006852 Ga0075433_10067251 Ga0075433_100672512 268
476 3300006871 Ga0075434_100031443 Ga0075434_1000314436 268
477 3300006871 Ga0075434_100175540 Ga0075434_1001755403 268
478 3300006871 Ga0075434_100281163 Ga0075434_1002811631 268
479 3300006880 Ga0075429_100000003 Ga0075429_10000000363 268
480 3300006881 Ga0068865_100161512 Ga0068865_1001615122 268
481 3300007076 Ga0075435_100119046 Ga0075435_1001190462 268
482 3300007265 Ga0099794_10009489 Ga0099794_100094896 268
483 3300007788 Ga0099795_10060195 Ga0099795_100601952 268
484 3300009093 Ga0105240_10044074 Ga0105240_100440745 268
485 3300009093 Ga0105240_10188913 Ga0105240_101889132 268
486 3300009094 Ga0111539_10000387 Ga0111539_1000038729 268
487 3300009094 Ga0111539_10037748 Ga0111539_100377485 268
488 3300009094 Ga0111539_10062968 Ga0111539_100629682 268
489 3300009098 Ga0105245_10008214 Ga0105245_100082143 268
490 3300009147 Ga0114129_10005359 Ga0114129_100053596 268
491 3300009147 Ga0114129_10090068 Ga0114129_100900684 268
492 3300009147 Ga0114129_10127814 Ga0114129_101278142 268
493 3300009147 Ga0114129_10332768 Ga0114129_103327681 268
494 3300009147 Ga0114129_10368526 Ga0114129_103685263 268
495 3300009147 Ga0114129_10426852 Ga0114129_104268521 268
496 3300009147 Ga0114129_10451566 Ga0114129_104515661 268
497 3300009148 Ga0105243_10067067 Ga0105243_100670672 268
498 3300009148 Ga0105243_10181148 Ga0105243_101811482 268
499 3300009148 Ga0105243_10232271 Ga0105243_102322712 268
500 3300009148 Ga0105243_10772503 Ga0105243_107725032 268
501 3300009174 Ga0105241_10079079 Ga0105241_100790791 268
502 3300009176 Ga0105242_10272565 Ga0105242_102725652 268
503 3300009176 Ga0105242_10275776 Ga0105242_102757762 268
504 3300009177 Ga0105248_10088269 Ga0105248_100882695 268
505 3300009177 Ga0105248_10168955 Ga0105248_101689553 268
506 3300009177 Ga0105248_10485265 Ga0105248_104852651 268
507 3300009545 Ga0105237_10007319 Ga0105237_100073195 268
508 3300009545 Ga0105237_10043711 Ga0105237_100437113 268
509 3300009545 Ga0105237_10048539 Ga0105237_100485396 268
510 3300009545 Ga0105237_10213722 Ga0105237_102137222 268
511 3300009553 Ga0105249_10013696 Ga0105249_100136965 268
512 3300010375 Ga0105239_10126553 Ga0105239_101265531 268
513 3300010375 Ga0105239_10215689 Ga0105239_102156891 268
514 3300013100 Ga0157373_10001232 Ga0157373_100012326 268
515 3300013102 Ga0157371_10102647 Ga0157371_101026472 268
516 3300013104 Ga0157370_10052997 Ga0157370_100529973 268
517 3300013104 Ga0157370_10055518 Ga0157370_100555182 268
518 3300013104 Ga0157370_10158080 Ga0157370_101580801 268
519 3300013105 Ga0157369_10004456 Ga0157369_1000445611 268
520 3300013105 Ga0157369_10019805 Ga0157369_100198058 268
521 3300013105 Ga0157369_10610831 Ga0157369_106108312 268
522 3300013296 Ga0157374_10061756 Ga0157374_100617563 268
523 3300013296 Ga0157374_10100879 Ga0157374_101008792 268
524 3300013296 Ga0157374_10278033 Ga0157374_102780332 268
525 3300013296 Ga0157374_10679080 Ga0157374_106790801 268
526 3300013297 Ga0157378_10041710 Ga0157378_100417105 268
527 3300013297 Ga0157378_10073485 Ga0157378_100734857 268
528 3300013306 Ga0163162_10082024 Ga0163162_100820242 268
529 3300013306 Ga0163162_10128132 Ga0163162_101281322 268
530 3300013307 Ga0157372_10000612 Ga0157372_1000061230 268
531 3300013307 Ga0157372_10041944 Ga0157372_100419443 268
532 3300013307 Ga0157372_10212403 Ga0157372_102124032 268
533 3300013308 Ga0157375_10078073 Ga0157375_100780733 268
534 3300013308 Ga0157375_10343430 Ga0157375_103434301 268
535 3300014325 Ga0163163_10024216 Ga0163163_100242164 268
536 3300014325 Ga0163163_10050760 Ga0163163_100507604 268
537 3300014497 Ga0182008_10021801 Ga0182008_100218015 268
538 3300014968 Ga0157379_10098375 Ga0157379_100983752 268
539 3300014969 Ga0157376_10151953 Ga0157376_101519532 268
540 3300014969 Ga0157376_10215625 Ga0157376_102156251 268
541 3300017792 Ga0163161_10116625 Ga0163161_101166252 268
542 3300017792 Ga0163161_10189794 Ga0163161_101897941 268
543 3300020070 Ga0206356_10060346 Ga0206356_100603462 268
544 3300021358 Ga0213873_10019757 Ga0213873_100197573 268
545 3300021377 Ga0213874_10061093 Ga0213874_100610932 268
546 3300021384 Ga0213876_10003793 Ga0213876_100037935 268
547 3300022467 Ga0224712_10147600 Ga0224712_101476002 268
548 3300022467 Ga0224712_10150931 Ga0224712_101509311 268
549 3300024225 Ga0224572_1007000 Ga0224572_10070002 268
550 3300025253 Ga0209677_101915 Ga0209677_1019152 268
551 3300025254 Ga0209148_1006564 Ga0209148_10065642 268
552 3300025261 Ga0209233_1004436 Ga0209233_10044362 268
553 3300025272 Ga0209455_1003615 Ga0209455_10036152 268
554 3300025272 Ga0209455_1004331 Ga0209455_10043313 268
555 3300025297 Ga0209758_1006475 Ga0209758_10064753 268
556 3300025321 Ga0207656_10129390 Ga0207656_101293901 268
557 3300025885 Ga0207653_10003590 Ga0207653_100035902 268
558 3300025898 Ga0207692_10001827 Ga0207692_100018275 268
559 3300025898 Ga0207692_10021921 Ga0207692_100219213 268
560 3300025898 Ga0207692_10112045 Ga0207692_101120451 268
561 3300025905 Ga0207685_10002290 Ga0207685_100022902 268
562 3300025905 Ga0207685_10049722 Ga0207685_100497222 268
563 3300025906 Ga0207699_10027465 Ga0207699_100274652 268
564 3300025906 Ga0207699_10083256 Ga0207699_100832562 268
565 3300025906 Ga0207699_10132736 Ga0207699_101327362 268
566 3300025907 Ga0207645_10009046 Ga0207645_100090464 268
567 3300025910 Ga0207684_10001645 Ga0207684_1000164518 268
568 3300025910 Ga0207684_10017949 Ga0207684_100179493 268
569 3300025910 Ga0207684_10019307 Ga0207684_100193073 268
570 3300025910 Ga0207684_10195869 Ga0207684_101958692 268
571 3300025911 Ga0207654_10021309 Ga0207654_100213093 268
572 3300025912 Ga0207707_10000170 Ga0207707_1000017026 268
573 3300025912 Ga0207707_10000555 Ga0207707_1000055527 268
574 3300025912 Ga0207707_10258954 Ga0207707_102589541 268
575 3300025913 Ga0207695_10081975 Ga0207695_100819751 268
576 3300025913 Ga0207695_10452537 Ga0207695_104525371 268
577 3300025914 Ga0207671_10036016 Ga0207671_100360162 268
578 3300025914 Ga0207671_10071214 Ga0207671_100712143 268
579 3300025914 Ga0207671_10075808 Ga0207671_100758083 268
580 3300025915 Ga0207693_10006093 Ga0207693_100060932 268
581 3300025915 Ga0207693_10010348 Ga0207693_100103487 268
582 3300025915 Ga0207693_10036914 Ga0207693_100369145 268
583 3300025915 Ga0207693_10046726 Ga0207693_100467261 268
584 3300025916 Ga0207663_10005048 Ga0207663_100050487 268
585 3300025916 Ga0207663_10007145 Ga0207663_100071454 268
586 3300025917 Ga0207660_10007797 Ga0207660_100077974 268
587 3300025917 Ga0207660_10051731 Ga0207660_100517312 268
588 3300025917 Ga0207660_10139553 Ga0207660_101395532 268
589 3300025917 Ga0207660_10143522 Ga0207660_101435222 268
590 3300025917 Ga0207660_10296179 Ga0207660_102961791 268
591 3300025919 Ga0207657_10001106 Ga0207657_1000110615 268
592 3300025919 Ga0207657_10225025 Ga0207657_102250251 268
593 3300025920 Ga0207649_10010165 Ga0207649_100101653 268
594 3300025921 Ga0207652_10004264 Ga0207652_100042646 268
595 3300025921 Ga0207652_10041977 Ga0207652_100419776 268
596 3300025921 Ga0207652_10045482 Ga0207652_100454823 268
597 3300025922 Ga0207646_10036612 Ga0207646_100366123 268
598 3300025922 Ga0207646_10162053 Ga0207646_101620532 268
599 3300025923 Ga0207681_10166003 Ga0207681_101660032 268
600 3300025923 Ga0207681_10512964 Ga0207681_105129641 268
601 3300025924 Ga0207694_10054336 Ga0207694_100543362 268
602 3300025924 Ga0207694_10175659 Ga0207694_101756592 268
603 3300025927 Ga0207687_10057049 Ga0207687_100570493 268
604 3300025928 Ga0207700_10013572 Ga0207700_100135725 268
605 3300025928 Ga0207700_10117449 Ga0207700_101174492 268
606 3300025928 Ga0207700_10258138 Ga0207700_102581382 268
607 3300025928 Ga0207700_10515566 Ga0207700_105155661 268
608 3300025929 Ga0207664_10025824 Ga0207664_100258242 268
609 3300025929 Ga0207664_10047275 Ga0207664_100472753 268
610 3300025929 Ga0207664_10047750 Ga0207664_100477502 268
611 3300025929 Ga0207664_10150039 Ga0207664_101500392 268
612 3300025929 Ga0207664_10176266 Ga0207664_101762661 268
613 3300025929 Ga0207664_10188599 Ga0207664_101885992 268
614 3300025931 Ga0207644_10055972 Ga0207644_100559721 268
615 3300025932 Ga0207690_10002071 Ga0207690_100020716 268
616 3300025932 Ga0207690_10285842 Ga0207690_102858421 268
617 3300025933 Ga0207706_10053483 Ga0207706_100534833 268
618 3300025933 Ga0207706_10568223 Ga0207706_105682231 268
619 3300025934 Ga0207686_10021531 Ga0207686_100215313 268
620 3300025934 Ga0207686_10050676 Ga0207686_100506762 268
621 3300025935 Ga0207709_10011247 Ga0207709_100112474 268
622 3300025935 Ga0207709_10021268 Ga0207709_100212683 268
623 3300025935 Ga0207709_10199122 Ga0207709_101991222 268
624 3300025936 Ga0207670_10095037 Ga0207670_100950372 268
625 3300025937 Ga0207669_10026910 Ga0207669_100269101 268
626 3300025938 Ga0207704_10027519 Ga0207704_100275192 268
627 3300025939 Ga0207665_10027175 Ga0207665_100271753 268
628 3300025939 Ga0207665_10221391 Ga0207665_102213912 268
629 3300025939 Ga0207665_10463737 Ga0207665_104637371 268
630 3300025940 Ga0207691_10013018 Ga0207691_100130188 268
631 3300025940 Ga0207691_10128303 Ga0207691_101283033 268
632 3300025941 Ga0207711_10051920 Ga0207711_100519203 268
633 3300025941 Ga0207711_10107410 Ga0207711_101074102 268
634 3300025942 Ga0207689_10003550 Ga0207689_100035502 268
635 3300025945 Ga0207679_10000523 Ga0207679_1000052316 268
636 3300025945 Ga0207679_10145361 Ga0207679_101453612 268
637 3300025945 Ga0207679_10244799 Ga0207679_102447992 268
638 3300025949 Ga0207667_10042230 Ga0207667_100422303 268
639 3300025949 Ga0207667_10053418 Ga0207667_100534184 268
640 3300025949 Ga0207667_10127732 Ga0207667_101277323 268
641 3300025949 Ga0207667_10297304 Ga0207667_102973043 268
642 3300025961 Ga0207712_10006218 Ga0207712_100062185 268
643 3300025961 Ga0207712_10465499 Ga0207712_104654991 268
644 3300025972 Ga0207668_10010781 Ga0207668_100107812 268
645 3300025972 Ga0207668_10032351 Ga0207668_100323513 268
646 3300025972 Ga0207668_10037486 Ga0207668_100374864 268
647 3300026023 Ga0207677_10032031 Ga0207677_100320312 268
648 3300026035 Ga0207703_10255363 Ga0207703_102553632 268
649 3300026035 Ga0207703_10381053 Ga0207703_103810531 268
650 3300026035 Ga0207703_10769933 Ga0207703_107699331 268
651 3300026041 Ga0207639_10000950 Ga0207639_100009506 268
652 3300026041 Ga0207639_10037696 Ga0207639_100376964 268
653 3300026041 Ga0207639_10137781 Ga0207639_101377812 268
654 3300026067 Ga0207678_10011341 Ga0207678_100113417 268
655 3300026067 Ga0207678_10119607 Ga0207678_101196072 268
656 3300026067 Ga0207678_10210406 Ga0207678_102104063 268
657 3300026078 Ga0207702_10000493 Ga0207702_1000049316 268
658 3300026078 Ga0207702_10001780 Ga0207702_100017808 268
659 3300026088 Ga0207641_10149247 Ga0207641_101492473 268
660 3300026088 Ga0207641_10342052 Ga0207641_103420522 268
661 3300026089 Ga0207648_10028734 Ga0207648_100287345 268
662 3300026089 Ga0207648_10147191 Ga0207648_101471913 268
663 3300026095 Ga0207676_10133644 Ga0207676_101336442 268
664 3300026095 Ga0207676_10259028 Ga0207676_102590281 268
665 3300026116 Ga0207674_10001680 Ga0207674_1000168021 268
666 3300026116 Ga0207674_10021630 Ga0207674_100216307 268
667 3300026116 Ga0207674_10026802 Ga0207674_100268022 268
668 3300026116 Ga0207674_10102499 Ga0207674_101024992 268
669 3300026118 Ga0207675_100017359 Ga0207675_1000173592 268
670 3300026118 Ga0207675_100041747 Ga0207675_1000417474 268
671 3300026121 Ga0207683_10033261 Ga0207683_100332614 268
672 3300026121 Ga0207683_10042020 Ga0207683_100420203 268
673 3300026121 Ga0207683_10174145 Ga0207683_101741451 268
674 3300026142 Ga0207698_10093056 Ga0207698_100930561 268
675 3300026142 Ga0207698_10145023 Ga0207698_101450232 268
676 3300027364 Ga0209967_1012739 Ga0209967_10127391 268
677 3300027395 Ga0209996_1004913 Ga0209996_10049133 268
678 3300027462 Ga0210000_1005050 Ga0210000_10050502 268
679 3300027471 Ga0209995_1000295 Ga0209995_10002955 268
680 3300027526 Ga0209968_1001353 Ga0209968_10013531 268
681 3300027543 Ga0209999_1002059 Ga0209999_10020592 268
682 3300027617 Ga0210002_1001677 Ga0210002_10016772 268
683 3300027665 Ga0209983_1000262 Ga0209983_10002622 268
684 3300027671 Ga0209588_1016656 Ga0209588_10166563 268
685 3300027682 Ga0209971_1000116 Ga0209971_100011611 268
686 3300027695 Ga0209966_1000058 Ga0209966_100005820 268
687 3300027717 Ga0209998_10000039 Ga0209998_1000003915 268
688 3300027866 Ga0209813_10001121 Ga0209813_100011213 268
689 3300027876 Ga0209974_10000714 Ga0209974_100007149 268
690 3300027907 Ga0207428_10000348 Ga0207428_1000034848 268
691 3300027907 Ga0207428_10090326 Ga0207428_100903264 268
692 3300027907 Ga0207428_10093179 Ga0207428_100931793 268
693 3300028379 Ga0268266_10055562 Ga0268266_100555623 268
694 3300028379 Ga0268266_10102008 Ga0268266_101020083 268
695 3300028380 Ga0268265_10002346 Ga0268265_100023463 268
696 3300028380 Ga0268265_10083502 Ga0268265_100835022 268
697 3300028381 Ga0268264_10000185 Ga0268264_1000018526 268
698 3300028381 Ga0268264_10026277 Ga0268264_100262776 268
699 3300028381 Ga0268264_10178140 Ga0268264_101781402 268
700 3300028573 Ga0265334_10055104 Ga0265334_100551042 268
701 3300028800 Ga0265338_10208844 Ga0265338_102088441 268
702 3300030878 Ga0265770_1013382 Ga0265770_10133821 268
703 3300031235 Ga0265330_10165085 Ga0265330_101650851 268
704 3300031240 Ga0265320_10009525 Ga0265320_100095252 268
705 3300031242 Ga0265329_10040072 Ga0265329_100400722 268
706 3300031247 Ga0265340_10119704 Ga0265340_101197041 268
707 3300031249 Ga0265339_10015996 Ga0265339_100159962 268
708 3300031249 Ga0265339_10036309 Ga0265339_100363093 268
709 3300031250 Ga0265331_10029942 Ga0265331_100299422 268
710 3300031507 Ga0307509_10007409 Ga0307509_100074092 268
711 3300031548 Ga0307408_100498722 Ga0307408_1004987221 268
712 3300031595 Ga0265313_10001065 Ga0265313_100010655 268
713 3300031616 Ga0307508_10188540 Ga0307508_101885401 268
714 3300031711 Ga0265314_10039124 Ga0265314_100391241 268
715 3300031711 Ga0265314_10048272 Ga0265314_100482722 268
716 3300031712 Ga0265342_10029931 Ga0265342_100299313 268
717 3300031901 Ga0307406_10323945 Ga0307406_103239451 268
718 3300031911 Ga0307412_10305653 Ga0307412_103056532 268
719 3300032002 Ga0307416_100078453 Ga0307416_1000784532 268
720 3300032002 Ga0307416_100311421 Ga0307416_1003114212 268
721 3300032005 Ga0307411_10074312 Ga0307411_100743123 268
722 3300032126 Ga0307415_100299448 Ga0307415_1002994482 268
723 3300033179 Ga0307507_10030517 Ga0307507_100305175 268
724 3300034818 Ga0373950_0030769 Ga0373950_0030769_90_932 268
725 3300034818 Ga0373950_0034094 Ga0373950_0034094_28_900 268
726 3300034819 Ga0373958_0033593 Ga0373958_0033593_154_996 268
727 3300034820 Ga0373959_0010657 Ga0373959_0010657_528_1400 268
728 3300035084 Ga0373928_0054902 Ga0373928_0054902_30_872 268
729 3300035088 Ga0373940_0019900 Ga0373940_0019900_99_941 268
730 3300035091 Ga0373951_0036276 Ga0373951_0036276_273_1145 268
731 3300035111 Ga0373923_0015627 Ga0373923_0015627_1704_2681 268
732 3300035112 Ga0373932_0006898 Ga0373932_0006898_97_948 268
733 3300035113 Ga0373936_0050570 Ga0373936_0050570_248_1225 268
734 3300035113 Ga0373936_0084743 Ga0373936_0084743_60_902 268
735 3300035114 Ga0373939_0007202 Ga0373939_0007202_963_1805 268
736 3300035115 Ga0373941_0017752 Ga0373941_0017752_146_988 268
737 3300035117 Ga0373953_0001311 Ga0373953_0001311_1777_2754 268
738 3300035118 Ga0373954_0007164 Ga0373954_0007164_3048_4025 268
739 3300035118 Ga0373954_0047564 Ga0373954_0047564_1131_1973 268
740 3300035118 Ga0373954_0155016 Ga0373954_0155016_256_1098 268
741 3300035119 Ga0373956_0010752 Ga0373956_0010752_1248_2225 268
742 3300035120 Ga0373957_0010481 Ga0373957_0010481_1164_2141 268
743 3300035121 Ga0373960_0013848 Ga0373960_0013848_1174_2016 268
744 3300035172 Ga0373955_0010295 Ga0373955_0010295_1904_2881 268
745 3300035207 Ga0373942_0014880 Ga0373942_0014880_40_882 268
746 3300035241 Ga0373961_0016401 Ga0373961_0016401_528_1400 268
747 3300035410 Ga0373924_0004646 Ga0373924_0004646_1535_2512 268
748 3300035691 Ga0373931_0000166 Ga0373931_0000166_4004_4846 268
749 3300035691 Ga0373931_0046692 Ga0373931_0046692_1285_2127 268
750 3300035691 Ga0373931_0116701 Ga0373931_0116701_69_914 268
751 3300035692 Ga0373935_0037944 Ga0373935_0037944_231_1073 268
752 3300035692 Ga0373935_0135126 Ga0373935_0135126_536_1378 268
753 3300035695 Ga0373927_0074190 Ga0373927_0074190_21_863 268
754 3300035695 Ga0373927_0104601 Ga0373927_0104601_530_1372 268
755 3300035695 Ga0373927_0200298 Ga0373927_0200298_279_1121 268
756 3300035695 Ga0373927_0286960 Ga0373927_0286960_43_900 268
757 3300035724 Ga0373933_0014326 Ga0373933_0014326_3145_4002 268
758 3300035724 Ga0373933_0243216 Ga0373933_0243216_33_875 268
759 3300035725 Ga0373947_0161699 Ga0373947_0161699_57_899 268
760 3300036401 Ga0373937_0012706 Ga0373937_0012706_1764_2621 268
761 3300036401 Ga0373937_0049137 Ga0373937_0049137_780_1622 268
762 3300036401 Ga0373937_0188488 Ga0373937_0188488_200_1042 268
763 3300037068 Ga0373925_0155550 Ga0373925_0155550_791_1633 268
764 3300037312 Ga0395899_0012702 Ga0395899_0012702_1405_2247 268
765 3300037312 Ga0395899_0058617 Ga0395899_0058617_338_1180 268
766 3300037418 Ga0395900_0002247 Ga0395900_0002247_2150_2992 268
767 3300037418 Ga0395900_0002271 Ga0395900_0002271_12758_13600 268
768 3300037418 Ga0395900_0035217 Ga0395900_0035217_66_908 268
769 3300037418 Ga0395900_0192052 Ga0395900_0192052_366_1208 268
770 3300037466 Ga0395898_0004503 Ga0395898_0004503_4554_5396 268
771 3300037466 Ga0395898_0004746 Ga0395898_0004746_3152_3994 268
772 3300037466 Ga0395898_0347505 Ga0395898_0347505_215_1057 268
773 3300037853 Ga0436364_1170705 Ga0436364_1170705_1231_2073 268
774 3300038443 Ga0395901_0001831 Ga0395901_0001831_12024_12866 268
775 3300038443 Ga0395901_0002599 Ga0395901_0002599_6337_7179 268
776 3300038443 Ga0395901_0003317 Ga0395901_0003317_8554_9396 268
777 3300038443 Ga0395901_0105356 Ga0395901_0105356_1584_2426 268
778 3300038443 Ga0395901_0318822 Ga0395901_0318822_545_1384 268
779 3300039437 Ga0436365_0015071 Ga0436365_0015071_210_1073 268
780 3300039437 Ga0436365_0026985 Ga0436365_0026985_1190_2029 268
781 3300039437 Ga0436365_0133331 Ga0436365_0133331_122_964 268
782 3300039437 Ga0436365_0893854 Ga0436365_0893854_2684_3526 268
783 3300039437 Ga0436365_1367547 Ga0436365_1367547_68_910 268
784 3300039437 Ga0436365_1494838 Ga0436365_1494838_105_947 268
785 3300039438 Ga0436360_0097146 Ga0436360_0097146_632_1474 268
786 3300039438 Ga0436360_0195957 Ga0436360_0195957_1662_2669 268
787 3300039438 Ga0436360_0399216 Ga0436360_0399216_837_1679 268
788 3300039438 Ga0436360_1082434 Ga0436360_1082434_1259_2098 268
789 3300039447 Ga0436361_0430054 Ga0436361_0430054_54_896 268
790 3300039447 Ga0436361_1154927 Ga0436361_1154927_130_972 268
791 3300039450 Ga0436363_0150716 Ga0436363_0150716_1059_1907 268
792 3300039450 Ga0436363_0251745 Ga0436363_0251745_2879_3721 268
793 3300039450 Ga0436363_0311273 Ga0436363_0311273_138_980 268
794 3300039450 Ga0436363_1126738 Ga0436363_1126738_250_1092 268
795 3300039450 Ga0436363_1628040 Ga0436363_1628040_108_950 268
796 3300039453 Ga0436362_0816695 Ga0436362_0816695_686_1528 268
797 3300039453 Ga0436362_1139972 Ga0436362_1139972_1287_2129 268
798 3300041408 Ga0439453_0007398 Ga0439453_0007398_726_1568 268
799 3300042001 Ga0439441_011458 Ga0439441_011458_376_1215 268
800 3300042005 Ga0439448_0000117 Ga0439448_0000117_12741_13613 268
801 3300042006 Ga0439432_054549 Ga0439432_054549_13_855 268
802 3300042144 Ga0450889_001760 Ga0450889_001760_401_1273 268
803 3300042438 Ga0439459_0005360 Ga0439459_0005360_1151_2023 268
804 3300042439 Ga0439464_0048673 Ga0439464_0048673_304_1164 268
805 3300042461 Ga0439460_0023223 Ga0439460_0023223_587_1429 268
806 3300042876 Ga0451577_0002467 Ga0451577_0002467_9182_10024 268
807 3300044673 Ga0453683_0163557 Ga0453683_0163557_155_1003 268
808 3300044673 Ga0453683_0302945 Ga0453683_0302945_19_867 268
809 3300044694 Ga0466963_0115634 Ga0466963_0115634_347_1189 268
810 3300044712 Ga0453684_0018119 Ga0453684_0018119_4305_5147 268
811 3300044712 Ga0453684_0222653 Ga0453684_0222653_262_1134 268
812 3300044842 Ga0466957_0141944 Ga0466957_0141944_67_909 268
813 3300044842 Ga0466957_0261151 Ga0466957_0261151_215_1057 268
814 3300045049 Ga0466959_0055755 Ga0466959_0055755_1474_2313 268
815 3300045051 Ga0451576_0003327 Ga0451576_0003327_15711_16553 268
816 3300045051 Ga0451576_0044978 Ga0451576_0044978_2150_2998 268
817 3300045051 Ga0451576_0085302 Ga0451576_0085302_2122_2964 268
818 3300045051 Ga0451576_0116389 Ga0451576_0116389_337_1179 268
819 3300045051 Ga0451576_0172198 Ga0451576_0172198_1010_1882 268
820 3300045051 Ga0451576_0774923 Ga0451576_0774923_124_966 268
821 3300045976 Ga0466967_0072518 Ga0466967_0072518_978_1820 268
822 3300045976 Ga0466967_0499599 Ga0466967_0499599_192_1034 268
823 3300046454 Ga0495592_0094341 Ga0495592_0094341_641_1618 268
824 3300046455 Ga0495603_0073435 Ga0495603_0073435_813_1655 268
825 3300046460 Ga0495638_0259989 Ga0495638_0259989_72_914 268
826 3300046462 Ga0495651_0262351 Ga0495651_0262351_271_1113 268
827 3300046472 Ga0495580_0173129 Ga0495580_0173129_70_912 268
828 3300046477 Ga0495664_0026941 Ga0495664_0026941_2135_2977 268
829 3300046511 Ga0495608_0017406 Ga0495608_0017406_2340_3182 268
830 3300046511 Ga0495608_0017855 Ga0495608_0017855_3659_4516 268
831 3300046514 Ga0495618_0024590 Ga0495618_0024590_943_1785 268
832 3300046523 Ga0495644_0017912 Ga0495644_0017912_1370_2212 268
833 3300046523 Ga0495644_0044869 Ga0495644_0044869_222_1064 268
834 3300046529 Ga0495652_0314288 Ga0495652_0314288_24_866 268
835 3300046533 Ga0495640_0028742 Ga0495640_0028742_1702_2679 268
836 3300046533 Ga0495640_0181464 Ga0495640_0181464_257_1108 268
837 3300046536 Ga0495587_0010837 Ga0495587_0010837_1701_2543 268
838 3300046537 Ga0495598_0021039 Ga0495598_0021039_661_1539 268
839 3300046543 Ga0495645_0016548 Ga0495645_0016548_3289_4131 268
840 3300046559 Ga0495667_0060016 Ga0495667_0060016_629_1486 268
841 3300046616 Ga0495668_0202508 Ga0495668_0202508_67_909 268
842 3300046642 Ga0495634_0005618 Ga0495634_0005618_6599_7441 268
843 3300046664 Ga0495659_0078021 Ga0495659_0078021_19_861 268
844 3300046674 Ga0495588_0230405 Ga0495588_0230405_50_892 268
845 3300046809 Ga0495600_0023789 Ga0495600_0023789_3024_3866 268
846 3300047317 Ga0495604_0233382 Ga0495604_0233382_186_1043 268
847 3300047319 Ga0495674_0032010 Ga0495674_0032010_2307_3149 268
848 3300047321 Ga0495676_0145830 Ga0495676_0145830_794_1672 268
849 3300047322 Ga0495680_0041762 Ga0495680_0041762_788_1645 268
850 3300047322 Ga0495680_0068580 Ga0495680_0068580_461_1438 268
851 3300047471 Ga0495684_0079506 Ga0495684_0079506_407_1249 268
852 3300047472 Ga0495686_0135476 Ga0495686_0135476_85_978 268
853 3300048088 Ga0495602_0007106 Ga0495602_0007106_9121_9963 268
854 3300048903 Ga0496100_0032236 Ga0496100_0032236_1073_1915 268
855 3300048903 Ga0496100_0091227 Ga0496100_0091227_255_1109 268
856 3300048904 Ga0496101_0023361 Ga0496101_0023361_3093_3947 268
857 3300048904 Ga0496101_0043473 Ga0496101_0043473_1070_1912 268
858 3300048905 Ga0496102_0010410 Ga0496102_0010410_4411_5253 268
859 3300048905 Ga0496102_0080745 Ga0496102_0080745_1173_2015 268
860 3300048905 Ga0496102_0223265 Ga0496102_0223265_77_940 268
861 3300048905 Ga0496102_0246590 Ga0496102_0246590_306_1148 268
862 3300048907 Ga0496104_0013029 Ga0496104_0013029_2502_3350 268
863 3300048907 Ga0496104_0045750 Ga0496104_0045750_3077_3919 268
864 3300048907 Ga0496104_0099452 Ga0496104_0099452_123_965 268
865 3300048907 Ga0496104_0129640 Ga0496104_0129640_1488_2342 268
866 3300048907 Ga0496104_0197340 Ga0496104_0197340_872_1735 268
867 3300048907 Ga0496104_0503717 Ga0496104_0503717_146_988 268
868 3300048908 Ga0496105_0048427 Ga0496105_0048427_1639_2493 268
869 3300048908 Ga0496105_0054223 Ga0496105_0054223_1611_2453 268
870 3300048909 Ga0496106_0010966 Ga0496106_0010966_2646_3488 268
871 3300048909 Ga0496106_0030363 Ga0496106_0030363_1776_2639 268
872 3300048909 Ga0496106_0551911 Ga0496106_0551911_54_914 268
873 3300048910 Ga0496107_0017835 Ga0496107_0017835_2718_3560 268
874 3300048910 Ga0496107_0019534 Ga0496107_0019534_3339_4181 268
875 3300048910 Ga0496107_0050042 Ga0496107_0050042_702_1544 268
876 3300048910 Ga0496107_0056838 Ga0496107_0056838_1870_2712 268
877 3300048910 Ga0496107_0158153 Ga0496107_0158153_403_1257 268
878 3300048910 Ga0496107_0161270 Ga0496107_0161270_769_1611 268
879 3300048911 Ga0496108_0040364 Ga0496108_0040364_503_1366 268
880 3300048911 Ga0496108_0101622 Ga0496108_0101622_353_1201 268
881 3300048911 Ga0496108_0204292 Ga0496108_0204292_549_1403 268
882 3300048911 Ga0496108_0277717 Ga0496108_0277717_154_996 268
883 3300048912 Ga0496109_0021552 Ga0496109_0021552_823_1665 268
884 3300048912 Ga0496109_0025246 Ga0496109_0025246_334_1188 268
885 3300048912 Ga0496109_0029973 Ga0496109_0029973_1666_2514 268
886 3300048912 Ga0496109_0244595 Ga0496109_0244595_497_1339 268
887 3300048912 Ga0496109_0299142 Ga0496109_0299142_63_905 268
888 3300048912 Ga0496109_0330334 Ga0496109_0330334_186_1028 268
889 3300048913 Ga0496110_0004167 Ga0496110_0004167_10220_11083 268
890 3300048913 Ga0496110_0054188 Ga0496110_0054188_1449_2291 268
891 3300048913 Ga0496110_0275684 Ga0496110_0275684_678_1520 268
892 3300048914 Ga0496111_0021427 Ga0496111_0021427_1760_2602 268
893 3300048914 Ga0496111_0032087 Ga0496111_0032087_2051_2893 268
894 3300048914 Ga0496111_0070832 Ga0496111_0070832_766_1620 268
895 3300048915 Ga0496112_0064301 Ga0496112_0064301_871_1713 268
896 3300048915 Ga0496112_0106883 Ga0496112_0106883_20_862 268
897 3300048915 Ga0496112_0261948 Ga0496112_0261948_194_1051 268
898 3300048915 Ga0496112_0294047 Ga0496112_0294047_586_1434 268
899 3300048916 Ga0496113_0055903 Ga0496113_0055903_241_1083 268
900 3300048917 Ga0496114_0164730 Ga0496114_0164730_733_1575 268
901 3300048918 Ga0496115_0003906 Ga0496115_0003906_4822_5664 268
902 3300048918 Ga0496115_0081649 Ga0496115_0081649_1767_2615 268
903 3300048918 Ga0496115_0154432 Ga0496115_0154432_632_1486 268
904 3300048918 Ga0496115_0225357 Ga0496115_0225357_511_1353 268
905 3300048920 Ga0496117_0110468 Ga0496117_0110468_87_929 268
906 3300048921 Ga0496118_0016521 Ga0496118_0016521_3351_4193 268
907 3300048922 Ga0496119_0108517 Ga0496119_0108517_72_914 268
908 3300048923 Ga0496120_0054274 Ga0496120_0054274_1388_2230 268
909 3300048924 Ga0496121_0000668 Ga0496121_0000668_62108_62950 268
910 3300048924 Ga0496121_0035985 Ga0496121_0035985_905_1747 268
911 3300048927 Ga0496124_0003401 Ga0496124_0003401_15264_16106 268
912 3300048928 Ga0496125_0190072 Ga0496125_0190072_45_887 268
913 3300048929 Ga0496126_0006242 Ga0496126_0006242_33_875 268
914 3300048929 Ga0496126_0015566 Ga0496126_0015566_704_1546 268
915 3300049570 Ga0501033_0028100 Ga0501033_0028100_978_1823 268
916 3300049571 Ga0501034_0001484 Ga0501034_0001484_25312_26154 268
917 3300049571 Ga0501034_0004456 Ga0501034_0004456_14205_15044 268
918 3300049574 Ga0501038_0078548 Ga0501038_0078548_707_1552 268
919 3300049575 Ga0501039_0080131 Ga0501039_0080131_14_862 268
920 3300049576 Ga0501040_0019560 Ga0501040_0019560_1795_2637 268
921 3300049577 Ga0501041_0008967 Ga0501041_0008967_3336_4181 268
922 3300049577 Ga0501041_0211195 Ga0501041_0211195_84_926 268
923 3300049581 Ga0501047_0344693 Ga0501047_0344693_95_940 268
924 3300049584 Ga0501068_0040625 Ga0501068_0040625_947_1789 268
925 3300049586 Ga0501070_0069511 Ga0501070_0069511_1499_2338 268
926 3300049586 Ga0501070_0214174 Ga0501070_0214174_470_1312 268
927 3300049588 Ga0501072_0183106 Ga0501072_0183106_430_1278 268
928 3300049590 Ga0501074_0047671 Ga0501074_0047671_69_908 268
929 3300049591 Ga0501075_0012445 Ga0501075_0012445_506_1348 268
930 3300049591 Ga0501075_0015379 Ga0501075_0015379_4386_5231 268
931 3300049592 Ga0501076_0011883 Ga0501076_0011883_1394_2239 268
932 3300049593 Ga0501077_0036140 Ga0501077_0036140_726_1571 268
933 3300049742 Ga0501080_0007219 Ga0501080_0007219_6629_7468 268
934 3300049743 Ga0501081_0000770 Ga0501081_0000770_5651_6496 268
935 3300049822 Ga0501035_0137942 Ga0501035_0137942_579_1418 268
936 3300049822 Ga0501035_0466629 Ga0501035_0466629_148_993 268
937 3300049823 Ga0501044_0029952 Ga0501044_0029952_2076_2918 268
938 3300049823 Ga0501044_0052437 Ga0501044_0052437_591_1430 268
939 3300049823 Ga0501044_0575339 Ga0501044_0575339_86_931 268
940 3300049824 Ga0501045_0067122 Ga0501045_0067122_1153_1995 268
941 3300050489 nmdc:mga03683_23583_c1 nmdc:mga03683_23583_c1_1171_2010 268
942 3300050489 nmdc:mga03683_58258_c1 nmdc:mga03683_58258_c1_384_1226 268
943 3300050490 nmdc:mga03n38_120198_c1 nmdc:mga03n38_120198_c1_141_980 268
944 3300050491 nmdc:mga00v17_279191_c1 nmdc:mga00v17_279191_c1_199_1041 268
945 3300050492 nmdc:mga0yw44_144645_c1 nmdc:mga0yw44_144645_c1_645_1487 268
946 3300050492 nmdc:mga0yw44_21824_c1 nmdc:mga0yw44_21824_c1_1104_1946 268
947 3300050495 nmdc:mga04h51_27778_c1 nmdc:mga04h51_27778_c1_682_1524 268
948 3300050507 nmdc:mga05p37_293713_c1 nmdc:mga05p37_293713_c1_808_1650 268
949 3300050507 nmdc:mga05p37_328420_c1 nmdc:mga05p37_328420_c1_245_1087 268
950 3300050507 nmdc:mga05p37_364116_c1 nmdc:mga05p37_364116_c1_632_1504 268
951 3300050507 nmdc:mga05p37_73435_c1 nmdc:mga05p37_73435_c1_3096_3938 268
952 3300050507 nmdc:mga05p37_77_c1 nmdc:mga05p37_77_c1_54770_55618 268
953 3300050507 nmdc:mga05p37_95699_c1 nmdc:mga05p37_95699_c1_397_1239 268
954 3300050508 nmdc:mga09592_140_c1 nmdc:mga09592_140_c1_23402_24250 268
955 3300050508 nmdc:mga09592_17731_c1 nmdc:mga09592_17731_c1_4904_5746 268
956 3300050509 nmdc:mga0qj67_25259_c1 nmdc:mga0qj67_25259_c1_3464_4321 268
957 3300050509 nmdc:mga0qj67_4986_c1 nmdc:mga0qj67_4986_c1_4068_4910 268
958 3300050510 nmdc:mga06r32_34853_c1 nmdc:mga06r32_34853_c1_1783_2631 268
959 3300050510 nmdc:mga06r32_3616_c1 nmdc:mga06r32_3616_c1_4625_5467 268
960 3300050510 nmdc:mga06r32_61973_c1 nmdc:mga06r32_61973_c1_2474_3322 268
961 3300050510 nmdc:mga06r32_62760_c1 nmdc:mga06r32_62760_c1_1706_2548 268
962 3300050510 nmdc:mga06r32_7599_c1 nmdc:mga06r32_7599_c1_8663_9520 268
963 3300050511 nmdc:mga08y16_126145_c1 nmdc:mga08y16_126145_c1_677_1519 268
964 3300050511 nmdc:mga08y16_173809_c1 nmdc:mga08y16_173809_c1_1191_2033 268
965 3300050511 nmdc:mga08y16_348511_c1 nmdc:mga08y16_348511_c1_337_1179 268
966 3300050511 nmdc:mga08y16_430888_c1 nmdc:mga08y16_430888_c1_202_1062 268
967 3300050511 nmdc:mga08y16_5208_c1 nmdc:mga08y16_5208_c1_9275_10117 268
968 3300050512 nmdc:mga0n895_112146_c1 nmdc:mga0n895_112146_c1_423_1271 268
969 3300050512 nmdc:mga0n895_336813_c1 nmdc:mga0n895_336813_c1_213_1055 268
970 3300050512 nmdc:mga0n895_6328_c1 nmdc:mga0n895_6328_c1_4983_5825 268
971 3300050513 nmdc:mga0rr50_104400_c1 nmdc:mga0rr50_104400_c1_757_1599 268
972 3300050513 nmdc:mga0rr50_156837_c1 nmdc:mga0rr50_156837_c1_205_1047 268
973 3300050513 nmdc:mga0rr50_70272_c1 nmdc:mga0rr50_70272_c1_647_1495 268
974 3300050513 nmdc:mga0rr50_71210_c1 nmdc:mga0rr50_71210_c1_1426_2268 268
975 3300050514 nmdc:mga08x19_16429_c1 nmdc:mga08x19_16429_c1_460_1308 268
976 3300050515 nmdc:mga0a205_11223_c1 nmdc:mga0a205_11223_c1_7083_7925 268
977 3300050515 nmdc:mga0a205_27624_c1 nmdc:mga0a205_27624_c1_2581_3423 268
978 3300050515 nmdc:mga0a205_285699_c1 nmdc:mga0a205_285699_c1_307_1149 268
979 3300050515 nmdc:mga0a205_71646_c1 nmdc:mga0a205_71646_c1_1178_2026 268
980 3300050515 nmdc:mga0a205_99668_c1 nmdc:mga0a205_99668_c1_660_1532 268
981 3300050516 nmdc:mga0sz30_51761_c1 nmdc:mga0sz30_51761_c1_15_860 268
982 3300053077 Ga0495601_0009955 Ga0495601_0009955_1766_2608 268
983 3300053077 Ga0495601_0041808 Ga0495601_0041808_1433_2410 268
984 3300053077 Ga0495601_0243540 Ga0495601_0243540_153_995 268
985 3300053078 Ga0495612_0007865 Ga0495612_0007865_334_1176 268
986 3300053084 Ga0495595_0014758 Ga0495595_0014758_2059_2901 268
987 3300053084 Ga0495595_0088653 Ga0495595_0088653_16_993 268
988 3300053084 Ga0495595_0187834 Ga0495595_0187834_110_952 268
989 3300053085 Ga0495619_0035699 Ga0495619_0035699_2111_2968 268
990 3300053085 Ga0495619_0083605 Ga0495619_0083605_935_1777 268
991 3300053085 Ga0495619_0134189 Ga0495619_0134189_224_1066 268
992 3300053094 Ga0500566_0000131 Ga0500566_0000131_25117_25959 268
993 3300053095 Ga0500640_104280 Ga0500640_104280_115_957 268
994 3300053111 Ga0500572_000369 Ga0500572_000369_4284_5126 268
995 3300053111 Ga0500572_015069 Ga0500572_015069_339_1181 268
996 3300053119 Ga0500595_000286 Ga0500595_000286_4911_5750 268
997 3300053119 Ga0500595_004482 Ga0500595_004482_2382_3260 268
998 3300053119 Ga0500595_010217 Ga0500595_010217_1340_2182 268
999 3300053122 Ga0500608_092183 Ga0500608_092183_118_960 268
1000 3300053123 Ga0500614_002288 Ga0500614_002288_3268_4110 268
1001 3300053136 Ga0500559_0000301 Ga0500559_0000301_15449_16291 268
1002 3300053136 Ga0500559_0069392 Ga0500559_0069392_263_1105 268
1003 3300053150 Ga0500603_000193 Ga0500603_000193_8261_9103 268
1004 3300053150 Ga0500603_009964 Ga0500603_009964_1023_1862 268
1005 3300053159 Ga0500630_018258 Ga0500630_018258_221_1063 268
1006 3300053162 Ga0500638_000725 Ga0500638_000725_2571_3410 268
1007 3300053162 Ga0500638_154855 Ga0500638_154855_120_998 268
1008 3300053163 Ga0500639_006329 Ga0500639_006329_1375_2217 268
1009 3300053177 Ga0500636_0057929 Ga0500636_0057929_654_1496 268
1010 3300053178 Ga0500637_0000135 Ga0500637_0000135_4793_5632 268
1011 3300054114 Ga0501084_0142736 Ga0501084_0142736_1129_1980 268
1012 3300055283 Ga0500661_005425 Ga0500661_005425_1056_1895 268
1013 3300059421 Ga0590071_006828 Ga0590071_006828_651_1493 268
1014 3300060353 Ga0501082_0169733 Ga0501082_0169733_10_855 268
1015 3300061734 Ga0530510_0000216 Ga0530510_0000216_23735_24577 268
1016 3300061734 Ga0530510_0003154 Ga0530510_0003154_4017_4862 268
1017 3300061734 Ga0530510_0039593 Ga0530510_0039593_588_1430 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

3

279

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4do7-assembly2.cif.gz_B crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 0.8023 1 263
4i6k-assembly1.cif.gz_A crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound 0.8017 1 264
4dnm-assembly1.cif.gz_A crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 0.7908 1 263
4i6k-assembly1.cif.gz_A crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound 0.7908 1 264
4do7-assembly2.cif.gz_B crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 0.7858 1 263
ID Description Score Start End Superfamily
af_A0A0P0W9I9_79_364_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8136 2 264 3.20.20.140
4do7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8023 1 263 3.20.20.140
4i6kA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8017 1 264 3.20.20.140
af_A0A0P0W9I9_79_364_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7967 2 264 3.20.20.140
4i6kA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7908 1 264 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A521M1K5-F1-model_v4 Amidohydrolase 0.9898 2 268 GO:0016787
AF-A0A4R5QDA7-F1-model_v4 Amidohydrolase 0.9867 1 268 GO:0016787
AF-A0A536VTI0-F1-model_v4 Amidohydrolase 0.985 35 268 GO:0016787
AF-A0A4R5QDA7-F1-model_v4 Amidohydrolase 0.9831 1 268 GO:0016787
AF-A0A521M1K5-F1-model_v4 Amidohydrolase 0.9825 2 268 GO:0016787

Feature Viewer

pLDDT pTM Quality
93.03 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map