F488300
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1017 | 446 | 1004 | 281 |
Family's Representative Sequence
| Representative Sequence | 3300053177|Ga0500636_0017052|Ga0500636_0017052_782_1636 |
| Length | 284 |
| Sequence | MIIDSQVHAYEANTLKRPWDTVPNWPDHVTGDEMVAAMDKVGVDGAIFISAFSMYRYDASYAVEVQRAHPDRMAIVKPVDPDDPAVADVVADWKRTPGAVGIRIMLTPEHKPRTPDDPGLDRIARAAVQHDFPVNILCWGNLDQGTALIDRHPETRFILDHLGILQPRTKPAPEQPLQQPWADLPKVLALARRPNVVIKVSGACTLSKEPYPFPDIWDPLARVFDAWGFERCLWGTDWTRAFAVVNYEQAVKPFVETKRLSESERAMLMGGACAKAYGWSPKRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 2 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 3 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 4 | 2791355199 | |||
| 5 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 6 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 7 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 8 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 9 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 10 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 94 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 98 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 99 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 100 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 104 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 105 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 114 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 143 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 144 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 145 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 147 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 227 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 234 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 236 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 237 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 238 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 239 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 240 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 241 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 243 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 244 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 245 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 246 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 247 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 248 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 249 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 250 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 251 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 252 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 253 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 254 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 255 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 256 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 257 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 258 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 260 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 264 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 265 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 268 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 269 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 271 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 272 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 273 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 276 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 278 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 279 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 280 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 281 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 282 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 283 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 286 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 287 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 288 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 289 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 290 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 291 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 292 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 293 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 294 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 295 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 296 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 297 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 298 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 299 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 300 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 301 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 302 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 303 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 304 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 305 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 306 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 307 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 308 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 309 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 312 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 313 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 314 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 359 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 360 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 361 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 362 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 363 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 366 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 367 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 368 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 369 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 370 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 371 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 372 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 373 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 374 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 375 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 376 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 377 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 378 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 379 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 403 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 404 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 405 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 406 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 407 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 408 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 409 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 410 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 420 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 425 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 426 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 427 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 428 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 429 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 430 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 431 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 432 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 433 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 434 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 435 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 436 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 437 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 438 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 439 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 441 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 442 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 444 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 445 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 446 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.43 |
| Metatranscriptomes | 0.39 |
| Isolates | 1.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.59 |
| Nodule | 0.79 |
| Rhizoplane | 6.78 |
| Rhizosphere | 82.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000162 | 3300003203 | Bacteria | 29622 |
| 2 | JGI25153J46596_10002866 | 3300003215 | Bacteria | 9797 |
| 3 | JGI25404J52841_10001411 | 3300003659 | Bacteria | 4218 |
| 4 | Ga0065712_10018464 | 3300005290 | Bacteria | 2120 |
| 5 | Ga0065715_10168973 | 3300005293 | Bacteria | 1562 |
| 6 | Ga0070676_10015138 | 3300005328 | Bacteria | 4252 |
| 7 | Ga0070683_100000791 | 3300005329 | Bacteria | 23353 |
| 8 | Ga0070683_100015757 | 3300005329 | Bacteria | 6645 |
| 9 | Ga0070683_100044454 | 3300005329 | Bacteria | 4096 |
| 10 | Ga0070690_100060130 | 3300005330 | Bacteria | 2445 |
| 11 | Ga0070690_100276750 | 3300005330 | Bacteria | 1196 |
| 12 | Ga0070670_100001030 | 3300005331 | Bacteria | 22062 |
| 13 | Ga0070670_100007487 | 3300005331 | Bacteria | 9272 |
| 14 | Ga0070670_100058179 | 3300005331 | Bacteria | 3318 |
| 15 | Ga0068869_100002206 | 3300005334 | Bacteria | 11714 |
| 16 | Ga0068869_100024561 | 3300005334 | Bacteria | 4174 |
| 17 | Ga0068869_100369404 | 3300005334 | Bacteria | 1173 |
| 18 | Ga0070666_10066982 | 3300005335 | Bacteria | 2438 |
| 19 | Ga0070680_100002402 | 3300005336 | Bacteria | 13867 |
| 20 | Ga0070680_100166702 | 3300005336 | Bacteria | 1852 |
| 21 | Ga0070680_100384707 | 3300005336 | Bacteria | 1195 |
| 22 | Ga0070682_100001262 | 3300005337 | Bacteria | 14373 |
| 23 | Ga0068868_100000913 | 3300005338 | Bacteria | 20073 |
| 24 | Ga0068868_100002406 | 3300005338 | Bacteria | 12953 |
| 25 | Ga0068868_100184928 | 3300005338 | Bacteria | 1730 |
| 26 | Ga0070660_100000335 | 3300005339 | Bacteria | 31181 |
| 27 | Ga0070660_100007713 | 3300005339 | Bacteria | 7502 |
| 28 | Ga0070689_100127552 | 3300005340 | Bacteria | 2037 |
| 29 | Ga0070689_100301513 | 3300005340 | Bacteria | 1334 |
| 30 | Ga0070691_10005617 | 3300005341 | Bacteria | 5712 |
| 31 | Ga0070661_100002058 | 3300005344 | Bacteria | 13863 |
| 32 | Ga0070661_100004972 | 3300005344 | Bacteria | 9154 |
| 33 | Ga0070661_100007089 | 3300005344 | Bacteria | 7731 |
| 34 | Ga0070661_100177216 | 3300005344 | Bacteria | 1621 |
| 35 | Ga0070692_10355987 | 3300005345 | Bacteria | 911 |
| 36 | Ga0070668_100006633 | 3300005347 | Bacteria | 8579 |
| 37 | Ga0070668_100055643 | 3300005347 | Bacteria | 3054 |
| 38 | Ga0070668_100211200 | 3300005347 | Bacteria | 1597 |
| 39 | Ga0070669_100071085 | 3300005353 | Bacteria | 2574 |
| 40 | Ga0070669_100101261 | 3300005353 | Bacteria | 2173 |
| 41 | Ga0070675_100001929 | 3300005354 | Bacteria | 15345 |
| 42 | Ga0070675_100002216 | 3300005354 | Bacteria | 14411 |
| 43 | Ga0070675_100076889 | 3300005354 | Bacteria | 2777 |
| 44 | Ga0070671_100005082 | 3300005355 | Bacteria | 10477 |
| 45 | Ga0070671_100031325 | 3300005355 | Bacteria | 4392 |
| 46 | Ga0070674_100014014 | 3300005356 | Bacteria | 4975 |
| 47 | Ga0070674_100239269 | 3300005356 | Bacteria | 1420 |
| 48 | Ga0070673_100004294 | 3300005364 | Bacteria | 8999 |
| 49 | Ga0070673_100032903 | 3300005364 | Bacteria | 3909 |
| 50 | Ga0070673_100077263 | 3300005364 | Bacteria | 2690 |
| 51 | Ga0070673_100232277 | 3300005364 | Bacteria | 1600 |
| 52 | Ga0070673_100333459 | 3300005364 | Bacteria | 1342 |
| 53 | Ga0070659_100004245 | 3300005366 | Bacteria | 10230 |
| 54 | Ga0070659_100209780 | 3300005366 | Bacteria | 1605 |
| 55 | Ga0070667_100012473 | 3300005367 | Bacteria | 7032 |
| 56 | Ga0070667_100136242 | 3300005367 | Bacteria | 2147 |
| 57 | Ga0070667_100272937 | 3300005367 | Bacteria | 1517 |
| 58 | Ga0070709_10009864 | 3300005434 | Bacteria | 5276 |
| 59 | Ga0070709_10017830 | 3300005434 | Bacteria | 4079 |
| 60 | Ga0070714_100005779 | 3300005435 | Bacteria | 9485 |
| 61 | Ga0070714_100027828 | 3300005435 | Bacteria | 4684 |
| 62 | Ga0070714_100246470 | 3300005435 | Bacteria | 1651 |
| 63 | Ga0070714_100253500 | 3300005435 | Bacteria | 1628 |
| 64 | Ga0070713_100007564 | 3300005436 | Bacteria | 7637 |
| 65 | Ga0070713_100035562 | 3300005436 | Bacteria | 4011 |
| 66 | Ga0070713_100109247 | 3300005436 | Bacteria | 2409 |
| 67 | Ga0070713_100145452 | 3300005436 | Bacteria | 2103 |
| 68 | Ga0070710_10000521 | 3300005437 | Bacteria | 18075 |
| 69 | Ga0070710_10001560 | 3300005437 | Bacteria | 10830 |
| 70 | Ga0070710_10066926 | 3300005437 | Bacteria | 2061 |
| 71 | Ga0070710_10169158 | 3300005437 | Bacteria | 1361 |
| 72 | Ga0070711_100009231 | 3300005439 | Bacteria | 6065 |
| 73 | Ga0070711_100014060 | 3300005439 | Bacteria | 5036 |
| 74 | Ga0070711_100049569 | 3300005439 | Bacteria | 2876 |
| 75 | Ga0070705_100009249 | 3300005440 | Bacteria | 4895 |
| 76 | Ga0070705_100013922 | 3300005440 | Bacteria | 4126 |
| 77 | Ga0070700_100062043 | 3300005441 | Bacteria | 2360 |
| 78 | Ga0070700_100084649 | 3300005441 | Bacteria | 2055 |
| 79 | Ga0070694_100029203 | 3300005444 | Bacteria | 3597 |
| 80 | Ga0070694_100368108 | 3300005444 | Bacteria | 1118 |
| 81 | Ga0070708_100064166 | 3300005445 | Bacteria | 3290 |
| 82 | Ga0070708_100184557 | 3300005445 | Bacteria | 1950 |
| 83 | Ga0070708_100368691 | 3300005445 | Bacteria | 1354 |
| 84 | Ga0070663_100006448 | 3300005455 | Bacteria | 7057 |
| 85 | Ga0070663_100094486 | 3300005455 | Bacteria | 2220 |
| 86 | Ga0070663_100238632 | 3300005455 | Bacteria | 1434 |
| 87 | Ga0070663_100454869 | 3300005455 | Bacteria | 1056 |
| 88 | Ga0070678_100000640 | 3300005456 | Bacteria | 17148 |
| 89 | Ga0070678_100003210 | 3300005456 | Bacteria | 9073 |
| 90 | Ga0070678_100549068 | 3300005456 | Bacteria | 1025 |
| 91 | Ga0070662_100023019 | 3300005457 | Bacteria | 4275 |
| 92 | Ga0070662_100041868 | 3300005457 | Bacteria | 3270 |
| 93 | Ga0070662_100076697 | 3300005457 | Bacteria | 2478 |
| 94 | Ga0070681_10089175 | 3300005458 | Bacteria | 3035 |
| 95 | Ga0070681_10396293 | 3300005458 | Bacteria | 1292 |
| 96 | Ga0070681_10445009 | 3300005458 | Bacteria | 1208 |
| 97 | Ga0070681_10623070 | 3300005458 | Bacteria | 993 |
| 98 | Ga0068867_100004506 | 3300005459 | Bacteria | 9789 |
| 99 | Ga0068867_100065528 | 3300005459 | Bacteria | 2703 |
| 100 | Ga0068867_100068789 | 3300005459 | Bacteria | 2643 |
| 101 | Ga0070685_10140715 | 3300005466 | Bacteria | 1519 |
| 102 | Ga0070706_100178535 | 3300005467 | Bacteria | 1982 |
| 103 | Ga0070706_100225177 | 3300005467 | Bacteria | 1751 |
| 104 | Ga0070706_100238099 | 3300005467 | Bacteria | 1699 |
| 105 | Ga0070706_100252170 | 3300005467 | Bacteria | 1647 |
| 106 | Ga0070706_100385076 | 3300005467 | Bacteria | 1306 |
| 107 | Ga0070707_100071546 | 3300005468 | Bacteria | 3341 |
| 108 | Ga0070707_100158548 | 3300005468 | Bacteria | 2204 |
| 109 | Ga0070707_100298481 | 3300005468 | Bacteria | 1565 |
| 110 | Ga0070698_100048147 | 3300005471 | Bacteria | 4356 |
| 111 | Ga0070698_100093465 | 3300005471 | Bacteria | 2987 |
| 112 | Ga0070698_100096482 | 3300005471 | Bacteria | 2933 |
| 113 | Ga0070698_100113516 | 3300005471 | Bacteria | 2674 |
| 114 | Ga0070698_100153464 | 3300005471 | Bacteria | 2249 |
| 115 | Ga0070699_100041399 | 3300005518 | Bacteria | 3988 |
| 116 | Ga0070699_100047275 | 3300005518 | Bacteria | 3723 |
| 117 | Ga0070699_100084776 | 3300005518 | Bacteria | 2765 |
| 118 | Ga0070699_100326413 | 3300005518 | Bacteria | 1380 |
| 119 | Ga0070699_100382109 | 3300005518 | Bacteria | 1271 |
| 120 | Ga0070679_100005011 | 3300005530 | Bacteria | 12222 |
| 121 | Ga0070679_100026077 | 3300005530 | Bacteria | 5737 |
| 122 | Ga0070679_100067501 | 3300005530 | Bacteria | 3566 |
| 123 | Ga0070679_100078056 | 3300005530 | Bacteria | 3300 |
| 124 | Ga0070679_100241516 | 3300005530 | Bacteria | 1763 |
| 125 | Ga0070684_100009593 | 3300005535 | Bacteria | 7629 |
| 126 | Ga0070684_100030692 | 3300005535 | Bacteria | 4569 |
| 127 | Ga0070697_100256275 | 3300005536 | Bacteria | 1497 |
| 128 | Ga0070697_100321683 | 3300005536 | Bacteria | 1332 |
| 129 | Ga0068853_100005907 | 3300005539 | Bacteria | 9658 |
| 130 | Ga0068853_100030633 | 3300005539 | Bacteria | 4546 |
| 131 | Ga0068853_100206610 | 3300005539 | Bacteria | 1789 |
| 132 | Ga0068853_100494130 | 3300005539 | Bacteria | 1155 |
| 133 | Ga0070672_100000756 | 3300005543 | Bacteria | 19234 |
| 134 | Ga0070672_100001321 | 3300005543 | Bacteria | 15281 |
| 135 | Ga0070672_100045964 | 3300005543 | Bacteria | 3381 |
| 136 | Ga0070672_100077910 | 3300005543 | Bacteria | 2651 |
| 137 | Ga0070672_100331998 | 3300005543 | Bacteria | 1294 |
| 138 | Ga0070695_100009784 | 3300005545 | Bacteria | 5711 |
| 139 | Ga0070695_100010947 | 3300005545 | Bacteria | 5421 |
| 140 | Ga0070695_100034299 | 3300005545 | Bacteria | 3181 |
| 141 | Ga0070696_100006504 | 3300005546 | Bacteria | 7805 |
| 142 | Ga0070696_100019857 | 3300005546 | Bacteria | 4555 |
| 143 | Ga0070693_100000201 | 3300005547 | Bacteria | 28084 |
| 144 | Ga0070693_100062384 | 3300005547 | Bacteria | 2169 |
| 145 | Ga0070665_100056988 | 3300005548 | Bacteria | 3918 |
| 146 | Ga0070704_100000395 | 3300005549 | Bacteria | 20026 |
| 147 | Ga0070704_100001335 | 3300005549 | Bacteria | 13077 |
| 148 | Ga0070704_100005399 | 3300005549 | Bacteria | 7442 |
| 149 | Ga0068855_100001465 | 3300005563 | Bacteria | 29468 |
| 150 | Ga0068855_100172656 | 3300005563 | Bacteria | 2447 |
| 151 | Ga0068855_100226845 | 3300005563 | Bacteria | 2093 |
| 152 | Ga0070664_100006519 | 3300005564 | Bacteria | 9412 |
| 153 | Ga0070664_100039095 | 3300005564 | Bacteria | 3996 |
| 154 | Ga0070664_100269003 | 3300005564 | Bacteria | 1535 |
| 155 | Ga0068857_100086635 | 3300005577 | Bacteria | 2801 |
| 156 | Ga0068857_100088251 | 3300005577 | Bacteria | 2774 |
| 157 | Ga0068857_100104239 | 3300005577 | Bacteria | 2546 |
| 158 | Ga0068854_100006822 | 3300005578 | Bacteria | 7282 |
| 159 | Ga0068854_100027180 | 3300005578 | Bacteria | 3941 |
| 160 | Ga0068856_100000513 | 3300005614 | Bacteria | 42640 |
| 161 | Ga0068856_100001138 | 3300005614 | Bacteria | 27944 |
| 162 | Ga0068856_100133819 | 3300005614 | Bacteria | 2484 |
| 163 | Ga0070702_100099719 | 3300005615 | Bacteria | 1779 |
| 164 | Ga0068852_100001088 | 3300005616 | Bacteria | 17948 |
| 165 | Ga0068852_100003525 | 3300005616 | Bacteria | 10947 |
| 166 | Ga0068852_100047281 | 3300005616 | Bacteria | 3670 |
| 167 | Ga0068859_100112847 | 3300005617 | Bacteria | 2781 |
| 168 | Ga0068859_100263614 | 3300005617 | Bacteria | 1815 |
| 169 | Ga0068864_100013872 | 3300005618 | Bacteria | 6679 |
| 170 | Ga0068864_100061767 | 3300005618 | Bacteria | 3245 |
| 171 | Ga0068864_100082720 | 3300005618 | Bacteria | 2817 |
| 172 | Ga0068864_100088756 | 3300005618 | Bacteria | 2723 |
| 173 | Ga0068866_10061647 | 3300005718 | Bacteria | 1948 |
| 174 | Ga0068866_10193962 | 3300005718 | Bacteria | 1209 |
| 175 | Ga0068866_10302339 | 3300005718 | Bacteria | 1000 |
| 176 | Ga0068861_100036662 | 3300005719 | Bacteria | 3642 |
| 177 | Ga0068851_10012174 | 3300005834 | Bacteria | 4051 |
| 178 | Ga0068870_10004585 | 3300005840 | Bacteria | 5956 |
| 179 | Ga0068870_10039704 | 3300005840 | Bacteria | 2436 |
| 180 | Ga0068863_100045502 | 3300005841 | Bacteria | 4165 |
| 181 | Ga0068863_100080491 | 3300005841 | Bacteria | 3085 |
| 182 | Ga0068863_100083763 | 3300005841 | Bacteria | 3022 |
| 183 | Ga0068858_100028605 | 3300005842 | Bacteria | 5176 |
| 184 | Ga0068858_100563949 | 3300005842 | Bacteria | 1103 |
| 185 | Ga0068860_100000503 | 3300005843 | Bacteria | 48508 |
| 186 | Ga0068860_100035583 | 3300005843 | Bacteria | 4775 |
| 187 | Ga0068860_100094659 | 3300005843 | Bacteria | 2847 |
| 188 | Ga0068860_100147155 | 3300005843 | Bacteria | 2267 |
| 189 | Ga0068862_100025439 | 3300005844 | Bacteria | 4970 |
| 190 | Ga0081455_10000022 | 3300005937 | Bacteria | 159620 |
| 191 | Ga0081455_10000864 | 3300005937 | Bacteria | 39060 |
| 192 | Ga0081455_10019456 | 3300005937 | Bacteria | 6423 |
| 193 | Ga0081455_10020308 | 3300005937 | Bacteria | 6261 |
| 194 | Ga0081538_10044258 | 3300005981 | Bacteria | 2780 |
| 195 | Ga0081540_1000374 | 3300005983 | Bacteria | 44794 |
| 196 | Ga0081540_1002045 | 3300005983 | Bacteria | 16821 |
| 197 | Ga0081539_10001007 | 3300005985 | Bacteria | 52055 |
| 198 | Ga0070717_10035339 | 3300006028 | Bacteria | 4045 |
| 199 | Ga0070717_10065385 | 3300006028 | Bacteria | 3023 |
| 200 | Ga0075365_10029929 | 3300006038 | Bacteria | 3483 |
| 201 | Ga0075365_10042546 | 3300006038 | Bacteria | 2970 |
| 202 | Ga0075365_10279407 | 3300006038 | Bacteria | 1175 |
| 203 | Ga0075365_10332934 | 3300006038 | Bacteria | 1070 |
| 204 | Ga0075368_10027879 | 3300006042 | Bacteria | 2180 |
| 205 | Ga0075368_10095838 | 3300006042 | Bacteria | 1216 |
| 206 | Ga0075363_100038980 | 3300006048 | Bacteria | 2499 |
| 207 | Ga0075363_100085334 | 3300006048 | Bacteria | 1732 |
| 208 | Ga0075364_10050605 | 3300006051 | Bacteria | 2712 |
| 209 | Ga0075364_10125743 | 3300006051 | Bacteria | 1719 |
| 210 | Ga0075364_10172107 | 3300006051 | Bacteria | 1464 |
| 211 | Ga0075432_10030582 | 3300006058 | Bacteria | 1861 |
| 212 | Ga0070715_10000603 | 3300006163 | Bacteria | 9492 |
| 213 | Ga0070715_10254362 | 3300006163 | Bacteria | 919 |
| 214 | Ga0070716_100031698 | 3300006173 | Bacteria | 2877 |
| 215 | Ga0070716_100055965 | 3300006173 | Bacteria | 2260 |
| 216 | Ga0070712_100003710 | 3300006175 | Bacteria | 9408 |
| 217 | Ga0075362_10004593 | 3300006177 | Bacteria | 4975 |
| 218 | Ga0075362_10033366 | 3300006177 | Bacteria | 2238 |
| 219 | Ga0075362_10073325 | 3300006177 | Bacteria | 1567 |
| 220 | Ga0075367_10008292 | 3300006178 | Bacteria | 5380 |
| 221 | Ga0075367_10021431 | 3300006178 | Bacteria | 3611 |
| 222 | Ga0075369_10008692 | 3300006186 | Bacteria | 3919 |
| 223 | Ga0075369_10034929 | 3300006186 | Bacteria | 2135 |
| 224 | Ga0075369_10129066 | 3300006186 | Bacteria | 1148 |
| 225 | Ga0075366_10019315 | 3300006195 | Bacteria | 3941 |
| 226 | Ga0075366_10091024 | 3300006195 | Bacteria | 1827 |
| 227 | Ga0097621_100001375 | 3300006237 | Bacteria | 16725 |
| 228 | Ga0097621_100005490 | 3300006237 | Bacteria | 8932 |
| 229 | Ga0097621_100269539 | 3300006237 | Bacteria | 1496 |
| 230 | Ga0068871_100001017 | 3300006358 | Bacteria | 18777 |
| 231 | Ga0068871_100055451 | 3300006358 | Bacteria | 3217 |
| 232 | Ga0075428_100008280 | 3300006844 | Bacteria | 11527 |
| 233 | Ga0075428_100014675 | 3300006844 | Bacteria | 8702 |
| 234 | Ga0075428_100022172 | 3300006844 | Bacteria | 7031 |
| 235 | Ga0075428_100047019 | 3300006844 | Bacteria | 4740 |
| 236 | Ga0075428_100059199 | 3300006844 | Bacteria | 4195 |
| 237 | Ga0075428_100080660 | 3300006844 | Bacteria | 3551 |
| 238 | Ga0075428_100133891 | 3300006844 | Bacteria | 2695 |
| 239 | Ga0075428_100625905 | 3300006844 | Bacteria | 1149 |
| 240 | Ga0075428_100746163 | 3300006844 | Bacteria | 1042 |
| 241 | Ga0075430_100001172 | 3300006846 | Bacteria | 20997 |
| 242 | Ga0075430_100008019 | 3300006846 | Bacteria | 8929 |
| 243 | Ga0075431_100000109 | 3300006847 | Bacteria | 52399 |
| 244 | Ga0075431_100005848 | 3300006847 | Bacteria | 12170 |
| 245 | Ga0075431_100008045 | 3300006847 | Bacteria | 10521 |
| 246 | Ga0075431_100011372 | 3300006847 | Bacteria | 8965 |
| 247 | Ga0075431_100017008 | 3300006847 | Bacteria | 7385 |
| 248 | Ga0075431_100050589 | 3300006847 | Bacteria | 4284 |
| 249 | Ga0075431_100098586 | 3300006847 | Bacteria | 3017 |
| 250 | Ga0075433_10004254 | 3300006852 | Bacteria | 11118 |
| 251 | Ga0075433_10008732 | 3300006852 | Bacteria | 8084 |
| 252 | Ga0075433_10033075 | 3300006852 | Bacteria | 4432 |
| 253 | Ga0075433_10067251 | 3300006852 | Bacteria | 3145 |
| 254 | Ga0075434_100010330 | 3300006871 | Bacteria | 8751 |
| 255 | Ga0075434_100031443 | 3300006871 | Bacteria | 5234 |
| 256 | Ga0075434_100175540 | 3300006871 | Bacteria | 2162 |
| 257 | Ga0075434_100281163 | 3300006871 | Bacteria | 1684 |
| 258 | Ga0075429_100000003 | 3300006880 | Bacteria | 130377 |
| 259 | Ga0075429_100020823 | 3300006880 | Bacteria | 5692 |
| 260 | Ga0075429_100061447 | 3300006880 | Bacteria | 3273 |
| 261 | Ga0068865_100047363 | 3300006881 | Bacteria | 2954 |
| 262 | Ga0068865_100112910 | 3300006881 | Bacteria | 2008 |
| 263 | Ga0068865_100161512 | 3300006881 | Bacteria | 1710 |
| 264 | Ga0075436_100000611 | 3300006914 | Bacteria | 23398 |
| 265 | Ga0075436_100050850 | 3300006914 | Bacteria | 2860 |
| 266 | Ga0097620_100112848 | 3300006931 | Bacteria | 2781 |
| 267 | Ga0097620_100263626 | 3300006931 | Bacteria | 1815 |
| 268 | Ga0075435_100003813 | 3300007076 | Bacteria | 10283 |
| 269 | Ga0075435_100119046 | 3300007076 | Bacteria | 2202 |
| 270 | Ga0099794_10009489 | 3300007265 | Bacteria | 4094 |
| 271 | Ga0099795_10060195 | 3300007788 | Bacteria | 1407 |
| 272 | Ga0105240_10044074 | 3300009093 | Bacteria | 5673 |
| 273 | Ga0105240_10188913 | 3300009093 | Bacteria | 2424 |
| 274 | Ga0111539_10000387 | 3300009094 | Bacteria | 54408 |
| 275 | Ga0111539_10000684 | 3300009094 | Bacteria | 43895 |
| 276 | Ga0111539_10037748 | 3300009094 | Bacteria | 5831 |
| 277 | Ga0111539_10062968 | 3300009094 | Bacteria | 4389 |
| 278 | Ga0111539_10078453 | 3300009094 | Bacteria | 3885 |
| 279 | Ga0105245_10008214 | 3300009098 | Bacteria | 9127 |
| 280 | Ga0105245_10187866 | 3300009098 | Bacteria | 1977 |
| 281 | Ga0114129_10000425 | 3300009147 | Bacteria | 50146 |
| 282 | Ga0114129_10005359 | 3300009147 | Bacteria | 18104 |
| 283 | Ga0114129_10090068 | 3300009147 | Bacteria | 4253 |
| 284 | Ga0114129_10101093 | 3300009147 | Bacteria | 3990 |
| 285 | Ga0114129_10127814 | 3300009147 | Bacteria | 3493 |
| 286 | Ga0114129_10332768 | 3300009147 | Bacteria | 2016 |
| 287 | Ga0114129_10368526 | 3300009147 | Bacteria | 1899 |
| 288 | Ga0114129_10426852 | 3300009147 | Bacteria | 1742 |
| 289 | Ga0114129_10451566 | 3300009147 | Bacteria | 1686 |
| 290 | Ga0114129_10504961 | 3300009147 | Bacteria | 1579 |
| 291 | Ga0105243_10067067 | 3300009148 | Bacteria | 2888 |
| 292 | Ga0105243_10181148 | 3300009148 | Bacteria | 1832 |
| 293 | Ga0105243_10232271 | 3300009148 | Bacteria | 1637 |
| 294 | Ga0105243_10562352 | 3300009148 | Bacteria | 1092 |
| 295 | Ga0105243_10772503 | 3300009148 | Bacteria | 944 |
| 296 | Ga0105241_10079079 | 3300009174 | Bacteria | 2571 |
| 297 | Ga0105242_10272565 | 3300009176 | Bacteria | 1534 |
| 298 | Ga0105242_10275776 | 3300009176 | Bacteria | 1525 |
| 299 | Ga0105248_10088269 | 3300009177 | Bacteria | 3490 |
| 300 | Ga0105248_10168955 | 3300009177 | Bacteria | 2465 |
| 301 | Ga0105248_10485265 | 3300009177 | Bacteria | 1393 |
| 302 | Ga0105237_10007319 | 3300009545 | Bacteria | 12102 |
| 303 | Ga0105237_10043711 | 3300009545 | Bacteria | 4512 |
| 304 | Ga0105237_10048539 | 3300009545 | Bacteria | 4267 |
| 305 | Ga0105237_10213722 | 3300009545 | Bacteria | 1928 |
| 306 | Ga0105249_10013696 | 3300009553 | Bacteria | 7161 |
| 307 | Ga0105239_10126553 | 3300010375 | Bacteria | 2840 |
| 308 | Ga0105239_10215689 | 3300010375 | Bacteria | 2152 |
| 309 | Ga0157373_10001232 | 3300013100 | Bacteria | 19561 |
| 310 | Ga0157371_10102647 | 3300013102 | Bacteria | 2029 |
| 311 | Ga0157371_10266182 | 3300013102 | Bacteria | 1236 |
| 312 | Ga0157370_10052997 | 3300013104 | Bacteria | 3871 |
| 313 | Ga0157370_10055518 | 3300013104 | Bacteria | 3772 |
| 314 | Ga0157370_10158080 | 3300013104 | Bacteria | 2109 |
| 315 | Ga0157369_10004456 | 3300013105 | Bacteria | 16499 |
| 316 | Ga0157369_10019805 | 3300013105 | Bacteria | 7530 |
| 317 | Ga0157369_10610831 | 3300013105 | Bacteria | 1125 |
| 318 | Ga0157374_10008483 | 3300013296 | Bacteria | 8789 |
| 319 | Ga0157374_10050173 | 3300013296 | Bacteria | 3878 |
| 320 | Ga0157374_10061756 | 3300013296 | Bacteria | 3510 |
| 321 | Ga0157374_10100879 | 3300013296 | Bacteria | 2767 |
| 322 | Ga0157374_10278033 | 3300013296 | Bacteria | 1652 |
| 323 | Ga0157374_10679080 | 3300013296 | Bacteria | 1042 |
| 324 | Ga0157378_10041710 | 3300013297 | Bacteria | 4072 |
| 325 | Ga0157378_10073414 | 3300013297 | Bacteria | 3076 |
| 326 | Ga0157378_10073485 | 3300013297 | Bacteria | 3074 |
| 327 | Ga0157378_10207784 | 3300013297 | Bacteria | 1855 |
| 328 | Ga0163162_10082024 | 3300013306 | Bacteria | 3296 |
| 329 | Ga0163162_10103175 | 3300013306 | Bacteria | 2945 |
| 330 | Ga0163162_10128132 | 3300013306 | Bacteria | 2646 |
| 331 | Ga0157372_10000612 | 3300013307 | Bacteria | 39043 |
| 332 | Ga0157372_10041944 | 3300013307 | Bacteria | 5060 |
| 333 | Ga0157372_10212403 | 3300013307 | Bacteria | 2242 |
| 334 | Ga0157375_10010239 | 3300013308 | Bacteria | 8248 |
| 335 | Ga0157375_10055192 | 3300013308 | Bacteria | 3916 |
| 336 | Ga0157375_10078073 | 3300013308 | Bacteria | 3343 |
| 337 | Ga0157375_10343430 | 3300013308 | Bacteria | 1658 |
| 338 | Ga0163163_10024216 | 3300014325 | Bacteria | 5775 |
| 339 | Ga0163163_10050760 | 3300014325 | Bacteria | 4086 |
| 340 | Ga0157380_10114633 | 3300014326 | Bacteria | 2271 |
| 341 | Ga0182008_10021801 | 3300014497 | Bacteria | 3288 |
| 342 | Ga0157379_10098375 | 3300014968 | Bacteria | 2626 |
| 343 | Ga0157376_10016314 | 3300014969 | Bacteria | 5635 |
| 344 | Ga0157376_10151953 | 3300014969 | Bacteria | 2089 |
| 345 | Ga0157376_10215625 | 3300014969 | Bacteria | 1775 |
| 346 | Ga0163161_10116625 | 3300017792 | Bacteria | 2002 |
| 347 | Ga0163161_10189794 | 3300017792 | Bacteria | 1579 |
| 348 | Ga0206356_10060346 | 3300020070 | Bacteria | 1096 |
| 349 | Ga0213873_10019757 | 3300021358 | Bacteria | 1566 |
| 350 | Ga0213874_10061093 | 3300021377 | Bacteria | 1180 |
| 351 | Ga0213876_10003793 | 3300021384 | Bacteria | 8571 |
| 352 | Ga0224712_10147600 | 3300022467 | Bacteria | 1040 |
| 353 | Ga0224712_10150931 | 3300022467 | Bacteria | 1029 |
| 354 | Ga0224572_1007000 | 3300024225 | Bacteria | 2055 |
| 355 | Ga0209677_101915 | 3300025253 | Bacteria | 8379 |
| 356 | Ga0209148_1006564 | 3300025254 | Bacteria | 2509 |
| 357 | Ga0209233_1004436 | 3300025261 | Bacteria | 4772 |
| 358 | Ga0209455_1003615 | 3300025272 | Bacteria | 5383 |
| 359 | Ga0209455_1004331 | 3300025272 | Bacteria | 4686 |
| 360 | Ga0209758_1006475 | 3300025297 | Bacteria | 8389 |
| 361 | Ga0207656_10005307 | 3300025321 | Bacteria | 4547 |
| 362 | Ga0207656_10024914 | 3300025321 | Bacteria | 2425 |
| 363 | Ga0207656_10129390 | 3300025321 | Bacteria | 1181 |
| 364 | Ga0207653_10003590 | 3300025885 | Bacteria | 4884 |
| 365 | Ga0207682_10000949 | 3300025893 | Bacteria | 13441 |
| 366 | Ga0207692_10001827 | 3300025898 | Bacteria | 8089 |
| 367 | Ga0207692_10021921 | 3300025898 | Bacteria | 2931 |
| 368 | Ga0207692_10112045 | 3300025898 | Bacteria | 1514 |
| 369 | Ga0207680_10012253 | 3300025903 | Bacteria | 4363 |
| 370 | Ga0207685_10002290 | 3300025905 | Bacteria | 4350 |
| 371 | Ga0207685_10049722 | 3300025905 | Bacteria | 1612 |
| 372 | Ga0207699_10027465 | 3300025906 | Bacteria | 3151 |
| 373 | Ga0207699_10083256 | 3300025906 | Bacteria | 1989 |
| 374 | Ga0207699_10132736 | 3300025906 | Bacteria | 1626 |
| 375 | Ga0207645_10009046 | 3300025907 | Bacteria | 6912 |
| 376 | Ga0207645_10189163 | 3300025907 | Bacteria | 1352 |
| 377 | Ga0207643_10040490 | 3300025908 | Bacteria | 2624 |
| 378 | Ga0207684_10001645 | 3300025910 | Bacteria | 23726 |
| 379 | Ga0207684_10017949 | 3300025910 | Bacteria | 6063 |
| 380 | Ga0207684_10019307 | 3300025910 | Bacteria | 5830 |
| 381 | Ga0207684_10080444 | 3300025910 | Bacteria | 2772 |
| 382 | Ga0207684_10195869 | 3300025910 | Bacteria | 1743 |
| 383 | Ga0207654_10021309 | 3300025911 | Bacteria | 3445 |
| 384 | Ga0207707_10000170 | 3300025912 | Bacteria | 68142 |
| 385 | Ga0207707_10000555 | 3300025912 | Bacteria | 37837 |
| 386 | Ga0207707_10258954 | 3300025912 | Bacteria | 1510 |
| 387 | Ga0207695_10081975 | 3300025913 | Bacteria | 3263 |
| 388 | Ga0207695_10452537 | 3300025913 | Bacteria | 1167 |
| 389 | Ga0207671_10036016 | 3300025914 | Bacteria | 3670 |
| 390 | Ga0207671_10071214 | 3300025914 | Bacteria | 2593 |
| 391 | Ga0207671_10075808 | 3300025914 | Bacteria | 2516 |
| 392 | Ga0207693_10006093 | 3300025915 | Bacteria | 9988 |
| 393 | Ga0207693_10010348 | 3300025915 | Bacteria | 7571 |
| 394 | Ga0207693_10036914 | 3300025915 | Bacteria | 3853 |
| 395 | Ga0207693_10046726 | 3300025915 | Bacteria | 3401 |
| 396 | Ga0207663_10005048 | 3300025916 | Bacteria | 6627 |
| 397 | Ga0207663_10007145 | 3300025916 | Bacteria | 5771 |
| 398 | Ga0207660_10007797 | 3300025917 | Bacteria | 6929 |
| 399 | Ga0207660_10051731 | 3300025917 | Bacteria | 2921 |
| 400 | Ga0207660_10139553 | 3300025917 | Bacteria | 1852 |
| 401 | Ga0207660_10143522 | 3300025917 | Bacteria | 1827 |
| 402 | Ga0207660_10296179 | 3300025917 | Bacteria | 1287 |
| 403 | Ga0207657_10001106 | 3300025919 | Bacteria | 28608 |
| 404 | Ga0207657_10225025 | 3300025919 | Bacteria | 1502 |
| 405 | Ga0207649_10010165 | 3300025920 | Bacteria | 5166 |
| 406 | Ga0207649_10017532 | 3300025920 | Bacteria | 4058 |
| 407 | Ga0207649_10018651 | 3300025920 | Bacteria | 3951 |
| 408 | Ga0207652_10004264 | 3300025921 | Bacteria | 11671 |
| 409 | Ga0207652_10041977 | 3300025921 | Bacteria | 3890 |
| 410 | Ga0207652_10045482 | 3300025921 | Bacteria | 3743 |
| 411 | Ga0207646_10036612 | 3300025922 | Bacteria | 4428 |
| 412 | Ga0207646_10162053 | 3300025922 | Bacteria | 2018 |
| 413 | Ga0207681_10166003 | 3300025923 | Bacteria | 1669 |
| 414 | Ga0207681_10512964 | 3300025923 | Bacteria | 983 |
| 415 | Ga0207694_10054336 | 3300025924 | Bacteria | 3107 |
| 416 | Ga0207694_10175659 | 3300025924 | Bacteria | 1735 |
| 417 | Ga0207650_10007352 | 3300025925 | Bacteria | 7499 |
| 418 | Ga0207659_10026148 | 3300025926 | Bacteria | 3935 |
| 419 | Ga0207659_10097269 | 3300025926 | Bacteria | 2211 |
| 420 | Ga0207687_10057049 | 3300025927 | Bacteria | 2742 |
| 421 | Ga0207700_10013572 | 3300025928 | Bacteria | 5307 |
| 422 | Ga0207700_10024377 | 3300025928 | Bacteria | 4186 |
| 423 | Ga0207700_10117449 | 3300025928 | Bacteria | 2151 |
| 424 | Ga0207700_10258138 | 3300025928 | Bacteria | 1491 |
| 425 | Ga0207700_10515566 | 3300025928 | Bacteria | 1059 |
| 426 | Ga0207664_10025824 | 3300025929 | Bacteria | 4431 |
| 427 | Ga0207664_10047275 | 3300025929 | Bacteria | 3379 |
| 428 | Ga0207664_10047750 | 3300025929 | Bacteria | 3364 |
| 429 | Ga0207664_10150039 | 3300025929 | Bacteria | 1979 |
| 430 | Ga0207664_10176266 | 3300025929 | Bacteria | 1833 |
| 431 | Ga0207664_10188599 | 3300025929 | Bacteria | 1774 |
| 432 | Ga0207644_10024145 | 3300025931 | Bacteria | 4171 |
| 433 | Ga0207644_10041790 | 3300025931 | Bacteria | 3245 |
| 434 | Ga0207644_10055972 | 3300025931 | Bacteria | 2845 |
| 435 | Ga0207644_10320333 | 3300025931 | Bacteria | 1253 |
| 436 | Ga0207690_10002071 | 3300025932 | Bacteria | 12292 |
| 437 | Ga0207690_10285842 | 3300025932 | Bacteria | 1286 |
| 438 | Ga0207706_10013378 | 3300025933 | Bacteria | 7463 |
| 439 | Ga0207706_10053483 | 3300025933 | Bacteria | 3564 |
| 440 | Ga0207706_10086601 | 3300025933 | Bacteria | 2754 |
| 441 | Ga0207706_10177687 | 3300025933 | Bacteria | 1870 |
| 442 | Ga0207706_10568223 | 3300025933 | Bacteria | 975 |
| 443 | Ga0207686_10021531 | 3300025934 | Bacteria | 3702 |
| 444 | Ga0207686_10050676 | 3300025934 | Bacteria | 2583 |
| 445 | Ga0207709_10011247 | 3300025935 | Bacteria | 4937 |
| 446 | Ga0207709_10021268 | 3300025935 | Bacteria | 3671 |
| 447 | Ga0207709_10199122 | 3300025935 | Bacteria | 1429 |
| 448 | Ga0207709_10487196 | 3300025935 | Bacteria | 960 |
| 449 | Ga0207670_10095037 | 3300025936 | Bacteria | 2116 |
| 450 | Ga0207670_10251610 | 3300025936 | Bacteria | 1366 |
| 451 | Ga0207669_10017679 | 3300025937 | Bacteria | 3664 |
| 452 | Ga0207669_10026910 | 3300025937 | Bacteria | 3137 |
| 453 | Ga0207704_10027519 | 3300025938 | Bacteria | 3139 |
| 454 | Ga0207704_10031936 | 3300025938 | Bacteria | 2973 |
| 455 | Ga0207704_10409460 | 3300025938 | Bacteria | 1072 |
| 456 | Ga0207704_10490779 | 3300025938 | Bacteria | 988 |
| 457 | Ga0207665_10027175 | 3300025939 | Bacteria | 3780 |
| 458 | Ga0207665_10221391 | 3300025939 | Bacteria | 1387 |
| 459 | Ga0207665_10463737 | 3300025939 | Bacteria | 974 |
| 460 | Ga0207691_10000521 | 3300025940 | Bacteria | 38291 |
| 461 | Ga0207691_10013018 | 3300025940 | Bacteria | 7966 |
| 462 | Ga0207691_10017685 | 3300025940 | Bacteria | 6758 |
| 463 | Ga0207691_10128303 | 3300025940 | Bacteria | 2242 |
| 464 | Ga0207711_10051920 | 3300025941 | Bacteria | 3512 |
| 465 | Ga0207711_10107410 | 3300025941 | Bacteria | 2478 |
| 466 | Ga0207689_10003550 | 3300025942 | Bacteria | 14259 |
| 467 | Ga0207689_10079309 | 3300025942 | Bacteria | 2699 |
| 468 | Ga0207661_10002623 | 3300025944 | Bacteria | 12375 |
| 469 | Ga0207679_10000523 | 3300025945 | Bacteria | 25949 |
| 470 | Ga0207679_10024346 | 3300025945 | Bacteria | 4150 |
| 471 | Ga0207679_10092320 | 3300025945 | Bacteria | 2345 |
| 472 | Ga0207679_10145361 | 3300025945 | Bacteria | 1922 |
| 473 | Ga0207679_10244799 | 3300025945 | Bacteria | 1521 |
| 474 | Ga0207667_10042230 | 3300025949 | Bacteria | 4848 |
| 475 | Ga0207667_10053418 | 3300025949 | Bacteria | 4252 |
| 476 | Ga0207667_10127732 | 3300025949 | Bacteria | 2619 |
| 477 | Ga0207667_10297304 | 3300025949 | Bacteria | 1649 |
| 478 | Ga0207651_10005670 | 3300025960 | Bacteria | 6440 |
| 479 | Ga0207651_10028072 | 3300025960 | Bacteria | 3544 |
| 480 | Ga0207651_10060806 | 3300025960 | Bacteria | 2624 |
| 481 | Ga0207712_10006218 | 3300025961 | Bacteria | 7524 |
| 482 | Ga0207712_10126562 | 3300025961 | Bacteria | 1941 |
| 483 | Ga0207712_10465499 | 3300025961 | Bacteria | 1075 |
| 484 | Ga0207668_10010781 | 3300025972 | Bacteria | 5535 |
| 485 | Ga0207668_10032351 | 3300025972 | Bacteria | 3455 |
| 486 | Ga0207668_10037486 | 3300025972 | Bacteria | 3245 |
| 487 | Ga0207668_10118739 | 3300025972 | Bacteria | 1998 |
| 488 | Ga0207668_10270481 | 3300025972 | Bacteria | 1389 |
| 489 | Ga0207640_10011956 | 3300025981 | Bacteria | 4931 |
| 490 | Ga0207640_10013130 | 3300025981 | Bacteria | 4738 |
| 491 | Ga0207677_10004363 | 3300026023 | Bacteria | 7579 |
| 492 | Ga0207677_10032031 | 3300026023 | Bacteria | 3375 |
| 493 | Ga0207703_10149895 | 3300026035 | Bacteria | 2032 |
| 494 | Ga0207703_10255363 | 3300026035 | Bacteria | 1582 |
| 495 | Ga0207703_10381053 | 3300026035 | Bacteria | 1304 |
| 496 | Ga0207703_10769933 | 3300026035 | Bacteria | 918 |
| 497 | Ga0207639_10000950 | 3300026041 | Bacteria | 19642 |
| 498 | Ga0207639_10037696 | 3300026041 | Bacteria | 3592 |
| 499 | Ga0207639_10137781 | 3300026041 | Bacteria | 2029 |
| 500 | Ga0207678_10011341 | 3300026067 | Bacteria | 7823 |
| 501 | Ga0207678_10119607 | 3300026067 | Bacteria | 2248 |
| 502 | Ga0207678_10210406 | 3300026067 | Bacteria | 1663 |
| 503 | Ga0207708_10234827 | 3300026075 | Bacteria | 1473 |
| 504 | Ga0207702_10000493 | 3300026078 | Bacteria | 44394 |
| 505 | Ga0207702_10001780 | 3300026078 | Bacteria | 21210 |
| 506 | Ga0207641_10018656 | 3300026088 | Bacteria | 5687 |
| 507 | Ga0207641_10149247 | 3300026088 | Bacteria | 2116 |
| 508 | Ga0207641_10154757 | 3300026088 | Bacteria | 2079 |
| 509 | Ga0207641_10289975 | 3300026088 | Bacteria | 1542 |
| 510 | Ga0207641_10342052 | 3300026088 | Bacteria | 1424 |
| 511 | Ga0207648_10028734 | 3300026089 | Bacteria | 4929 |
| 512 | Ga0207648_10042389 | 3300026089 | Bacteria | 3995 |
| 513 | Ga0207648_10095401 | 3300026089 | Bacteria | 2602 |
| 514 | Ga0207648_10147191 | 3300026089 | Bacteria | 2078 |
| 515 | Ga0207676_10031026 | 3300026095 | Bacteria | 4016 |
| 516 | Ga0207676_10047575 | 3300026095 | Bacteria | 3325 |
| 517 | Ga0207676_10133644 | 3300026095 | Bacteria | 2113 |
| 518 | Ga0207676_10259028 | 3300026095 | Bacteria | 1569 |
| 519 | Ga0207676_10281306 | 3300026095 | Bacteria | 1511 |
| 520 | Ga0207674_10001680 | 3300026116 | Bacteria | 28444 |
| 521 | Ga0207674_10021630 | 3300026116 | Bacteria | 6925 |
| 522 | Ga0207674_10026802 | 3300026116 | Bacteria | 6113 |
| 523 | Ga0207674_10102499 | 3300026116 | Bacteria | 2842 |
| 524 | Ga0207674_10558095 | 3300026116 | Bacteria | 1106 |
| 525 | Ga0207675_100017359 | 3300026118 | Bacteria | 6719 |
| 526 | Ga0207675_100041747 | 3300026118 | Bacteria | 4283 |
| 527 | Ga0207675_100349091 | 3300026118 | Bacteria | 1450 |
| 528 | Ga0207683_10000576 | 3300026121 | Bacteria | 33957 |
| 529 | Ga0207683_10001256 | 3300026121 | Bacteria | 23013 |
| 530 | Ga0207683_10033261 | 3300026121 | Bacteria | 4478 |
| 531 | Ga0207683_10042020 | 3300026121 | Bacteria | 3993 |
| 532 | Ga0207683_10092520 | 3300026121 | Bacteria | 2694 |
| 533 | Ga0207683_10174145 | 3300026121 | Bacteria | 1950 |
| 534 | Ga0207683_10306855 | 3300026121 | Bacteria | 1452 |
| 535 | Ga0207698_10002415 | 3300026142 | Bacteria | 11059 |
| 536 | Ga0207698_10007863 | 3300026142 | Bacteria | 6710 |
| 537 | Ga0207698_10093056 | 3300026142 | Bacteria | 2474 |
| 538 | Ga0207698_10145023 | 3300026142 | Bacteria | 2052 |
| 539 | Ga0209967_1012739 | 3300027364 | Bacteria | 1189 |
| 540 | Ga0209996_1004913 | 3300027395 | Bacteria | 1706 |
| 541 | Ga0210000_1005050 | 3300027462 | Bacteria | 1914 |
| 542 | Ga0209995_1000295 | 3300027471 | Bacteria | 7880 |
| 543 | Ga0209968_1001353 | 3300027526 | Bacteria | 3718 |
| 544 | Ga0209999_1002059 | 3300027543 | Bacteria | 3515 |
| 545 | Ga0210002_1001677 | 3300027617 | Bacteria | 3159 |
| 546 | Ga0209983_1000262 | 3300027665 | Bacteria | 10869 |
| 547 | Ga0209588_1016656 | 3300027671 | Bacteria | 2271 |
| 548 | Ga0209971_1000116 | 3300027682 | Bacteria | 23344 |
| 549 | Ga0209966_1000058 | 3300027695 | Bacteria | 48823 |
| 550 | Ga0209998_10000039 | 3300027717 | Bacteria | 52864 |
| 551 | Ga0209813_10001121 | 3300027866 | Bacteria | 5976 |
| 552 | Ga0209974_10000714 | 3300027876 | Bacteria | 11353 |
| 553 | Ga0207428_10000348 | 3300027907 | Bacteria | 59998 |
| 554 | Ga0207428_10005414 | 3300027907 | Bacteria | 11904 |
| 555 | Ga0207428_10090326 | 3300027907 | Bacteria | 2379 |
| 556 | Ga0207428_10093179 | 3300027907 | Bacteria | 2337 |
| 557 | Ga0268266_10055562 | 3300028379 | Bacteria | 3404 |
| 558 | Ga0268266_10102008 | 3300028379 | Bacteria | 2530 |
| 559 | Ga0268265_10002346 | 3300028380 | Bacteria | 14354 |
| 560 | Ga0268265_10006977 | 3300028380 | Bacteria | 7642 |
| 561 | Ga0268265_10078256 | 3300028380 | Bacteria | 2600 |
| 562 | Ga0268265_10083502 | 3300028380 | Bacteria | 2529 |
| 563 | Ga0268264_10000185 | 3300028381 | Bacteria | 131374 |
| 564 | Ga0268264_10026277 | 3300028381 | Bacteria | 4756 |
| 565 | Ga0268264_10178140 | 3300028381 | Bacteria | 1928 |
| 566 | Ga0265334_10055104 | 3300028573 | Bacteria | 1514 |
| 567 | Ga0265338_10208844 | 3300028800 | Bacteria | 1467 |
| 568 | Ga0265770_1013382 | 3300030878 | Bacteria | 1227 |
| 569 | Ga0265330_10165085 | 3300031235 | Bacteria | 939 |
| 570 | Ga0265320_10009525 | 3300031240 | Bacteria | 5854 |
| 571 | Ga0265329_10040072 | 3300031242 | Bacteria | 1503 |
| 572 | Ga0265340_10119704 | 3300031247 | Bacteria | 1212 |
| 573 | Ga0265339_10015996 | 3300031249 | Bacteria | 4482 |
| 574 | Ga0265339_10036309 | 3300031249 | Bacteria | 2759 |
| 575 | Ga0265331_10029942 | 3300031250 | Bacteria | 2713 |
| 576 | Ga0307509_10007409 | 3300031507 | Bacteria | 14339 |
| 577 | Ga0307408_100498722 | 3300031548 | Bacteria | 1065 |
| 578 | Ga0265313_10001065 | 3300031595 | Bacteria | 26573 |
| 579 | Ga0307508_10188540 | 3300031616 | Bacteria | 1663 |
| 580 | Ga0265314_10003957 | 3300031711 | Bacteria | 14046 |
| 581 | Ga0265314_10039124 | 3300031711 | Bacteria | 3420 |
| 582 | Ga0265314_10048272 | 3300031711 | Bacteria | 2989 |
| 583 | Ga0265342_10029931 | 3300031712 | Bacteria | 3378 |
| 584 | Ga0307516_10001211 | 3300031730 | Bacteria | 35950 |
| 585 | Ga0307406_10323945 | 3300031901 | Bacteria | 1193 |
| 586 | Ga0307412_10305653 | 3300031911 | Bacteria | 1259 |
| 587 | Ga0307416_100078453 | 3300032002 | Bacteria | 2779 |
| 588 | Ga0307416_100311421 | 3300032002 | Bacteria | 1571 |
| 589 | Ga0307411_10074312 | 3300032005 | Bacteria | 2316 |
| 590 | Ga0307415_100299448 | 3300032126 | Bacteria | 1331 |
| 591 | Ga0307507_10030517 | 3300033179 | Bacteria | 5685 |
| 592 | Ga0307510_10121750 | 3300033180 | Bacteria | 2311 |
| 593 | Ga0373950_0030769 | 3300034818 | Bacteria | 992 |
| 594 | Ga0373950_0034094 | 3300034818 | Bacteria | 953 |
| 595 | Ga0373958_0033593 | 3300034819 | Bacteria | 1018 |
| 596 | Ga0373959_0010657 | 3300034820 | Bacteria | 1610 |
| 597 | Ga0373926_0003405 | 3300035083 | Bacteria | 5125 |
| 598 | Ga0373928_0005693 | 3300035084 | Bacteria | 2382 |
| 599 | Ga0373928_0054902 | 3300035084 | Bacteria | 950 |
| 600 | Ga0373940_0019900 | 3300035088 | Bacteria | 1700 |
| 601 | Ga0373944_0008596 | 3300035089 | Bacteria | 2757 |
| 602 | Ga0373944_0009950 | 3300035089 | Bacteria | 2585 |
| 603 | Ga0373951_0036276 | 3300035091 | Bacteria | 1176 |
| 604 | Ga0373923_0015627 | 3300035111 | Bacteria | 2869 |
| 605 | Ga0373932_0006898 | 3300035112 | Bacteria | 2697 |
| 606 | Ga0373932_0042428 | 3300035112 | Bacteria | 1319 |
| 607 | Ga0373936_0013775 | 3300035113 | Bacteria | 3086 |
| 608 | Ga0373936_0050570 | 3300035113 | Bacteria | 1681 |
| 609 | Ga0373936_0084743 | 3300035113 | Bacteria | 1323 |
| 610 | Ga0373939_0007202 | 3300035114 | Bacteria | 2697 |
| 611 | Ga0373941_0017752 | 3300035115 | Bacteria | 1955 |
| 612 | Ga0373945_0059529 | 3300035116 | Bacteria | 1422 |
| 613 | Ga0373953_0001311 | 3300035117 | Bacteria | 7125 |
| 614 | Ga0373954_0007164 | 3300035118 | Bacteria | 4870 |
| 615 | Ga0373954_0047564 | 3300035118 | Bacteria | 2008 |
| 616 | Ga0373954_0155016 | 3300035118 | Bacteria | 1120 |
| 617 | Ga0373956_0010752 | 3300035119 | Bacteria | 3758 |
| 618 | Ga0373957_0010481 | 3300035120 | Bacteria | 3065 |
| 619 | Ga0373960_0013848 | 3300035121 | Bacteria | 2031 |
| 620 | Ga0373943_0014099 | 3300035170 | Bacteria | 3614 |
| 621 | Ga0373943_0098316 | 3300035170 | Bacteria | 1526 |
| 622 | Ga0373946_0001981 | 3300035171 | Bacteria | 7165 |
| 623 | Ga0373955_0010295 | 3300035172 | Bacteria | 4411 |
| 624 | Ga0373942_0011956 | 3300035207 | Bacteria | 2065 |
| 625 | Ga0373942_0014880 | 3300035207 | Bacteria | 1889 |
| 626 | Ga0373961_0016401 | 3300035241 | Bacteria | 1908 |
| 627 | Ga0373961_0051323 | 3300035241 | Bacteria | 1224 |
| 628 | Ga0373924_0004646 | 3300035410 | Bacteria | 4813 |
| 629 | Ga0373931_0000166 | 3300035691 | Bacteria | 28738 |
| 630 | Ga0373931_0046692 | 3300035691 | Bacteria | 2290 |
| 631 | Ga0373931_0116701 | 3300035691 | Bacteria | 1521 |
| 632 | Ga0373935_0014415 | 3300035692 | Bacteria | 4769 |
| 633 | Ga0373935_0037944 | 3300035692 | Bacteria | 3015 |
| 634 | Ga0373935_0135126 | 3300035692 | Bacteria | 1661 |
| 635 | Ga0373927_0027559 | 3300035695 | Bacteria | 3708 |
| 636 | Ga0373927_0074190 | 3300035695 | Bacteria | 2203 |
| 637 | Ga0373927_0104601 | 3300035695 | Bacteria | 1843 |
| 638 | Ga0373927_0178788 | 3300035695 | Bacteria | 1391 |
| 639 | Ga0373927_0200298 | 3300035695 | Bacteria | 1311 |
| 640 | Ga0373927_0286960 | 3300035695 | Bacteria | 1083 |
| 641 | Ga0373933_0014326 | 3300035724 | Bacteria | 4409 |
| 642 | Ga0373933_0243216 | 3300035724 | Bacteria | 1157 |
| 643 | Ga0373947_0007294 | 3300035725 | Bacteria | 6400 |
| 644 | Ga0373947_0161699 | 3300035725 | Bacteria | 1449 |
| 645 | Ga0373937_0012706 | 3300036401 | Bacteria | 7410 |
| 646 | Ga0373937_0049137 | 3300036401 | Bacteria | 3863 |
| 647 | Ga0373937_0188488 | 3300036401 | Bacteria | 1938 |
| 648 | Ga0373937_0334992 | 3300036401 | Bacteria | 1432 |
| 649 | Ga0373937_0830278 | 3300036401 | Bacteria | 872 |
| 650 | Ga0373925_0155550 | 3300037068 | Bacteria | 1798 |
| 651 | Ga0373925_0157408 | 3300037068 | Bacteria | 1787 |
| 652 | Ga0373925_0168444 | 3300037068 | Bacteria | 1728 |
| 653 | Ga0395899_0012702 | 3300037312 | Bacteria | 6453 |
| 654 | Ga0395899_0058617 | 3300037312 | Bacteria | 2840 |
| 655 | Ga0395900_0002247 | 3300037418 | Bacteria | 21493 |
| 656 | Ga0395900_0002271 | 3300037418 | Bacteria | 21357 |
| 657 | Ga0395900_0035217 | 3300037418 | Bacteria | 5156 |
| 658 | Ga0395900_0192052 | 3300037418 | Bacteria | 2071 |
| 659 | Ga0395898_0004503 | 3300037466 | Bacteria | 15232 |
| 660 | Ga0395898_0004746 | 3300037466 | Bacteria | 14792 |
| 661 | Ga0395898_0347505 | 3300037466 | Bacteria | 1414 |
| 662 | Ga0436364_1170705 | 3300037853 | Bacteria | 2407 |
| 663 | Ga0395901_0001831 | 3300038443 | Bacteria | 21964 |
| 664 | Ga0395901_0002599 | 3300038443 | Bacteria | 18294 |
| 665 | Ga0395901_0003317 | 3300038443 | Bacteria | 16221 |
| 666 | Ga0395901_0105356 | 3300038443 | Bacteria | 2960 |
| 667 | Ga0395901_0318822 | 3300038443 | Bacteria | 1609 |
| 668 | Ga0436365_0015071 | 3300039437 | Bacteria | 3942 |
| 669 | Ga0436365_0026985 | 3300039437 | Bacteria | 2510 |
| 670 | Ga0436365_0133331 | 3300039437 | Bacteria | 992 |
| 671 | Ga0436365_0893854 | 3300039437 | Bacteria | 10457 |
| 672 | Ga0436365_1367547 | 3300039437 | Bacteria | 1035 |
| 673 | Ga0436365_1494838 | 3300039437 | Bacteria | 1286 |
| 674 | Ga0436360_0097146 | 3300039438 | Bacteria | 1688 |
| 675 | Ga0436360_0195957 | 3300039438 | Bacteria | 2724 |
| 676 | Ga0436360_0399216 | 3300039438 | Bacteria | 2846 |
| 677 | Ga0436360_0643054 | 3300039438 | Bacteria | 1790 |
| 678 | Ga0436360_1082434 | 3300039438 | Bacteria | 4042 |
| 679 | Ga0436361_0430054 | 3300039447 | Bacteria | 933 |
| 680 | Ga0436361_0709860 | 3300039447 | Bacteria | 1001 |
| 681 | Ga0436361_1154927 | 3300039447 | Bacteria | 2595 |
| 682 | Ga0436363_0150716 | 3300039450 | Bacteria | 2267 |
| 683 | Ga0436363_0251745 | 3300039450 | Bacteria | 6871 |
| 684 | Ga0436363_0311273 | 3300039450 | Bacteria | 990 |
| 685 | Ga0436363_1126738 | 3300039450 | Bacteria | 1168 |
| 686 | Ga0436363_1628040 | 3300039450 | Bacteria | 1093 |
| 687 | Ga0436362_0816695 | 3300039453 | Bacteria | 1586 |
| 688 | Ga0436362_1139972 | 3300039453 | Bacteria | 5026 |
| 689 | Ga0439453_0007398 | 3300041408 | Bacteria | 1741 |
| 690 | Ga0451807_1812818 | 3300041486 | Bacteria | 1326 |
| 691 | Ga0451853_3273381 | 3300041512 | Bacteria | 1808 |
| 692 | Ga0439441_011458 | 3300042001 | Bacteria | 1504 |
| 693 | Ga0439448_0000117 | 3300042005 | Bacteria | 14757 |
| 694 | Ga0439432_054549 | 3300042006 | Bacteria | 1242 |
| 695 | Ga0450889_001760 | 3300042144 | Bacteria | 2191 |
| 696 | Ga0439459_0005360 | 3300042438 | Bacteria | 2104 |
| 697 | Ga0439464_0048673 | 3300042439 | Bacteria | 1222 |
| 698 | Ga0439460_0023223 | 3300042461 | Bacteria | 1708 |
| 699 | Ga0451577_0002467 | 3300042876 | Bacteria | 21994 |
| 700 | Ga0453683_0163557 | 3300044673 | Bacteria | 1408 |
| 701 | Ga0453683_0302945 | 3300044673 | Bacteria | 1022 |
| 702 | Ga0466963_0115634 | 3300044694 | Bacteria | 1843 |
| 703 | Ga0466964_0010040 | 3300044706 | Bacteria | 3567 |
| 704 | Ga0453684_0018119 | 3300044712 | Bacteria | 10840 |
| 705 | Ga0453684_0222653 | 3300044712 | Bacteria | 2184 |
| 706 | Ga0466957_0059024 | 3300044842 | Bacteria | 2351 |
| 707 | Ga0466957_0141944 | 3300044842 | Bacteria | 1548 |
| 708 | Ga0466957_0261151 | 3300044842 | Bacteria | 1154 |
| 709 | Ga0466957_0299491 | 3300044842 | Bacteria | 1080 |
| 710 | Ga0466959_0055755 | 3300045049 | Bacteria | 2884 |
| 711 | Ga0451576_0003327 | 3300045051 | Bacteria | 22273 |
| 712 | Ga0451576_0044978 | 3300045051 | Bacteria | 4651 |
| 713 | Ga0451576_0085302 | 3300045051 | Bacteria | 3285 |
| 714 | Ga0451576_0116389 | 3300045051 | Bacteria | 2783 |
| 715 | Ga0451576_0172198 | 3300045051 | Bacteria | 2259 |
| 716 | Ga0451576_0334666 | 3300045051 | Bacteria | 1585 |
| 717 | Ga0451576_0774923 | 3300045051 | Bacteria | 1007 |
| 718 | Ga0466967_0023923 | 3300045976 | Bacteria | 5014 |
| 719 | Ga0466967_0072518 | 3300045976 | Bacteria | 3086 |
| 720 | Ga0466967_0499599 | 3300045976 | Bacteria | 1193 |
| 721 | Ga0495592_0094341 | 3300046454 | Bacteria | 2142 |
| 722 | Ga0495592_0156824 | 3300046454 | Bacteria | 1569 |
| 723 | Ga0495603_0069137 | 3300046455 | Bacteria | 2078 |
| 724 | Ga0495603_0073435 | 3300046455 | Bacteria | 2010 |
| 725 | Ga0495629_0015176 | 3300046459 | Bacteria | 5536 |
| 726 | Ga0495638_0259989 | 3300046460 | Bacteria | 952 |
| 727 | Ga0495651_0262351 | 3300046462 | Bacteria | 1175 |
| 728 | Ga0495580_0014077 | 3300046472 | Bacteria | 6081 |
| 729 | Ga0495580_0173129 | 3300046472 | Bacteria | 1492 |
| 730 | Ga0495605_0084487 | 3300046474 | Bacteria | 1480 |
| 731 | Ga0495639_0020871 | 3300046475 | Bacteria | 2864 |
| 732 | Ga0495664_0026941 | 3300046477 | Bacteria | 3349 |
| 733 | Ga0495594_0111015 | 3300046499 | Bacteria | 1546 |
| 734 | Ga0495608_0017406 | 3300046511 | Bacteria | 4970 |
| 735 | Ga0495608_0017855 | 3300046511 | Bacteria | 4903 |
| 736 | Ga0495618_0024590 | 3300046514 | Bacteria | 3731 |
| 737 | Ga0495628_0015875 | 3300046516 | Bacteria | 6286 |
| 738 | Ga0495644_0017912 | 3300046523 | Bacteria | 2706 |
| 739 | Ga0495644_0044869 | 3300046523 | Bacteria | 1663 |
| 740 | Ga0495642_0087056 | 3300046528 | Bacteria | 1320 |
| 741 | Ga0495652_0216325 | 3300046529 | Bacteria | 1442 |
| 742 | Ga0495652_0314288 | 3300046529 | Bacteria | 1134 |
| 743 | Ga0495665_0067470 | 3300046531 | Bacteria | 1887 |
| 744 | Ga0495640_0028742 | 3300046533 | Bacteria | 4000 |
| 745 | Ga0495640_0181464 | 3300046533 | Bacteria | 1341 |
| 746 | Ga0495586_0003380 | 3300046535 | Bacteria | 8561 |
| 747 | Ga0495587_0010837 | 3300046536 | Bacteria | 5786 |
| 748 | Ga0495587_0107954 | 3300046536 | Bacteria | 1600 |
| 749 | Ga0495598_0021039 | 3300046537 | Bacteria | 1730 |
| 750 | Ga0495598_0094738 | 3300046537 | Bacteria | 979 |
| 751 | Ga0495621_0042342 | 3300046539 | Bacteria | 1603 |
| 752 | Ga0495645_0016548 | 3300046543 | Bacteria | 5269 |
| 753 | Ga0495667_0049207 | 3300046559 | Bacteria | 2782 |
| 754 | Ga0495667_0060016 | 3300046559 | Bacteria | 2495 |
| 755 | Ga0495668_0202508 | 3300046616 | Bacteria | 1087 |
| 756 | Ga0495634_0005618 | 3300046642 | Bacteria | 9615 |
| 757 | Ga0495635_0076908 | 3300046663 | Bacteria | 2287 |
| 758 | Ga0495659_0078021 | 3300046664 | Bacteria | 1252 |
| 759 | Ga0495588_0230405 | 3300046674 | Bacteria | 977 |
| 760 | Ga0495599_0027883 | 3300046678 | Bacteria | 3538 |
| 761 | Ga0495646_0086302 | 3300046680 | Bacteria | 1820 |
| 762 | Ga0495647_0000532 | 3300046681 | Bacteria | 11168 |
| 763 | Ga0495600_0023789 | 3300046809 | Bacteria | 3942 |
| 764 | Ga0495600_0063653 | 3300046809 | Bacteria | 2410 |
| 765 | Ga0495581_0030073 | 3300047315 | Bacteria | 3149 |
| 766 | Ga0495604_0069264 | 3300047317 | Bacteria | 2674 |
| 767 | Ga0495604_0208844 | 3300047317 | Bacteria | 1350 |
| 768 | Ga0495604_0233382 | 3300047317 | Bacteria | 1261 |
| 769 | Ga0495674_0032010 | 3300047319 | Bacteria | 4773 |
| 770 | Ga0495676_0027854 | 3300047321 | Bacteria | 4840 |
| 771 | Ga0495676_0145830 | 3300047321 | Bacteria | 1691 |
| 772 | Ga0495680_0041762 | 3300047322 | Bacteria | 3644 |
| 773 | Ga0495680_0068580 | 3300047322 | Bacteria | 2709 |
| 774 | Ga0495675_0011969 | 3300047444 | Bacteria | 5452 |
| 775 | Ga0495684_0026568 | 3300047471 | Bacteria | 4449 |
| 776 | Ga0495684_0079506 | 3300047471 | Bacteria | 2489 |
| 777 | Ga0495686_0135476 | 3300047472 | Bacteria | 1457 |
| 778 | Ga0495602_0007106 | 3300048088 | Bacteria | 11751 |
| 779 | Ga0496100_0032236 | 3300048903 | Bacteria | 3265 |
| 780 | Ga0496100_0091227 | 3300048903 | Bacteria | 2079 |
| 781 | Ga0496100_0100688 | 3300048903 | Bacteria | 1991 |
| 782 | Ga0496101_0023361 | 3300048904 | Bacteria | 4271 |
| 783 | Ga0496101_0043473 | 3300048904 | Bacteria | 3211 |
| 784 | Ga0496102_0010410 | 3300048905 | Bacteria | 8003 |
| 785 | Ga0496102_0080745 | 3300048905 | Bacteria | 2996 |
| 786 | Ga0496102_0192330 | 3300048905 | Bacteria | 1923 |
| 787 | Ga0496102_0223265 | 3300048905 | Bacteria | 1776 |
| 788 | Ga0496102_0246590 | 3300048905 | Bacteria | 1684 |
| 789 | Ga0496104_0000358 | 3300048907 | Bacteria | 40736 |
| 790 | Ga0496104_0013029 | 3300048907 | Bacteria | 7488 |
| 791 | Ga0496104_0045750 | 3300048907 | Bacteria | 4117 |
| 792 | Ga0496104_0082559 | 3300048907 | Bacteria | 3064 |
| 793 | Ga0496104_0083875 | 3300048907 | Bacteria | 3040 |
| 794 | Ga0496104_0099452 | 3300048907 | Bacteria | 2785 |
| 795 | Ga0496104_0129640 | 3300048907 | Bacteria | 2422 |
| 796 | Ga0496104_0197340 | 3300048907 | Bacteria | 1924 |
| 797 | Ga0496104_0503717 | 3300048907 | Bacteria | 1122 |
| 798 | Ga0496105_0014385 | 3300048908 | Bacteria | 6297 |
| 799 | Ga0496105_0048427 | 3300048908 | Bacteria | 3508 |
| 800 | Ga0496105_0054223 | 3300048908 | Bacteria | 3310 |
| 801 | Ga0496105_0069047 | 3300048908 | Bacteria | 2920 |
| 802 | Ga0496106_0010966 | 3300048909 | Bacteria | 6701 |
| 803 | Ga0496106_0030363 | 3300048909 | Bacteria | 4031 |
| 804 | Ga0496106_0200259 | 3300048909 | Bacteria | 1589 |
| 805 | Ga0496106_0551911 | 3300048909 | Bacteria | 924 |
| 806 | Ga0496107_0017835 | 3300048910 | Bacteria | 4996 |
| 807 | Ga0496107_0019534 | 3300048910 | Bacteria | 4781 |
| 808 | Ga0496107_0050042 | 3300048910 | Bacteria | 3012 |
| 809 | Ga0496107_0056838 | 3300048910 | Bacteria | 2827 |
| 810 | Ga0496107_0158153 | 3300048910 | Bacteria | 1678 |
| 811 | Ga0496107_0161270 | 3300048910 | Bacteria | 1662 |
| 812 | Ga0496108_0040364 | 3300048911 | Bacteria | 3890 |
| 813 | Ga0496108_0045344 | 3300048911 | Bacteria | 3672 |
| 814 | Ga0496108_0049184 | 3300048911 | Bacteria | 3526 |
| 815 | Ga0496108_0101622 | 3300048911 | Bacteria | 2453 |
| 816 | Ga0496108_0204292 | 3300048911 | Bacteria | 1714 |
| 817 | Ga0496108_0277717 | 3300048911 | Bacteria | 1458 |
| 818 | Ga0496109_0003211 | 3300048912 | Bacteria | 13608 |
| 819 | Ga0496109_0021552 | 3300048912 | Bacteria | 5700 |
| 820 | Ga0496109_0025246 | 3300048912 | Bacteria | 5293 |
| 821 | Ga0496109_0029973 | 3300048912 | Bacteria | 4876 |
| 822 | Ga0496109_0072899 | 3300048912 | Bacteria | 3155 |
| 823 | Ga0496109_0244595 | 3300048912 | Bacteria | 1689 |
| 824 | Ga0496109_0299142 | 3300048912 | Bacteria | 1517 |
| 825 | Ga0496109_0330334 | 3300048912 | Bacteria | 1439 |
| 826 | Ga0496109_0429726 | 3300048912 | Bacteria | 1248 |
| 827 | Ga0496110_0004167 | 3300048913 | Bacteria | 11165 |
| 828 | Ga0496110_0014947 | 3300048913 | Bacteria | 6453 |
| 829 | Ga0496110_0021327 | 3300048913 | Bacteria | 5482 |
| 830 | Ga0496110_0054188 | 3300048913 | Bacteria | 3527 |
| 831 | Ga0496110_0275684 | 3300048913 | Bacteria | 1531 |
| 832 | Ga0496111_0021427 | 3300048914 | Bacteria | 4513 |
| 833 | Ga0496111_0025670 | 3300048914 | Bacteria | 4158 |
| 834 | Ga0496111_0032087 | 3300048914 | Bacteria | 3744 |
| 835 | Ga0496111_0070832 | 3300048914 | Bacteria | 2537 |
| 836 | Ga0496112_0017288 | 3300048915 | Bacteria | 6772 |
| 837 | Ga0496112_0064301 | 3300048915 | Bacteria | 3620 |
| 838 | Ga0496112_0106883 | 3300048915 | Bacteria | 2768 |
| 839 | Ga0496112_0261948 | 3300048915 | Bacteria | 1678 |
| 840 | Ga0496112_0294047 | 3300048915 | Bacteria | 1570 |
| 841 | Ga0496113_0055903 | 3300048916 | Bacteria | 2960 |
| 842 | Ga0496114_0164730 | 3300048917 | Bacteria | 1929 |
| 843 | Ga0496115_0003906 | 3300048918 | Bacteria | 10741 |
| 844 | Ga0496115_0081649 | 3300048918 | Bacteria | 2633 |
| 845 | Ga0496115_0154432 | 3300048918 | Bacteria | 1896 |
| 846 | Ga0496115_0225357 | 3300048918 | Bacteria | 1546 |
| 847 | Ga0496117_0110468 | 3300048920 | Bacteria | 1714 |
| 848 | Ga0496118_0016521 | 3300048921 | Bacteria | 6768 |
| 849 | Ga0496119_0108517 | 3300048922 | Bacteria | 1545 |
| 850 | Ga0496120_0054274 | 3300048923 | Bacteria | 2272 |
| 851 | Ga0496121_0000668 | 3300048924 | Bacteria | 64093 |
| 852 | Ga0496121_0035985 | 3300048924 | Bacteria | 4421 |
| 853 | Ga0496121_0063085 | 3300048924 | Bacteria | 3031 |
| 854 | Ga0496124_0003401 | 3300048927 | Bacteria | 19546 |
| 855 | Ga0496125_0190072 | 3300048928 | Bacteria | 1357 |
| 856 | Ga0496126_0006242 | 3300048929 | Bacteria | 13320 |
| 857 | Ga0496126_0015566 | 3300048929 | Bacteria | 7643 |
| 858 | Ga0501033_0024046 | 3300049570 | Bacteria | 4597 |
| 859 | Ga0501033_0028100 | 3300049570 | Bacteria | 4228 |
| 860 | Ga0501034_0001484 | 3300049571 | Bacteria | 30939 |
| 861 | Ga0501034_0004456 | 3300049571 | Bacteria | 15570 |
| 862 | Ga0501038_0078548 | 3300049574 | Bacteria | 2785 |
| 863 | Ga0501039_0018197 | 3300049575 | Bacteria | 5393 |
| 864 | Ga0501039_0080131 | 3300049575 | Bacteria | 2541 |
| 865 | Ga0501039_0122847 | 3300049575 | Bacteria | 2035 |
| 866 | Ga0501040_0019560 | 3300049576 | Bacteria | 4505 |
| 867 | Ga0501040_0032234 | 3300049576 | Bacteria | 3546 |
| 868 | Ga0501041_0002404 | 3300049577 | Bacteria | 10600 |
| 869 | Ga0501041_0008967 | 3300049577 | Bacteria | 5885 |
| 870 | Ga0501041_0030715 | 3300049577 | Bacteria | 3243 |
| 871 | Ga0501041_0211195 | 3300049577 | Bacteria | 1217 |
| 872 | Ga0501042_0005575 | 3300049578 | Bacteria | 8109 |
| 873 | Ga0501042_0219033 | 3300049578 | Bacteria | 1373 |
| 874 | Ga0501042_0314131 | 3300049578 | Bacteria | 1132 |
| 875 | Ga0501046_0106450 | 3300049580 | Bacteria | 2146 |
| 876 | Ga0501047_0344693 | 3300049581 | Bacteria | 1327 |
| 877 | Ga0501067_0059452 | 3300049583 | Bacteria | 2116 |
| 878 | Ga0501068_0040625 | 3300049584 | Bacteria | 2793 |
| 879 | Ga0501070_0069511 | 3300049586 | Bacteria | 2915 |
| 880 | Ga0501070_0214174 | 3300049586 | Bacteria | 1581 |
| 881 | Ga0501072_0183106 | 3300049588 | Bacteria | 1671 |
| 882 | Ga0501074_0047671 | 3300049590 | Bacteria | 3096 |
| 883 | Ga0501075_0012445 | 3300049591 | Bacteria | 6047 |
| 884 | Ga0501075_0015379 | 3300049591 | Bacteria | 5491 |
| 885 | Ga0501076_0011883 | 3300049592 | Bacteria | 6502 |
| 886 | Ga0501076_0020356 | 3300049592 | Bacteria | 5078 |
| 887 | Ga0501077_0036140 | 3300049593 | Bacteria | 3146 |
| 888 | Ga0501079_0004657 | 3300049741 | Bacteria | 10161 |
| 889 | Ga0501080_0007219 | 3300049742 | Bacteria | 10030 |
| 890 | Ga0501080_0169417 | 3300049742 | Bacteria | 2014 |
| 891 | Ga0501081_0000770 | 3300049743 | Bacteria | 18795 |
| 892 | Ga0501035_0137942 | 3300049822 | Bacteria | 2122 |
| 893 | Ga0501035_0466629 | 3300049822 | Bacteria | 1043 |
| 894 | Ga0501044_0029952 | 3300049823 | Bacteria | 5738 |
| 895 | Ga0501044_0052437 | 3300049823 | Bacteria | 4203 |
| 896 | Ga0501044_0575339 | 3300049823 | Bacteria | 1021 |
| 897 | Ga0501045_0067122 | 3300049824 | Bacteria | 2634 |
| 898 | nmdc:mga03683_23583_c1 | 3300050489 | Bacteria | 2398 |
| 899 | nmdc:mga03683_58258_c1 | 3300050489 | Bacteria | 1627 |
| 900 | nmdc:mga03683_6258_c1 | 3300050489 | Bacteria | 4065 |
| 901 | nmdc:mga03n38_120198_c1 | 3300050490 | Bacteria | 1290 |
| 902 | nmdc:mga03n38_131368_c1 | 3300050490 | Bacteria | 1241 |
| 903 | nmdc:mga00v17_157452_c1 | 3300050491 | Bacteria | 1461 |
| 904 | nmdc:mga00v17_279191_c1 | 3300050491 | Bacteria | 1084 |
| 905 | nmdc:mga0yw44_144645_c1 | 3300050492 | Bacteria | 1547 |
| 906 | nmdc:mga0yw44_21824_c1 | 3300050492 | Bacteria | 3579 |
| 907 | nmdc:mga0k408_12201_c1 | 3300050493 | Bacteria | 4695 |
| 908 | nmdc:mga06z11_2002_c1 | 3300050494 | Bacteria | 7714 |
| 909 | nmdc:mga04h51_1961_c1 | 3300050495 | Bacteria | 4799 |
| 910 | nmdc:mga04h51_27778_c1 | 3300050495 | Bacteria | 1761 |
| 911 | nmdc:mga07m45_40538_c1 | 3300050496 | Bacteria | 2605 |
| 912 | nmdc:mga05p37_124989_c1 | 3300050507 | Bacteria | 3159 |
| 913 | nmdc:mga05p37_268_c1 | 3300050507 | Bacteria | 53897 |
| 914 | nmdc:mga05p37_293713_c1 | 3300050507 | Bacteria | 1934 |
| 915 | nmdc:mga05p37_328420_c1 | 3300050507 | Bacteria | 1808 |
| 916 | nmdc:mga05p37_33437_c1 | 3300050507 | Bacteria | 6298 |
| 917 | nmdc:mga05p37_364116_c1 | 3300050507 | Bacteria | 1699 |
| 918 | nmdc:mga05p37_397457_c1 | 3300050507 | Bacteria | 1610 |
| 919 | nmdc:mga05p37_73435_c1 | 3300050507 | Bacteria | 4210 |
| 920 | nmdc:mga05p37_77_c1 | 3300050507 | Bacteria | 86224 |
| 921 | nmdc:mga05p37_95699_c1 | 3300050507 | Bacteria | 3658 |
| 922 | nmdc:mga09592_12464_c1 | 3300050508 | Bacteria | 6926 |
| 923 | nmdc:mga09592_140_c1 | 3300050508 | Bacteria | 48059 |
| 924 | nmdc:mga09592_17731_c1 | 3300050508 | Bacteria | 5835 |
| 925 | nmdc:mga0qj67_11947_c1 | 3300050509 | Bacteria | 6525 |
| 926 | nmdc:mga0qj67_25259_c1 | 3300050509 | Bacteria | 4589 |
| 927 | nmdc:mga0qj67_42245_c1 | 3300050509 | Bacteria | 3589 |
| 928 | nmdc:mga0qj67_4986_c1 | 3300050509 | Bacteria | 9647 |
| 929 | nmdc:mga06r32_10732_c1 | 3300050510 | Bacteria | 8250 |
| 930 | nmdc:mga06r32_133_c1 | 3300050510 | Bacteria | 53973 |
| 931 | nmdc:mga06r32_137946_c1 | 3300050510 | Bacteria | 2414 |
| 932 | nmdc:mga06r32_34853_c1 | 3300050510 | Bacteria | 4748 |
| 933 | nmdc:mga06r32_3616_c1 | 3300050510 | Bacteria | 13796 |
| 934 | nmdc:mga06r32_61973_c1 | 3300050510 | Bacteria | 3602 |
| 935 | nmdc:mga06r32_62760_c1 | 3300050510 | Bacteria | 3580 |
| 936 | nmdc:mga06r32_7599_c1 | 3300050510 | Bacteria | 9744 |
| 937 | nmdc:mga08y16_126145_c1 | 3300050511 | Bacteria | 2663 |
| 938 | nmdc:mga08y16_146589_c1 | 3300050511 | Bacteria | 2454 |
| 939 | nmdc:mga08y16_173809_c1 | 3300050511 | Bacteria | 2237 |
| 940 | nmdc:mga08y16_348511_c1 | 3300050511 | Bacteria | 1521 |
| 941 | nmdc:mga08y16_430888_c1 | 3300050511 | Bacteria | 1347 |
| 942 | nmdc:mga08y16_5208_c1 | 3300050511 | Bacteria | 13581 |
| 943 | nmdc:mga08y16_604_c1 | 3300050511 | Bacteria | 33484 |
| 944 | nmdc:mga0n895_10909_c1 | 3300050512 | Bacteria | 8072 |
| 945 | nmdc:mga0n895_112146_c1 | 3300050512 | Bacteria | 2744 |
| 946 | nmdc:mga0n895_336813_c1 | 3300050512 | Bacteria | 1528 |
| 947 | nmdc:mga0n895_6328_c1 | 3300050512 | Bacteria | 10039 |
| 948 | nmdc:mga0rr50_104400_c1 | 3300050513 | Bacteria | 2232 |
| 949 | nmdc:mga0rr50_156837_c1 | 3300050513 | Bacteria | 1844 |
| 950 | nmdc:mga0rr50_522826_c1 | 3300050513 | Bacteria | 1010 |
| 951 | nmdc:mga0rr50_70272_c1 | 3300050513 | Bacteria | 2668 |
| 952 | nmdc:mga0rr50_71210_c1 | 3300050513 | Bacteria | 2652 |
| 953 | nmdc:mga0rr50_7940_c1 | 3300050513 | Bacteria | 6584 |
| 954 | nmdc:mga08x19_16429_c1 | 3300050514 | Bacteria | 4516 |
| 955 | nmdc:mga08x19_1956_c1 | 3300050514 | Bacteria | 12595 |
| 956 | nmdc:mga08x19_59784_c1 | 3300050514 | Bacteria | 2468 |
| 957 | nmdc:mga08x19_96455_c1 | 3300050514 | Bacteria | 1957 |
| 958 | nmdc:mga0a205_10383_c1 | 3300050515 | Bacteria | 8557 |
| 959 | nmdc:mga0a205_11223_c1 | 3300050515 | Bacteria | 8244 |
| 960 | nmdc:mga0a205_27624_c1 | 3300050515 | Bacteria | 5420 |
| 961 | nmdc:mga0a205_285699_c1 | 3300050515 | Bacteria | 1525 |
| 962 | nmdc:mga0a205_71646_c1 | 3300050515 | Bacteria | 3347 |
| 963 | nmdc:mga0a205_99668_c1 | 3300050515 | Bacteria | 2804 |
| 964 | nmdc:mga0sz30_51761_c1 | 3300050516 | Bacteria | 1743 |
| 965 | Ga0495601_0009955 | 3300053077 | Bacteria | 5634 |
| 966 | Ga0495601_0041808 | 3300053077 | Bacteria | 2874 |
| 967 | Ga0495601_0243540 | 3300053077 | Bacteria | 1174 |
| 968 | Ga0495612_0007865 | 3300053078 | Bacteria | 4347 |
| 969 | Ga0495595_0014758 | 3300053084 | Bacteria | 3321 |
| 970 | Ga0495595_0088653 | 3300053084 | Bacteria | 1482 |
| 971 | Ga0495595_0187834 | 3300053084 | Bacteria | 1026 |
| 972 | Ga0495619_0011890 | 3300053085 | Bacteria | 5481 |
| 973 | Ga0495619_0035699 | 3300053085 | Bacteria | 3234 |
| 974 | Ga0495619_0083605 | 3300053085 | Bacteria | 2153 |
| 975 | Ga0495619_0134189 | 3300053085 | Bacteria | 1702 |
| 976 | Ga0500566_0000131 | 3300053094 | Bacteria | 38186 |
| 977 | Ga0500640_104280 | 3300053095 | Bacteria | 1166 |
| 978 | Ga0500572_000369 | 3300053111 | Bacteria | 16000 |
| 979 | Ga0500572_015069 | 3300053111 | Bacteria | 1943 |
| 980 | Ga0500595_000286 | 3300053119 | Bacteria | 33353 |
| 981 | Ga0500595_004482 | 3300053119 | Bacteria | 6256 |
| 982 | Ga0500595_010217 | 3300053119 | Bacteria | 3740 |
| 983 | Ga0500608_092183 | 3300053122 | Bacteria | 1414 |
| 984 | Ga0500614_002288 | 3300053123 | Bacteria | 4305 |
| 985 | Ga0500559_0000301 | 3300053136 | Bacteria | 37742 |
| 986 | Ga0500559_0069392 | 3300053136 | Bacteria | 1584 |
| 987 | Ga0500603_000193 | 3300053150 | Bacteria | 15937 |
| 988 | Ga0500603_009964 | 3300053150 | Bacteria | 2136 |
| 989 | Ga0500616_0000385 | 3300053153 | Bacteria | 61815 |
| 990 | Ga0500630_018258 | 3300053159 | Bacteria | 3460 |
| 991 | Ga0500638_000725 | 3300053162 | Bacteria | 8877 |
| 992 | Ga0500638_154855 | 3300053162 | Bacteria | 1015 |
| 993 | Ga0500639_006329 | 3300053163 | Bacteria | 6115 |
| 994 | Ga0500636_0017052 | 3300053177 | Bacteria | 4284 |
| 995 | Ga0500636_0057929 | 3300053177 | Bacteria | 2266 |
| 996 | Ga0500637_0000135 | 3300053178 | Bacteria | 27083 |
| 997 | Ga0500601_005824 | 3300053737 | Bacteria | 1354 |
| 998 | Ga0501084_0142736 | 3300054114 | Bacteria | 2017 |
| 999 | Ga0500661_005425 | 3300055283 | Bacteria | 2384 |
| 1000 | Ga0590071_006828 | 3300059421 | Bacteria | 2706 |
| 1001 | Ga0501082_0169733 | 3300060353 | Bacteria | 1896 |
| 1002 | Ga0530510_0000216 | 3300061734 | Bacteria | 35741 |
| 1003 | Ga0530510_0003154 | 3300061734 | Bacteria | 11320 |
| 1004 | Ga0530510_0039593 | 3300061734 | Bacteria | 3403 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013102 | Ga0157371_10266182 | Ga0157371_102661822 | 239 |
| 2 | 3300036401 | Ga0373937_0830278 | Ga0373937_0830278_75_851 | 246 |
| 3 | 3300047317 | Ga0495604_0208844 | Ga0495604_0208844_555_1331 | 246 |
| 4 | 3300050490 | nmdc:mga03n38_131368_c1 | nmdc:mga03n38_131368_c1_312_1088 | 246 |
| 5 | 3300050494 | nmdc:mga06z11_2002_c1 | nmdc:mga06z11_2002_c1_847_1623 | 246 |
| 6 | 3300050495 | nmdc:mga04h51_1961_c1 | nmdc:mga04h51_1961_c1_156_932 | 246 |
| 7 | 3300005329 | Ga0070683_100015757 | Ga0070683_1000157576 | 261 |
| 8 | 3300005331 | Ga0070670_100007487 | Ga0070670_1000074872 | 261 |
| 9 | 3300005335 | Ga0070666_10066982 | Ga0070666_100669824 | 261 |
| 10 | 3300005338 | Ga0068868_100000913 | Ga0068868_10000091312 | 261 |
| 11 | 3300005344 | Ga0070661_100004972 | Ga0070661_1000049728 | 261 |
| 12 | 3300005345 | Ga0070692_10355987 | Ga0070692_103559871 | 261 |
| 13 | 3300005354 | Ga0070675_100002216 | Ga0070675_10000221611 | 261 |
| 14 | 3300005355 | Ga0070671_100005082 | Ga0070671_10000508211 | 261 |
| 15 | 3300005364 | Ga0070673_100004294 | Ga0070673_10000429411 | 261 |
| 16 | 3300005367 | Ga0070667_100012473 | Ga0070667_1000124734 | 261 |
| 17 | 3300005455 | Ga0070663_100454869 | Ga0070663_1004548691 | 261 |
| 18 | 3300005456 | Ga0070678_100000640 | Ga0070678_10000064011 | 261 |
| 19 | 3300005459 | Ga0068867_100065528 | Ga0068867_1000655282 | 261 |
| 20 | 3300005535 | Ga0070684_100030692 | Ga0070684_1000306924 | 261 |
| 21 | 3300005543 | Ga0070672_100000756 | Ga0070672_10000075612 | 261 |
| 22 | 3300005564 | Ga0070664_100006519 | Ga0070664_1000065192 | 261 |
| 23 | 3300005578 | Ga0068854_100006822 | Ga0068854_1000068222 | 261 |
| 24 | 3300005616 | Ga0068852_100001088 | Ga0068852_10000108813 | 261 |
| 25 | 3300005618 | Ga0068864_100013872 | Ga0068864_1000138722 | 261 |
| 26 | 3300005841 | Ga0068863_100083763 | Ga0068863_1000837632 | 261 |
| 27 | 3300005842 | Ga0068858_100563949 | Ga0068858_1005639491 | 261 |
| 28 | 3300006237 | Ga0097621_100005490 | Ga0097621_10000549011 | 261 |
| 29 | 3300006358 | Ga0068871_100001017 | Ga0068871_10000101710 | 261 |
| 30 | 3300013296 | Ga0157374_10008483 | Ga0157374_100084833 | 261 |
| 31 | 3300013308 | Ga0157375_10055192 | Ga0157375_100551922 | 261 |
| 32 | 3300025321 | Ga0207656_10005307 | Ga0207656_100053077 | 261 |
| 33 | 3300025920 | Ga0207649_10017532 | Ga0207649_100175323 | 261 |
| 34 | 3300025926 | Ga0207659_10026148 | Ga0207659_100261482 | 261 |
| 35 | 3300025931 | Ga0207644_10041790 | Ga0207644_100417902 | 261 |
| 36 | 3300025940 | Ga0207691_10000521 | Ga0207691_1000052119 | 261 |
| 37 | 3300025944 | Ga0207661_10002623 | Ga0207661_100026233 | 261 |
| 38 | 3300025945 | Ga0207679_10024346 | Ga0207679_100243463 | 261 |
| 39 | 3300025960 | Ga0207651_10005670 | Ga0207651_100056706 | 261 |
| 40 | 3300025981 | Ga0207640_10011956 | Ga0207640_100119562 | 261 |
| 41 | 3300026023 | Ga0207677_10004363 | Ga0207677_100043636 | 261 |
| 42 | 3300026088 | Ga0207641_10154757 | Ga0207641_101547572 | 261 |
| 43 | 3300026089 | Ga0207648_10042389 | Ga0207648_100423894 | 261 |
| 44 | 3300026095 | Ga0207676_10047575 | Ga0207676_100475752 | 261 |
| 45 | 3300026121 | Ga0207683_10000576 | Ga0207683_100005763 | 261 |
| 46 | 3300026142 | Ga0207698_10002415 | Ga0207698_1000241511 | 261 |
| 47 | 3300031730 | Ga0307516_10001211 | Ga0307516_1000121123 | 261 |
| 48 | 3300033180 | Ga0307510_10121750 | Ga0307510_101217502 | 261 |
| 49 | iso_pu_bacteria | 2513237141 | 2513888705 | 263 |
| 50 | 3300005329 | Ga0070683_100000791 | Ga0070683_10000079124 | 264 |
| 51 | 3300005330 | Ga0070690_100060130 | Ga0070690_1000601303 | 264 |
| 52 | 3300005331 | Ga0070670_100001030 | Ga0070670_1000010303 | 264 |
| 53 | 3300005334 | Ga0068869_100024561 | Ga0068869_1000245612 | 264 |
| 54 | 3300005338 | Ga0068868_100002406 | Ga0068868_1000024062 | 264 |
| 55 | 3300005338 | Ga0068868_100184928 | Ga0068868_1001849281 | 264 |
| 56 | 3300005340 | Ga0070689_100127552 | Ga0070689_1001275522 | 264 |
| 57 | 3300005344 | Ga0070661_100007089 | Ga0070661_1000070897 | 264 |
| 58 | 3300005353 | Ga0070669_100101261 | Ga0070669_1001012613 | 264 |
| 59 | 3300005354 | Ga0070675_100001929 | Ga0070675_10000192916 | 264 |
| 60 | 3300005355 | Ga0070671_100031325 | Ga0070671_1000313253 | 264 |
| 61 | 3300005356 | Ga0070674_100239269 | Ga0070674_1002392692 | 264 |
| 62 | 3300005364 | Ga0070673_100032903 | Ga0070673_1000329033 | 264 |
| 63 | 3300005364 | Ga0070673_100232277 | Ga0070673_1002322772 | 264 |
| 64 | 3300005366 | Ga0070659_100209780 | Ga0070659_1002097802 | 264 |
| 65 | 3300005367 | Ga0070667_100136242 | Ga0070667_1001362423 | 264 |
| 66 | 3300005441 | Ga0070700_100062043 | Ga0070700_1000620432 | 264 |
| 67 | 3300005455 | Ga0070663_100238632 | Ga0070663_1002386321 | 264 |
| 68 | 3300005456 | Ga0070678_100003210 | Ga0070678_1000032108 | 264 |
| 69 | 3300005457 | Ga0070662_100076697 | Ga0070662_1000766973 | 264 |
| 70 | 3300005459 | Ga0068867_100068789 | Ga0068867_1000687893 | 264 |
| 71 | 3300005466 | Ga0070685_10140715 | Ga0070685_101407152 | 264 |
| 72 | 3300005543 | Ga0070672_100001321 | Ga0070672_10000132117 | 264 |
| 73 | 3300005547 | Ga0070693_100062384 | Ga0070693_1000623842 | 264 |
| 74 | 3300005564 | Ga0070664_100039095 | Ga0070664_1000390953 | 264 |
| 75 | 3300005578 | Ga0068854_100027180 | Ga0068854_1000271803 | 264 |
| 76 | 3300005615 | Ga0070702_100099719 | Ga0070702_1000997192 | 264 |
| 77 | 3300005616 | Ga0068852_100003525 | Ga0068852_10000352511 | 264 |
| 78 | 3300005617 | Ga0068859_100263614 | Ga0068859_1002636141 | 264 |
| 79 | 3300005618 | Ga0068864_100088756 | Ga0068864_1000887562 | 264 |
| 80 | 3300005718 | Ga0068866_10302339 | Ga0068866_103023391 | 264 |
| 81 | 3300005834 | Ga0068851_10012174 | Ga0068851_100121743 | 264 |
| 82 | 3300005840 | Ga0068870_10039704 | Ga0068870_100397042 | 264 |
| 83 | 3300005841 | Ga0068863_100080491 | Ga0068863_1000804911 | 264 |
| 84 | 3300006237 | Ga0097621_100001375 | Ga0097621_10000137516 | 264 |
| 85 | 3300006358 | Ga0068871_100055451 | Ga0068871_1000554513 | 264 |
| 86 | 3300006881 | Ga0068865_100047363 | Ga0068865_1000473631 | 264 |
| 87 | 3300006931 | Ga0097620_100263626 | Ga0097620_1002636261 | 264 |
| 88 | 3300009098 | Ga0105245_10187866 | Ga0105245_101878661 | 264 |
| 89 | 3300009148 | Ga0105243_10562352 | Ga0105243_105623521 | 264 |
| 90 | 3300013296 | Ga0157374_10050173 | Ga0157374_100501732 | 264 |
| 91 | 3300013297 | Ga0157378_10073414 | Ga0157378_100734141 | 264 |
| 92 | 3300013297 | Ga0157378_10207784 | Ga0157378_102077842 | 264 |
| 93 | 3300013306 | Ga0163162_10103175 | Ga0163162_101031751 | 264 |
| 94 | 3300013308 | Ga0157375_10010239 | Ga0157375_100102397 | 264 |
| 95 | 3300014969 | Ga0157376_10016314 | Ga0157376_100163142 | 264 |
| 96 | 3300025321 | Ga0207656_10024914 | Ga0207656_100249141 | 264 |
| 97 | 3300025903 | Ga0207680_10012253 | Ga0207680_100122533 | 264 |
| 98 | 3300025907 | Ga0207645_10189163 | Ga0207645_101891632 | 264 |
| 99 | 3300025908 | Ga0207643_10040490 | Ga0207643_100404903 | 264 |
| 100 | 3300025920 | Ga0207649_10018651 | Ga0207649_100186513 | 264 |
| 101 | 3300025925 | Ga0207650_10007352 | Ga0207650_100073527 | 264 |
| 102 | 3300025926 | Ga0207659_10097269 | Ga0207659_100972692 | 264 |
| 103 | 3300025931 | Ga0207644_10024145 | Ga0207644_100241452 | 264 |
| 104 | 3300025931 | Ga0207644_10320333 | Ga0207644_103203332 | 264 |
| 105 | 3300025933 | Ga0207706_10013378 | Ga0207706_100133785 | 264 |
| 106 | 3300025933 | Ga0207706_10086601 | Ga0207706_100866011 | 264 |
| 107 | 3300025935 | Ga0207709_10487196 | Ga0207709_104871961 | 264 |
| 108 | 3300025936 | Ga0207670_10251610 | Ga0207670_102516102 | 264 |
| 109 | 3300025938 | Ga0207704_10031936 | Ga0207704_100319362 | 264 |
| 110 | 3300025940 | Ga0207691_10017685 | Ga0207691_100176857 | 264 |
| 111 | 3300025942 | Ga0207689_10079309 | Ga0207689_100793091 | 264 |
| 112 | 3300025945 | Ga0207679_10092320 | Ga0207679_100923202 | 264 |
| 113 | 3300025960 | Ga0207651_10028072 | Ga0207651_100280723 | 264 |
| 114 | 3300025961 | Ga0207712_10126562 | Ga0207712_101265621 | 264 |
| 115 | 3300025972 | Ga0207668_10270481 | Ga0207668_102704811 | 264 |
| 116 | 3300025981 | Ga0207640_10013130 | Ga0207640_100131303 | 264 |
| 117 | 3300026088 | Ga0207641_10018656 | Ga0207641_100186566 | 264 |
| 118 | 3300026088 | Ga0207641_10289975 | Ga0207641_102899752 | 264 |
| 119 | 3300026089 | Ga0207648_10095401 | Ga0207648_100954012 | 264 |
| 120 | 3300026095 | Ga0207676_10031026 | Ga0207676_100310263 | 264 |
| 121 | 3300026116 | Ga0207674_10558095 | Ga0207674_105580951 | 264 |
| 122 | 3300026118 | Ga0207675_100349091 | Ga0207675_1003490912 | 264 |
| 123 | 3300026121 | Ga0207683_10001256 | Ga0207683_1000125620 | 264 |
| 124 | 3300026121 | Ga0207683_10306855 | Ga0207683_103068551 | 264 |
| 125 | 3300026142 | Ga0207698_10007863 | Ga0207698_100078632 | 264 |
| 126 | 3300028380 | Ga0268265_10078256 | Ga0268265_100782562 | 264 |
| 127 | 3300041486 | Ga0451807_1812818 | Ga0451807_1812818_140_985 | 264 |
| 128 | 3300041512 | Ga0451853_3273381 | Ga0451853_3273381_526_1371 | 264 |
| 129 | 3300046474 | Ga0495605_0084487 | Ga0495605_0084487_244_1086 | 264 |
| 130 | 3300046528 | Ga0495642_0087056 | Ga0495642_0087056_250_1092 | 264 |
| 131 | 3300046539 | Ga0495621_0042342 | Ga0495621_0042342_653_1498 | 264 |
| 132 | 3300048903 | Ga0496100_0100688 | Ga0496100_0100688_987_1832 | 264 |
| 133 | 3300048905 | Ga0496102_0192330 | Ga0496102_0192330_666_1511 | 264 |
| 134 | 3300048907 | Ga0496104_0083875 | Ga0496104_0083875_689_1534 | 264 |
| 135 | 3300048909 | Ga0496106_0200259 | Ga0496106_0200259_240_1085 | 264 |
| 136 | 3300048911 | Ga0496108_0045344 | Ga0496108_0045344_657_1502 | 264 |
| 137 | 3300048912 | Ga0496109_0429726 | Ga0496109_0429726_224_1069 | 264 |
| 138 | 3300048913 | Ga0496110_0014947 | Ga0496110_0014947_3907_4752 | 264 |
| 139 | iso_pu_bacteria | 2513237101 | 2513695718 | 264 |
| 140 | iso_pu_bacteria | 2721755755 | 2723846966 | 264 |
| 141 | iso_pu_bacteria | 2791355199 | 2793084254 | 264 |
| 142 | iso_pu_bacteria | 2874604998 | 2874611069 | 264 |
| 143 | iso_pu_bacteria | 2876808645 | 2876811908 | 264 |
| 144 | iso_pu_bacteria | 2879110137 | 2879117368 | 264 |
| 145 | iso_pu_bacteria | 2922361189 | 2922362660 | 264 |
| 146 | iso_pu_bacteria | 2922386360 | 2922387526 | 264 |
| 147 | iso_pu_bacteria | 2929199973 | 2929202666 | 264 |
| 148 | iso_pu_bacteria | 8006964411 | 8006968463 | 264 |
| 149 | iso_pu_bacteria | 8006984368 | 8006984814 | 264 |
| 150 | iso_pu_bacteria | 8055909800 | 8055910238 | 264 |
| 151 | 3300044842 | Ga0466957_0299491 | Ga0466957_0299491_36_881 | 265 |
| 152 | 3300005468 | Ga0070707_100298481 | Ga0070707_1002984813 | 266 |
| 153 | 3300025910 | Ga0207684_10080444 | Ga0207684_100804444 | 266 |
| 154 | 3300031711 | Ga0265314_10003957 | Ga0265314_100039576 | 266 |
| 155 | 3300049578 | Ga0501042_0219033 | Ga0501042_0219033_302_1144 | 266 |
| 156 | 3300003659 | JGI25404J52841_10001411 | JGI25404J52841_100014115 | 267 |
| 157 | 3300005290 | Ga0065712_10018464 | Ga0065712_100184642 | 267 |
| 158 | 3300005364 | Ga0070673_100077263 | Ga0070673_1000772632 | 267 |
| 159 | 3300005436 | Ga0070713_100007564 | Ga0070713_1000075642 | 267 |
| 160 | 3300005456 | Ga0070678_100549068 | Ga0070678_1005490681 | 267 |
| 161 | 3300005467 | Ga0070706_100385076 | Ga0070706_1003850761 | 267 |
| 162 | 3300005617 | Ga0068859_100112847 | Ga0068859_1001128472 | 267 |
| 163 | 3300005981 | Ga0081538_10044258 | Ga0081538_100442582 | 267 |
| 164 | 3300005983 | Ga0081540_1000374 | Ga0081540_100037446 | 267 |
| 165 | 3300006028 | Ga0070717_10035339 | Ga0070717_100353392 | 267 |
| 166 | 3300006048 | Ga0075363_100038980 | Ga0075363_1000389802 | 267 |
| 167 | 3300006051 | Ga0075364_10050605 | Ga0075364_100506052 | 267 |
| 168 | 3300006173 | Ga0070716_100055965 | Ga0070716_1000559653 | 267 |
| 169 | 3300006177 | Ga0075362_10033366 | Ga0075362_100333662 | 267 |
| 170 | 3300006178 | Ga0075367_10008292 | Ga0075367_100082924 | 267 |
| 171 | 3300006195 | Ga0075366_10091024 | Ga0075366_100910242 | 267 |
| 172 | 3300006844 | Ga0075428_100008280 | Ga0075428_10000828011 | 267 |
| 173 | 3300006844 | Ga0075428_100014675 | Ga0075428_1000146757 | 267 |
| 174 | 3300006844 | Ga0075428_100047019 | Ga0075428_1000470195 | 267 |
| 175 | 3300006846 | Ga0075430_100008019 | Ga0075430_1000080196 | 267 |
| 176 | 3300006847 | Ga0075431_100000109 | Ga0075431_10000010918 | 267 |
| 177 | 3300006847 | Ga0075431_100005848 | Ga0075431_1000058484 | 267 |
| 178 | 3300006847 | Ga0075431_100050589 | Ga0075431_1000505892 | 267 |
| 179 | 3300006871 | Ga0075434_100010330 | Ga0075434_1000103304 | 267 |
| 180 | 3300006880 | Ga0075429_100020823 | Ga0075429_1000208232 | 267 |
| 181 | 3300006880 | Ga0075429_100061447 | Ga0075429_1000614472 | 267 |
| 182 | 3300006881 | Ga0068865_100112910 | Ga0068865_1001129102 | 267 |
| 183 | 3300006914 | Ga0075436_100000611 | Ga0075436_1000006118 | 267 |
| 184 | 3300006914 | Ga0075436_100050850 | Ga0075436_1000508502 | 267 |
| 185 | 3300006931 | Ga0097620_100112848 | Ga0097620_1001128482 | 267 |
| 186 | 3300007076 | Ga0075435_100003813 | Ga0075435_1000038133 | 267 |
| 187 | 3300009094 | Ga0111539_10000684 | Ga0111539_100006845 | 267 |
| 188 | 3300009094 | Ga0111539_10078453 | Ga0111539_100784533 | 267 |
| 189 | 3300009147 | Ga0114129_10000425 | Ga0114129_1000042515 | 267 |
| 190 | 3300009147 | Ga0114129_10101093 | Ga0114129_101010935 | 267 |
| 191 | 3300009147 | Ga0114129_10504961 | Ga0114129_105049612 | 267 |
| 192 | 3300014326 | Ga0157380_10114633 | Ga0157380_101146332 | 267 |
| 193 | 3300025893 | Ga0207682_10000949 | Ga0207682_1000094910 | 267 |
| 194 | 3300025928 | Ga0207700_10024377 | Ga0207700_100243774 | 267 |
| 195 | 3300025933 | Ga0207706_10177687 | Ga0207706_101776872 | 267 |
| 196 | 3300025937 | Ga0207669_10017679 | Ga0207669_100176792 | 267 |
| 197 | 3300025938 | Ga0207704_10409460 | Ga0207704_104094601 | 267 |
| 198 | 3300025938 | Ga0207704_10490779 | Ga0207704_104907791 | 267 |
| 199 | 3300025960 | Ga0207651_10060806 | Ga0207651_100608062 | 267 |
| 200 | 3300025972 | Ga0207668_10118739 | Ga0207668_101187392 | 267 |
| 201 | 3300026035 | Ga0207703_10149895 | Ga0207703_101498953 | 267 |
| 202 | 3300026075 | Ga0207708_10234827 | Ga0207708_102348271 | 267 |
| 203 | 3300026095 | Ga0207676_10281306 | Ga0207676_102813063 | 267 |
| 204 | 3300026121 | Ga0207683_10092520 | Ga0207683_100925202 | 267 |
| 205 | 3300027907 | Ga0207428_10005414 | Ga0207428_100054142 | 267 |
| 206 | 3300028380 | Ga0268265_10006977 | Ga0268265_100069774 | 267 |
| 207 | 3300035083 | Ga0373926_0003405 | Ga0373926_0003405_3323_4162 | 267 |
| 208 | 3300035084 | Ga0373928_0005693 | Ga0373928_0005693_1271_2107 | 267 |
| 209 | 3300035089 | Ga0373944_0008596 | Ga0373944_0008596_1299_2138 | 267 |
| 210 | 3300035089 | Ga0373944_0009950 | Ga0373944_0009950_1267_2106 | 267 |
| 211 | 3300035112 | Ga0373932_0042428 | Ga0373932_0042428_204_1040 | 267 |
| 212 | 3300035113 | Ga0373936_0013775 | Ga0373936_0013775_219_1058 | 267 |
| 213 | 3300035116 | Ga0373945_0059529 | Ga0373945_0059529_348_1187 | 267 |
| 214 | 3300035170 | Ga0373943_0014099 | Ga0373943_0014099_620_1459 | 267 |
| 215 | 3300035170 | Ga0373943_0098316 | Ga0373943_0098316_234_1073 | 267 |
| 216 | 3300035171 | Ga0373946_0001981 | Ga0373946_0001981_233_1072 | 267 |
| 217 | 3300035207 | Ga0373942_0011956 | Ga0373942_0011956_644_1480 | 267 |
| 218 | 3300035241 | Ga0373961_0051323 | Ga0373961_0051323_361_1197 | 267 |
| 219 | 3300035692 | Ga0373935_0014415 | Ga0373935_0014415_214_1053 | 267 |
| 220 | 3300035695 | Ga0373927_0027559 | Ga0373927_0027559_242_1081 | 267 |
| 221 | 3300035695 | Ga0373927_0178788 | Ga0373927_0178788_409_1248 | 267 |
| 222 | 3300035725 | Ga0373947_0007294 | Ga0373947_0007294_4942_5781 | 267 |
| 223 | 3300036401 | Ga0373937_0334992 | Ga0373937_0334992_193_1032 | 267 |
| 224 | 3300037068 | Ga0373925_0157408 | Ga0373925_0157408_534_1373 | 267 |
| 225 | 3300037068 | Ga0373925_0168444 | Ga0373925_0168444_236_1075 | 267 |
| 226 | 3300039438 | Ga0436360_0643054 | Ga0436360_0643054_141_980 | 267 |
| 227 | 3300039447 | Ga0436361_0709860 | Ga0436361_0709860_95_934 | 267 |
| 228 | 3300044706 | Ga0466964_0010040 | Ga0466964_0010040_2592_3437 | 267 |
| 229 | 3300044842 | Ga0466957_0059024 | Ga0466957_0059024_307_1152 | 267 |
| 230 | 3300045051 | Ga0451576_0334666 | Ga0451576_0334666_298_1143 | 267 |
| 231 | 3300045976 | Ga0466967_0023923 | Ga0466967_0023923_3451_4296 | 267 |
| 232 | 3300046454 | Ga0495592_0156824 | Ga0495592_0156824_136_975 | 267 |
| 233 | 3300046455 | Ga0495603_0069137 | Ga0495603_0069137_144_983 | 267 |
| 234 | 3300046459 | Ga0495629_0015176 | Ga0495629_0015176_1356_2204 | 267 |
| 235 | 3300046472 | Ga0495580_0014077 | Ga0495580_0014077_3704_4543 | 267 |
| 236 | 3300046475 | Ga0495639_0020871 | Ga0495639_0020871_823_1662 | 267 |
| 237 | 3300046499 | Ga0495594_0111015 | Ga0495594_0111015_85_924 | 267 |
| 238 | 3300046516 | Ga0495628_0015875 | Ga0495628_0015875_3781_4620 | 267 |
| 239 | 3300046529 | Ga0495652_0216325 | Ga0495652_0216325_149_988 | 267 |
| 240 | 3300046531 | Ga0495665_0067470 | Ga0495665_0067470_59_898 | 267 |
| 241 | 3300046535 | Ga0495586_0003380 | Ga0495586_0003380_131_970 | 267 |
| 242 | 3300046536 | Ga0495587_0107954 | Ga0495587_0107954_725_1564 | 267 |
| 243 | 3300046537 | Ga0495598_0094738 | Ga0495598_0094738_66_905 | 267 |
| 244 | 3300046559 | Ga0495667_0049207 | Ga0495667_0049207_1444_2283 | 267 |
| 245 | 3300046663 | Ga0495635_0076908 | Ga0495635_0076908_1044_1883 | 267 |
| 246 | 3300046678 | Ga0495599_0027883 | Ga0495599_0027883_107_946 | 267 |
| 247 | 3300046680 | Ga0495646_0086302 | Ga0495646_0086302_758_1597 | 267 |
| 248 | 3300046681 | Ga0495647_0000532 | Ga0495647_0000532_9427_10266 | 267 |
| 249 | 3300046809 | Ga0495600_0063653 | Ga0495600_0063653_811_1650 | 267 |
| 250 | 3300047315 | Ga0495581_0030073 | Ga0495581_0030073_1572_2411 | 267 |
| 251 | 3300047317 | Ga0495604_0069264 | Ga0495604_0069264_935_1774 | 267 |
| 252 | 3300047321 | Ga0495676_0027854 | Ga0495676_0027854_1427_2266 | 267 |
| 253 | 3300047444 | Ga0495675_0011969 | Ga0495675_0011969_837_1676 | 267 |
| 254 | 3300047471 | Ga0495684_0026568 | Ga0495684_0026568_279_1118 | 267 |
| 255 | 3300048907 | Ga0496104_0000358 | Ga0496104_0000358_7152_7994 | 267 |
| 256 | 3300048907 | Ga0496104_0082559 | Ga0496104_0082559_609_1457 | 267 |
| 257 | 3300048908 | Ga0496105_0014385 | Ga0496105_0014385_51_890 | 267 |
| 258 | 3300048908 | Ga0496105_0069047 | Ga0496105_0069047_853_1695 | 267 |
| 259 | 3300048911 | Ga0496108_0049184 | Ga0496108_0049184_1758_2606 | 267 |
| 260 | 3300048912 | Ga0496109_0003211 | Ga0496109_0003211_969_1817 | 267 |
| 261 | 3300048912 | Ga0496109_0072899 | Ga0496109_0072899_92_931 | 267 |
| 262 | 3300048913 | Ga0496110_0021327 | Ga0496110_0021327_4247_5095 | 267 |
| 263 | 3300048914 | Ga0496111_0025670 | Ga0496111_0025670_2177_3025 | 267 |
| 264 | 3300048915 | Ga0496112_0017288 | Ga0496112_0017288_4188_5036 | 267 |
| 265 | 3300048924 | Ga0496121_0063085 | Ga0496121_0063085_1610_2452 | 267 |
| 266 | 3300049570 | Ga0501033_0024046 | Ga0501033_0024046_3406_4248 | 267 |
| 267 | 3300049575 | Ga0501039_0018197 | Ga0501039_0018197_243_1082 | 267 |
| 268 | 3300049575 | Ga0501039_0122847 | Ga0501039_0122847_219_1061 | 267 |
| 269 | 3300049576 | Ga0501040_0032234 | Ga0501040_0032234_737_1579 | 267 |
| 270 | 3300049577 | Ga0501041_0002404 | Ga0501041_0002404_1405_2244 | 267 |
| 271 | 3300049577 | Ga0501041_0030715 | Ga0501041_0030715_578_1420 | 267 |
| 272 | 3300049578 | Ga0501042_0005575 | Ga0501042_0005575_2859_3698 | 267 |
| 273 | 3300049578 | Ga0501042_0314131 | Ga0501042_0314131_173_1012 | 267 |
| 274 | 3300049580 | Ga0501046_0106450 | Ga0501046_0106450_1228_2067 | 267 |
| 275 | 3300049583 | Ga0501067_0059452 | Ga0501067_0059452_1080_1925 | 267 |
| 276 | 3300049592 | Ga0501076_0020356 | Ga0501076_0020356_617_1456 | 267 |
| 277 | 3300049741 | Ga0501079_0004657 | Ga0501079_0004657_4483_5322 | 267 |
| 278 | 3300049742 | Ga0501080_0169417 | Ga0501080_0169417_1086_1925 | 267 |
| 279 | 3300050489 | nmdc:mga03683_6258_c1 | nmdc:mga03683_6258_c1_2651_3493 | 267 |
| 280 | 3300050491 | nmdc:mga00v17_157452_c1 | nmdc:mga00v17_157452_c1_458_1300 | 267 |
| 281 | 3300050493 | nmdc:mga0k408_12201_c1 | nmdc:mga0k408_12201_c1_1579_2421 | 267 |
| 282 | 3300050496 | nmdc:mga07m45_40538_c1 | nmdc:mga07m45_40538_c1_64_900 | 267 |
| 283 | 3300050507 | nmdc:mga05p37_124989_c1 | nmdc:mga05p37_124989_c1_1992_2840 | 267 |
| 284 | 3300050507 | nmdc:mga05p37_268_c1 | nmdc:mga05p37_268_c1_12956_13795 | 267 |
| 285 | 3300050507 | nmdc:mga05p37_33437_c1 | nmdc:mga05p37_33437_c1_12_851 | 267 |
| 286 | 3300050507 | nmdc:mga05p37_397457_c1 | nmdc:mga05p37_397457_c1_710_1549 | 267 |
| 287 | 3300050508 | nmdc:mga09592_12464_c1 | nmdc:mga09592_12464_c1_2160_2999 | 267 |
| 288 | 3300050509 | nmdc:mga0qj67_11947_c1 | nmdc:mga0qj67_11947_c1_3953_4792 | 267 |
| 289 | 3300050509 | nmdc:mga0qj67_42245_c1 | nmdc:mga0qj67_42245_c1_885_1736 | 267 |
| 290 | 3300050510 | nmdc:mga06r32_10732_c1 | nmdc:mga06r32_10732_c1_3212_4051 | 267 |
| 291 | 3300050510 | nmdc:mga06r32_133_c1 | nmdc:mga06r32_133_c1_38412_39251 | 267 |
| 292 | 3300050510 | nmdc:mga06r32_137946_c1 | nmdc:mga06r32_137946_c1_991_1836 | 267 |
| 293 | 3300050511 | nmdc:mga08y16_146589_c1 | nmdc:mga08y16_146589_c1_1292_2137 | 267 |
| 294 | 3300050511 | nmdc:mga08y16_604_c1 | nmdc:mga08y16_604_c1_28002_28841 | 267 |
| 295 | 3300050512 | nmdc:mga0n895_10909_c1 | nmdc:mga0n895_10909_c1_3111_3962 | 267 |
| 296 | 3300050513 | nmdc:mga0rr50_522826_c1 | nmdc:mga0rr50_522826_c1_141_986 | 267 |
| 297 | 3300050513 | nmdc:mga0rr50_7940_c1 | nmdc:mga0rr50_7940_c1_2973_3824 | 267 |
| 298 | 3300050514 | nmdc:mga08x19_1956_c1 | nmdc:mga08x19_1956_c1_2861_3712 | 267 |
| 299 | 3300050514 | nmdc:mga08x19_59784_c1 | nmdc:mga08x19_59784_c1_93_932 | 267 |
| 300 | 3300050514 | nmdc:mga08x19_96455_c1 | nmdc:mga08x19_96455_c1_855_1700 | 267 |
| 301 | 3300050515 | nmdc:mga0a205_10383_c1 | nmdc:mga0a205_10383_c1_3349_4200 | 267 |
| 302 | 3300053085 | Ga0495619_0011890 | Ga0495619_0011890_2822_3670 | 267 |
| 303 | 3300053153 | Ga0500616_0000385 | Ga0500616_0000385_48021_48857 | 267 |
| 304 | 3300053177 | Ga0500636_0017052 | Ga0500636_0017052_782_1636 | 267 |
| 305 | 3300053737 | Ga0500601_005824 | Ga0500601_005824_18_872 | 267 |
| 306 | 3300003203 | JGI25406J46586_10000162 | JGI25406J46586_100001629 | 268 |
| 307 | 3300003215 | JGI25153J46596_10002866 | JGI25153J46596_100028664 | 268 |
| 308 | 3300005293 | Ga0065715_10168973 | Ga0065715_101689732 | 268 |
| 309 | 3300005328 | Ga0070676_10015138 | Ga0070676_100151383 | 268 |
| 310 | 3300005329 | Ga0070683_100044454 | Ga0070683_1000444542 | 268 |
| 311 | 3300005330 | Ga0070690_100276750 | Ga0070690_1002767501 | 268 |
| 312 | 3300005331 | Ga0070670_100058179 | Ga0070670_1000581792 | 268 |
| 313 | 3300005334 | Ga0068869_100002206 | Ga0068869_10000220610 | 268 |
| 314 | 3300005334 | Ga0068869_100369404 | Ga0068869_1003694041 | 268 |
| 315 | 3300005336 | Ga0070680_100002402 | Ga0070680_10000240215 | 268 |
| 316 | 3300005336 | Ga0070680_100166702 | Ga0070680_1001667022 | 268 |
| 317 | 3300005336 | Ga0070680_100384707 | Ga0070680_1003847072 | 268 |
| 318 | 3300005337 | Ga0070682_100001262 | Ga0070682_1000012622 | 268 |
| 319 | 3300005339 | Ga0070660_100000335 | Ga0070660_1000003353 | 268 |
| 320 | 3300005339 | Ga0070660_100007713 | Ga0070660_1000077131 | 268 |
| 321 | 3300005340 | Ga0070689_100301513 | Ga0070689_1003015132 | 268 |
| 322 | 3300005341 | Ga0070691_10005617 | Ga0070691_100056176 | 268 |
| 323 | 3300005344 | Ga0070661_100002058 | Ga0070661_10000205812 | 268 |
| 324 | 3300005344 | Ga0070661_100177216 | Ga0070661_1001772162 | 268 |
| 325 | 3300005347 | Ga0070668_100006633 | Ga0070668_1000066336 | 268 |
| 326 | 3300005347 | Ga0070668_100055643 | Ga0070668_1000556432 | 268 |
| 327 | 3300005347 | Ga0070668_100211200 | Ga0070668_1002112003 | 268 |
| 328 | 3300005353 | Ga0070669_100071085 | Ga0070669_1000710851 | 268 |
| 329 | 3300005354 | Ga0070675_100076889 | Ga0070675_1000768891 | 268 |
| 330 | 3300005356 | Ga0070674_100014014 | Ga0070674_1000140142 | 268 |
| 331 | 3300005364 | Ga0070673_100333459 | Ga0070673_1003334592 | 268 |
| 332 | 3300005366 | Ga0070659_100004245 | Ga0070659_1000042454 | 268 |
| 333 | 3300005367 | Ga0070667_100272937 | Ga0070667_1002729371 | 268 |
| 334 | 3300005434 | Ga0070709_10009864 | Ga0070709_100098643 | 268 |
| 335 | 3300005434 | Ga0070709_10017830 | Ga0070709_100178304 | 268 |
| 336 | 3300005435 | Ga0070714_100005779 | Ga0070714_1000057796 | 268 |
| 337 | 3300005435 | Ga0070714_100027828 | Ga0070714_1000278286 | 268 |
| 338 | 3300005435 | Ga0070714_100246470 | Ga0070714_1002464701 | 268 |
| 339 | 3300005435 | Ga0070714_100253500 | Ga0070714_1002535002 | 268 |
| 340 | 3300005436 | Ga0070713_100035562 | Ga0070713_1000355622 | 268 |
| 341 | 3300005436 | Ga0070713_100109247 | Ga0070713_1001092472 | 268 |
| 342 | 3300005436 | Ga0070713_100145452 | Ga0070713_1001454525 | 268 |
| 343 | 3300005437 | Ga0070710_10000521 | Ga0070710_100005215 | 268 |
| 344 | 3300005437 | Ga0070710_10001560 | Ga0070710_100015605 | 268 |
| 345 | 3300005437 | Ga0070710_10066926 | Ga0070710_100669262 | 268 |
| 346 | 3300005437 | Ga0070710_10169158 | Ga0070710_101691581 | 268 |
| 347 | 3300005439 | Ga0070711_100009231 | Ga0070711_1000092314 | 268 |
| 348 | 3300005439 | Ga0070711_100014060 | Ga0070711_1000140603 | 268 |
| 349 | 3300005439 | Ga0070711_100049569 | Ga0070711_1000495692 | 268 |
| 350 | 3300005440 | Ga0070705_100009249 | Ga0070705_1000092492 | 268 |
| 351 | 3300005440 | Ga0070705_100013922 | Ga0070705_1000139225 | 268 |
| 352 | 3300005441 | Ga0070700_100084649 | Ga0070700_1000846493 | 268 |
| 353 | 3300005444 | Ga0070694_100029203 | Ga0070694_1000292034 | 268 |
| 354 | 3300005444 | Ga0070694_100368108 | Ga0070694_1003681082 | 268 |
| 355 | 3300005445 | Ga0070708_100064166 | Ga0070708_1000641663 | 268 |
| 356 | 3300005445 | Ga0070708_100184557 | Ga0070708_1001845572 | 268 |
| 357 | 3300005445 | Ga0070708_100368691 | Ga0070708_1003686912 | 268 |
| 358 | 3300005455 | Ga0070663_100006448 | Ga0070663_10000644812 | 268 |
| 359 | 3300005455 | Ga0070663_100094486 | Ga0070663_1000944862 | 268 |
| 360 | 3300005457 | Ga0070662_100023019 | Ga0070662_1000230193 | 268 |
| 361 | 3300005457 | Ga0070662_100041868 | Ga0070662_1000418682 | 268 |
| 362 | 3300005458 | Ga0070681_10089175 | Ga0070681_100891754 | 268 |
| 363 | 3300005458 | Ga0070681_10396293 | Ga0070681_103962931 | 268 |
| 364 | 3300005458 | Ga0070681_10445009 | Ga0070681_104450092 | 268 |
| 365 | 3300005458 | Ga0070681_10623070 | Ga0070681_106230701 | 268 |
| 366 | 3300005459 | Ga0068867_100004506 | Ga0068867_10000450611 | 268 |
| 367 | 3300005467 | Ga0070706_100178535 | Ga0070706_1001785351 | 268 |
| 368 | 3300005467 | Ga0070706_100225177 | Ga0070706_1002251772 | 268 |
| 369 | 3300005467 | Ga0070706_100238099 | Ga0070706_1002380991 | 268 |
| 370 | 3300005467 | Ga0070706_100252170 | Ga0070706_1002521703 | 268 |
| 371 | 3300005468 | Ga0070707_100071546 | Ga0070707_1000715463 | 268 |
| 372 | 3300005468 | Ga0070707_100158548 | Ga0070707_1001585481 | 268 |
| 373 | 3300005471 | Ga0070698_100048147 | Ga0070698_1000481475 | 268 |
| 374 | 3300005471 | Ga0070698_100093465 | Ga0070698_1000934652 | 268 |
| 375 | 3300005471 | Ga0070698_100096482 | Ga0070698_1000964823 | 268 |
| 376 | 3300005471 | Ga0070698_100113516 | Ga0070698_1001135163 | 268 |
| 377 | 3300005471 | Ga0070698_100153464 | Ga0070698_1001534642 | 268 |
| 378 | 3300005518 | Ga0070699_100041399 | Ga0070699_1000413992 | 268 |
| 379 | 3300005518 | Ga0070699_100047275 | Ga0070699_1000472752 | 268 |
| 380 | 3300005518 | Ga0070699_100084776 | Ga0070699_1000847762 | 268 |
| 381 | 3300005518 | Ga0070699_100326413 | Ga0070699_1003264132 | 268 |
| 382 | 3300005518 | Ga0070699_100382109 | Ga0070699_1003821091 | 268 |
| 383 | 3300005530 | Ga0070679_100005011 | Ga0070679_10000501114 | 268 |
| 384 | 3300005530 | Ga0070679_100026077 | Ga0070679_1000260777 | 268 |
| 385 | 3300005530 | Ga0070679_100067501 | Ga0070679_1000675012 | 268 |
| 386 | 3300005530 | Ga0070679_100078056 | Ga0070679_1000780563 | 268 |
| 387 | 3300005530 | Ga0070679_100241516 | Ga0070679_1002415162 | 268 |
| 388 | 3300005535 | Ga0070684_100009593 | Ga0070684_1000095932 | 268 |
| 389 | 3300005536 | Ga0070697_100256275 | Ga0070697_1002562752 | 268 |
| 390 | 3300005536 | Ga0070697_100321683 | Ga0070697_1003216832 | 268 |
| 391 | 3300005539 | Ga0068853_100005907 | Ga0068853_1000059074 | 268 |
| 392 | 3300005539 | Ga0068853_100030633 | Ga0068853_1000306332 | 268 |
| 393 | 3300005539 | Ga0068853_100206610 | Ga0068853_1002066102 | 268 |
| 394 | 3300005539 | Ga0068853_100494130 | Ga0068853_1004941301 | 268 |
| 395 | 3300005543 | Ga0070672_100045964 | Ga0070672_1000459643 | 268 |
| 396 | 3300005543 | Ga0070672_100077910 | Ga0070672_1000779105 | 268 |
| 397 | 3300005543 | Ga0070672_100331998 | Ga0070672_1003319982 | 268 |
| 398 | 3300005545 | Ga0070695_100009784 | Ga0070695_1000097846 | 268 |
| 399 | 3300005545 | Ga0070695_100010947 | Ga0070695_1000109474 | 268 |
| 400 | 3300005545 | Ga0070695_100034299 | Ga0070695_1000342992 | 268 |
| 401 | 3300005546 | Ga0070696_100006504 | Ga0070696_1000065046 | 268 |
| 402 | 3300005546 | Ga0070696_100019857 | Ga0070696_1000198575 | 268 |
| 403 | 3300005547 | Ga0070693_100000201 | Ga0070693_1000002014 | 268 |
| 404 | 3300005548 | Ga0070665_100056988 | Ga0070665_1000569883 | 268 |
| 405 | 3300005549 | Ga0070704_100000395 | Ga0070704_1000003956 | 268 |
| 406 | 3300005549 | Ga0070704_100001335 | Ga0070704_1000013352 | 268 |
| 407 | 3300005549 | Ga0070704_100005399 | Ga0070704_1000053996 | 268 |
| 408 | 3300005563 | Ga0068855_100001465 | Ga0068855_10000146518 | 268 |
| 409 | 3300005563 | Ga0068855_100172656 | Ga0068855_1001726563 | 268 |
| 410 | 3300005563 | Ga0068855_100226845 | Ga0068855_1002268452 | 268 |
| 411 | 3300005564 | Ga0070664_100269003 | Ga0070664_1002690031 | 268 |
| 412 | 3300005577 | Ga0068857_100086635 | Ga0068857_1000866352 | 268 |
| 413 | 3300005577 | Ga0068857_100088251 | Ga0068857_1000882511 | 268 |
| 414 | 3300005577 | Ga0068857_100104239 | Ga0068857_1001042392 | 268 |
| 415 | 3300005614 | Ga0068856_100000513 | Ga0068856_10000051317 | 268 |
| 416 | 3300005614 | Ga0068856_100001138 | Ga0068856_10000113815 | 268 |
| 417 | 3300005614 | Ga0068856_100133819 | Ga0068856_1001338193 | 268 |
| 418 | 3300005616 | Ga0068852_100047281 | Ga0068852_1000472813 | 268 |
| 419 | 3300005618 | Ga0068864_100061767 | Ga0068864_1000617672 | 268 |
| 420 | 3300005618 | Ga0068864_100082720 | Ga0068864_1000827202 | 268 |
| 421 | 3300005718 | Ga0068866_10061647 | Ga0068866_100616472 | 268 |
| 422 | 3300005718 | Ga0068866_10193962 | Ga0068866_101939622 | 268 |
| 423 | 3300005719 | Ga0068861_100036662 | Ga0068861_1000366623 | 268 |
| 424 | 3300005840 | Ga0068870_10004585 | Ga0068870_100045857 | 268 |
| 425 | 3300005841 | Ga0068863_100045502 | Ga0068863_1000455024 | 268 |
| 426 | 3300005842 | Ga0068858_100028605 | Ga0068858_1000286052 | 268 |
| 427 | 3300005843 | Ga0068860_100000503 | Ga0068860_10000050330 | 268 |
| 428 | 3300005843 | Ga0068860_100035583 | Ga0068860_1000355832 | 268 |
| 429 | 3300005843 | Ga0068860_100094659 | Ga0068860_1000946592 | 268 |
| 430 | 3300005843 | Ga0068860_100147155 | Ga0068860_1001471553 | 268 |
| 431 | 3300005844 | Ga0068862_100025439 | Ga0068862_1000254394 | 268 |
| 432 | 3300005937 | Ga0081455_10000022 | Ga0081455_10000022110 | 268 |
| 433 | 3300005937 | Ga0081455_10000864 | Ga0081455_1000086410 | 268 |
| 434 | 3300005937 | Ga0081455_10019456 | Ga0081455_100194567 | 268 |
| 435 | 3300005937 | Ga0081455_10020308 | Ga0081455_100203085 | 268 |
| 436 | 3300005983 | Ga0081540_1002045 | Ga0081540_100204510 | 268 |
| 437 | 3300005985 | Ga0081539_10001007 | Ga0081539_1000100728 | 268 |
| 438 | 3300006028 | Ga0070717_10065385 | Ga0070717_100653853 | 268 |
| 439 | 3300006038 | Ga0075365_10029929 | Ga0075365_100299293 | 268 |
| 440 | 3300006038 | Ga0075365_10042546 | Ga0075365_100425463 | 268 |
| 441 | 3300006038 | Ga0075365_10279407 | Ga0075365_102794072 | 268 |
| 442 | 3300006038 | Ga0075365_10332934 | Ga0075365_103329342 | 268 |
| 443 | 3300006042 | Ga0075368_10027879 | Ga0075368_100278791 | 268 |
| 444 | 3300006042 | Ga0075368_10095838 | Ga0075368_100958382 | 268 |
| 445 | 3300006048 | Ga0075363_100085334 | Ga0075363_1000853342 | 268 |
| 446 | 3300006051 | Ga0075364_10125743 | Ga0075364_101257432 | 268 |
| 447 | 3300006051 | Ga0075364_10172107 | Ga0075364_101721071 | 268 |
| 448 | 3300006058 | Ga0075432_10030582 | Ga0075432_100305822 | 268 |
| 449 | 3300006163 | Ga0070715_10000603 | Ga0070715_100006034 | 268 |
| 450 | 3300006163 | Ga0070715_10254362 | Ga0070715_102543621 | 268 |
| 451 | 3300006173 | Ga0070716_100031698 | Ga0070716_1000316983 | 268 |
| 452 | 3300006175 | Ga0070712_100003710 | Ga0070712_1000037108 | 268 |
| 453 | 3300006177 | Ga0075362_10004593 | Ga0075362_100045933 | 268 |
| 454 | 3300006177 | Ga0075362_10073325 | Ga0075362_100733252 | 268 |
| 455 | 3300006178 | Ga0075367_10021431 | Ga0075367_100214314 | 268 |
| 456 | 3300006186 | Ga0075369_10008692 | Ga0075369_100086923 | 268 |
| 457 | 3300006186 | Ga0075369_10034929 | Ga0075369_100349292 | 268 |
| 458 | 3300006186 | Ga0075369_10129066 | Ga0075369_101290661 | 268 |
| 459 | 3300006195 | Ga0075366_10019315 | Ga0075366_100193152 | 268 |
| 460 | 3300006237 | Ga0097621_100269539 | Ga0097621_1002695392 | 268 |
| 461 | 3300006844 | Ga0075428_100022172 | Ga0075428_1000221728 | 268 |
| 462 | 3300006844 | Ga0075428_100059199 | Ga0075428_1000591996 | 268 |
| 463 | 3300006844 | Ga0075428_100080660 | Ga0075428_1000806603 | 268 |
| 464 | 3300006844 | Ga0075428_100133891 | Ga0075428_1001338911 | 268 |
| 465 | 3300006844 | Ga0075428_100625905 | Ga0075428_1006259051 | 268 |
| 466 | 3300006844 | Ga0075428_100746163 | Ga0075428_1007461631 | 268 |
| 467 | 3300006846 | Ga0075430_100001172 | Ga0075430_10000117210 | 268 |
| 468 | 3300006847 | Ga0075431_100008045 | Ga0075431_10000804510 | 268 |
| 469 | 3300006847 | Ga0075431_100011372 | Ga0075431_1000113729 | 268 |
| 470 | 3300006847 | Ga0075431_100017008 | Ga0075431_1000170082 | 268 |
| 471 | 3300006847 | Ga0075431_100098586 | Ga0075431_1000985863 | 268 |
| 472 | 3300006852 | Ga0075433_10004254 | Ga0075433_100042542 | 268 |
| 473 | 3300006852 | Ga0075433_10008732 | Ga0075433_100087329 | 268 |
| 474 | 3300006852 | Ga0075433_10033075 | Ga0075433_100330752 | 268 |
| 475 | 3300006852 | Ga0075433_10067251 | Ga0075433_100672512 | 268 |
| 476 | 3300006871 | Ga0075434_100031443 | Ga0075434_1000314436 | 268 |
| 477 | 3300006871 | Ga0075434_100175540 | Ga0075434_1001755403 | 268 |
| 478 | 3300006871 | Ga0075434_100281163 | Ga0075434_1002811631 | 268 |
| 479 | 3300006880 | Ga0075429_100000003 | Ga0075429_10000000363 | 268 |
| 480 | 3300006881 | Ga0068865_100161512 | Ga0068865_1001615122 | 268 |
| 481 | 3300007076 | Ga0075435_100119046 | Ga0075435_1001190462 | 268 |
| 482 | 3300007265 | Ga0099794_10009489 | Ga0099794_100094896 | 268 |
| 483 | 3300007788 | Ga0099795_10060195 | Ga0099795_100601952 | 268 |
| 484 | 3300009093 | Ga0105240_10044074 | Ga0105240_100440745 | 268 |
| 485 | 3300009093 | Ga0105240_10188913 | Ga0105240_101889132 | 268 |
| 486 | 3300009094 | Ga0111539_10000387 | Ga0111539_1000038729 | 268 |
| 487 | 3300009094 | Ga0111539_10037748 | Ga0111539_100377485 | 268 |
| 488 | 3300009094 | Ga0111539_10062968 | Ga0111539_100629682 | 268 |
| 489 | 3300009098 | Ga0105245_10008214 | Ga0105245_100082143 | 268 |
| 490 | 3300009147 | Ga0114129_10005359 | Ga0114129_100053596 | 268 |
| 491 | 3300009147 | Ga0114129_10090068 | Ga0114129_100900684 | 268 |
| 492 | 3300009147 | Ga0114129_10127814 | Ga0114129_101278142 | 268 |
| 493 | 3300009147 | Ga0114129_10332768 | Ga0114129_103327681 | 268 |
| 494 | 3300009147 | Ga0114129_10368526 | Ga0114129_103685263 | 268 |
| 495 | 3300009147 | Ga0114129_10426852 | Ga0114129_104268521 | 268 |
| 496 | 3300009147 | Ga0114129_10451566 | Ga0114129_104515661 | 268 |
| 497 | 3300009148 | Ga0105243_10067067 | Ga0105243_100670672 | 268 |
| 498 | 3300009148 | Ga0105243_10181148 | Ga0105243_101811482 | 268 |
| 499 | 3300009148 | Ga0105243_10232271 | Ga0105243_102322712 | 268 |
| 500 | 3300009148 | Ga0105243_10772503 | Ga0105243_107725032 | 268 |
| 501 | 3300009174 | Ga0105241_10079079 | Ga0105241_100790791 | 268 |
| 502 | 3300009176 | Ga0105242_10272565 | Ga0105242_102725652 | 268 |
| 503 | 3300009176 | Ga0105242_10275776 | Ga0105242_102757762 | 268 |
| 504 | 3300009177 | Ga0105248_10088269 | Ga0105248_100882695 | 268 |
| 505 | 3300009177 | Ga0105248_10168955 | Ga0105248_101689553 | 268 |
| 506 | 3300009177 | Ga0105248_10485265 | Ga0105248_104852651 | 268 |
| 507 | 3300009545 | Ga0105237_10007319 | Ga0105237_100073195 | 268 |
| 508 | 3300009545 | Ga0105237_10043711 | Ga0105237_100437113 | 268 |
| 509 | 3300009545 | Ga0105237_10048539 | Ga0105237_100485396 | 268 |
| 510 | 3300009545 | Ga0105237_10213722 | Ga0105237_102137222 | 268 |
| 511 | 3300009553 | Ga0105249_10013696 | Ga0105249_100136965 | 268 |
| 512 | 3300010375 | Ga0105239_10126553 | Ga0105239_101265531 | 268 |
| 513 | 3300010375 | Ga0105239_10215689 | Ga0105239_102156891 | 268 |
| 514 | 3300013100 | Ga0157373_10001232 | Ga0157373_100012326 | 268 |
| 515 | 3300013102 | Ga0157371_10102647 | Ga0157371_101026472 | 268 |
| 516 | 3300013104 | Ga0157370_10052997 | Ga0157370_100529973 | 268 |
| 517 | 3300013104 | Ga0157370_10055518 | Ga0157370_100555182 | 268 |
| 518 | 3300013104 | Ga0157370_10158080 | Ga0157370_101580801 | 268 |
| 519 | 3300013105 | Ga0157369_10004456 | Ga0157369_1000445611 | 268 |
| 520 | 3300013105 | Ga0157369_10019805 | Ga0157369_100198058 | 268 |
| 521 | 3300013105 | Ga0157369_10610831 | Ga0157369_106108312 | 268 |
| 522 | 3300013296 | Ga0157374_10061756 | Ga0157374_100617563 | 268 |
| 523 | 3300013296 | Ga0157374_10100879 | Ga0157374_101008792 | 268 |
| 524 | 3300013296 | Ga0157374_10278033 | Ga0157374_102780332 | 268 |
| 525 | 3300013296 | Ga0157374_10679080 | Ga0157374_106790801 | 268 |
| 526 | 3300013297 | Ga0157378_10041710 | Ga0157378_100417105 | 268 |
| 527 | 3300013297 | Ga0157378_10073485 | Ga0157378_100734857 | 268 |
| 528 | 3300013306 | Ga0163162_10082024 | Ga0163162_100820242 | 268 |
| 529 | 3300013306 | Ga0163162_10128132 | Ga0163162_101281322 | 268 |
| 530 | 3300013307 | Ga0157372_10000612 | Ga0157372_1000061230 | 268 |
| 531 | 3300013307 | Ga0157372_10041944 | Ga0157372_100419443 | 268 |
| 532 | 3300013307 | Ga0157372_10212403 | Ga0157372_102124032 | 268 |
| 533 | 3300013308 | Ga0157375_10078073 | Ga0157375_100780733 | 268 |
| 534 | 3300013308 | Ga0157375_10343430 | Ga0157375_103434301 | 268 |
| 535 | 3300014325 | Ga0163163_10024216 | Ga0163163_100242164 | 268 |
| 536 | 3300014325 | Ga0163163_10050760 | Ga0163163_100507604 | 268 |
| 537 | 3300014497 | Ga0182008_10021801 | Ga0182008_100218015 | 268 |
| 538 | 3300014968 | Ga0157379_10098375 | Ga0157379_100983752 | 268 |
| 539 | 3300014969 | Ga0157376_10151953 | Ga0157376_101519532 | 268 |
| 540 | 3300014969 | Ga0157376_10215625 | Ga0157376_102156251 | 268 |
| 541 | 3300017792 | Ga0163161_10116625 | Ga0163161_101166252 | 268 |
| 542 | 3300017792 | Ga0163161_10189794 | Ga0163161_101897941 | 268 |
| 543 | 3300020070 | Ga0206356_10060346 | Ga0206356_100603462 | 268 |
| 544 | 3300021358 | Ga0213873_10019757 | Ga0213873_100197573 | 268 |
| 545 | 3300021377 | Ga0213874_10061093 | Ga0213874_100610932 | 268 |
| 546 | 3300021384 | Ga0213876_10003793 | Ga0213876_100037935 | 268 |
| 547 | 3300022467 | Ga0224712_10147600 | Ga0224712_101476002 | 268 |
| 548 | 3300022467 | Ga0224712_10150931 | Ga0224712_101509311 | 268 |
| 549 | 3300024225 | Ga0224572_1007000 | Ga0224572_10070002 | 268 |
| 550 | 3300025253 | Ga0209677_101915 | Ga0209677_1019152 | 268 |
| 551 | 3300025254 | Ga0209148_1006564 | Ga0209148_10065642 | 268 |
| 552 | 3300025261 | Ga0209233_1004436 | Ga0209233_10044362 | 268 |
| 553 | 3300025272 | Ga0209455_1003615 | Ga0209455_10036152 | 268 |
| 554 | 3300025272 | Ga0209455_1004331 | Ga0209455_10043313 | 268 |
| 555 | 3300025297 | Ga0209758_1006475 | Ga0209758_10064753 | 268 |
| 556 | 3300025321 | Ga0207656_10129390 | Ga0207656_101293901 | 268 |
| 557 | 3300025885 | Ga0207653_10003590 | Ga0207653_100035902 | 268 |
| 558 | 3300025898 | Ga0207692_10001827 | Ga0207692_100018275 | 268 |
| 559 | 3300025898 | Ga0207692_10021921 | Ga0207692_100219213 | 268 |
| 560 | 3300025898 | Ga0207692_10112045 | Ga0207692_101120451 | 268 |
| 561 | 3300025905 | Ga0207685_10002290 | Ga0207685_100022902 | 268 |
| 562 | 3300025905 | Ga0207685_10049722 | Ga0207685_100497222 | 268 |
| 563 | 3300025906 | Ga0207699_10027465 | Ga0207699_100274652 | 268 |
| 564 | 3300025906 | Ga0207699_10083256 | Ga0207699_100832562 | 268 |
| 565 | 3300025906 | Ga0207699_10132736 | Ga0207699_101327362 | 268 |
| 566 | 3300025907 | Ga0207645_10009046 | Ga0207645_100090464 | 268 |
| 567 | 3300025910 | Ga0207684_10001645 | Ga0207684_1000164518 | 268 |
| 568 | 3300025910 | Ga0207684_10017949 | Ga0207684_100179493 | 268 |
| 569 | 3300025910 | Ga0207684_10019307 | Ga0207684_100193073 | 268 |
| 570 | 3300025910 | Ga0207684_10195869 | Ga0207684_101958692 | 268 |
| 571 | 3300025911 | Ga0207654_10021309 | Ga0207654_100213093 | 268 |
| 572 | 3300025912 | Ga0207707_10000170 | Ga0207707_1000017026 | 268 |
| 573 | 3300025912 | Ga0207707_10000555 | Ga0207707_1000055527 | 268 |
| 574 | 3300025912 | Ga0207707_10258954 | Ga0207707_102589541 | 268 |
| 575 | 3300025913 | Ga0207695_10081975 | Ga0207695_100819751 | 268 |
| 576 | 3300025913 | Ga0207695_10452537 | Ga0207695_104525371 | 268 |
| 577 | 3300025914 | Ga0207671_10036016 | Ga0207671_100360162 | 268 |
| 578 | 3300025914 | Ga0207671_10071214 | Ga0207671_100712143 | 268 |
| 579 | 3300025914 | Ga0207671_10075808 | Ga0207671_100758083 | 268 |
| 580 | 3300025915 | Ga0207693_10006093 | Ga0207693_100060932 | 268 |
| 581 | 3300025915 | Ga0207693_10010348 | Ga0207693_100103487 | 268 |
| 582 | 3300025915 | Ga0207693_10036914 | Ga0207693_100369145 | 268 |
| 583 | 3300025915 | Ga0207693_10046726 | Ga0207693_100467261 | 268 |
| 584 | 3300025916 | Ga0207663_10005048 | Ga0207663_100050487 | 268 |
| 585 | 3300025916 | Ga0207663_10007145 | Ga0207663_100071454 | 268 |
| 586 | 3300025917 | Ga0207660_10007797 | Ga0207660_100077974 | 268 |
| 587 | 3300025917 | Ga0207660_10051731 | Ga0207660_100517312 | 268 |
| 588 | 3300025917 | Ga0207660_10139553 | Ga0207660_101395532 | 268 |
| 589 | 3300025917 | Ga0207660_10143522 | Ga0207660_101435222 | 268 |
| 590 | 3300025917 | Ga0207660_10296179 | Ga0207660_102961791 | 268 |
| 591 | 3300025919 | Ga0207657_10001106 | Ga0207657_1000110615 | 268 |
| 592 | 3300025919 | Ga0207657_10225025 | Ga0207657_102250251 | 268 |
| 593 | 3300025920 | Ga0207649_10010165 | Ga0207649_100101653 | 268 |
| 594 | 3300025921 | Ga0207652_10004264 | Ga0207652_100042646 | 268 |
| 595 | 3300025921 | Ga0207652_10041977 | Ga0207652_100419776 | 268 |
| 596 | 3300025921 | Ga0207652_10045482 | Ga0207652_100454823 | 268 |
| 597 | 3300025922 | Ga0207646_10036612 | Ga0207646_100366123 | 268 |
| 598 | 3300025922 | Ga0207646_10162053 | Ga0207646_101620532 | 268 |
| 599 | 3300025923 | Ga0207681_10166003 | Ga0207681_101660032 | 268 |
| 600 | 3300025923 | Ga0207681_10512964 | Ga0207681_105129641 | 268 |
| 601 | 3300025924 | Ga0207694_10054336 | Ga0207694_100543362 | 268 |
| 602 | 3300025924 | Ga0207694_10175659 | Ga0207694_101756592 | 268 |
| 603 | 3300025927 | Ga0207687_10057049 | Ga0207687_100570493 | 268 |
| 604 | 3300025928 | Ga0207700_10013572 | Ga0207700_100135725 | 268 |
| 605 | 3300025928 | Ga0207700_10117449 | Ga0207700_101174492 | 268 |
| 606 | 3300025928 | Ga0207700_10258138 | Ga0207700_102581382 | 268 |
| 607 | 3300025928 | Ga0207700_10515566 | Ga0207700_105155661 | 268 |
| 608 | 3300025929 | Ga0207664_10025824 | Ga0207664_100258242 | 268 |
| 609 | 3300025929 | Ga0207664_10047275 | Ga0207664_100472753 | 268 |
| 610 | 3300025929 | Ga0207664_10047750 | Ga0207664_100477502 | 268 |
| 611 | 3300025929 | Ga0207664_10150039 | Ga0207664_101500392 | 268 |
| 612 | 3300025929 | Ga0207664_10176266 | Ga0207664_101762661 | 268 |
| 613 | 3300025929 | Ga0207664_10188599 | Ga0207664_101885992 | 268 |
| 614 | 3300025931 | Ga0207644_10055972 | Ga0207644_100559721 | 268 |
| 615 | 3300025932 | Ga0207690_10002071 | Ga0207690_100020716 | 268 |
| 616 | 3300025932 | Ga0207690_10285842 | Ga0207690_102858421 | 268 |
| 617 | 3300025933 | Ga0207706_10053483 | Ga0207706_100534833 | 268 |
| 618 | 3300025933 | Ga0207706_10568223 | Ga0207706_105682231 | 268 |
| 619 | 3300025934 | Ga0207686_10021531 | Ga0207686_100215313 | 268 |
| 620 | 3300025934 | Ga0207686_10050676 | Ga0207686_100506762 | 268 |
| 621 | 3300025935 | Ga0207709_10011247 | Ga0207709_100112474 | 268 |
| 622 | 3300025935 | Ga0207709_10021268 | Ga0207709_100212683 | 268 |
| 623 | 3300025935 | Ga0207709_10199122 | Ga0207709_101991222 | 268 |
| 624 | 3300025936 | Ga0207670_10095037 | Ga0207670_100950372 | 268 |
| 625 | 3300025937 | Ga0207669_10026910 | Ga0207669_100269101 | 268 |
| 626 | 3300025938 | Ga0207704_10027519 | Ga0207704_100275192 | 268 |
| 627 | 3300025939 | Ga0207665_10027175 | Ga0207665_100271753 | 268 |
| 628 | 3300025939 | Ga0207665_10221391 | Ga0207665_102213912 | 268 |
| 629 | 3300025939 | Ga0207665_10463737 | Ga0207665_104637371 | 268 |
| 630 | 3300025940 | Ga0207691_10013018 | Ga0207691_100130188 | 268 |
| 631 | 3300025940 | Ga0207691_10128303 | Ga0207691_101283033 | 268 |
| 632 | 3300025941 | Ga0207711_10051920 | Ga0207711_100519203 | 268 |
| 633 | 3300025941 | Ga0207711_10107410 | Ga0207711_101074102 | 268 |
| 634 | 3300025942 | Ga0207689_10003550 | Ga0207689_100035502 | 268 |
| 635 | 3300025945 | Ga0207679_10000523 | Ga0207679_1000052316 | 268 |
| 636 | 3300025945 | Ga0207679_10145361 | Ga0207679_101453612 | 268 |
| 637 | 3300025945 | Ga0207679_10244799 | Ga0207679_102447992 | 268 |
| 638 | 3300025949 | Ga0207667_10042230 | Ga0207667_100422303 | 268 |
| 639 | 3300025949 | Ga0207667_10053418 | Ga0207667_100534184 | 268 |
| 640 | 3300025949 | Ga0207667_10127732 | Ga0207667_101277323 | 268 |
| 641 | 3300025949 | Ga0207667_10297304 | Ga0207667_102973043 | 268 |
| 642 | 3300025961 | Ga0207712_10006218 | Ga0207712_100062185 | 268 |
| 643 | 3300025961 | Ga0207712_10465499 | Ga0207712_104654991 | 268 |
| 644 | 3300025972 | Ga0207668_10010781 | Ga0207668_100107812 | 268 |
| 645 | 3300025972 | Ga0207668_10032351 | Ga0207668_100323513 | 268 |
| 646 | 3300025972 | Ga0207668_10037486 | Ga0207668_100374864 | 268 |
| 647 | 3300026023 | Ga0207677_10032031 | Ga0207677_100320312 | 268 |
| 648 | 3300026035 | Ga0207703_10255363 | Ga0207703_102553632 | 268 |
| 649 | 3300026035 | Ga0207703_10381053 | Ga0207703_103810531 | 268 |
| 650 | 3300026035 | Ga0207703_10769933 | Ga0207703_107699331 | 268 |
| 651 | 3300026041 | Ga0207639_10000950 | Ga0207639_100009506 | 268 |
| 652 | 3300026041 | Ga0207639_10037696 | Ga0207639_100376964 | 268 |
| 653 | 3300026041 | Ga0207639_10137781 | Ga0207639_101377812 | 268 |
| 654 | 3300026067 | Ga0207678_10011341 | Ga0207678_100113417 | 268 |
| 655 | 3300026067 | Ga0207678_10119607 | Ga0207678_101196072 | 268 |
| 656 | 3300026067 | Ga0207678_10210406 | Ga0207678_102104063 | 268 |
| 657 | 3300026078 | Ga0207702_10000493 | Ga0207702_1000049316 | 268 |
| 658 | 3300026078 | Ga0207702_10001780 | Ga0207702_100017808 | 268 |
| 659 | 3300026088 | Ga0207641_10149247 | Ga0207641_101492473 | 268 |
| 660 | 3300026088 | Ga0207641_10342052 | Ga0207641_103420522 | 268 |
| 661 | 3300026089 | Ga0207648_10028734 | Ga0207648_100287345 | 268 |
| 662 | 3300026089 | Ga0207648_10147191 | Ga0207648_101471913 | 268 |
| 663 | 3300026095 | Ga0207676_10133644 | Ga0207676_101336442 | 268 |
| 664 | 3300026095 | Ga0207676_10259028 | Ga0207676_102590281 | 268 |
| 665 | 3300026116 | Ga0207674_10001680 | Ga0207674_1000168021 | 268 |
| 666 | 3300026116 | Ga0207674_10021630 | Ga0207674_100216307 | 268 |
| 667 | 3300026116 | Ga0207674_10026802 | Ga0207674_100268022 | 268 |
| 668 | 3300026116 | Ga0207674_10102499 | Ga0207674_101024992 | 268 |
| 669 | 3300026118 | Ga0207675_100017359 | Ga0207675_1000173592 | 268 |
| 670 | 3300026118 | Ga0207675_100041747 | Ga0207675_1000417474 | 268 |
| 671 | 3300026121 | Ga0207683_10033261 | Ga0207683_100332614 | 268 |
| 672 | 3300026121 | Ga0207683_10042020 | Ga0207683_100420203 | 268 |
| 673 | 3300026121 | Ga0207683_10174145 | Ga0207683_101741451 | 268 |
| 674 | 3300026142 | Ga0207698_10093056 | Ga0207698_100930561 | 268 |
| 675 | 3300026142 | Ga0207698_10145023 | Ga0207698_101450232 | 268 |
| 676 | 3300027364 | Ga0209967_1012739 | Ga0209967_10127391 | 268 |
| 677 | 3300027395 | Ga0209996_1004913 | Ga0209996_10049133 | 268 |
| 678 | 3300027462 | Ga0210000_1005050 | Ga0210000_10050502 | 268 |
| 679 | 3300027471 | Ga0209995_1000295 | Ga0209995_10002955 | 268 |
| 680 | 3300027526 | Ga0209968_1001353 | Ga0209968_10013531 | 268 |
| 681 | 3300027543 | Ga0209999_1002059 | Ga0209999_10020592 | 268 |
| 682 | 3300027617 | Ga0210002_1001677 | Ga0210002_10016772 | 268 |
| 683 | 3300027665 | Ga0209983_1000262 | Ga0209983_10002622 | 268 |
| 684 | 3300027671 | Ga0209588_1016656 | Ga0209588_10166563 | 268 |
| 685 | 3300027682 | Ga0209971_1000116 | Ga0209971_100011611 | 268 |
| 686 | 3300027695 | Ga0209966_1000058 | Ga0209966_100005820 | 268 |
| 687 | 3300027717 | Ga0209998_10000039 | Ga0209998_1000003915 | 268 |
| 688 | 3300027866 | Ga0209813_10001121 | Ga0209813_100011213 | 268 |
| 689 | 3300027876 | Ga0209974_10000714 | Ga0209974_100007149 | 268 |
| 690 | 3300027907 | Ga0207428_10000348 | Ga0207428_1000034848 | 268 |
| 691 | 3300027907 | Ga0207428_10090326 | Ga0207428_100903264 | 268 |
| 692 | 3300027907 | Ga0207428_10093179 | Ga0207428_100931793 | 268 |
| 693 | 3300028379 | Ga0268266_10055562 | Ga0268266_100555623 | 268 |
| 694 | 3300028379 | Ga0268266_10102008 | Ga0268266_101020083 | 268 |
| 695 | 3300028380 | Ga0268265_10002346 | Ga0268265_100023463 | 268 |
| 696 | 3300028380 | Ga0268265_10083502 | Ga0268265_100835022 | 268 |
| 697 | 3300028381 | Ga0268264_10000185 | Ga0268264_1000018526 | 268 |
| 698 | 3300028381 | Ga0268264_10026277 | Ga0268264_100262776 | 268 |
| 699 | 3300028381 | Ga0268264_10178140 | Ga0268264_101781402 | 268 |
| 700 | 3300028573 | Ga0265334_10055104 | Ga0265334_100551042 | 268 |
| 701 | 3300028800 | Ga0265338_10208844 | Ga0265338_102088441 | 268 |
| 702 | 3300030878 | Ga0265770_1013382 | Ga0265770_10133821 | 268 |
| 703 | 3300031235 | Ga0265330_10165085 | Ga0265330_101650851 | 268 |
| 704 | 3300031240 | Ga0265320_10009525 | Ga0265320_100095252 | 268 |
| 705 | 3300031242 | Ga0265329_10040072 | Ga0265329_100400722 | 268 |
| 706 | 3300031247 | Ga0265340_10119704 | Ga0265340_101197041 | 268 |
| 707 | 3300031249 | Ga0265339_10015996 | Ga0265339_100159962 | 268 |
| 708 | 3300031249 | Ga0265339_10036309 | Ga0265339_100363093 | 268 |
| 709 | 3300031250 | Ga0265331_10029942 | Ga0265331_100299422 | 268 |
| 710 | 3300031507 | Ga0307509_10007409 | Ga0307509_100074092 | 268 |
| 711 | 3300031548 | Ga0307408_100498722 | Ga0307408_1004987221 | 268 |
| 712 | 3300031595 | Ga0265313_10001065 | Ga0265313_100010655 | 268 |
| 713 | 3300031616 | Ga0307508_10188540 | Ga0307508_101885401 | 268 |
| 714 | 3300031711 | Ga0265314_10039124 | Ga0265314_100391241 | 268 |
| 715 | 3300031711 | Ga0265314_10048272 | Ga0265314_100482722 | 268 |
| 716 | 3300031712 | Ga0265342_10029931 | Ga0265342_100299313 | 268 |
| 717 | 3300031901 | Ga0307406_10323945 | Ga0307406_103239451 | 268 |
| 718 | 3300031911 | Ga0307412_10305653 | Ga0307412_103056532 | 268 |
| 719 | 3300032002 | Ga0307416_100078453 | Ga0307416_1000784532 | 268 |
| 720 | 3300032002 | Ga0307416_100311421 | Ga0307416_1003114212 | 268 |
| 721 | 3300032005 | Ga0307411_10074312 | Ga0307411_100743123 | 268 |
| 722 | 3300032126 | Ga0307415_100299448 | Ga0307415_1002994482 | 268 |
| 723 | 3300033179 | Ga0307507_10030517 | Ga0307507_100305175 | 268 |
| 724 | 3300034818 | Ga0373950_0030769 | Ga0373950_0030769_90_932 | 268 |
| 725 | 3300034818 | Ga0373950_0034094 | Ga0373950_0034094_28_900 | 268 |
| 726 | 3300034819 | Ga0373958_0033593 | Ga0373958_0033593_154_996 | 268 |
| 727 | 3300034820 | Ga0373959_0010657 | Ga0373959_0010657_528_1400 | 268 |
| 728 | 3300035084 | Ga0373928_0054902 | Ga0373928_0054902_30_872 | 268 |
| 729 | 3300035088 | Ga0373940_0019900 | Ga0373940_0019900_99_941 | 268 |
| 730 | 3300035091 | Ga0373951_0036276 | Ga0373951_0036276_273_1145 | 268 |
| 731 | 3300035111 | Ga0373923_0015627 | Ga0373923_0015627_1704_2681 | 268 |
| 732 | 3300035112 | Ga0373932_0006898 | Ga0373932_0006898_97_948 | 268 |
| 733 | 3300035113 | Ga0373936_0050570 | Ga0373936_0050570_248_1225 | 268 |
| 734 | 3300035113 | Ga0373936_0084743 | Ga0373936_0084743_60_902 | 268 |
| 735 | 3300035114 | Ga0373939_0007202 | Ga0373939_0007202_963_1805 | 268 |
| 736 | 3300035115 | Ga0373941_0017752 | Ga0373941_0017752_146_988 | 268 |
| 737 | 3300035117 | Ga0373953_0001311 | Ga0373953_0001311_1777_2754 | 268 |
| 738 | 3300035118 | Ga0373954_0007164 | Ga0373954_0007164_3048_4025 | 268 |
| 739 | 3300035118 | Ga0373954_0047564 | Ga0373954_0047564_1131_1973 | 268 |
| 740 | 3300035118 | Ga0373954_0155016 | Ga0373954_0155016_256_1098 | 268 |
| 741 | 3300035119 | Ga0373956_0010752 | Ga0373956_0010752_1248_2225 | 268 |
| 742 | 3300035120 | Ga0373957_0010481 | Ga0373957_0010481_1164_2141 | 268 |
| 743 | 3300035121 | Ga0373960_0013848 | Ga0373960_0013848_1174_2016 | 268 |
| 744 | 3300035172 | Ga0373955_0010295 | Ga0373955_0010295_1904_2881 | 268 |
| 745 | 3300035207 | Ga0373942_0014880 | Ga0373942_0014880_40_882 | 268 |
| 746 | 3300035241 | Ga0373961_0016401 | Ga0373961_0016401_528_1400 | 268 |
| 747 | 3300035410 | Ga0373924_0004646 | Ga0373924_0004646_1535_2512 | 268 |
| 748 | 3300035691 | Ga0373931_0000166 | Ga0373931_0000166_4004_4846 | 268 |
| 749 | 3300035691 | Ga0373931_0046692 | Ga0373931_0046692_1285_2127 | 268 |
| 750 | 3300035691 | Ga0373931_0116701 | Ga0373931_0116701_69_914 | 268 |
| 751 | 3300035692 | Ga0373935_0037944 | Ga0373935_0037944_231_1073 | 268 |
| 752 | 3300035692 | Ga0373935_0135126 | Ga0373935_0135126_536_1378 | 268 |
| 753 | 3300035695 | Ga0373927_0074190 | Ga0373927_0074190_21_863 | 268 |
| 754 | 3300035695 | Ga0373927_0104601 | Ga0373927_0104601_530_1372 | 268 |
| 755 | 3300035695 | Ga0373927_0200298 | Ga0373927_0200298_279_1121 | 268 |
| 756 | 3300035695 | Ga0373927_0286960 | Ga0373927_0286960_43_900 | 268 |
| 757 | 3300035724 | Ga0373933_0014326 | Ga0373933_0014326_3145_4002 | 268 |
| 758 | 3300035724 | Ga0373933_0243216 | Ga0373933_0243216_33_875 | 268 |
| 759 | 3300035725 | Ga0373947_0161699 | Ga0373947_0161699_57_899 | 268 |
| 760 | 3300036401 | Ga0373937_0012706 | Ga0373937_0012706_1764_2621 | 268 |
| 761 | 3300036401 | Ga0373937_0049137 | Ga0373937_0049137_780_1622 | 268 |
| 762 | 3300036401 | Ga0373937_0188488 | Ga0373937_0188488_200_1042 | 268 |
| 763 | 3300037068 | Ga0373925_0155550 | Ga0373925_0155550_791_1633 | 268 |
| 764 | 3300037312 | Ga0395899_0012702 | Ga0395899_0012702_1405_2247 | 268 |
| 765 | 3300037312 | Ga0395899_0058617 | Ga0395899_0058617_338_1180 | 268 |
| 766 | 3300037418 | Ga0395900_0002247 | Ga0395900_0002247_2150_2992 | 268 |
| 767 | 3300037418 | Ga0395900_0002271 | Ga0395900_0002271_12758_13600 | 268 |
| 768 | 3300037418 | Ga0395900_0035217 | Ga0395900_0035217_66_908 | 268 |
| 769 | 3300037418 | Ga0395900_0192052 | Ga0395900_0192052_366_1208 | 268 |
| 770 | 3300037466 | Ga0395898_0004503 | Ga0395898_0004503_4554_5396 | 268 |
| 771 | 3300037466 | Ga0395898_0004746 | Ga0395898_0004746_3152_3994 | 268 |
| 772 | 3300037466 | Ga0395898_0347505 | Ga0395898_0347505_215_1057 | 268 |
| 773 | 3300037853 | Ga0436364_1170705 | Ga0436364_1170705_1231_2073 | 268 |
| 774 | 3300038443 | Ga0395901_0001831 | Ga0395901_0001831_12024_12866 | 268 |
| 775 | 3300038443 | Ga0395901_0002599 | Ga0395901_0002599_6337_7179 | 268 |
| 776 | 3300038443 | Ga0395901_0003317 | Ga0395901_0003317_8554_9396 | 268 |
| 777 | 3300038443 | Ga0395901_0105356 | Ga0395901_0105356_1584_2426 | 268 |
| 778 | 3300038443 | Ga0395901_0318822 | Ga0395901_0318822_545_1384 | 268 |
| 779 | 3300039437 | Ga0436365_0015071 | Ga0436365_0015071_210_1073 | 268 |
| 780 | 3300039437 | Ga0436365_0026985 | Ga0436365_0026985_1190_2029 | 268 |
| 781 | 3300039437 | Ga0436365_0133331 | Ga0436365_0133331_122_964 | 268 |
| 782 | 3300039437 | Ga0436365_0893854 | Ga0436365_0893854_2684_3526 | 268 |
| 783 | 3300039437 | Ga0436365_1367547 | Ga0436365_1367547_68_910 | 268 |
| 784 | 3300039437 | Ga0436365_1494838 | Ga0436365_1494838_105_947 | 268 |
| 785 | 3300039438 | Ga0436360_0097146 | Ga0436360_0097146_632_1474 | 268 |
| 786 | 3300039438 | Ga0436360_0195957 | Ga0436360_0195957_1662_2669 | 268 |
| 787 | 3300039438 | Ga0436360_0399216 | Ga0436360_0399216_837_1679 | 268 |
| 788 | 3300039438 | Ga0436360_1082434 | Ga0436360_1082434_1259_2098 | 268 |
| 789 | 3300039447 | Ga0436361_0430054 | Ga0436361_0430054_54_896 | 268 |
| 790 | 3300039447 | Ga0436361_1154927 | Ga0436361_1154927_130_972 | 268 |
| 791 | 3300039450 | Ga0436363_0150716 | Ga0436363_0150716_1059_1907 | 268 |
| 792 | 3300039450 | Ga0436363_0251745 | Ga0436363_0251745_2879_3721 | 268 |
| 793 | 3300039450 | Ga0436363_0311273 | Ga0436363_0311273_138_980 | 268 |
| 794 | 3300039450 | Ga0436363_1126738 | Ga0436363_1126738_250_1092 | 268 |
| 795 | 3300039450 | Ga0436363_1628040 | Ga0436363_1628040_108_950 | 268 |
| 796 | 3300039453 | Ga0436362_0816695 | Ga0436362_0816695_686_1528 | 268 |
| 797 | 3300039453 | Ga0436362_1139972 | Ga0436362_1139972_1287_2129 | 268 |
| 798 | 3300041408 | Ga0439453_0007398 | Ga0439453_0007398_726_1568 | 268 |
| 799 | 3300042001 | Ga0439441_011458 | Ga0439441_011458_376_1215 | 268 |
| 800 | 3300042005 | Ga0439448_0000117 | Ga0439448_0000117_12741_13613 | 268 |
| 801 | 3300042006 | Ga0439432_054549 | Ga0439432_054549_13_855 | 268 |
| 802 | 3300042144 | Ga0450889_001760 | Ga0450889_001760_401_1273 | 268 |
| 803 | 3300042438 | Ga0439459_0005360 | Ga0439459_0005360_1151_2023 | 268 |
| 804 | 3300042439 | Ga0439464_0048673 | Ga0439464_0048673_304_1164 | 268 |
| 805 | 3300042461 | Ga0439460_0023223 | Ga0439460_0023223_587_1429 | 268 |
| 806 | 3300042876 | Ga0451577_0002467 | Ga0451577_0002467_9182_10024 | 268 |
| 807 | 3300044673 | Ga0453683_0163557 | Ga0453683_0163557_155_1003 | 268 |
| 808 | 3300044673 | Ga0453683_0302945 | Ga0453683_0302945_19_867 | 268 |
| 809 | 3300044694 | Ga0466963_0115634 | Ga0466963_0115634_347_1189 | 268 |
| 810 | 3300044712 | Ga0453684_0018119 | Ga0453684_0018119_4305_5147 | 268 |
| 811 | 3300044712 | Ga0453684_0222653 | Ga0453684_0222653_262_1134 | 268 |
| 812 | 3300044842 | Ga0466957_0141944 | Ga0466957_0141944_67_909 | 268 |
| 813 | 3300044842 | Ga0466957_0261151 | Ga0466957_0261151_215_1057 | 268 |
| 814 | 3300045049 | Ga0466959_0055755 | Ga0466959_0055755_1474_2313 | 268 |
| 815 | 3300045051 | Ga0451576_0003327 | Ga0451576_0003327_15711_16553 | 268 |
| 816 | 3300045051 | Ga0451576_0044978 | Ga0451576_0044978_2150_2998 | 268 |
| 817 | 3300045051 | Ga0451576_0085302 | Ga0451576_0085302_2122_2964 | 268 |
| 818 | 3300045051 | Ga0451576_0116389 | Ga0451576_0116389_337_1179 | 268 |
| 819 | 3300045051 | Ga0451576_0172198 | Ga0451576_0172198_1010_1882 | 268 |
| 820 | 3300045051 | Ga0451576_0774923 | Ga0451576_0774923_124_966 | 268 |
| 821 | 3300045976 | Ga0466967_0072518 | Ga0466967_0072518_978_1820 | 268 |
| 822 | 3300045976 | Ga0466967_0499599 | Ga0466967_0499599_192_1034 | 268 |
| 823 | 3300046454 | Ga0495592_0094341 | Ga0495592_0094341_641_1618 | 268 |
| 824 | 3300046455 | Ga0495603_0073435 | Ga0495603_0073435_813_1655 | 268 |
| 825 | 3300046460 | Ga0495638_0259989 | Ga0495638_0259989_72_914 | 268 |
| 826 | 3300046462 | Ga0495651_0262351 | Ga0495651_0262351_271_1113 | 268 |
| 827 | 3300046472 | Ga0495580_0173129 | Ga0495580_0173129_70_912 | 268 |
| 828 | 3300046477 | Ga0495664_0026941 | Ga0495664_0026941_2135_2977 | 268 |
| 829 | 3300046511 | Ga0495608_0017406 | Ga0495608_0017406_2340_3182 | 268 |
| 830 | 3300046511 | Ga0495608_0017855 | Ga0495608_0017855_3659_4516 | 268 |
| 831 | 3300046514 | Ga0495618_0024590 | Ga0495618_0024590_943_1785 | 268 |
| 832 | 3300046523 | Ga0495644_0017912 | Ga0495644_0017912_1370_2212 | 268 |
| 833 | 3300046523 | Ga0495644_0044869 | Ga0495644_0044869_222_1064 | 268 |
| 834 | 3300046529 | Ga0495652_0314288 | Ga0495652_0314288_24_866 | 268 |
| 835 | 3300046533 | Ga0495640_0028742 | Ga0495640_0028742_1702_2679 | 268 |
| 836 | 3300046533 | Ga0495640_0181464 | Ga0495640_0181464_257_1108 | 268 |
| 837 | 3300046536 | Ga0495587_0010837 | Ga0495587_0010837_1701_2543 | 268 |
| 838 | 3300046537 | Ga0495598_0021039 | Ga0495598_0021039_661_1539 | 268 |
| 839 | 3300046543 | Ga0495645_0016548 | Ga0495645_0016548_3289_4131 | 268 |
| 840 | 3300046559 | Ga0495667_0060016 | Ga0495667_0060016_629_1486 | 268 |
| 841 | 3300046616 | Ga0495668_0202508 | Ga0495668_0202508_67_909 | 268 |
| 842 | 3300046642 | Ga0495634_0005618 | Ga0495634_0005618_6599_7441 | 268 |
| 843 | 3300046664 | Ga0495659_0078021 | Ga0495659_0078021_19_861 | 268 |
| 844 | 3300046674 | Ga0495588_0230405 | Ga0495588_0230405_50_892 | 268 |
| 845 | 3300046809 | Ga0495600_0023789 | Ga0495600_0023789_3024_3866 | 268 |
| 846 | 3300047317 | Ga0495604_0233382 | Ga0495604_0233382_186_1043 | 268 |
| 847 | 3300047319 | Ga0495674_0032010 | Ga0495674_0032010_2307_3149 | 268 |
| 848 | 3300047321 | Ga0495676_0145830 | Ga0495676_0145830_794_1672 | 268 |
| 849 | 3300047322 | Ga0495680_0041762 | Ga0495680_0041762_788_1645 | 268 |
| 850 | 3300047322 | Ga0495680_0068580 | Ga0495680_0068580_461_1438 | 268 |
| 851 | 3300047471 | Ga0495684_0079506 | Ga0495684_0079506_407_1249 | 268 |
| 852 | 3300047472 | Ga0495686_0135476 | Ga0495686_0135476_85_978 | 268 |
| 853 | 3300048088 | Ga0495602_0007106 | Ga0495602_0007106_9121_9963 | 268 |
| 854 | 3300048903 | Ga0496100_0032236 | Ga0496100_0032236_1073_1915 | 268 |
| 855 | 3300048903 | Ga0496100_0091227 | Ga0496100_0091227_255_1109 | 268 |
| 856 | 3300048904 | Ga0496101_0023361 | Ga0496101_0023361_3093_3947 | 268 |
| 857 | 3300048904 | Ga0496101_0043473 | Ga0496101_0043473_1070_1912 | 268 |
| 858 | 3300048905 | Ga0496102_0010410 | Ga0496102_0010410_4411_5253 | 268 |
| 859 | 3300048905 | Ga0496102_0080745 | Ga0496102_0080745_1173_2015 | 268 |
| 860 | 3300048905 | Ga0496102_0223265 | Ga0496102_0223265_77_940 | 268 |
| 861 | 3300048905 | Ga0496102_0246590 | Ga0496102_0246590_306_1148 | 268 |
| 862 | 3300048907 | Ga0496104_0013029 | Ga0496104_0013029_2502_3350 | 268 |
| 863 | 3300048907 | Ga0496104_0045750 | Ga0496104_0045750_3077_3919 | 268 |
| 864 | 3300048907 | Ga0496104_0099452 | Ga0496104_0099452_123_965 | 268 |
| 865 | 3300048907 | Ga0496104_0129640 | Ga0496104_0129640_1488_2342 | 268 |
| 866 | 3300048907 | Ga0496104_0197340 | Ga0496104_0197340_872_1735 | 268 |
| 867 | 3300048907 | Ga0496104_0503717 | Ga0496104_0503717_146_988 | 268 |
| 868 | 3300048908 | Ga0496105_0048427 | Ga0496105_0048427_1639_2493 | 268 |
| 869 | 3300048908 | Ga0496105_0054223 | Ga0496105_0054223_1611_2453 | 268 |
| 870 | 3300048909 | Ga0496106_0010966 | Ga0496106_0010966_2646_3488 | 268 |
| 871 | 3300048909 | Ga0496106_0030363 | Ga0496106_0030363_1776_2639 | 268 |
| 872 | 3300048909 | Ga0496106_0551911 | Ga0496106_0551911_54_914 | 268 |
| 873 | 3300048910 | Ga0496107_0017835 | Ga0496107_0017835_2718_3560 | 268 |
| 874 | 3300048910 | Ga0496107_0019534 | Ga0496107_0019534_3339_4181 | 268 |
| 875 | 3300048910 | Ga0496107_0050042 | Ga0496107_0050042_702_1544 | 268 |
| 876 | 3300048910 | Ga0496107_0056838 | Ga0496107_0056838_1870_2712 | 268 |
| 877 | 3300048910 | Ga0496107_0158153 | Ga0496107_0158153_403_1257 | 268 |
| 878 | 3300048910 | Ga0496107_0161270 | Ga0496107_0161270_769_1611 | 268 |
| 879 | 3300048911 | Ga0496108_0040364 | Ga0496108_0040364_503_1366 | 268 |
| 880 | 3300048911 | Ga0496108_0101622 | Ga0496108_0101622_353_1201 | 268 |
| 881 | 3300048911 | Ga0496108_0204292 | Ga0496108_0204292_549_1403 | 268 |
| 882 | 3300048911 | Ga0496108_0277717 | Ga0496108_0277717_154_996 | 268 |
| 883 | 3300048912 | Ga0496109_0021552 | Ga0496109_0021552_823_1665 | 268 |
| 884 | 3300048912 | Ga0496109_0025246 | Ga0496109_0025246_334_1188 | 268 |
| 885 | 3300048912 | Ga0496109_0029973 | Ga0496109_0029973_1666_2514 | 268 |
| 886 | 3300048912 | Ga0496109_0244595 | Ga0496109_0244595_497_1339 | 268 |
| 887 | 3300048912 | Ga0496109_0299142 | Ga0496109_0299142_63_905 | 268 |
| 888 | 3300048912 | Ga0496109_0330334 | Ga0496109_0330334_186_1028 | 268 |
| 889 | 3300048913 | Ga0496110_0004167 | Ga0496110_0004167_10220_11083 | 268 |
| 890 | 3300048913 | Ga0496110_0054188 | Ga0496110_0054188_1449_2291 | 268 |
| 891 | 3300048913 | Ga0496110_0275684 | Ga0496110_0275684_678_1520 | 268 |
| 892 | 3300048914 | Ga0496111_0021427 | Ga0496111_0021427_1760_2602 | 268 |
| 893 | 3300048914 | Ga0496111_0032087 | Ga0496111_0032087_2051_2893 | 268 |
| 894 | 3300048914 | Ga0496111_0070832 | Ga0496111_0070832_766_1620 | 268 |
| 895 | 3300048915 | Ga0496112_0064301 | Ga0496112_0064301_871_1713 | 268 |
| 896 | 3300048915 | Ga0496112_0106883 | Ga0496112_0106883_20_862 | 268 |
| 897 | 3300048915 | Ga0496112_0261948 | Ga0496112_0261948_194_1051 | 268 |
| 898 | 3300048915 | Ga0496112_0294047 | Ga0496112_0294047_586_1434 | 268 |
| 899 | 3300048916 | Ga0496113_0055903 | Ga0496113_0055903_241_1083 | 268 |
| 900 | 3300048917 | Ga0496114_0164730 | Ga0496114_0164730_733_1575 | 268 |
| 901 | 3300048918 | Ga0496115_0003906 | Ga0496115_0003906_4822_5664 | 268 |
| 902 | 3300048918 | Ga0496115_0081649 | Ga0496115_0081649_1767_2615 | 268 |
| 903 | 3300048918 | Ga0496115_0154432 | Ga0496115_0154432_632_1486 | 268 |
| 904 | 3300048918 | Ga0496115_0225357 | Ga0496115_0225357_511_1353 | 268 |
| 905 | 3300048920 | Ga0496117_0110468 | Ga0496117_0110468_87_929 | 268 |
| 906 | 3300048921 | Ga0496118_0016521 | Ga0496118_0016521_3351_4193 | 268 |
| 907 | 3300048922 | Ga0496119_0108517 | Ga0496119_0108517_72_914 | 268 |
| 908 | 3300048923 | Ga0496120_0054274 | Ga0496120_0054274_1388_2230 | 268 |
| 909 | 3300048924 | Ga0496121_0000668 | Ga0496121_0000668_62108_62950 | 268 |
| 910 | 3300048924 | Ga0496121_0035985 | Ga0496121_0035985_905_1747 | 268 |
| 911 | 3300048927 | Ga0496124_0003401 | Ga0496124_0003401_15264_16106 | 268 |
| 912 | 3300048928 | Ga0496125_0190072 | Ga0496125_0190072_45_887 | 268 |
| 913 | 3300048929 | Ga0496126_0006242 | Ga0496126_0006242_33_875 | 268 |
| 914 | 3300048929 | Ga0496126_0015566 | Ga0496126_0015566_704_1546 | 268 |
| 915 | 3300049570 | Ga0501033_0028100 | Ga0501033_0028100_978_1823 | 268 |
| 916 | 3300049571 | Ga0501034_0001484 | Ga0501034_0001484_25312_26154 | 268 |
| 917 | 3300049571 | Ga0501034_0004456 | Ga0501034_0004456_14205_15044 | 268 |
| 918 | 3300049574 | Ga0501038_0078548 | Ga0501038_0078548_707_1552 | 268 |
| 919 | 3300049575 | Ga0501039_0080131 | Ga0501039_0080131_14_862 | 268 |
| 920 | 3300049576 | Ga0501040_0019560 | Ga0501040_0019560_1795_2637 | 268 |
| 921 | 3300049577 | Ga0501041_0008967 | Ga0501041_0008967_3336_4181 | 268 |
| 922 | 3300049577 | Ga0501041_0211195 | Ga0501041_0211195_84_926 | 268 |
| 923 | 3300049581 | Ga0501047_0344693 | Ga0501047_0344693_95_940 | 268 |
| 924 | 3300049584 | Ga0501068_0040625 | Ga0501068_0040625_947_1789 | 268 |
| 925 | 3300049586 | Ga0501070_0069511 | Ga0501070_0069511_1499_2338 | 268 |
| 926 | 3300049586 | Ga0501070_0214174 | Ga0501070_0214174_470_1312 | 268 |
| 927 | 3300049588 | Ga0501072_0183106 | Ga0501072_0183106_430_1278 | 268 |
| 928 | 3300049590 | Ga0501074_0047671 | Ga0501074_0047671_69_908 | 268 |
| 929 | 3300049591 | Ga0501075_0012445 | Ga0501075_0012445_506_1348 | 268 |
| 930 | 3300049591 | Ga0501075_0015379 | Ga0501075_0015379_4386_5231 | 268 |
| 931 | 3300049592 | Ga0501076_0011883 | Ga0501076_0011883_1394_2239 | 268 |
| 932 | 3300049593 | Ga0501077_0036140 | Ga0501077_0036140_726_1571 | 268 |
| 933 | 3300049742 | Ga0501080_0007219 | Ga0501080_0007219_6629_7468 | 268 |
| 934 | 3300049743 | Ga0501081_0000770 | Ga0501081_0000770_5651_6496 | 268 |
| 935 | 3300049822 | Ga0501035_0137942 | Ga0501035_0137942_579_1418 | 268 |
| 936 | 3300049822 | Ga0501035_0466629 | Ga0501035_0466629_148_993 | 268 |
| 937 | 3300049823 | Ga0501044_0029952 | Ga0501044_0029952_2076_2918 | 268 |
| 938 | 3300049823 | Ga0501044_0052437 | Ga0501044_0052437_591_1430 | 268 |
| 939 | 3300049823 | Ga0501044_0575339 | Ga0501044_0575339_86_931 | 268 |
| 940 | 3300049824 | Ga0501045_0067122 | Ga0501045_0067122_1153_1995 | 268 |
| 941 | 3300050489 | nmdc:mga03683_23583_c1 | nmdc:mga03683_23583_c1_1171_2010 | 268 |
| 942 | 3300050489 | nmdc:mga03683_58258_c1 | nmdc:mga03683_58258_c1_384_1226 | 268 |
| 943 | 3300050490 | nmdc:mga03n38_120198_c1 | nmdc:mga03n38_120198_c1_141_980 | 268 |
| 944 | 3300050491 | nmdc:mga00v17_279191_c1 | nmdc:mga00v17_279191_c1_199_1041 | 268 |
| 945 | 3300050492 | nmdc:mga0yw44_144645_c1 | nmdc:mga0yw44_144645_c1_645_1487 | 268 |
| 946 | 3300050492 | nmdc:mga0yw44_21824_c1 | nmdc:mga0yw44_21824_c1_1104_1946 | 268 |
| 947 | 3300050495 | nmdc:mga04h51_27778_c1 | nmdc:mga04h51_27778_c1_682_1524 | 268 |
| 948 | 3300050507 | nmdc:mga05p37_293713_c1 | nmdc:mga05p37_293713_c1_808_1650 | 268 |
| 949 | 3300050507 | nmdc:mga05p37_328420_c1 | nmdc:mga05p37_328420_c1_245_1087 | 268 |
| 950 | 3300050507 | nmdc:mga05p37_364116_c1 | nmdc:mga05p37_364116_c1_632_1504 | 268 |
| 951 | 3300050507 | nmdc:mga05p37_73435_c1 | nmdc:mga05p37_73435_c1_3096_3938 | 268 |
| 952 | 3300050507 | nmdc:mga05p37_77_c1 | nmdc:mga05p37_77_c1_54770_55618 | 268 |
| 953 | 3300050507 | nmdc:mga05p37_95699_c1 | nmdc:mga05p37_95699_c1_397_1239 | 268 |
| 954 | 3300050508 | nmdc:mga09592_140_c1 | nmdc:mga09592_140_c1_23402_24250 | 268 |
| 955 | 3300050508 | nmdc:mga09592_17731_c1 | nmdc:mga09592_17731_c1_4904_5746 | 268 |
| 956 | 3300050509 | nmdc:mga0qj67_25259_c1 | nmdc:mga0qj67_25259_c1_3464_4321 | 268 |
| 957 | 3300050509 | nmdc:mga0qj67_4986_c1 | nmdc:mga0qj67_4986_c1_4068_4910 | 268 |
| 958 | 3300050510 | nmdc:mga06r32_34853_c1 | nmdc:mga06r32_34853_c1_1783_2631 | 268 |
| 959 | 3300050510 | nmdc:mga06r32_3616_c1 | nmdc:mga06r32_3616_c1_4625_5467 | 268 |
| 960 | 3300050510 | nmdc:mga06r32_61973_c1 | nmdc:mga06r32_61973_c1_2474_3322 | 268 |
| 961 | 3300050510 | nmdc:mga06r32_62760_c1 | nmdc:mga06r32_62760_c1_1706_2548 | 268 |
| 962 | 3300050510 | nmdc:mga06r32_7599_c1 | nmdc:mga06r32_7599_c1_8663_9520 | 268 |
| 963 | 3300050511 | nmdc:mga08y16_126145_c1 | nmdc:mga08y16_126145_c1_677_1519 | 268 |
| 964 | 3300050511 | nmdc:mga08y16_173809_c1 | nmdc:mga08y16_173809_c1_1191_2033 | 268 |
| 965 | 3300050511 | nmdc:mga08y16_348511_c1 | nmdc:mga08y16_348511_c1_337_1179 | 268 |
| 966 | 3300050511 | nmdc:mga08y16_430888_c1 | nmdc:mga08y16_430888_c1_202_1062 | 268 |
| 967 | 3300050511 | nmdc:mga08y16_5208_c1 | nmdc:mga08y16_5208_c1_9275_10117 | 268 |
| 968 | 3300050512 | nmdc:mga0n895_112146_c1 | nmdc:mga0n895_112146_c1_423_1271 | 268 |
| 969 | 3300050512 | nmdc:mga0n895_336813_c1 | nmdc:mga0n895_336813_c1_213_1055 | 268 |
| 970 | 3300050512 | nmdc:mga0n895_6328_c1 | nmdc:mga0n895_6328_c1_4983_5825 | 268 |
| 971 | 3300050513 | nmdc:mga0rr50_104400_c1 | nmdc:mga0rr50_104400_c1_757_1599 | 268 |
| 972 | 3300050513 | nmdc:mga0rr50_156837_c1 | nmdc:mga0rr50_156837_c1_205_1047 | 268 |
| 973 | 3300050513 | nmdc:mga0rr50_70272_c1 | nmdc:mga0rr50_70272_c1_647_1495 | 268 |
| 974 | 3300050513 | nmdc:mga0rr50_71210_c1 | nmdc:mga0rr50_71210_c1_1426_2268 | 268 |
| 975 | 3300050514 | nmdc:mga08x19_16429_c1 | nmdc:mga08x19_16429_c1_460_1308 | 268 |
| 976 | 3300050515 | nmdc:mga0a205_11223_c1 | nmdc:mga0a205_11223_c1_7083_7925 | 268 |
| 977 | 3300050515 | nmdc:mga0a205_27624_c1 | nmdc:mga0a205_27624_c1_2581_3423 | 268 |
| 978 | 3300050515 | nmdc:mga0a205_285699_c1 | nmdc:mga0a205_285699_c1_307_1149 | 268 |
| 979 | 3300050515 | nmdc:mga0a205_71646_c1 | nmdc:mga0a205_71646_c1_1178_2026 | 268 |
| 980 | 3300050515 | nmdc:mga0a205_99668_c1 | nmdc:mga0a205_99668_c1_660_1532 | 268 |
| 981 | 3300050516 | nmdc:mga0sz30_51761_c1 | nmdc:mga0sz30_51761_c1_15_860 | 268 |
| 982 | 3300053077 | Ga0495601_0009955 | Ga0495601_0009955_1766_2608 | 268 |
| 983 | 3300053077 | Ga0495601_0041808 | Ga0495601_0041808_1433_2410 | 268 |
| 984 | 3300053077 | Ga0495601_0243540 | Ga0495601_0243540_153_995 | 268 |
| 985 | 3300053078 | Ga0495612_0007865 | Ga0495612_0007865_334_1176 | 268 |
| 986 | 3300053084 | Ga0495595_0014758 | Ga0495595_0014758_2059_2901 | 268 |
| 987 | 3300053084 | Ga0495595_0088653 | Ga0495595_0088653_16_993 | 268 |
| 988 | 3300053084 | Ga0495595_0187834 | Ga0495595_0187834_110_952 | 268 |
| 989 | 3300053085 | Ga0495619_0035699 | Ga0495619_0035699_2111_2968 | 268 |
| 990 | 3300053085 | Ga0495619_0083605 | Ga0495619_0083605_935_1777 | 268 |
| 991 | 3300053085 | Ga0495619_0134189 | Ga0495619_0134189_224_1066 | 268 |
| 992 | 3300053094 | Ga0500566_0000131 | Ga0500566_0000131_25117_25959 | 268 |
| 993 | 3300053095 | Ga0500640_104280 | Ga0500640_104280_115_957 | 268 |
| 994 | 3300053111 | Ga0500572_000369 | Ga0500572_000369_4284_5126 | 268 |
| 995 | 3300053111 | Ga0500572_015069 | Ga0500572_015069_339_1181 | 268 |
| 996 | 3300053119 | Ga0500595_000286 | Ga0500595_000286_4911_5750 | 268 |
| 997 | 3300053119 | Ga0500595_004482 | Ga0500595_004482_2382_3260 | 268 |
| 998 | 3300053119 | Ga0500595_010217 | Ga0500595_010217_1340_2182 | 268 |
| 999 | 3300053122 | Ga0500608_092183 | Ga0500608_092183_118_960 | 268 |
| 1000 | 3300053123 | Ga0500614_002288 | Ga0500614_002288_3268_4110 | 268 |
| 1001 | 3300053136 | Ga0500559_0000301 | Ga0500559_0000301_15449_16291 | 268 |
| 1002 | 3300053136 | Ga0500559_0069392 | Ga0500559_0069392_263_1105 | 268 |
| 1003 | 3300053150 | Ga0500603_000193 | Ga0500603_000193_8261_9103 | 268 |
| 1004 | 3300053150 | Ga0500603_009964 | Ga0500603_009964_1023_1862 | 268 |
| 1005 | 3300053159 | Ga0500630_018258 | Ga0500630_018258_221_1063 | 268 |
| 1006 | 3300053162 | Ga0500638_000725 | Ga0500638_000725_2571_3410 | 268 |
| 1007 | 3300053162 | Ga0500638_154855 | Ga0500638_154855_120_998 | 268 |
| 1008 | 3300053163 | Ga0500639_006329 | Ga0500639_006329_1375_2217 | 268 |
| 1009 | 3300053177 | Ga0500636_0057929 | Ga0500636_0057929_654_1496 | 268 |
| 1010 | 3300053178 | Ga0500637_0000135 | Ga0500637_0000135_4793_5632 | 268 |
| 1011 | 3300054114 | Ga0501084_0142736 | Ga0501084_0142736_1129_1980 | 268 |
| 1012 | 3300055283 | Ga0500661_005425 | Ga0500661_005425_1056_1895 | 268 |
| 1013 | 3300059421 | Ga0590071_006828 | Ga0590071_006828_651_1493 | 268 |
| 1014 | 3300060353 | Ga0501082_0169733 | Ga0501082_0169733_10_855 | 268 |
| 1015 | 3300061734 | Ga0530510_0000216 | Ga0530510_0000216_23735_24577 | 268 |
| 1016 | 3300061734 | Ga0530510_0003154 | Ga0530510_0003154_4017_4862 | 268 |
| 1017 | 3300061734 | Ga0530510_0039593 | Ga0530510_0039593_588_1430 | 268 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4do7-assembly2.cif.gz_B | crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 | 0.8023 | 1 | 263 |
| 4i6k-assembly1.cif.gz_A | crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound | 0.8017 | 1 | 264 |
| 4dnm-assembly1.cif.gz_A | crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 | 0.7908 | 1 | 263 |
| 4i6k-assembly1.cif.gz_A | crystal structure of probable 2-pyrone-4,6-dicarboxylic acid hydrolase abaye1769 (target efi-505029) from acinetobacter baumannii with citric acid bound | 0.7908 | 1 | 264 |
| 4do7-assembly2.cif.gz_B | crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 | 0.7858 | 1 | 263 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0W9I9_79_364_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8136 | 2 | 264 | 3.20.20.140 |
| 4do7B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8023 | 1 | 263 | 3.20.20.140 |
| 4i6kA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8017 | 1 | 264 | 3.20.20.140 |
| af_A0A0P0W9I9_79_364_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7967 | 2 | 264 | 3.20.20.140 |
| 4i6kA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.7908 | 1 | 264 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521M1K5-F1-model_v4 | Amidohydrolase | 0.9898 | 2 | 268 |
GO:0016787
|
| AF-A0A4R5QDA7-F1-model_v4 | Amidohydrolase | 0.9867 | 1 | 268 |
GO:0016787
|
| AF-A0A536VTI0-F1-model_v4 | Amidohydrolase | 0.985 | 35 | 268 |
GO:0016787
|
| AF-A0A4R5QDA7-F1-model_v4 | Amidohydrolase | 0.9831 | 1 | 268 |
GO:0016787
|
| AF-A0A521M1K5-F1-model_v4 | Amidohydrolase | 0.9825 | 2 | 268 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar