F488247

General Info

Members Datasets Scaffolds Average Seq Length
1015 401 1015 50

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0346911|Ga0496124_0346911_202_381
Length 59
Sequence MAFNPGKEHHMHISQLALTPLISLIAGVLILVMPRLLNYIVALYLIVVGLLGLFPQLAG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
100 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
101 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
137 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
139 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
141 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
142 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
212 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
213 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
214 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
220 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
221 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
223 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
224 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
229 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
230 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
231 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
232 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
233 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
234 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
235 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
236 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
237 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
238 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
239 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
240 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
241 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
242 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
243 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
250 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
251 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
252 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
253 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
254 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
255 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
256 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
257 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
258 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
259 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
260 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
261 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
262 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
263 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
264 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
265 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
266 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
267 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
274 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
277 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
278 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
279 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
280 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
281 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
284 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
285 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
286 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
287 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
288 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
289 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
292 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
295 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
296 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
304 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
305 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
306 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
307 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
308 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
309 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
310 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
311 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
312 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
323 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
324 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
325 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
326 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
327 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
328 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
331 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
332 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
335 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
336 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
337 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
356 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
359 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
360 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
361 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
362 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
363 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
364 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
365 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
368 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
369 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
370 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
371 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
372 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
373 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
374 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
375 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
376 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
377 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
378 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
379 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
380 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
381 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
382 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
383 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
384 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
385 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
386 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
387 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
388 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
389 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
390 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
391 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
392 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
393 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
394 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
395 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
396 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
397 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.5
Nodule 0.39
Rhizoplane 3.74
Rhizosphere 73.69
Stem 0
Stem Tuber 0
Unclassified 8.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013514 3300001979 Bacteria 3041
2 JGI24740J21852_10047535 3300001979 Bacteria 1252
3 JGI24739J22299_10002039 3300001989 Bacteria 7740
4 JGI24735J21928_10002948 3300002067 Bacteria 5851
5 JGI24735J21928_10040493 3300002067 Bacteria 1360
6 JGI25155J39150_1000285 3300002704 Bacteria 17934
7 JGI25156J39149_1000168 3300002705 Bacteria 47907
8 JGI25156J39149_1004985 3300002705 Bacteria 3921
9 JGI25156J39149_1014953 3300002705 Bacteria 1575
10 JGI25162J39368_1003783 3300002737 Bacteria 4036
11 JGI25154J39366_1000185 3300002738 Bacteria 47907
12 JGI25154J39366_1000245 3300002738 Bacteria 35470
13 JGI25157J39369_1000429 3300002741 Bacteria 27371
14 JGI25157J39369_1001872 3300002741 Bacteria 6455
15 JGI25165J46597_1000147 3300003214 Bacteria 116564
16 rootH1_10060681 3300003316 Bacteria 1897
17 JGI25160J50197_1042927 3300003354 Bacteria 1024
18 Ga0055532_1000050 3300003758 Bacteria 169240
19 Ga0055535_1008146 3300003761 Bacteria 1918
20 Ga0055529_1009834 3300003763 Bacteria 1248
21 Ga0055528_1052701 3300003790 Bacteria 811
22 Ga0055530_10008439 3300003791 Bacteria 4126
23 Ga0065165_1009352 3300005262 Bacteria 4407
24 Ga0065165_1103783 3300005262 Bacteria 708
25 Ga0065704_10223530 3300005289 Bacteria 1053
26 Ga0065704_10292439 3300005289 Bacteria 901
27 Ga0065707_10300891 3300005295 Bacteria 989
28 Ga0070658_10314433 3300005327 Bacteria 1337
29 Ga0070658_11172460 3300005327 Unclassified 668
30 Ga0070658_11255454 3300005327 Bacteria 644
31 Ga0070658_11335603 3300005327 Bacteria 622
32 Ga0070676_10504095 3300005328 Bacteria 860
33 Ga0070676_10544954 3300005328 Bacteria 830
34 Ga0070676_11449390 3300005328 Bacteria 528
35 Ga0070683_100517115 3300005329 Bacteria 1141
36 Ga0070683_100823835 3300005329 Bacteria 890
37 Ga0070690_100767971 3300005330 Bacteria 745
38 Ga0070690_101565610 3300005330 Bacteria 534
39 Ga0070670_100066337 3300005331 Bacteria 3097
40 Ga0070670_100371230 3300005331 Bacteria 1259
41 Ga0068869_100230828 3300005334 Bacteria 1470
42 Ga0068869_100373316 3300005334 Bacteria 1167
43 Ga0070666_10004869 3300005335 Bacteria 8206
44 Ga0070666_10250629 3300005335 Bacteria 1254
45 Ga0070682_100894205 3300005337 Bacteria 729
46 Ga0068868_100363275 3300005338 Bacteria 1242
47 Ga0068868_100399695 3300005338 Bacteria 1186
48 Ga0070660_100179601 3300005339 Bacteria 1712
49 Ga0070660_100920092 3300005339 Bacteria 738
50 Ga0070660_101873411 3300005339 Unclassified 511
51 Ga0070689_101003968 3300005340 Bacteria 742
52 Ga0070691_10077465 3300005341 Bacteria 1623
53 Ga0070691_10363956 3300005341 Bacteria 806
54 Ga0070691_10446418 3300005341 Bacteria 738
55 Ga0070691_11014139 3300005341 Bacteria 519
56 Ga0070687_100047222 3300005343 Bacteria 2208
57 Ga0070661_100046521 3300005344 Bacteria 3174
58 Ga0070661_100886922 3300005344 Bacteria 736
59 Ga0070661_101079581 3300005344 Bacteria 668
60 Ga0070692_10904175 3300005345 Bacteria 610
61 Ga0070668_100219865 3300005347 Bacteria 1566
62 Ga0070668_100294462 3300005347 Bacteria 1359
63 Ga0070668_100382004 3300005347 Bacteria 1199
64 Ga0070668_100908346 3300005347 Bacteria 787
65 Ga0070669_100262145 3300005353 Bacteria 1379
66 Ga0070669_100753245 3300005353 Bacteria 825
67 Ga0070669_100850399 3300005353 Bacteria 777
68 Ga0070669_101702996 3300005353 Bacteria 549
69 Ga0070675_100049484 3300005354 Bacteria 3450
70 Ga0070675_100269594 3300005354 Bacteria 1493
71 Ga0070675_100942679 3300005354 Bacteria 792
72 Ga0070675_101080373 3300005354 Bacteria 737
73 Ga0070671_100442975 3300005355 Bacteria 1114
74 Ga0070674_100287186 3300005356 Bacteria 1306
75 Ga0070674_100412160 3300005356 Bacteria 1107
76 Ga0070674_102115227 3300005356 Bacteria 513
77 Ga0070673_100421894 3300005364 Bacteria 1196
78 Ga0070673_100947910 3300005364 Bacteria 800
79 Ga0070688_100070462 3300005365 Bacteria 2235
80 Ga0070659_100349804 3300005366 Bacteria 1239
81 Ga0070659_100376180 3300005366 Bacteria 1196
82 Ga0070659_101440702 3300005366 Bacteria 613
83 Ga0070659_101461581 3300005366 Bacteria 608
84 Ga0070667_100014791 3300005367 Bacteria 6447
85 Ga0070667_100037624 3300005367 Bacteria 4057
86 Ga0070667_100220162 3300005367 Bacteria 1689
87 Ga0070667_100414315 3300005367 Bacteria 1228
88 Ga0070667_100516892 3300005367 Bacteria 1095
89 Ga0070667_101498056 3300005367 Bacteria 633
90 Ga0070714_100020874 3300005435 Bacteria 5354
91 Ga0070714_100161864 3300005435 Bacteria 2025
92 Ga0070714_100221090 3300005435 Bacteria 1740
93 Ga0070714_101733893 3300005435 Bacteria 610
94 Ga0070713_100021206 3300005436 Bacteria 4993
95 Ga0070711_100462835 3300005439 Bacteria 1040
96 Ga0070700_100054334 3300005441 Bacteria 2502
97 Ga0070700_101345854 3300005441 Bacteria 602
98 Ga0070694_100038566 3300005444 Bacteria 3175
99 Ga0070694_100531411 3300005444 Bacteria 939
100 Ga0070663_100023376 3300005455 Bacteria 4142
101 Ga0070663_100031241 3300005455 Bacteria 3659
102 Ga0070663_100158000 3300005455 Bacteria 1743
103 Ga0070663_100244805 3300005455 Bacteria 1417
104 Ga0070663_100256293 3300005455 Bacteria 1386
105 Ga0070663_100287791 3300005455 Bacteria 1311
106 Ga0070663_100289085 3300005455 Bacteria 1309
107 Ga0070663_100711292 3300005455 Bacteria 855
108 Ga0070663_100725075 3300005455 Bacteria 847
109 Ga0070663_101417682 3300005455 Bacteria 616
110 Ga0070663_101836544 3300005455 Bacteria 544
111 Ga0070663_101863546 3300005455 Bacteria 540
112 Ga0070678_100186469 3300005456 Bacteria 1702
113 Ga0070678_100204119 3300005456 Bacteria 1633
114 Ga0070678_100884653 3300005456 Bacteria 816
115 Ga0070678_100898688 3300005456 Bacteria 809
116 Ga0070678_100943929 3300005456 Bacteria 790
117 Ga0070678_101255587 3300005456 Bacteria 688
118 Ga0070662_100005114 3300005457 Bacteria 8361
119 Ga0070681_11087527 3300005458 Bacteria 720
120 Ga0070706_100018724 3300005467 Bacteria 6384
121 Ga0070706_100623902 3300005467 Bacteria 1001
122 Ga0070698_100054973 3300005471 Bacteria 4040
123 Ga0070698_100067072 3300005471 Unclassified 3610
124 Ga0070698_101296037 3300005471 Bacteria 678
125 Ga0070699_100585868 3300005518 Bacteria 1017
126 Ga0070684_100524449 3300005535 Bacteria 1098
127 Ga0070697_101840214 3300005536 Bacteria 542
128 Ga0068853_100029492 3300005539 Bacteria 4626
129 Ga0068853_100319291 3300005539 Bacteria 1439
130 Ga0068853_100341109 3300005539 Bacteria 1392
131 Ga0068853_100381560 3300005539 Bacteria 1316
132 Ga0068853_100703249 3300005539 Bacteria 964
133 Ga0068853_100727705 3300005539 Bacteria 947
134 Ga0068853_100951970 3300005539 Bacteria 826
135 Ga0068853_101209781 3300005539 Bacteria 729
136 Ga0068853_101680477 3300005539 Bacteria 615
137 Ga0068853_102366403 3300005539 Bacteria 514
138 Ga0070672_101702862 3300005543 Bacteria 566
139 Ga0070695_100085770 3300005545 Bacteria 2091
140 Ga0070695_100351489 3300005545 Bacteria 1104
141 Ga0070695_101777788 3300005545 Bacteria 517
142 Ga0070693_100499626 3300005547 Bacteria 862
143 Ga0070665_100000778 3300005548 Bacteria 41953
144 Ga0070665_100001771 3300005548 Bacteria 24595
145 Ga0070665_100021841 3300005548 Bacteria 6436
146 Ga0070665_100050498 3300005548 Bacteria 4173
147 Ga0070665_100171044 3300005548 Bacteria 2174
148 Ga0070665_100190059 3300005548 Bacteria 2054
149 Ga0070665_100227245 3300005548 Bacteria 1866
150 Ga0070665_100439706 3300005548 Bacteria 1313
151 Ga0070665_102113295 3300005548 Bacteria 568
152 Ga0068855_100018720 3300005563 Bacteria 8326
153 Ga0068855_100387978 3300005563 Bacteria 1532
154 Ga0068855_100697493 3300005563 Bacteria 1087
155 Ga0068855_101283159 3300005563 Bacteria 759
156 Ga0068855_101426752 3300005563 Bacteria 713
157 Ga0070664_100140986 3300005564 Bacteria 2122
158 Ga0070664_100229728 3300005564 Bacteria 1663
159 Ga0070664_101117259 3300005564 Bacteria 743
160 Ga0070664_101754108 3300005564 Bacteria 589
161 Ga0068854_100156413 3300005578 Bacteria 1762
162 Ga0068854_101058707 3300005578 Bacteria 721
163 Ga0068854_101536123 3300005578 Bacteria 605
164 Ga0068856_100028271 3300005614 Bacteria 5475
165 Ga0068856_100138824 3300005614 Bacteria 2437
166 Ga0068856_100385836 3300005614 Bacteria 1420
167 Ga0068856_100408509 3300005614 Bacteria 1377
168 Ga0068856_100504705 3300005614 Bacteria 1231
169 Ga0068856_100790700 3300005614 Bacteria 968
170 Ga0068856_101154138 3300005614 Bacteria 791
171 Ga0068852_100143206 3300005616 Bacteria 2214
172 Ga0068852_100289998 3300005616 Bacteria 1580
173 Ga0068852_100746806 3300005616 Bacteria 990
174 Ga0068852_100756000 3300005616 Bacteria 984
175 Ga0068852_101033037 3300005616 Bacteria 841
176 Ga0068852_101274626 3300005616 Bacteria 756
177 Ga0068859_100069591 3300005617 Bacteria 3554
178 Ga0068859_100069885 3300005617 Bacteria 3547
179 Ga0068859_101799198 3300005617 Bacteria 677
180 Ga0068864_100528729 3300005618 Bacteria 1138
181 Ga0068864_101001603 3300005618 Bacteria 829
182 Ga0068864_102445082 3300005618 Bacteria 529
183 Ga0068861_100159665 3300005719 Bacteria 1858
184 Ga0068861_100759481 3300005719 Bacteria 906
185 Ga0068861_101082105 3300005719 Bacteria 770
186 Ga0068861_102694114 3300005719 Bacteria 501
187 Ga0068851_10011579 3300005834 Bacteria 4139
188 Ga0068851_10256520 3300005834 Bacteria 993
189 Ga0068851_10761710 3300005834 Bacteria 599
190 Ga0068851_10951395 3300005834 Bacteria 540
191 Ga0068870_10463712 3300005840 Bacteria 837
192 Ga0068863_100008576 3300005841 Bacteria 9990
193 Ga0068863_100316694 3300005841 Bacteria 1515
194 Ga0068863_101348929 3300005841 Bacteria 720
195 Ga0068863_102199813 3300005841 Bacteria 561
196 Ga0068858_100002518 3300005842 Bacteria 18454
197 Ga0068858_100008681 3300005842 Bacteria 9755
198 Ga0068858_102506059 3300005842 Bacteria 509
199 Ga0068860_100064420 3300005843 Bacteria 3481
200 Ga0068860_100228673 3300005843 Bacteria 1807
201 Ga0068860_100393836 3300005843 Bacteria 1369
202 Ga0068860_101024800 3300005843 Bacteria 844
203 Ga0068860_102276117 3300005843 Bacteria 562
204 Ga0068860_102769293 3300005843 Bacteria 508
205 Ga0068862_100005681 3300005844 Bacteria 10409
206 Ga0068862_100359643 3300005844 Bacteria 1352
207 Ga0068862_100373904 3300005844 Bacteria 1327
208 Ga0068862_100737249 3300005844 Bacteria 957
209 Ga0068862_101011478 3300005844 Bacteria 822
210 Ga0081538_10056531 3300005981 Bacteria 2297
211 Ga0070717_10356939 3300006028 Bacteria 1308
212 Ga0070717_10579511 3300006028 Bacteria 1017
213 Ga0075365_10008054 3300006038 Bacteria 5951
214 Ga0075365_10019410 3300006038 Bacteria 4195
215 Ga0075365_10042042 3300006038 Bacteria 2987
216 Ga0075365_10050844 3300006038 Bacteria 2735
217 Ga0075365_10136515 3300006038 Bacteria 1700
218 Ga0075365_10219305 3300006038 Bacteria 1334
219 Ga0075365_10366096 3300006038 Bacteria 1016
220 Ga0075368_10010145 3300006042 Bacteria 3403
221 Ga0075368_10059835 3300006042 Bacteria 1524
222 Ga0075368_10084686 3300006042 Bacteria 1292
223 Ga0075368_10357698 3300006042 Bacteria 636
224 Ga0075363_100016696 3300006048 Bacteria 3630
225 Ga0075363_100048225 3300006048 Bacteria 2264
226 Ga0075363_100109067 3300006048 Bacteria 1537
227 Ga0075363_100164697 3300006048 Bacteria 1257
228 Ga0075363_100255157 3300006048 Bacteria 1010
229 Ga0075363_100767230 3300006048 Bacteria 585
230 Ga0075364_10013967 3300006051 Bacteria 4949
231 Ga0075364_10081007 3300006051 Bacteria 2146
232 Ga0075364_10144673 3300006051 Bacteria 1600
233 Ga0075364_10686839 3300006051 Bacteria 699
234 Ga0070716_100262904 3300006173 Bacteria 1182
235 Ga0070712_100489010 3300006175 Bacteria 1030
236 Ga0075362_10034290 3300006177 Bacteria 2212
237 Ga0075362_10043133 3300006177 Bacteria 1996
238 Ga0075362_10047661 3300006177 Bacteria 1909
239 Ga0075362_10081871 3300006177 Bacteria 1489
240 Ga0075362_10094100 3300006177 Bacteria 1394
241 Ga0075362_10210340 3300006177 Bacteria 949
242 Ga0075367_10010494 3300006178 Bacteria 4868
243 Ga0075367_10030565 3300006178 Bacteria 3088
244 Ga0075367_10059422 3300006178 Bacteria 2276
245 Ga0075367_10080622 3300006178 Bacteria 1968
246 Ga0075367_10132711 3300006178 Bacteria 1540
247 Ga0075367_10326650 3300006178 Bacteria 967
248 Ga0075367_10432529 3300006178 Bacteria 833
249 Ga0075367_10519804 3300006178 Bacteria 755
250 Ga0075367_10751006 3300006178 Bacteria 621
251 Ga0075369_10014365 3300006186 Bacteria 3162
252 Ga0075369_10015191 3300006186 Bacteria 3087
253 Ga0075369_10207810 3300006186 Bacteria 904
254 Ga0075366_10043033 3300006195 Bacteria 2675
255 Ga0075366_10131825 3300006195 Bacteria 1508
256 Ga0075366_10883572 3300006195 Bacteria 557
257 Ga0097621_100263485 3300006237 Bacteria 1513
258 Ga0097621_101110566 3300006237 Bacteria 743
259 Ga0097621_101845026 3300006237 Bacteria 577
260 Ga0097621_101872621 3300006237 Bacteria 572
261 Ga0075370_10007676 3300006353 Bacteria 5508
262 Ga0075370_10082152 3300006353 Bacteria 1852
263 Ga0075370_10200649 3300006353 Bacteria 1177
264 Ga0075370_10384002 3300006353 Bacteria 841
265 Ga0068871_100640227 3300006358 Bacteria 970
266 Ga0068871_101116781 3300006358 Bacteria 737
267 Ga0068871_102006879 3300006358 Bacteria 551
268 Ga0075428_100044800 3300006844 Bacteria 4861
269 Ga0075428_100066058 3300006844 Bacteria 3961
270 Ga0075428_101572210 3300006844 Bacteria 688
271 Ga0075430_100921741 3300006846 Bacteria 720
272 Ga0075430_101408962 3300006846 Bacteria 573
273 Ga0075431_100149210 3300006847 Bacteria 2408
274 Ga0075431_100204554 3300006847 Bacteria 2019
275 Ga0075433_10845724 3300006852 Bacteria 799
276 Ga0075429_100001760 3300006880 Bacteria 17924
277 Ga0075429_100568100 3300006880 Bacteria 994
278 Ga0068865_100505232 3300006881 Bacteria 1008
279 Ga0068865_100756977 3300006881 Bacteria 835
280 Ga0068865_101013723 3300006881 Bacteria 727
281 Ga0068865_101100683 3300006881 Bacteria 700
282 Ga0097620_100069591 3300006931 Bacteria 3554
283 Ga0097620_100069885 3300006931 Bacteria 3547
284 Ga0097620_101799161 3300006931 Bacteria 677
285 Ga0079104_1000056 3300006946 Bacteria 166276
286 Ga0099826_10157999 3300006948 Bacteria 1288
287 Ga0105251_10001596 3300009011 Bacteria 19332
288 Ga0105244_10269823 3300009036 Bacteria 790
289 Ga0105250_10112457 3300009092 Bacteria 1116
290 Ga0105250_10212425 3300009092 Bacteria 818
291 Ga0105250_10283495 3300009092 Bacteria 713
292 Ga0105240_10008179 3300009093 Bacteria 14996
293 Ga0105240_10059150 3300009093 Bacteria 4784
294 Ga0105240_10061454 3300009093 Bacteria 4681
295 Ga0105240_10127106 3300009093 Bacteria 3062
296 Ga0105240_10519837 3300009093 Bacteria 1321
297 Ga0105240_10757023 3300009093 Bacteria 1055
298 Ga0105240_10762312 3300009093 Bacteria 1051
299 Ga0105240_11107972 3300009093 Bacteria 842
300 Ga0105240_11111977 3300009093 Bacteria 840
301 Ga0105240_11497022 3300009093 Bacteria 708
302 Ga0105240_11904074 3300009093 Bacteria 619
303 Ga0105240_11967403 3300009093 Bacteria 608
304 Ga0105240_12300583 3300009093 Bacteria 558
305 Ga0105240_12371562 3300009093 Unclassified 549
306 Ga0111539_10619587 3300009094 Bacteria 1260
307 Ga0111539_10739501 3300009094 Bacteria 1145
308 Ga0105245_10440947 3300009098 Bacteria 1309
309 Ga0105245_10707052 3300009098 Bacteria 1041
310 Ga0105245_12451026 3300009098 Bacteria 575
311 Ga0105247_10083289 3300009101 Bacteria 2020
312 Ga0105247_10448093 3300009101 Bacteria 930
313 Ga0105247_10942533 3300009101 Bacteria 670
314 Ga0105247_11002055 3300009101 Bacteria 652
315 Ga0105247_11750672 3300009101 Bacteria 515
316 Ga0114129_10005806 3300009147 Bacteria 17476
317 Ga0114129_10451997 3300009147 Bacteria 1685
318 Ga0105243_10301244 3300009148 Bacteria 1453
319 Ga0105243_11420752 3300009148 Bacteria 715
320 Ga0105243_11691615 3300009148 Bacteria 661
321 Ga0105243_12610887 3300009148 Bacteria 545
322 Ga0105241_10081072 3300009174 Bacteria 2541
323 Ga0105241_10253459 3300009174 Bacteria 1493
324 Ga0105241_11211629 3300009174 Unclassified 715
325 Ga0105241_11354902 3300009174 Bacteria 680
326 Ga0105241_11461227 3300009174 Bacteria 656
327 Ga0105241_12008479 3300009174 Bacteria 569
328 Ga0105241_12483104 3300009174 Bacteria 519
329 Ga0105242_10086392 3300009176 Bacteria 2632
330 Ga0105248_10074394 3300009177 Bacteria 3818
331 Ga0105248_10173347 3300009177 Bacteria 2431
332 Ga0105248_10703108 3300009177 Bacteria 1140
333 Ga0105248_12077331 3300009177 Bacteria 646
334 Ga0105237_10009094 3300009545 Bacteria 10676
335 Ga0105237_10138333 3300009545 Bacteria 2430
336 Ga0105237_10381952 3300009545 Bacteria 1413
337 Ga0105237_10473466 3300009545 Bacteria 1258
338 Ga0105237_10799817 3300009545 Bacteria 950
339 Ga0105237_10947979 3300009545 Bacteria 867
340 Ga0105237_11106922 3300009545 Bacteria 799
341 Ga0105237_11295390 3300009545 Bacteria 735
342 Ga0105237_11980845 3300009545 Bacteria 591
343 Ga0105238_10003517 3300009551 Bacteria 15606
344 Ga0105238_10052215 3300009551 Bacteria 4110
345 Ga0105238_10122725 3300009551 Bacteria 2577
346 Ga0105238_10191520 3300009551 Bacteria 2021
347 Ga0105238_10254791 3300009551 Bacteria 1734
348 Ga0105238_10282932 3300009551 Bacteria 1640
349 Ga0105238_10291740 3300009551 Bacteria 1613
350 Ga0105238_12250467 3300009551 Unclassified 580
351 Ga0105238_12982749 3300009551 Bacteria 509
352 Ga0105249_10092339 3300009553 Bacteria 2834
353 Ga0105249_10098527 3300009553 Bacteria 2746
354 Ga0105249_10391235 3300009553 Bacteria 1418
355 Ga0105249_11867444 3300009553 Bacteria 673
356 Ga0105249_13359691 3300009553 Bacteria 515
357 Ga0105239_10099609 3300010375 Bacteria 3213
358 Ga0105239_10118616 3300010375 Bacteria 2936
359 Ga0105239_10158197 3300010375 Bacteria 2531
360 Ga0105239_10164361 3300010375 Bacteria 2481
361 Ga0105239_10171834 3300010375 Bacteria 2424
362 Ga0105239_10181533 3300010375 Bacteria 2355
363 Ga0105239_10209027 3300010375 Bacteria 2187
364 Ga0105239_10267037 3300010375 Bacteria 1924
365 Ga0105239_10335177 3300010375 Bacteria 1707
366 Ga0105239_10436143 3300010375 Bacteria 1485
367 Ga0105239_10540272 3300010375 Bacteria 1327
368 Ga0105239_10729445 3300010375 Bacteria 1134
369 Ga0105239_10759015 3300010375 Bacteria 1110
370 Ga0105239_11388705 3300010375 Bacteria 811
371 Ga0105239_11599131 3300010375 Bacteria 754
372 Ga0105239_11626254 3300010375 Bacteria 747
373 Ga0105239_13094065 3300010375 Bacteria 542
374 Ga0105246_10217503 3300011119 Bacteria 1495
375 Ga0105246_10529946 3300011119 Bacteria 1006
376 Ga0105246_11262369 3300011119 Bacteria 683
377 Ga0105246_11439485 3300011119 Bacteria 644
378 Ga0157338_1036967 3300012515 Bacteria 649
379 Ga0157373_10093661 3300013100 Bacteria 2116
380 Ga0157371_11198026 3300013102 Bacteria 585
381 Ga0157370_10180720 3300013104 Bacteria 1960
382 Ga0157370_10220044 3300013104 Bacteria 1759
383 Ga0157369_10171634 3300013105 Bacteria 2285
384 Ga0157369_10497695 3300013105 Bacteria 1261
385 Ga0157369_10783890 3300013105 Bacteria 980
386 Ga0157369_10791152 3300013105 Bacteria 975
387 Ga0157369_10967080 3300013105 Bacteria 872
388 Ga0157374_10051579 3300013296 Bacteria 3829
389 Ga0157374_10076369 3300013296 Bacteria 3168
390 Ga0157374_10193082 3300013296 Bacteria 1992
391 Ga0157374_10279860 3300013296 Bacteria 1647
392 Ga0157378_10146986 3300013297 Bacteria 2193
393 Ga0157378_11134251 3300013297 Bacteria 820
394 Ga0157378_11250949 3300013297 Bacteria 782
395 Ga0163162_10001141 3300013306 Bacteria 24740
396 Ga0163162_10139381 3300013306 Bacteria 2537
397 Ga0163162_10218040 3300013306 Bacteria 2038
398 Ga0163162_10686908 3300013306 Bacteria 1146
399 Ga0163162_10711412 3300013306 Bacteria 1126
400 Ga0163162_11585151 3300013306 Bacteria 747
401 Ga0157372_10494947 3300013307 Bacteria 1425
402 Ga0157372_12018395 3300013307 Bacteria 663
403 Ga0157372_12240842 3300013307 Bacteria 627
404 Ga0157375_10764093 3300013308 Bacteria 1117
405 Ga0157375_11849920 3300013308 Bacteria 716
406 Ga0157375_12814828 3300013308 Bacteria 581
407 Ga0163163_10151077 3300014325 Bacteria 2366
408 Ga0163163_10942931 3300014325 Bacteria 926
409 Ga0163163_11149683 3300014325 Bacteria 839
410 Ga0157380_10441108 3300014326 Bacteria 1248
411 Ga0157380_10977078 3300014326 Bacteria 878
412 Ga0157380_12210898 3300014326 Bacteria 614
413 Ga0182008_10006567 3300014497 Bacteria 6492
414 Ga0182008_10249686 3300014497 Bacteria 915
415 Ga0157377_10648699 3300014745 Bacteria 759
416 Ga0157377_11732632 3300014745 Bacteria 505
417 Ga0157379_10362897 3300014968 Bacteria 1328
418 Ga0157379_10513640 3300014968 Bacteria 1111
419 Ga0157379_10617552 3300014968 Bacteria 1013
420 Ga0157379_12208812 3300014968 Bacteria 547
421 Ga0157376_10080368 3300014969 Bacteria 2796
422 Ga0157376_10852888 3300014969 Bacteria 926
423 Ga0157376_10877451 3300014969 Bacteria 914
424 Ga0157376_10975918 3300014969 Bacteria 869
425 Ga0157376_11410968 3300014969 Bacteria 728
426 Ga0157376_12423676 3300014969 Unclassified 564
427 Ga0182006_1061542 3300015261 Bacteria 1415
428 Ga0182006_1178185 3300015261 Bacteria 710
429 Ga0163161_10109379 3300017792 Bacteria 2065
430 Ga0163161_10110584 3300017792 Bacteria 2054
431 Ga0163161_10580314 3300017792 Bacteria 922
432 Ga0209435_100029 3300025206 Bacteria 176358
433 Ga0209435_100195 3300025206 Bacteria 17815
434 Ga0209435_110508 3300025206 Bacteria 1002
435 Ga0209147_100004 3300025229 Bacteria 1371850
436 Ga0209437_100053 3300025233 Bacteria 375580
437 Ga0209258_100396 3300025242 Bacteria 54877
438 Ga0209646_1000073 3300025246 Bacteria 224301
439 Ga0209646_1000109 3300025246 Bacteria 158348
440 Ga0209646_1037415 3300025246 Bacteria 625
441 Ga0209026_1000050 3300025250 Bacteria 254994
442 Ga0209026_1000124 3300025250 Bacteria 125673
443 Ga0209026_1003015 3300025250 Bacteria 5811
444 Ga0209026_1035417 3300025250 Bacteria 732
445 Ga0209026_1062093 3300025250 Bacteria 524
446 Ga0209148_1000032 3300025254 Bacteria 557660
447 Ga0209759_1000108 3300025256 Bacteria 146393
448 Ga0209759_1000706 3300025256 Bacteria 29792
449 Ga0209759_1000891 3300025256 Bacteria 22544
450 Ga0209759_1051238 3300025256 Bacteria 634
451 Ga0209233_1000034 3300025261 Bacteria 578898
452 Ga0209233_1012371 3300025261 Bacteria 2477
453 Ga0209233_1060313 3300025261 Bacteria 734
454 Ga0209455_1014667 3300025272 Bacteria 1762
455 Ga0209673_1001490 3300025273 Bacteria 21797
456 Ga0209673_1080125 3300025273 Bacteria 751
457 Ga0209675_1045396 3300025291 Bacteria 935
458 Ga0209758_1008143 3300025297 Bacteria 6890
459 Ga0209050_1000202 3300025298 Bacteria 133468
460 Ga0209050_1006802 3300025298 Bacteria 6657
461 Ga0209256_1000049 3300025299 Bacteria 310696
462 Ga0207426_1002546 3300025302 Bacteria 11425
463 Ga0209051_1011287 3300025303 Bacteria 4425
464 Ga0207697_10416142 3300025315 Bacteria 597
465 Ga0207656_10112723 3300025321 Bacteria 1258
466 Ga0207656_10235560 3300025321 Bacteria 893
467 Ga0207656_10397757 3300025321 Bacteria 692
468 Ga0207656_10427162 3300025321 Bacteria 668
469 Ga0207696_1100059 3300025711 Bacteria 790
470 Ga0207655_1231614 3300025728 Bacteria 533
471 Ga0207713_1003598 3300025735 Bacteria 10451
472 Ga0207642_10252153 3300025899 Bacteria 1002
473 Ga0207710_10088493 3300025900 Bacteria 1446
474 Ga0207710_10144651 3300025900 Bacteria 1150
475 Ga0207710_10333561 3300025900 Bacteria 770
476 Ga0207688_10350052 3300025901 Bacteria 910
477 Ga0207688_10983844 3300025901 Bacteria 533
478 Ga0207680_10147902 3300025903 Bacteria 1564
479 Ga0207680_10404237 3300025903 Bacteria 965
480 Ga0207647_10002871 3300025904 Bacteria 12977
481 Ga0207647_10140070 3300025904 Bacteria 1418
482 Ga0207647_10157711 3300025904 Bacteria 1325
483 Ga0207647_10167001 3300025904 Bacteria 1282
484 Ga0207647_10290538 3300025904 Bacteria 932
485 Ga0207647_10343297 3300025904 Bacteria 846
486 Ga0207647_10423436 3300025904 Bacteria 748
487 Ga0207645_10514842 3300025907 Bacteria 811
488 Ga0207643_10042620 3300025908 Bacteria 2559
489 Ga0207705_10074750 3300025909 Bacteria 2460
490 Ga0207684_10021192 3300025910 Bacteria 5550
491 Ga0207684_10235133 3300025910 Bacteria 1581
492 Ga0207654_10000942 3300025911 Bacteria 15994
493 Ga0207654_10035690 3300025911 Bacteria 2772
494 Ga0207654_10050624 3300025911 Bacteria 2388
495 Ga0207654_10097988 3300025911 Bacteria 1801
496 Ga0207654_10464192 3300025911 Bacteria 890
497 Ga0207695_10004636 3300025913 Bacteria 18634
498 Ga0207695_10044260 3300025913 Bacteria 4735
499 Ga0207695_10063100 3300025913 Bacteria 3820
500 Ga0207695_10068811 3300025913 Bacteria 3626
501 Ga0207695_10241541 3300025913 Bacteria 1707
502 Ga0207695_10426029 3300025913 Bacteria 1211
503 Ga0207695_10616805 3300025913 Bacteria 966
504 Ga0207695_10854637 3300025913 Bacteria 790
505 Ga0207695_11040740 3300025913 Unclassified 698
506 Ga0207671_10052890 3300025914 Bacteria 3010
507 Ga0207671_10180471 3300025914 Bacteria 1643
508 Ga0207671_10835395 3300025914 Bacteria 730
509 Ga0207671_10858431 3300025914 Bacteria 719
510 Ga0207671_11052088 3300025914 Bacteria 640
511 Ga0207693_10156578 3300025915 Bacteria 1792
512 Ga0207662_10475311 3300025918 Bacteria 858
513 Ga0207657_10121959 3300025919 Bacteria 2144
514 Ga0207649_10827859 3300025920 Bacteria 723
515 Ga0207649_11109882 3300025920 Bacteria 624
516 Ga0207681_10221538 3300025923 Bacteria 1464
517 Ga0207681_10779388 3300025923 Bacteria 798
518 Ga0207681_10986082 3300025923 Bacteria 707
519 Ga0207694_10114041 3300025924 Bacteria 2152
520 Ga0207694_10175086 3300025924 Bacteria 1739
521 Ga0207694_10563001 3300025924 Bacteria 957
522 Ga0207694_10904764 3300025924 Bacteria 746
523 Ga0207694_10949165 3300025924 Bacteria 727
524 Ga0207650_10049617 3300025925 Bacteria 3100
525 Ga0207650_10529854 3300025925 Bacteria 986
526 Ga0207650_10624944 3300025925 Bacteria 907
527 Ga0207659_10035830 3300025926 Bacteria 3433
528 Ga0207659_11225866 3300025926 Bacteria 645
529 Ga0207659_11571856 3300025926 Bacteria 562
530 Ga0207687_11165520 3300025927 Bacteria 662
531 Ga0207687_11653120 3300025927 Bacteria 549
532 Ga0207664_10129489 3300025929 Bacteria 2123
533 Ga0207644_11793311 3300025931 Bacteria 513
534 Ga0207690_10685398 3300025932 Bacteria 842
535 Ga0207690_10756531 3300025932 Bacteria 801
536 Ga0207690_11210805 3300025932 Bacteria 631
537 Ga0207690_11263468 3300025932 Bacteria 617
538 Ga0207706_10001802 3300025933 Bacteria 21049
539 Ga0207706_10302853 3300025933 Bacteria 1392
540 Ga0207706_10632786 3300025933 Bacteria 917
541 Ga0207686_10281454 3300025934 Bacteria 1228
542 Ga0207709_11305995 3300025935 Bacteria 600
543 Ga0207669_10089611 3300025937 Bacteria 1998
544 Ga0207669_10280034 3300025937 Bacteria 1257
545 Ga0207669_10761588 3300025937 Bacteria 800
546 Ga0207704_10099540 3300025938 Bacteria 1934
547 Ga0207704_10657184 3300025938 Bacteria 864
548 Ga0207704_10900818 3300025938 Bacteria 744
549 Ga0207704_11021919 3300025938 Bacteria 700
550 Ga0207665_10208107 3300025939 Bacteria 1428
551 Ga0207691_10116511 3300025940 Bacteria 2371
552 Ga0207691_10970442 3300025940 Bacteria 710
553 Ga0207711_10062500 3300025941 Bacteria 3212
554 Ga0207711_10113619 3300025941 Bacteria 2411
555 Ga0207711_10413166 3300025941 Bacteria 1254
556 Ga0207689_10162491 3300025942 Bacteria 1840
557 Ga0207689_10636036 3300025942 Bacteria 898
558 Ga0207689_10800584 3300025942 Bacteria 796
559 Ga0207679_10203273 3300025945 Bacteria 1656
560 Ga0207679_10285030 3300025945 Bacteria 1418
561 Ga0207679_10868108 3300025945 Bacteria 824
562 Ga0207667_10041465 3300025949 Bacteria 4895
563 Ga0207667_10080924 3300025949 Bacteria 3365
564 Ga0207667_10124951 3300025949 Bacteria 2650
565 Ga0207667_10246887 3300025949 Bacteria 1826
566 Ga0207651_10109903 3300025960 Bacteria 2067
567 Ga0207712_10000286 3300025961 Bacteria 48199
568 Ga0207712_10102427 3300025961 Bacteria 2131
569 Ga0207712_10282290 3300025961 Bacteria 1356
570 Ga0207712_10752865 3300025961 Bacteria 853
571 Ga0207712_12135776 3300025961 Bacteria 501
572 Ga0207668_10058070 3300025972 Bacteria 2702
573 Ga0207668_10634649 3300025972 Bacteria 933
574 Ga0207668_10823577 3300025972 Bacteria 823
575 Ga0207668_10938668 3300025972 Bacteria 771
576 Ga0207640_10334562 3300025981 Bacteria 1211
577 Ga0207640_11206571 3300025981 Bacteria 673
578 Ga0207640_11782461 3300025981 Bacteria 556
579 Ga0207658_10017165 3300025986 Bacteria 4986
580 Ga0207658_10019417 3300025986 Bacteria 4700
581 Ga0207658_10121969 3300025986 Bacteria 2080
582 Ga0207658_10675122 3300025986 Bacteria 932
583 Ga0207658_11037226 3300025986 Bacteria 748
584 Ga0207677_10506838 3300026023 Bacteria 1044
585 Ga0207703_10002368 3300026035 Bacteria 16400
586 Ga0207703_10005498 3300026035 Bacteria 10186
587 Ga0207703_11395769 3300026035 Bacteria 674
588 Ga0207639_10001087 3300026041 Bacteria 18462
589 Ga0207639_10055044 3300026041 Bacteria 3043
590 Ga0207639_10167800 3300026041 Bacteria 1856
591 Ga0207639_10261893 3300026041 Bacteria 1513
592 Ga0207639_10265260 3300026041 Bacteria 1504
593 Ga0207639_10342719 3300026041 Bacteria 1333
594 Ga0207639_10615886 3300026041 Bacteria 1002
595 Ga0207678_10005043 3300026067 Bacteria 11847
596 Ga0207678_10025302 3300026067 Bacteria 5182
597 Ga0207678_10068252 3300026067 Bacteria 3051
598 Ga0207678_10082193 3300026067 Bacteria 2756
599 Ga0207678_10159219 3300026067 Bacteria 1928
600 Ga0207678_10229319 3300026067 Bacteria 1590
601 Ga0207678_10260325 3300026067 Bacteria 1487
602 Ga0207678_10291214 3300026067 Bacteria 1402
603 Ga0207678_10631644 3300026067 Bacteria 940
604 Ga0207678_10706969 3300026067 Bacteria 887
605 Ga0207678_10864583 3300026067 Bacteria 799
606 Ga0207678_11262943 3300026067 Bacteria 654
607 Ga0207678_11282106 3300026067 Bacteria 648
608 Ga0207708_10550510 3300026075 Bacteria 973
609 Ga0207708_11149689 3300026075 Bacteria 678
610 Ga0207702_10020035 3300026078 Bacteria 5543
611 Ga0207702_10094264 3300026078 Bacteria 2627
612 Ga0207702_10102388 3300026078 Bacteria 2531
613 Ga0207702_10124196 3300026078 Bacteria 2314
614 Ga0207702_10289519 3300026078 Bacteria 1551
615 Ga0207702_10481096 3300026078 Bacteria 1208
616 Ga0207641_10000702 3300026088 Bacteria 36039
617 Ga0207641_11005709 3300026088 Bacteria 830
618 Ga0207641_11344920 3300026088 Bacteria 715
619 Ga0207648_10511798 3300026089 Bacteria 1099
620 Ga0207648_10561872 3300026089 Bacteria 1049
621 Ga0207676_10185626 3300026095 Bacteria 1825
622 Ga0207674_10826329 3300026116 Bacteria 894
623 Ga0207675_100682955 3300026118 Bacteria 1035
624 Ga0207683_10093051 3300026121 Bacteria 2686
625 Ga0207683_10161505 3300026121 Bacteria 2026
626 Ga0207683_10217267 3300026121 Bacteria 1741
627 Ga0207683_10364050 3300026121 Bacteria 1328
628 Ga0207683_12020586 3300026121 Bacteria 525
629 Ga0207698_10339836 3300026142 Bacteria 1414
630 Ga0207698_10340571 3300026142 Bacteria 1412
631 Ga0207698_10466812 3300026142 Bacteria 1222
632 Ga0207698_11138772 3300026142 Bacteria 793
633 Ga0207698_11277228 3300026142 Bacteria 749
634 Ga0209281_1000125 3300027111 Bacteria 200371
635 Ga0209282_1159044 3300027666 Bacteria 1082
636 Ga0209813_10042291 3300027866 Bacteria 1392
637 Ga0209813_10411684 3300027866 Bacteria 547
638 Ga0209974_10336904 3300027876 Bacteria 583
639 Ga0207428_10474748 3300027907 Bacteria 910
640 Ga0268266_10000007 3300028379 Bacteria 1372921
641 Ga0268266_10001711 3300028379 Bacteria 25121
642 Ga0268266_10002582 3300028379 Bacteria 19210
643 Ga0268266_10013394 3300028379 Bacteria 7063
644 Ga0268266_10052877 3300028379 Bacteria 3489
645 Ga0268266_10215044 3300028379 Bacteria 1764
646 Ga0268266_10264158 3300028379 Bacteria 1596
647 Ga0268266_10276694 3300028379 Bacteria 1560
648 Ga0268266_11789772 3300028379 Bacteria 589
649 Ga0268265_10011961 3300028380 Bacteria 5872
650 Ga0268265_10060136 3300028380 Bacteria 2910
651 Ga0268265_10293536 3300028380 Bacteria 1460
652 Ga0268265_10350717 3300028380 Bacteria 1347
653 Ga0268265_10366679 3300028380 Bacteria 1320
654 Ga0268265_10421317 3300028380 Bacteria 1239
655 Ga0268264_10000375 3300028381 Bacteria 65683
656 Ga0268264_11457193 3300028381 Bacteria 695
657 Ga0268264_11533885 3300028381 Bacteria 677
658 Ga0268264_11543635 3300028381 Bacteria 675
659 Ga0268264_11640070 3300028381 Bacteria 654
660 Ga0307517_10157202 3300028786 Unclassified 1538
661 Ga0307515_10213160 3300028794 Bacteria 1770
662 Ga0307515_10373703 3300028794 Bacteria 1061
663 Ga0265760_10346975 3300031090 Bacteria 531
664 Ga0265330_10472371 3300031235 Bacteria 533
665 Ga0265316_10403623 3300031344 Bacteria 984
666 Ga0307513_10000121 3300031456 Bacteria 109551
667 Ga0307513_10454646 3300031456 Bacteria 1004
668 Ga0307513_10503613 3300031456 Unclassified 928
669 Ga0307408_100051176 3300031548 Bacteria 2974
670 Ga0307408_100274192 3300031548 Bacteria 1402
671 Ga0307508_10509540 3300031616 Bacteria 799
672 Ga0307508_10553188 3300031616 Bacteria 749
673 Ga0265314_10643553 3300031711 Bacteria 541
674 Ga0307516_10002590 3300031730 Bacteria 24022
675 Ga0307516_10107182 3300031730 Bacteria 2603
676 Ga0307516_10487987 3300031730 Bacteria 887
677 Ga0307405_11566839 3300031731 Bacteria 580
678 Ga0307405_11983046 3300031731 Unclassified 521
679 Ga0307413_10221922 3300031824 Bacteria 1381
680 Ga0307413_10290712 3300031824 Bacteria 1234
681 Ga0307413_10425752 3300031824 Bacteria 1047
682 Ga0307410_10467495 3300031852 Bacteria 1032
683 Ga0307410_11824187 3300031852 Bacteria 540
684 Ga0307406_10000135 3300031901 Bacteria 43972
685 Ga0307406_10083585 3300031901 Bacteria 2129
686 Ga0307406_10714645 3300031901 Bacteria 838
687 Ga0307407_10554041 3300031903 Bacteria 850
688 Ga0307407_11289045 3300031903 Bacteria 573
689 Ga0307412_10649076 3300031911 Bacteria 900
690 Ga0307412_10758187 3300031911 Bacteria 838
691 Ga0307412_11221729 3300031911 Bacteria 674
692 Ga0307412_12268184 3300031911 Bacteria 506
693 Ga0307409_100093371 3300031995 Bacteria 2472
694 Ga0307409_102760842 3300031995 Bacteria 519
695 Ga0307416_100055412 3300032002 Bacteria 3193
696 Ga0307416_100103487 3300032002 Bacteria 2486
697 Ga0307416_100356145 3300032002 Bacteria 1483
698 Ga0307414_10151785 3300032004 Bacteria 1829
699 Ga0307411_10074054 3300032005 Bacteria 2319
700 Ga0307411_10366901 3300032005 Bacteria 1179
701 Ga0307415_100147801 3300032126 Bacteria 1804
702 Ga0307415_101624461 3300032126 Bacteria 621
703 Ga0307415_101642738 3300032126 Bacteria 618
704 Ga0307510_10000001 3300033180 Bacteria 1172244
705 Ga0307510_10416343 3300033180 Bacteria 786
706 Ga0373941_0268881 3300035115 Bacteria 671
707 Ga0373960_0313034 3300035121 Bacteria 587
708 Ga0372808_031413 3300036459 Bacteria 762
709 Ga0373925_1348402 3300037068 Bacteria 585
710 Ga0395899_0001320 3300037312 Bacteria 21369
711 Ga0395899_0077287 3300037312 Bacteria 2428
712 Ga0395899_0292198 3300037312 Bacteria 1105
713 Ga0395900_0063330 3300037418 Bacteria 3801
714 Ga0395900_0080559 3300037418 Bacteria 3346
715 Ga0395900_0140821 3300037418 Bacteria 2470
716 Ga0395900_0193173 3300037418 Bacteria 2064
717 Ga0395900_0606959 3300037418 Bacteria 1034
718 Ga0395898_0129537 3300037466 Bacteria 2417
719 Ga0395898_0903223 3300037466 Bacteria 821
720 Ga0395905_0017216 3300037471 Bacteria 6865
721 Ga0395905_0082683 3300037471 Bacteria 3009
722 Ga0395905_0142672 3300037471 Bacteria 2253
723 Ga0395905_0373161 3300037471 Bacteria 1320
724 Ga0395905_0750857 3300037471 Bacteria 878
725 Ga0395905_1463581 3300037471 Bacteria 587
726 Ga0395901_0012451 3300038443 Bacteria 8633
727 Ga0395901_0128021 3300038443 Bacteria 2669
728 Ga0395901_0128937 3300038443 Bacteria 2658
729 Ga0395901_0259946 3300038443 Bacteria 1807
730 Ga0395901_0673417 3300038443 Bacteria 1035
731 Ga0395901_0678497 3300038443 Bacteria 1030
732 Ga0436361_0582197 3300039447 Bacteria 1003
733 Ga0436361_1152275 3300039447 Bacteria 616
734 Ga0436361_1209085 3300039447 Unclassified 547
735 Ga0436363_0335585 3300039450 Bacteria 588
736 Ga0436363_1712487 3300039450 Bacteria 1382
737 Ga0451789_0699448 3300041443 Bacteria 578
738 Ga0451791_1322022 3300041451 Bacteria 817
739 Ga0451797_0765934 3300041453 Bacteria 514
740 Ga0451795_0778622 3300041456 Bacteria 677
741 Ga0451798_1024392 3300041458 Bacteria 647
742 Ga0451802_0028054 3300041460 Bacteria 585
743 Ga0451807_1395372 3300041486 Bacteria 728
744 Ga0451807_1424292 3300041486 Bacteria 1059
745 Ga0451833_0278061 3300041491 Bacteria 1228
746 Ga0451837_0136122 3300041494 Bacteria 540
747 Ga0451837_1562523 3300041494 Bacteria 569
748 Ga0451837_1750542 3300041494 Bacteria 552
749 Ga0451841_0543752 3300041498 Bacteria 523
750 Ga0451845_0714657 3300041501 Bacteria 503
751 Ga0451853_1863186 3300041512 Bacteria 504
752 Ga0451853_2014640 3300041512 Bacteria 792
753 Ga0451853_2303321 3300041512 Bacteria 673
754 Ga0451853_3343357 3300041512 Bacteria 543
755 Ga0450900_070252 3300042136 Bacteria 555
756 Ga0466972_0015806 3300044658 Bacteria 3773
757 Ga0466972_0158797 3300044658 Bacteria 1062
758 Ga0466972_0462217 3300044658 Bacteria 596
759 Ga0466966_0162359 3300044684 Bacteria 1360
760 Ga0466961_0832242 3300044693 Bacteria 550
761 Ga0466963_0180843 3300044694 Bacteria 1472
762 Ga0466968_0178091 3300044735 Bacteria 988
763 Ga0466957_0707196 3300044842 Bacteria 711
764 Ga0466960_0015562 3300044901 Bacteria 3281
765 Ga0466959_0138528 3300045049 Bacteria 1721
766 Ga0466958_0136574 3300045836 Bacteria 1542
767 Ga0495590_0011663 3300046457 Bacteria 3282
768 Ga0495580_0035215 3300046472 Bacteria 3600
769 Ga0495605_0076541 3300046474 Bacteria 1571
770 Ga0495585_0167869 3300046492 Bacteria 1135
771 Ga0495594_0152315 3300046499 Bacteria 1313
772 Ga0495596_0255550 3300046500 Bacteria 680
773 Ga0495606_0090373 3300046507 Bacteria 1885
774 Ga0495606_0532206 3300046507 Bacteria 588
775 Ga0495606_0558899 3300046507 Unclassified 568
776 Ga0495620_0063158 3300046515 Bacteria 1536
777 Ga0495620_0289251 3300046515 Bacteria 623
778 Ga0495630_0640351 3300046517 Bacteria 814
779 Ga0495631_0230041 3300046518 Bacteria 791
780 Ga0495632_0128243 3300046519 Bacteria 1182
781 Ga0495632_0303925 3300046519 Bacteria 707
782 Ga0495643_0186616 3300046522 Bacteria 1004
783 Ga0495643_0196006 3300046522 Bacteria 972
784 Ga0495643_0350809 3300046522 Bacteria 661
785 Ga0495648_0187270 3300046524 Unclassified 1047
786 Ga0495648_0512882 3300046524 Bacteria 512
787 Ga0495663_0037129 3300046525 Bacteria 1468
788 Ga0495666_0039580 3300046526 Bacteria 2288
789 Ga0495642_0225414 3300046528 Bacteria 818
790 Ga0495665_0292850 3300046531 Bacteria 834
791 Ga0495609_0464035 3300046538 Bacteria 502
792 Ga0495597_0159457 3300046542 Bacteria 921
793 Ga0495645_0096835 3300046543 Bacteria 2102
794 Ga0495633_0350884 3300046558 Bacteria 668
795 Ga0495634_0211403 3300046642 Bacteria 1201
796 Ga0495611_0138254 3300046648 Bacteria 1137
797 Ga0495625_0002652 3300046660 Bacteria 19076
798 Ga0495625_0171020 3300046660 Bacteria 1451
799 Ga0495625_0497612 3300046660 Bacteria 746
800 Ga0495588_0270199 3300046674 Bacteria 896
801 Ga0495599_0207120 3300046678 Bacteria 1204
802 Ga0495623_0090213 3300046679 Bacteria 1882
803 Ga0495624_0080889 3300046690 Bacteria 2013
804 Ga0495624_0833692 3300046690 Bacteria 544
805 Ga0495670_0006980 3300046691 Bacteria 5565
806 Ga0495670_0103497 3300046691 Bacteria 1468
807 Ga0495649_0229977 3300046694 Bacteria 957
808 Ga0495649_0355223 3300046694 Bacteria 740
809 Ga0495660_0201499 3300046810 Bacteria 950
810 Ga0495636_0166326 3300047318 Bacteria 995
811 Ga0495687_010536 3300047443 Bacteria 5063
812 Ga0495687_053816 3300047443 Bacteria 1693
813 Ga0495677_0217048 3300047445 Bacteria 745
814 Ga0495681_0082998 3300047470 Bacteria 1427
815 Ga0495686_0100077 3300047472 Bacteria 1749
816 Ga0495686_0211033 3300047472 Bacteria 1109
817 Ga0495686_0236703 3300047472 Bacteria 1031
818 Ga0495686_0238201 3300047472 Bacteria 1027
819 Ga0495686_0340068 3300047472 Bacteria 818
820 Ga0495593_0026405 3300047673 Bacteria 3207
821 Ga0495602_0734669 3300048088 Bacteria 667
822 Ga0496100_0143738 3300048903 Bacteria 1694
823 Ga0496102_0237931 3300048905 Bacteria 1717
824 Ga0496102_0582595 3300048905 Bacteria 1042
825 Ga0496102_0603027 3300048905 Bacteria 1021
826 Ga0496102_0609196 3300048905 Bacteria 1015
827 Ga0496102_0823480 3300048905 Bacteria 850
828 Ga0496102_1197689 3300048905 Bacteria 679
829 Ga0496103_0330136 3300048906 Bacteria 981
830 Ga0496103_0392709 3300048906 Bacteria 891
831 Ga0496103_0572233 3300048906 Bacteria 720
832 Ga0496103_0758974 3300048906 Bacteria 613
833 Ga0496104_0254658 3300048907 Bacteria 1668
834 Ga0496104_0670317 3300048907 Bacteria 946
835 Ga0496104_0896937 3300048907 Bacteria 792
836 Ga0496105_0915586 3300048908 Bacteria 660
837 Ga0496106_1174352 3300048909 Bacteria 599
838 Ga0496107_0971821 3300048910 Bacteria 617
839 Ga0496110_0345184 3300048913 Bacteria 1356
840 Ga0496110_0389745 3300048913 Bacteria 1270
841 Ga0496110_0811729 3300048913 Bacteria 840
842 Ga0496112_0534093 3300048915 Bacteria 1107
843 Ga0496112_0674996 3300048915 Bacteria 962
844 Ga0496112_0923917 3300048915 Bacteria 794
845 Ga0496113_0232009 3300048916 Bacteria 1472
846 Ga0496113_0328191 3300048916 Bacteria 1227
847 Ga0496113_1453958 3300048916 Bacteria 530
848 Ga0496114_0007282 3300048917 Bacteria 8734
849 Ga0496114_0522183 3300048917 Bacteria 1050
850 Ga0496114_0573759 3300048917 Bacteria 996
851 Ga0496115_0289106 3300048918 Bacteria 1345
852 Ga0496116_0003419 3300048919 Bacteria 15693
853 Ga0496117_0268786 3300048920 Bacteria 920
854 Ga0496118_0185063 3300048921 Bacteria 1253
855 Ga0496119_0008928 3300048922 Bacteria 8707
856 Ga0496119_0061788 3300048922 Bacteria 2235
857 Ga0496119_0089279 3300048922 Bacteria 1755
858 Ga0496119_0452284 3300048922 Bacteria 605
859 Ga0496119_0558548 3300048922 Bacteria 525
860 Ga0496120_0000104 3300048923 Bacteria 140731
861 Ga0496120_0000455 3300048923 Bacteria 64606
862 Ga0496120_0134647 3300048923 Bacteria 1261
863 Ga0496120_0206465 3300048923 Bacteria 948
864 Ga0496120_0274723 3300048923 Bacteria 781
865 Ga0496120_0442601 3300048923 Bacteria 567
866 Ga0496121_0004934 3300048924 Bacteria 17501
867 Ga0496121_0293030 3300048924 Bacteria 1108
868 Ga0496121_0365369 3300048924 Bacteria 957
869 Ga0496121_0457284 3300048924 Bacteria 821
870 Ga0496121_0774082 3300048924 Bacteria 567
871 Ga0496122_0000472 3300048925 Bacteria 83803
872 Ga0496122_0049301 3300048925 Bacteria 3227
873 Ga0496122_0258255 3300048925 Bacteria 969
874 Ga0496123_0000361 3300048926 Bacteria 85609
875 Ga0496124_0000108 3300048927 Bacteria 167473
876 Ga0496124_0099925 3300048927 Bacteria 2352
877 Ga0496124_0346911 3300048927 Bacteria 1052
878 Ga0496125_0000424 3300048928 Bacteria 78587
879 Ga0496125_0013473 3300048928 Bacteria 8033
880 Ga0496125_0027239 3300048928 Bacteria 5185
881 Ga0496125_0043904 3300048928 Bacteria 3788
882 Ga0496125_0052760 3300048928 Bacteria 3341
883 Ga0496125_0110752 3300048928 Bacteria 1989
884 Ga0496125_0615608 3300048928 Bacteria 590
885 Ga0496125_0749497 3300048928 Bacteria 512
886 Ga0496126_0116420 3300048929 Bacteria 2323
887 Ga0496126_0120695 3300048929 Bacteria 2274
888 Ga0496126_0303753 3300048929 Bacteria 1315
889 Ga0496126_0487172 3300048929 Bacteria 987
890 Ga0495682_0189213 3300049460 Bacteria 731
891 Ga0501300_019362 3300049523 Bacteria 994
892 Ga0501031_0005336 3300049568 Bacteria 8371
893 Ga0501031_1087203 3300049568 Bacteria 510
894 Ga0501032_0000067 3300049569 Bacteria 89910
895 Ga0501032_0409610 3300049569 Bacteria 870
896 Ga0501032_0636923 3300049569 Bacteria 677
897 Ga0501032_1054198 3300049569 Bacteria 510
898 Ga0501033_0000117 3300049570 Bacteria 75935
899 Ga0501033_0075134 3300049570 Bacteria 2480
900 Ga0501033_0280842 3300049570 Bacteria 1175
901 Ga0501034_0000153 3300049571 Bacteria 129892
902 Ga0501034_0062525 3300049571 Bacteria 3738
903 Ga0501036_0008779 3300049572 Bacteria 8296
904 Ga0501036_0040926 3300049572 Bacteria 3921
905 Ga0501037_0000081 3300049573 Bacteria 86623
906 Ga0501038_0000033 3300049574 Bacteria 129840
907 Ga0501038_0079637 3300049574 Bacteria 2762
908 Ga0501039_0000031 3300049575 Bacteria 129814
909 Ga0501039_0523466 3300049575 Bacteria 931
910 Ga0501043_0000009 3300049579 Bacteria 214823
911 Ga0501043_0000044 3300049579 Bacteria 114304
912 Ga0501043_0038431 3300049579 Bacteria 3763
913 Ga0501046_0000022 3300049580 Bacteria 215451
914 Ga0501046_0083687 3300049580 Bacteria 2462
915 Ga0501046_0085538 3300049580 Bacteria 2431
916 Ga0501047_0000021 3300049581 Bacteria 254841
917 Ga0501047_0159538 3300049581 Bacteria 2127
918 Ga0501047_0341253 3300049581 Bacteria 1335
919 Ga0501047_1039152 3300049581 Bacteria 632
920 Ga0501048_0000311 3300049582 Bacteria 33197
921 Ga0501048_0198999 3300049582 Bacteria 1420
922 Ga0501068_0947563 3300049584 Bacteria 567
923 Ga0501070_0388710 3300049586 Bacteria 1129
924 Ga0501070_0997363 3300049586 Bacteria 650
925 Ga0501073_0172446 3300049589 Bacteria 1497
926 Ga0501073_0304222 3300049589 Bacteria 1100
927 Ga0501076_0221660 3300049592 Bacteria 1546
928 Ga0501080_0067730 3300049742 Bacteria 3320
929 Ga0501083_0101224 3300049744 Bacteria 1900
930 Ga0501083_0172642 3300049744 Bacteria 1413
931 Ga0501280_006305 3300049776 Bacteria 1675
932 Ga0501035_0000472 3300049822 Bacteria 45098
933 Ga0501035_0110226 3300049822 Bacteria 2412
934 Ga0501044_0014405 3300049823 Bacteria 8538
935 Ga0501044_0439552 3300049823 Bacteria 1212
936 Ga0501044_0472110 3300049823 Bacteria 1158
937 Ga0501044_0475613 3300049823 Bacteria 1153
938 Ga0501045_0041678 3300049824 Bacteria 3341
939 nmdc:mga03683_271346_c1 3300050489 Bacteria 791
940 nmdc:mga03683_29779_c1 3300050489 Bacteria 2180
941 nmdc:mga03n38_103058_c1 3300050490 Bacteria 1379
942 nmdc:mga03n38_155457_c1 3300050490 Bacteria 1154
943 nmdc:mga03n38_53598_c1 3300050490 Bacteria 1809
944 nmdc:mga00v17_144100_c1 3300050491 Bacteria 1529
945 nmdc:mga00v17_21915_c1 3300050491 Bacteria 3680
946 nmdc:mga00v17_672799_c1 3300050491 Bacteria 665
947 nmdc:mga00v17_81391_c1 3300050491 Bacteria 2022
948 nmdc:mga00v17_84199_c1 3300050491 Bacteria 1990
949 nmdc:mga0yw44_159047_c1 3300050492 Bacteria 1478
950 nmdc:mga0yw44_253999_c1 3300050492 Bacteria 1171
951 nmdc:mga0yw44_256489_c1 3300050492 Bacteria 1165
952 nmdc:mga0yw44_3044_c1 3300050492 Bacteria 7334
953 nmdc:mga0yw44_438721_c1 3300050492 Bacteria 885
954 nmdc:mga0yw44_44151_c1 3300050492 Bacteria 2665
955 nmdc:mga0yw44_47931_c1 3300050492 Bacteria 2574
956 nmdc:mga0yw44_54408_c1 3300050492 Bacteria 2432
957 nmdc:mga0k408_142381_c1 3300050493 Bacteria 1427
958 nmdc:mga0k408_434742_c1 3300050493 Bacteria 780
959 nmdc:mga0k408_547213_c1 3300050493 Bacteria 684
960 nmdc:mga0k408_636169_c1 3300050493 Bacteria 628
961 nmdc:mga06z11_13238_c1 3300050494 Bacteria 3615
962 nmdc:mga06z11_178799_c1 3300050494 Bacteria 1222
963 nmdc:mga06z11_290636_c1 3300050494 Bacteria 970
964 nmdc:mga06z11_389451_c1 3300050494 Bacteria 838
965 nmdc:mga06z11_415692_c1 3300050494 Bacteria 810
966 nmdc:mga04h51_304655_c1 3300050495 Bacteria 650
967 nmdc:mga04h51_69223_c1 3300050495 Bacteria 1228
968 nmdc:mga07m45_264384_c1 3300050496 Bacteria 1001
969 nmdc:mga07m45_32868_c1 3300050496 Bacteria 2878
970 nmdc:mga07m45_332704_c1 3300050496 Bacteria 883
971 nmdc:mga07m45_751787_c1 3300050496 Bacteria 560
972 nmdc:mga05p37_397580_c1 3300050507 Bacteria 1610
973 nmdc:mga05p37_56596_c1 3300050507 Bacteria 4829
974 nmdc:mga09592_142_c2 3300050508 Bacteria 23737
975 nmdc:mga0qj67_1135337_c1 3300050509 Bacteria 609
976 nmdc:mga06r32_187262_c1 3300050510 Bacteria 2057
977 nmdc:mga06r32_192796_c1 3300050510 Bacteria 2025
978 nmdc:mga08y16_2132907_c1 3300050511 Bacteria 508
979 nmdc:mga0a205_388080_c2 3300050515 Bacteria 878
980 nmdc:mga0sz30_36074_c1 3300050516 Bacteria 2066
981 Ga0495601_0343647 3300053077 Bacteria 971
982 Ga0500610_0012946 3300053079 Bacteria 3861
983 Ga0500610_0192265 3300053079 Bacteria 990
984 Ga0495655_0032605 3300053083 Bacteria 1276
985 Ga0500578_0000327 3300053086 Bacteria 57988
986 Ga0500646_0012843 3300053090 Bacteria 2166
987 Ga0500583_0023535 3300053092 Bacteria 2598
988 Ga0500566_0530955 3300053094 Bacteria 502
989 Ga0500641_0003956 3300053096 Bacteria 5237
990 Ga0500641_0010765 3300053096 Bacteria 3312
991 Ga0500650_0383878 3300053098 Bacteria 610
992 Ga0500654_152786 3300053099 Bacteria 806
993 Ga0500556_0067354 3300053104 Bacteria 1331
994 Ga0500594_0021092 3300053118 Bacteria 1631
995 Ga0500595_013715 3300053119 Bacteria 3099
996 Ga0500595_041988 3300053119 Bacteria 1467
997 Ga0500595_192134 3300053119 Bacteria 564
998 Ga0500559_0235384 3300053136 Unclassified 863
999 Ga0500568_0021526 3300053139 Bacteria 2772
1000 Ga0500568_0286850 3300053139 Bacteria 598
1001 Ga0500589_178529 3300053147 Bacteria 836
1002 Ga0500590_173236 3300053148 Unclassified 946
1003 Ga0500604_0029850 3300053151 Bacteria 1592
1004 Ga0500604_0265557 3300053151 Bacteria 594
1005 Ga0500620_010708 3300053155 Bacteria 2428
1006 Ga0500620_098708 3300053155 Bacteria 1021
1007 Ga0500627_0146894 3300053158 Bacteria 1065
1008 Ga0500611_022925 3300053727 Bacteria 1210
1009 Ga0500645_082862 3300053730 Bacteria 914
1010 Ga0500587_032830 3300053739 Bacteria 719
1011 Ga0587073_0284930 3300059492 Bacteria 532
1012 Ga0587106_128633 3300059605 Bacteria 545
1013 Ga0587072_154827 3300059643 Bacteria 556
1014 Ga0587114_093791 3300059655 Bacteria 576
1015 Ga0501082_1098539 3300060353 Bacteria 695

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100221090 Ga0070714_1002210902 44
2 3300006028 Ga0070717_10356939 Ga0070717_103569392 44
3 3300006175 Ga0070712_100489010 Ga0070712_1004890102 44
4 3300013307 Ga0157372_12240842 Ga0157372_122408421 44
5 3300025915 Ga0207693_10156578 Ga0207693_101565782 44
6 3300025929 Ga0207664_10129489 Ga0207664_101294892 44
7 3300044684 Ga0466966_0162359 Ga0466966_0162359_150_305 44
8 3300044693 Ga0466961_0832242 Ga0466961_0832242_303_458 44
9 3300044694 Ga0466963_0180843 Ga0466963_0180843_1191_1346 44
10 3300044842 Ga0466957_0707196 Ga0466957_0707196_186_341 44
11 3300045049 Ga0466959_0138528 Ga0466959_0138528_1248_1403 44
12 3300045836 Ga0466958_0136574 Ga0466958_0136574_436_591 44
13 3300035121 Ga0373960_0313034 Ga0373960_0313034_178_333 45
14 3300037312 Ga0395899_0001320 Ga0395899_0001320_15773_15925 45
15 3300046518 Ga0495631_0230041 Ga0495631_0230041_344_499 45
16 3300046642 Ga0495634_0211403 Ga0495634_0211403_618_770 45
17 3300005467 Ga0070706_100018724 Ga0070706_1000187249 46
18 3300005471 Ga0070698_100067072 Ga0070698_1000670728 46
19 3300005843 Ga0068860_100393836 Ga0068860_1003938363 46
20 3300014969 Ga0157376_10080368 Ga0157376_100803685 46
21 3300025910 Ga0207684_10021192 Ga0207684_100211924 46
22 3300028794 Ga0307515_10373703 Ga0307515_103737032 46
23 3300039447 Ga0436361_0582197 Ga0436361_0582197_758_919 46
24 3300046472 Ga0495580_0035215 Ga0495580_0035215_1536_1682 46
25 3300046499 Ga0495594_0152315 Ga0495594_0152315_434_580 46
26 3300046526 Ga0495666_0039580 Ga0495666_0039580_1821_1967 46
27 3300046690 Ga0495624_0080889 Ga0495624_0080889_554_700 46
28 3300048088 Ga0495602_0734669 Ga0495602_0734669_128_274 46
29 3300048927 Ga0496124_0000108 Ga0496124_0000108_55802_55951 46
30 3300048928 Ga0496125_0027239 Ga0496125_0027239_4672_4821 46
31 3300048928 Ga0496125_0749497 Ga0496125_0749497_93_242 46
32 3300002067 JGI24735J21928_10002948 JGI24735J21928_100029482 47
33 3300002704 JGI25155J39150_1000285 JGI25155J39150_10002853 47
34 3300002705 JGI25156J39149_1000168 JGI25156J39149_100016813 47
35 3300002705 JGI25156J39149_1014953 JGI25156J39149_10149532 47
36 3300002737 JGI25162J39368_1003783 JGI25162J39368_10037836 47
37 3300002738 JGI25154J39366_1000185 JGI25154J39366_100018513 47
38 3300002738 JGI25154J39366_1000245 JGI25154J39366_100024517 47
39 3300002741 JGI25157J39369_1000429 JGI25157J39369_100042917 47
40 3300003354 JGI25160J50197_1042927 JGI25160J50197_10429272 47
41 3300003758 Ga0055532_1000050 Ga0055532_1000050100 47
42 3300003761 Ga0055535_1008146 Ga0055535_10081462 47
43 3300003763 Ga0055529_1009834 Ga0055529_10098342 47
44 3300003790 Ga0055528_1052701 Ga0055528_10527012 47
45 3300003791 Ga0055530_10008439 Ga0055530_100084393 47
46 3300005262 Ga0065165_1009352 Ga0065165_10093525 47
47 3300005262 Ga0065165_1103783 Ga0065165_11037832 47
48 3300005327 Ga0070658_10314433 Ga0070658_103144331 47
49 3300005327 Ga0070658_11172460 Ga0070658_111724601 47
50 3300005330 Ga0070690_100767971 Ga0070690_1007679711 47
51 3300005331 Ga0070670_100371230 Ga0070670_1003712302 47
52 3300005335 Ga0070666_10250629 Ga0070666_102506291 47
53 3300005337 Ga0070682_100894205 Ga0070682_1008942051 47
54 3300005339 Ga0070660_101873411 Ga0070660_1018734111 47
55 3300005341 Ga0070691_10077465 Ga0070691_100774651 47
56 3300005341 Ga0070691_10363956 Ga0070691_103639562 47
57 3300005344 Ga0070661_101079581 Ga0070661_1010795812 47
58 3300005347 Ga0070668_100219865 Ga0070668_1002198652 47
59 3300005353 Ga0070669_100753245 Ga0070669_1007532452 47
60 3300005354 Ga0070675_100049484 Ga0070675_1000494841 47
61 3300005364 Ga0070673_100421894 Ga0070673_1004218942 47
62 3300005366 Ga0070659_100376180 Ga0070659_1003761801 47
63 3300005366 Ga0070659_101461581 Ga0070659_1014615812 47
64 3300005367 Ga0070667_100037624 Ga0070667_1000376242 47
65 3300005367 Ga0070667_100220162 Ga0070667_1002201622 47
66 3300005367 Ga0070667_101498056 Ga0070667_1014980562 47
67 3300005435 Ga0070714_100020874 Ga0070714_1000208742 47
68 3300005435 Ga0070714_100161864 Ga0070714_1001618643 47
69 3300005435 Ga0070714_101733893 Ga0070714_1017338932 47
70 3300005436 Ga0070713_100021206 Ga0070713_1000212064 47
71 3300005439 Ga0070711_100462835 Ga0070711_1004628351 47
72 3300005444 Ga0070694_100038566 Ga0070694_1000385662 47
73 3300005455 Ga0070663_100244805 Ga0070663_1002448052 47
74 3300005455 Ga0070663_100256293 Ga0070663_1002562932 47
75 3300005455 Ga0070663_100289085 Ga0070663_1002890852 47
76 3300005455 Ga0070663_100725075 Ga0070663_1007250752 47
77 3300005455 Ga0070663_101836544 Ga0070663_1018365442 47
78 3300005456 Ga0070678_100186469 Ga0070678_1001864692 47
79 3300005458 Ga0070681_11087527 Ga0070681_110875272 47
80 3300005471 Ga0070698_100054973 Ga0070698_1000549735 47
81 3300005535 Ga0070684_100524449 Ga0070684_1005244492 47
82 3300005539 Ga0068853_100341109 Ga0068853_1003411093 47
83 3300005539 Ga0068853_100381560 Ga0068853_1003815602 47
84 3300005539 Ga0068853_100703249 Ga0068853_1007032493 47
85 3300005539 Ga0068853_100951970 Ga0068853_1009519702 47
86 3300005539 Ga0068853_101680477 Ga0068853_1016804771 47
87 3300005543 Ga0070672_101702862 Ga0070672_1017028621 47
88 3300005545 Ga0070695_100085770 Ga0070695_1000857701 47
89 3300005545 Ga0070695_101777788 Ga0070695_1017777881 47
90 3300005548 Ga0070665_100001771 Ga0070665_10000177116 47
91 3300005548 Ga0070665_100171044 Ga0070665_1001710442 47
92 3300005548 Ga0070665_100227245 Ga0070665_1002272452 47
93 3300005563 Ga0068855_100018720 Ga0068855_1000187208 47
94 3300005564 Ga0070664_100229728 Ga0070664_1002297281 47
95 3300005564 Ga0070664_101754108 Ga0070664_1017541082 47
96 3300005578 Ga0068854_100156413 Ga0068854_1001564132 47
97 3300005614 Ga0068856_100028271 Ga0068856_1000282715 47
98 3300005614 Ga0068856_100408509 Ga0068856_1004085093 47
99 3300005616 Ga0068852_100756000 Ga0068852_1007560001 47
100 3300005616 Ga0068852_101033037 Ga0068852_1010330372 47
101 3300005617 Ga0068859_100069885 Ga0068859_1000698854 47
102 3300005618 Ga0068864_101001603 Ga0068864_1010016031 47
103 3300005834 Ga0068851_10256520 Ga0068851_102565202 47
104 3300005834 Ga0068851_10761710 Ga0068851_107617101 47
105 3300005841 Ga0068863_100008576 Ga0068863_1000085763 47
106 3300005842 Ga0068858_100008681 Ga0068858_1000086813 47
107 3300005843 Ga0068860_100064420 Ga0068860_1000644202 47
108 3300005843 Ga0068860_102769293 Ga0068860_1027692932 47
109 3300005844 Ga0068862_100005681 Ga0068862_1000056813 47
110 3300005981 Ga0081538_10056531 Ga0081538_100565312 47
111 3300006028 Ga0070717_10579511 Ga0070717_105795112 47
112 3300006038 Ga0075365_10019410 Ga0075365_100194102 47
113 3300006042 Ga0075368_10357698 Ga0075368_103576982 47
114 3300006048 Ga0075363_100767230 Ga0075363_1007672302 47
115 3300006051 Ga0075364_10013967 Ga0075364_100139673 47
116 3300006177 Ga0075362_10034290 Ga0075362_100342904 47
117 3300006177 Ga0075362_10094100 Ga0075362_100941002 47
118 3300006178 Ga0075367_10326650 Ga0075367_103266502 47
119 3300006178 Ga0075367_10432529 Ga0075367_104325292 47
120 3300006237 Ga0097621_101872621 Ga0097621_1018726212 47
121 3300006358 Ga0068871_101116781 Ga0068871_1011167811 47
122 3300006358 Ga0068871_102006879 Ga0068871_1020068792 47
123 3300006844 Ga0075428_100044800 Ga0075428_1000448007 47
124 3300006844 Ga0075428_101572210 Ga0075428_1015722103 47
125 3300006846 Ga0075430_101408962 Ga0075430_1014089622 47
126 3300006847 Ga0075431_100149210 Ga0075431_1001492103 47
127 3300006847 Ga0075431_100204554 Ga0075431_1002045545 47
128 3300006852 Ga0075433_10845724 Ga0075433_108457241 47
129 3300006880 Ga0075429_100001760 Ga0075429_10000176016 47
130 3300006931 Ga0097620_100069885 Ga0097620_1000698854 47
131 3300006946 Ga0079104_1000056 Ga0079104_100005647 47
132 3300006948 Ga0099826_10157999 Ga0099826_101579992 47
133 3300009011 Ga0105251_10001596 Ga0105251_1000159616 47
134 3300009036 Ga0105244_10269823 Ga0105244_102698231 47
135 3300009092 Ga0105250_10112457 Ga0105250_101124572 47
136 3300009092 Ga0105250_10283495 Ga0105250_102834952 47
137 3300009093 Ga0105240_10008179 Ga0105240_100081797 47
138 3300009093 Ga0105240_10127106 Ga0105240_101271063 47
139 3300009093 Ga0105240_10519837 Ga0105240_105198371 47
140 3300009093 Ga0105240_10757023 Ga0105240_107570232 47
141 3300009093 Ga0105240_11107972 Ga0105240_111079722 47
142 3300009093 Ga0105240_11904074 Ga0105240_119040741 47
143 3300009093 Ga0105240_12371562 Ga0105240_123715621 47
144 3300009098 Ga0105245_12451026 Ga0105245_124510261 47
145 3300009101 Ga0105247_10083289 Ga0105247_100832892 47
146 3300009101 Ga0105247_11750672 Ga0105247_117506722 47
147 3300009147 Ga0114129_10005806 Ga0114129_1000580616 47
148 3300009174 Ga0105241_11211629 Ga0105241_112116292 47
149 3300009174 Ga0105241_11354902 Ga0105241_113549021 47
150 3300009174 Ga0105241_12008479 Ga0105241_120084792 47
151 3300009174 Ga0105241_12483104 Ga0105241_124831041 47
152 3300009176 Ga0105242_10086392 Ga0105242_100863922 47
153 3300009177 Ga0105248_10074394 Ga0105248_100743944 47
154 3300009177 Ga0105248_10703108 Ga0105248_107031082 47
155 3300009545 Ga0105237_10381952 Ga0105237_103819522 47
156 3300009545 Ga0105237_10473466 Ga0105237_104734662 47
157 3300009545 Ga0105237_11295390 Ga0105237_112953901 47
158 3300009551 Ga0105238_10052215 Ga0105238_100522152 47
159 3300009551 Ga0105238_10122725 Ga0105238_101227253 47
160 3300009551 Ga0105238_10282932 Ga0105238_102829322 47
161 3300009551 Ga0105238_10291740 Ga0105238_102917403 47
162 3300009551 Ga0105238_12250467 Ga0105238_122504671 47
163 3300009553 Ga0105249_10098527 Ga0105249_100985272 47
164 3300009553 Ga0105249_10391235 Ga0105249_103912352 47
165 3300010375 Ga0105239_10171834 Ga0105239_101718345 47
166 3300010375 Ga0105239_10209027 Ga0105239_102090273 47
167 3300010375 Ga0105239_11388705 Ga0105239_113887052 47
168 3300010375 Ga0105239_11626254 Ga0105239_116262542 47
169 3300011119 Ga0105246_10217503 Ga0105246_102175032 47
170 3300013100 Ga0157373_10093661 Ga0157373_100936612 47
171 3300013105 Ga0157369_10497695 Ga0157369_104976952 47
172 3300013296 Ga0157374_10051579 Ga0157374_100515793 47
173 3300013296 Ga0157374_10193082 Ga0157374_101930822 47
174 3300013297 Ga0157378_11134251 Ga0157378_111342512 47
175 3300013306 Ga0163162_10001141 Ga0163162_1000114111 47
176 3300013306 Ga0163162_10139381 Ga0163162_101393813 47
177 3300013308 Ga0157375_10764093 Ga0157375_107640932 47
178 3300013308 Ga0157375_12814828 Ga0157375_128148282 47
179 3300014325 Ga0163163_10942931 Ga0163163_109429312 47
180 3300014325 Ga0163163_11149683 Ga0163163_111496832 47
181 3300014497 Ga0182008_10006567 Ga0182008_100065673 47
182 3300014745 Ga0157377_10648699 Ga0157377_106486992 47
183 3300014745 Ga0157377_11732632 Ga0157377_117326321 47
184 3300014969 Ga0157376_10877451 Ga0157376_108774512 47
185 3300014969 Ga0157376_10975918 Ga0157376_109759182 47
186 3300014969 Ga0157376_12423676 Ga0157376_124236762 47
187 3300015261 Ga0182006_1061542 Ga0182006_10615423 47
188 3300017792 Ga0163161_10110584 Ga0163161_101105842 47
189 3300025206 Ga0209435_100029 Ga0209435_10002975 47
190 3300025206 Ga0209435_100195 Ga0209435_10019516 47
191 3300025206 Ga0209435_110508 Ga0209435_1105082 47
192 3300025229 Ga0209147_100004 Ga0209147_100004466 47
193 3300025233 Ga0209437_100053 Ga0209437_100053102 47
194 3300025242 Ga0209258_100396 Ga0209258_10039644 47
195 3300025246 Ga0209646_1000073 Ga0209646_1000073109 47
196 3300025246 Ga0209646_1000109 Ga0209646_100010913 47
197 3300025246 Ga0209646_1037415 Ga0209646_10374152 47
198 3300025250 Ga0209026_1000124 Ga0209026_100012474 47
199 3300025250 Ga0209026_1003015 Ga0209026_10030155 47
200 3300025250 Ga0209026_1035417 Ga0209026_10354171 47
201 3300025256 Ga0209759_1000108 Ga0209759_100010857 47
202 3300025256 Ga0209759_1000706 Ga0209759_100070614 47
203 3300025261 Ga0209233_1060313 Ga0209233_10603132 47
204 3300025272 Ga0209455_1014667 Ga0209455_10146673 47
205 3300025273 Ga0209673_1001490 Ga0209673_100149014 47
206 3300025273 Ga0209673_1080125 Ga0209673_10801252 47
207 3300025291 Ga0209675_1045396 Ga0209675_10453962 47
208 3300025298 Ga0209050_1000202 Ga0209050_100020276 47
209 3300025298 Ga0209050_1006802 Ga0209050_10068027 47
210 3300025299 Ga0209256_1000049 Ga0209256_1000049164 47
211 3300025302 Ga0207426_1002546 Ga0207426_10025465 47
212 3300025303 Ga0209051_1011287 Ga0209051_10112874 47
213 3300025321 Ga0207656_10427162 Ga0207656_104271621 47
214 3300025728 Ga0207655_1231614 Ga0207655_12316142 47
215 3300025735 Ga0207713_1003598 Ga0207713_10035987 47
216 3300025900 Ga0207710_10088493 Ga0207710_100884932 47
217 3300025903 Ga0207680_10147902 Ga0207680_101479023 47
218 3300025903 Ga0207680_10404237 Ga0207680_104042372 47
219 3300025904 Ga0207647_10167001 Ga0207647_101670012 47
220 3300025904 Ga0207647_10290538 Ga0207647_102905382 47
221 3300025911 Ga0207654_10000942 Ga0207654_100009422 47
222 3300025911 Ga0207654_10464192 Ga0207654_104641922 47
223 3300025913 Ga0207695_10004636 Ga0207695_1000463616 47
224 3300025913 Ga0207695_10426029 Ga0207695_104260292 47
225 3300025913 Ga0207695_10616805 Ga0207695_106168051 47
226 3300025913 Ga0207695_10854637 Ga0207695_108546372 47
227 3300025913 Ga0207695_11040740 Ga0207695_110407402 47
228 3300025914 Ga0207671_10858431 Ga0207671_108584312 47
229 3300025918 Ga0207662_10475311 Ga0207662_104753112 47
230 3300025920 Ga0207649_11109882 Ga0207649_111098821 47
231 3300025923 Ga0207681_10779388 Ga0207681_107793881 47
232 3300025924 Ga0207694_10904764 Ga0207694_109047641 47
233 3300025925 Ga0207650_10529854 Ga0207650_105298542 47
234 3300025925 Ga0207650_10624944 Ga0207650_106249442 47
235 3300025926 Ga0207659_10035830 Ga0207659_100358305 47
236 3300025927 Ga0207687_11653120 Ga0207687_116531201 47
237 3300025932 Ga0207690_11263468 Ga0207690_112634682 47
238 3300025934 Ga0207686_10281454 Ga0207686_102814542 47
239 3300025937 Ga0207669_10280034 Ga0207669_102800342 47
240 3300025940 Ga0207691_10970442 Ga0207691_109704422 47
241 3300025941 Ga0207711_10062500 Ga0207711_100625003 47
242 3300025941 Ga0207711_10413166 Ga0207711_104131662 47
243 3300025945 Ga0207679_10285030 Ga0207679_102850302 47
244 3300025945 Ga0207679_10868108 Ga0207679_108681081 47
245 3300025949 Ga0207667_10041465 Ga0207667_100414656 47
246 3300025949 Ga0207667_10124951 Ga0207667_101249512 47
247 3300025960 Ga0207651_10109903 Ga0207651_101099032 47
248 3300025961 Ga0207712_10102427 Ga0207712_101024273 47
249 3300025972 Ga0207668_10938668 Ga0207668_109386682 47
250 3300025981 Ga0207640_11782461 Ga0207640_117824612 47
251 3300025986 Ga0207658_10017165 Ga0207658_100171655 47
252 3300025986 Ga0207658_11037226 Ga0207658_110372262 47
253 3300026035 Ga0207703_10005498 Ga0207703_100054983 47
254 3300026041 Ga0207639_10167800 Ga0207639_101678003 47
255 3300026041 Ga0207639_10342719 Ga0207639_103427192 47
256 3300026067 Ga0207678_10005043 Ga0207678_100050439 47
257 3300026067 Ga0207678_10068252 Ga0207678_100682522 47
258 3300026067 Ga0207678_10260325 Ga0207678_102603252 47
259 3300026067 Ga0207678_10631644 Ga0207678_106316442 47
260 3300026067 Ga0207678_11282106 Ga0207678_112821062 47
261 3300026078 Ga0207702_10020035 Ga0207702_100200355 47
262 3300026078 Ga0207702_10481096 Ga0207702_104810962 47
263 3300026088 Ga0207641_10000702 Ga0207641_1000070232 47
264 3300026121 Ga0207683_10217267 Ga0207683_102172673 47
265 3300026121 Ga0207683_12020586 Ga0207683_120205862 47
266 3300026142 Ga0207698_10466812 Ga0207698_104668122 47
267 3300026142 Ga0207698_11138772 Ga0207698_111387722 47
268 3300026142 Ga0207698_11277228 Ga0207698_112772281 47
269 3300027111 Ga0209281_1000125 Ga0209281_100012555 47
270 3300027666 Ga0209282_1159044 Ga0209282_11590442 47
271 3300027876 Ga0209974_10336904 Ga0209974_103369042 47
272 3300028379 Ga0268266_10002582 Ga0268266_1000258211 47
273 3300028379 Ga0268266_10215044 Ga0268266_102150442 47
274 3300028379 Ga0268266_10276694 Ga0268266_102766943 47
275 3300028380 Ga0268265_10011961 Ga0268265_100119613 47
276 3300028381 Ga0268264_10000375 Ga0268264_1000037528 47
277 3300028381 Ga0268264_11640070 Ga0268264_116400702 47
278 3300028786 Ga0307517_10157202 Ga0307517_101572022 47
279 3300031344 Ga0265316_10403623 Ga0265316_104036231 47
280 3300031456 Ga0307513_10000121 Ga0307513_1000012121 47
281 3300031456 Ga0307513_10454646 Ga0307513_104546462 47
282 3300031456 Ga0307513_10503613 Ga0307513_105036131 47
283 3300031548 Ga0307408_100051176 Ga0307408_1000511761 47
284 3300031616 Ga0307508_10553188 Ga0307508_105531882 47
285 3300031730 Ga0307516_10002590 Ga0307516_1000259018 47
286 3300031730 Ga0307516_10107182 Ga0307516_101071824 47
287 3300031730 Ga0307516_10487987 Ga0307516_104879872 47
288 3300031731 Ga0307405_11983046 Ga0307405_119830462 47
289 3300031901 Ga0307406_10000135 Ga0307406_1000013512 47
290 3300031901 Ga0307406_10083585 Ga0307406_100835852 47
291 3300033180 Ga0307510_10000001 Ga0307510_10000001877 47
292 3300037312 Ga0395899_0077287 Ga0395899_0077287_2253_2399 47
293 3300037418 Ga0395900_0063330 Ga0395900_0063330_176_322 47
294 3300037466 Ga0395898_0129537 Ga0395898_0129537_334_480 47
295 3300038443 Ga0395901_0012451 Ga0395901_0012451_1012_1158 47
296 3300039447 Ga0436361_1152275 Ga0436361_1152275_43_198 47
297 3300039447 Ga0436361_1209085 Ga0436361_1209085_80_235 47
298 3300039450 Ga0436363_1712487 Ga0436363_1712487_236_388 47
299 3300041443 Ga0451789_0699448 Ga0451789_0699448_12_164 47
300 3300041494 Ga0451837_0136122 Ga0451837_0136122_253_405 47
301 3300041512 Ga0451853_2303321 Ga0451853_2303321_368_517 47
302 3300042136 Ga0450900_070252 Ga0450900_070252_270_422 47
303 3300046457 Ga0495590_0011663 Ga0495590_0011663_56_208 47
304 3300046507 Ga0495606_0090373 Ga0495606_0090373_1721_1873 47
305 3300046507 Ga0495606_0558899 Ga0495606_0558899_63_218 47
306 3300046517 Ga0495630_0640351 Ga0495630_0640351_17_169 47
307 3300046524 Ga0495648_0187270 Ga0495648_0187270_714_869 47
308 3300046524 Ga0495648_0512882 Ga0495648_0512882_83_235 47
309 3300046531 Ga0495665_0292850 Ga0495665_0292850_629_781 47
310 3300046538 Ga0495609_0464035 Ga0495609_0464035_169_321 47
311 3300046660 Ga0495625_0002652 Ga0495625_0002652_16282_16437 47
312 3300046679 Ga0495623_0090213 Ga0495623_0090213_17_169 47
313 3300046690 Ga0495624_0833692 Ga0495624_0833692_70_222 47
314 3300046691 Ga0495670_0006980 Ga0495670_0006980_5189_5341 47
315 3300046694 Ga0495649_0355223 Ga0495649_0355223_525_677 47
316 3300047443 Ga0495687_010536 Ga0495687_010536_2487_2642 47
317 3300047470 Ga0495681_0082998 Ga0495681_0082998_105_257 47
318 3300047673 Ga0495593_0026405 Ga0495593_0026405_1870_2022 47
319 3300048906 Ga0496103_0572233 Ga0496103_0572233_56_208 47
320 3300048917 Ga0496114_0007282 Ga0496114_0007282_2646_2801 47
321 3300048919 Ga0496116_0003419 Ga0496116_0003419_14799_14954 47
322 3300048922 Ga0496119_0008928 Ga0496119_0008928_8314_8469 47
323 3300048923 Ga0496120_0000104 Ga0496120_0000104_31771_31926 47
324 3300048923 Ga0496120_0274723 Ga0496120_0274723_125_280 47
325 3300048924 Ga0496121_0004934 Ga0496121_0004934_31_183 47
326 3300048924 Ga0496121_0293030 Ga0496121_0293030_245_400 47
327 3300048925 Ga0496122_0000472 Ga0496122_0000472_67438_67593 47
328 3300048925 Ga0496122_0049301 Ga0496122_0049301_3025_3177 47
329 3300048926 Ga0496123_0000361 Ga0496123_0000361_23872_24027 47
330 3300048928 Ga0496125_0000424 Ga0496125_0000424_61074_61229 47
331 3300048928 Ga0496125_0013473 Ga0496125_0013473_5412_5567 47
332 3300048928 Ga0496125_0052760 Ga0496125_0052760_373_528 47
333 3300049460 Ga0495682_0189213 Ga0495682_0189213_62_217 47
334 3300049523 Ga0501300_019362 Ga0501300_019362_609_764 47
335 3300049568 Ga0501031_1087203 Ga0501031_1087203_17_163 47
336 3300049569 Ga0501032_0409610 Ga0501032_0409610_129_275 47
337 3300049569 Ga0501032_1054198 Ga0501032_1054198_250_405 47
338 3300049570 Ga0501033_0075134 Ga0501033_0075134_2047_2193 47
339 3300049571 Ga0501034_0062525 Ga0501034_0062525_1046_1192 47
340 3300049572 Ga0501036_0040926 Ga0501036_0040926_1979_2125 47
341 3300049574 Ga0501038_0079637 Ga0501038_0079637_2073_2219 47
342 3300049575 Ga0501039_0523466 Ga0501039_0523466_79_225 47
343 3300049579 Ga0501043_0000009 Ga0501043_0000009_79696_79851 47
344 3300049579 Ga0501043_0038431 Ga0501043_0038431_2641_2787 47
345 3300049580 Ga0501046_0000022 Ga0501046_0000022_79685_79840 47
346 3300049580 Ga0501046_0085538 Ga0501046_0085538_1663_1809 47
347 3300049581 Ga0501047_0000021 Ga0501047_0000021_79743_79898 47
348 3300049581 Ga0501047_0159538 Ga0501047_0159538_135_281 47
349 3300049582 Ga0501048_0000311 Ga0501048_0000311_7166_7321 47
350 3300049582 Ga0501048_0198999 Ga0501048_0198999_625_771 47
351 3300049589 Ga0501073_0304222 Ga0501073_0304222_797_943 47
352 3300049744 Ga0501083_0101224 Ga0501083_0101224_1170_1316 47
353 3300049744 Ga0501083_0172642 Ga0501083_0172642_932_1087 47
354 3300049776 Ga0501280_006305 Ga0501280_006305_1053_1208 47
355 3300049822 Ga0501035_0110226 Ga0501035_0110226_1032_1178 47
356 3300049823 Ga0501044_0472110 Ga0501044_0472110_787_933 47
357 3300049824 Ga0501045_0041678 Ga0501045_0041678_478_633 47
358 3300050496 nmdc:mga07m45_264384_c1 nmdc:mga07m45_264384_c1_775_930 47
359 3300050507 nmdc:mga05p37_56596_c1 nmdc:mga05p37_56596_c1_3195_3347 47
360 3300050508 nmdc:mga09592_142_c2 nmdc:mga09592_142_c2_13605_13757 47
361 3300050510 nmdc:mga06r32_187262_c1 nmdc:mga06r32_187262_c1_1784_1936 47
362 3300050510 nmdc:mga06r32_192796_c1 nmdc:mga06r32_192796_c1_1162_1314 47
363 3300050515 nmdc:mga0a205_388080_c2 nmdc:mga0a205_388080_c2_682_834 47
364 3300053086 Ga0500578_0000327 Ga0500578_0000327_5189_5344 47
365 3300053092 Ga0500583_0023535 Ga0500583_0023535_1722_1877 47
366 3300053136 Ga0500559_0235384 Ga0500559_0235384_522_677 47
367 3300053148 Ga0500590_173236 Ga0500590_173236_734_889 47
368 3300053730 Ga0500645_082862 Ga0500645_082862_388_540 47
369 3300060353 Ga0501082_1098539 Ga0501082_1098539_62_217 47
370 3300005289 Ga0065704_10292439 Ga0065704_102924392 48
371 3300005295 Ga0065707_10300891 Ga0065707_103008912 48
372 3300005328 Ga0070676_10544954 Ga0070676_105449542 48
373 3300005328 Ga0070676_11449390 Ga0070676_114493901 48
374 3300005329 Ga0070683_100517115 Ga0070683_1005171152 48
375 3300005330 Ga0070690_101565610 Ga0070690_1015656101 48
376 3300005334 Ga0068869_100230828 Ga0068869_1002308282 48
377 3300005334 Ga0068869_100373316 Ga0068869_1003733162 48
378 3300005338 Ga0068868_100363275 Ga0068868_1003632752 48
379 3300005340 Ga0070689_101003968 Ga0070689_1010039682 48
380 3300005341 Ga0070691_10446418 Ga0070691_104464182 48
381 3300005341 Ga0070691_11014139 Ga0070691_110141391 48
382 3300005343 Ga0070687_100047222 Ga0070687_1000472222 48
383 3300005344 Ga0070661_100886922 Ga0070661_1008869222 48
384 3300005345 Ga0070692_10904175 Ga0070692_109041751 48
385 3300005347 Ga0070668_100294462 Ga0070668_1002944621 48
386 3300005347 Ga0070668_100908346 Ga0070668_1009083462 48
387 3300005353 Ga0070669_100262145 Ga0070669_1002621452 48
388 3300005353 Ga0070669_101702996 Ga0070669_1017029962 48
389 3300005354 Ga0070675_100269594 Ga0070675_1002695942 48
390 3300005354 Ga0070675_100942679 Ga0070675_1009426792 48
391 3300005354 Ga0070675_101080373 Ga0070675_1010803732 48
392 3300005355 Ga0070671_100442975 Ga0070671_1004429752 48
393 3300005356 Ga0070674_100287186 Ga0070674_1002871862 48
394 3300005356 Ga0070674_102115227 Ga0070674_1021152271 48
395 3300005364 Ga0070673_100947910 Ga0070673_1009479102 48
396 3300005365 Ga0070688_100070462 Ga0070688_1000704622 48
397 3300005366 Ga0070659_100349804 Ga0070659_1003498042 48
398 3300005367 Ga0070667_100516892 Ga0070667_1005168922 48
399 3300005441 Ga0070700_100054334 Ga0070700_1000543342 48
400 3300005441 Ga0070700_101345854 Ga0070700_1013458542 48
401 3300005444 Ga0070694_100531411 Ga0070694_1005314111 48
402 3300005455 Ga0070663_100031241 Ga0070663_1000312414 48
403 3300005455 Ga0070663_100711292 Ga0070663_1007112922 48
404 3300005456 Ga0070678_100204119 Ga0070678_1002041192 48
405 3300005456 Ga0070678_100898688 Ga0070678_1008986882 48
406 3300005456 Ga0070678_100943929 Ga0070678_1009439291 48
407 3300005467 Ga0070706_100623902 Ga0070706_1006239022 48
408 3300005471 Ga0070698_101296037 Ga0070698_1012960372 48
409 3300005518 Ga0070699_100585868 Ga0070699_1005858682 48
410 3300005536 Ga0070697_101840214 Ga0070697_1018402142 48
411 3300005539 Ga0068853_100319291 Ga0068853_1003192912 48
412 3300005545 Ga0070695_100351489 Ga0070695_1003514893 48
413 3300005547 Ga0070693_100499626 Ga0070693_1004996262 48
414 3300005548 Ga0070665_100021841 Ga0070665_1000218414 48
415 3300005548 Ga0070665_100190059 Ga0070665_1001900594 48
416 3300005548 Ga0070665_100439706 Ga0070665_1004397061 48
417 3300005564 Ga0070664_100140986 Ga0070664_1001409862 48
418 3300005564 Ga0070664_101117259 Ga0070664_1011172592 48
419 3300005617 Ga0068859_100069591 Ga0068859_1000695915 48
420 3300005618 Ga0068864_100528729 Ga0068864_1005287293 48
421 3300005618 Ga0068864_102445082 Ga0068864_1024450821 48
422 3300005719 Ga0068861_100159665 Ga0068861_1001596654 48
423 3300005719 Ga0068861_100759481 Ga0068861_1007594811 48
424 3300005719 Ga0068861_102694114 Ga0068861_1026941141 48
425 3300005840 Ga0068870_10463712 Ga0068870_104637122 48
426 3300005841 Ga0068863_101348929 Ga0068863_1013489291 48
427 3300005841 Ga0068863_102199813 Ga0068863_1021998132 48
428 3300005842 Ga0068858_102506059 Ga0068858_1025060592 48
429 3300005843 Ga0068860_100228673 Ga0068860_1002286731 48
430 3300005843 Ga0068860_101024800 Ga0068860_1010248002 48
431 3300005843 Ga0068860_102276117 Ga0068860_1022761172 48
432 3300005844 Ga0068862_100359643 Ga0068862_1003596431 48
433 3300005844 Ga0068862_100373904 Ga0068862_1003739042 48
434 3300005844 Ga0068862_100737249 Ga0068862_1007372491 48
435 3300005844 Ga0068862_101011478 Ga0068862_1010114782 48
436 3300006038 Ga0075365_10050844 Ga0075365_100508443 48
437 3300006038 Ga0075365_10136515 Ga0075365_101365154 48
438 3300006038 Ga0075365_10366096 Ga0075365_103660962 48
439 3300006042 Ga0075368_10084686 Ga0075368_100846862 48
440 3300006048 Ga0075363_100016696 Ga0075363_1000166963 48
441 3300006048 Ga0075363_100164697 Ga0075363_1001646972 48
442 3300006048 Ga0075363_100255157 Ga0075363_1002551572 48
443 3300006051 Ga0075364_10081007 Ga0075364_100810072 48
444 3300006173 Ga0070716_100262904 Ga0070716_1002629042 48
445 3300006177 Ga0075362_10047661 Ga0075362_100476612 48
446 3300006178 Ga0075367_10030565 Ga0075367_100305652 48
447 3300006178 Ga0075367_10519804 Ga0075367_105198042 48
448 3300006178 Ga0075367_10751006 Ga0075367_107510061 48
449 3300006186 Ga0075369_10014365 Ga0075369_100143652 48
450 3300006186 Ga0075369_10207810 Ga0075369_102078101 48
451 3300006195 Ga0075366_10131825 Ga0075366_101318252 48
452 3300006195 Ga0075366_10883572 Ga0075366_108835722 48
453 3300006353 Ga0075370_10082152 Ga0075370_100821521 48
454 3300006353 Ga0075370_10384002 Ga0075370_103840022 48
455 3300006844 Ga0075428_100066058 Ga0075428_1000660582 48
456 3300006846 Ga0075430_100921741 Ga0075430_1009217411 48
457 3300006880 Ga0075429_100568100 Ga0075429_1005681002 48
458 3300006881 Ga0068865_100756977 Ga0068865_1007569772 48
459 3300006881 Ga0068865_101013723 Ga0068865_1010137232 48
460 3300006931 Ga0097620_100069591 Ga0097620_1000695915 48
461 3300009092 Ga0105250_10212425 Ga0105250_102124252 48
462 3300009093 Ga0105240_12300583 Ga0105240_123005831 48
463 3300009094 Ga0111539_10619587 Ga0111539_106195872 48
464 3300009094 Ga0111539_10739501 Ga0111539_107395012 48
465 3300009098 Ga0105245_10707052 Ga0105245_107070521 48
466 3300009101 Ga0105247_10942533 Ga0105247_109425332 48
467 3300009147 Ga0114129_10451997 Ga0114129_104519972 48
468 3300009148 Ga0105243_10301244 Ga0105243_103012442 48
469 3300009148 Ga0105243_12610887 Ga0105243_126108872 48
470 3300009545 Ga0105237_11106922 Ga0105237_111069222 48
471 3300009545 Ga0105237_11980845 Ga0105237_119808452 48
472 3300009553 Ga0105249_10092339 Ga0105249_100923394 48
473 3300009553 Ga0105249_11867444 Ga0105249_118674441 48
474 3300009553 Ga0105249_13359691 Ga0105249_133596911 48
475 3300010375 Ga0105239_10335177 Ga0105239_103351772 48
476 3300010375 Ga0105239_10540272 Ga0105239_105402723 48
477 3300010375 Ga0105239_13094065 Ga0105239_130940652 48
478 3300011119 Ga0105246_10529946 Ga0105246_105299462 48
479 3300011119 Ga0105246_11262369 Ga0105246_112623692 48
480 3300012515 Ga0157338_1036967 Ga0157338_10369672 48
481 3300013102 Ga0157371_11198026 Ga0157371_111980262 48
482 3300013105 Ga0157369_10967080 Ga0157369_109670802 48
483 3300013297 Ga0157378_11250949 Ga0157378_112509491 48
484 3300013306 Ga0163162_10711412 Ga0163162_107114122 48
485 3300013306 Ga0163162_11585151 Ga0163162_115851511 48
486 3300013307 Ga0157372_12018395 Ga0157372_120183951 48
487 3300013308 Ga0157375_11849920 Ga0157375_118499202 48
488 3300014326 Ga0157380_10441108 Ga0157380_104411082 48
489 3300014326 Ga0157380_10977078 Ga0157380_109770782 48
490 3300014326 Ga0157380_12210898 Ga0157380_122108981 48
491 3300014968 Ga0157379_10513640 Ga0157379_105136401 48
492 3300014968 Ga0157379_12208812 Ga0157379_122088121 48
493 3300014969 Ga0157376_10852888 Ga0157376_108528882 48
494 3300025711 Ga0207696_1100059 Ga0207696_11000592 48
495 3300025899 Ga0207642_10252153 Ga0207642_102521532 48
496 3300025900 Ga0207710_10144651 Ga0207710_101446512 48
497 3300025901 Ga0207688_10350052 Ga0207688_103500522 48
498 3300025901 Ga0207688_10983844 Ga0207688_109838442 48
499 3300025904 Ga0207647_10157711 Ga0207647_101577112 48
500 3300025904 Ga0207647_10343297 Ga0207647_103432972 48
501 3300025907 Ga0207645_10514842 Ga0207645_105148422 48
502 3300025908 Ga0207643_10042620 Ga0207643_100426204 48
503 3300025910 Ga0207684_10235133 Ga0207684_102351332 48
504 3300025920 Ga0207649_10827859 Ga0207649_108278592 48
505 3300025923 Ga0207681_10221538 Ga0207681_102215383 48
506 3300025926 Ga0207659_11571856 Ga0207659_115718561 48
507 3300025931 Ga0207644_11793311 Ga0207644_117933112 48
508 3300025932 Ga0207690_10685398 Ga0207690_106853982 48
509 3300025933 Ga0207706_10632786 Ga0207706_106327862 48
510 3300025935 Ga0207709_11305995 Ga0207709_113059951 48
511 3300025937 Ga0207669_10089611 Ga0207669_100896113 48
512 3300025938 Ga0207704_10657184 Ga0207704_106571841 48
513 3300025939 Ga0207665_10208107 Ga0207665_102081072 48
514 3300025940 Ga0207691_10116511 Ga0207691_101165112 48
515 3300025942 Ga0207689_10162491 Ga0207689_101624911 48
516 3300025942 Ga0207689_10636036 Ga0207689_106360362 48
517 3300025942 Ga0207689_10800584 Ga0207689_108005841 48
518 3300025945 Ga0207679_10203273 Ga0207679_102032732 48
519 3300025961 Ga0207712_10282290 Ga0207712_102822902 48
520 3300025961 Ga0207712_10752865 Ga0207712_107528651 48
521 3300025961 Ga0207712_12135776 Ga0207712_121357761 48
522 3300025972 Ga0207668_10058070 Ga0207668_100580702 48
523 3300025972 Ga0207668_10634649 Ga0207668_106346491 48
524 3300025986 Ga0207658_10675122 Ga0207658_106751221 48
525 3300026023 Ga0207677_10506838 Ga0207677_105068382 48
526 3300026035 Ga0207703_11395769 Ga0207703_113957692 48
527 3300026041 Ga0207639_10615886 Ga0207639_106158862 48
528 3300026067 Ga0207678_10229319 Ga0207678_102293192 48
529 3300026067 Ga0207678_10706969 Ga0207678_107069692 48
530 3300026067 Ga0207678_11262943 Ga0207678_112629432 48
531 3300026075 Ga0207708_10550510 Ga0207708_105505101 48
532 3300026075 Ga0207708_11149689 Ga0207708_111496892 48
533 3300026088 Ga0207641_11005709 Ga0207641_110057091 48
534 3300026088 Ga0207641_11344920 Ga0207641_113449201 48
535 3300026089 Ga0207648_10561872 Ga0207648_105618722 48
536 3300026095 Ga0207676_10185626 Ga0207676_101856262 48
537 3300026118 Ga0207675_100682955 Ga0207675_1006829552 48
538 3300026121 Ga0207683_10093051 Ga0207683_100930514 48
539 3300026121 Ga0207683_10161505 Ga0207683_101615053 48
540 3300027866 Ga0209813_10411684 Ga0209813_104116841 48
541 3300027907 Ga0207428_10474748 Ga0207428_104747482 48
542 3300028379 Ga0268266_10001711 Ga0268266_100017112 48
543 3300028380 Ga0268265_10060136 Ga0268265_100601365 48
544 3300028380 Ga0268265_10293536 Ga0268265_102935362 48
545 3300028380 Ga0268265_10350717 Ga0268265_103507171 48
546 3300028380 Ga0268265_10366679 Ga0268265_103666793 48
547 3300028380 Ga0268265_10421317 Ga0268265_104213172 48
548 3300028381 Ga0268264_11457193 Ga0268264_114571931 48
549 3300028381 Ga0268264_11543635 Ga0268264_115436352 48
550 3300031090 Ga0265760_10346975 Ga0265760_103469752 48
551 3300031235 Ga0265330_10472371 Ga0265330_104723712 48
552 3300031548 Ga0307408_100274192 Ga0307408_1002741922 48
553 3300031731 Ga0307405_11566839 Ga0307405_115668392 48
554 3300031824 Ga0307413_10221922 Ga0307413_102219222 48
555 3300031824 Ga0307413_10290712 Ga0307413_102907122 48
556 3300031852 Ga0307410_10467495 Ga0307410_104674951 48
557 3300031852 Ga0307410_11824187 Ga0307410_118241872 48
558 3300031901 Ga0307406_10714645 Ga0307406_107146451 48
559 3300031903 Ga0307407_10554041 Ga0307407_105540412 48
560 3300031903 Ga0307407_11289045 Ga0307407_112890451 48
561 3300031911 Ga0307412_10649076 Ga0307412_106490761 48
562 3300031911 Ga0307412_10758187 Ga0307412_107581871 48
563 3300031911 Ga0307412_12268184 Ga0307412_122681842 48
564 3300031995 Ga0307409_100093371 Ga0307409_1000933714 48
565 3300032002 Ga0307416_100055412 Ga0307416_1000554123 48
566 3300032002 Ga0307416_100103487 Ga0307416_1001034872 48
567 3300032002 Ga0307416_100356145 Ga0307416_1003561453 48
568 3300032004 Ga0307414_10151785 Ga0307414_101517854 48
569 3300032005 Ga0307411_10074054 Ga0307411_100740544 48
570 3300032005 Ga0307411_10366901 Ga0307411_103669012 48
571 3300032126 Ga0307415_100147801 Ga0307415_1001478012 48
572 3300032126 Ga0307415_101624461 Ga0307415_1016244612 48
573 3300032126 Ga0307415_101642738 Ga0307415_1016427382 48
574 3300036459 Ga0372808_031413 Ga0372808_031413_559_717 48
575 3300037471 Ga0395905_1463581 Ga0395905_1463581_254_409 48
576 3300039450 Ga0436363_0335585 Ga0436363_0335585_418_573 48
577 3300041458 Ga0451798_1024392 Ga0451798_1024392_425_580 48
578 3300041486 Ga0451807_1424292 Ga0451807_1424292_747_902 48
579 3300041491 Ga0451833_0278061 Ga0451833_0278061_636_791 48
580 3300041494 Ga0451837_1750542 Ga0451837_1750542_290_445 48
581 3300041512 Ga0451853_1863186 Ga0451853_1863186_71_226 48
582 3300044658 Ga0466972_0462217 Ga0466972_0462217_227_382 48
583 3300046474 Ga0495605_0076541 Ga0495605_0076541_1222_1377 48
584 3300046492 Ga0495585_0167869 Ga0495585_0167869_595_750 48
585 3300046519 Ga0495632_0303925 Ga0495632_0303925_79_234 48
586 3300046522 Ga0495643_0350809 Ga0495643_0350809_310_465 48
587 3300046525 Ga0495663_0037129 Ga0495663_0037129_89_244 48
588 3300046542 Ga0495597_0159457 Ga0495597_0159457_121_276 48
589 3300046543 Ga0495645_0096835 Ga0495645_0096835_504_659 48
590 3300046558 Ga0495633_0350884 Ga0495633_0350884_36_191 48
591 3300046648 Ga0495611_0138254 Ga0495611_0138254_195_350 48
592 3300046660 Ga0495625_0497612 Ga0495625_0497612_223_378 48
593 3300046678 Ga0495599_0207120 Ga0495599_0207120_585_740 48
594 3300046691 Ga0495670_0103497 Ga0495670_0103497_166_321 48
595 3300046694 Ga0495649_0229977 Ga0495649_0229977_33_188 48
596 3300047318 Ga0495636_0166326 Ga0495636_0166326_122_277 48
597 3300047445 Ga0495677_0217048 Ga0495677_0217048_87_242 48
598 3300047472 Ga0495686_0238201 Ga0495686_0238201_443_598 48
599 3300048903 Ga0496100_0143738 Ga0496100_0143738_766_921 48
600 3300048905 Ga0496102_0237931 Ga0496102_0237931_1131_1286 48
601 3300048905 Ga0496102_0823480 Ga0496102_0823480_124_279 48
602 3300048906 Ga0496103_0330136 Ga0496103_0330136_147_302 48
603 3300048907 Ga0496104_0254658 Ga0496104_0254658_1177_1332 48
604 3300048908 Ga0496105_0915586 Ga0496105_0915586_220_375 48
605 3300048909 Ga0496106_1174352 Ga0496106_1174352_27_182 48
606 3300048913 Ga0496110_0389745 Ga0496110_0389745_399_554 48
607 3300048913 Ga0496110_0811729 Ga0496110_0811729_562_717 48
608 3300048915 Ga0496112_0674996 Ga0496112_0674996_142_297 48
609 3300048917 Ga0496114_0522183 Ga0496114_0522183_308_463 48
610 3300048918 Ga0496115_0289106 Ga0496115_0289106_520_675 48
611 3300048921 Ga0496118_0185063 Ga0496118_0185063_405_560 48
612 3300048922 Ga0496119_0061788 Ga0496119_0061788_551_706 48
613 3300048922 Ga0496119_0452284 Ga0496119_0452284_318_473 48
614 3300048923 Ga0496120_0206465 Ga0496120_0206465_44_199 48
615 3300048924 Ga0496121_0774082 Ga0496121_0774082_135_290 48
616 3300048927 Ga0496124_0099925 Ga0496124_0099925_2000_2155 48
617 3300048928 Ga0496125_0110752 Ga0496125_0110752_1167_1322 48
618 3300048928 Ga0496125_0615608 Ga0496125_0615608_310_465 48
619 3300048929 Ga0496126_0303753 Ga0496126_0303753_278_433 48
620 3300048929 Ga0496126_0487172 Ga0496126_0487172_558_713 48
621 3300049570 Ga0501033_0280842 Ga0501033_0280842_439_588 48
622 3300049581 Ga0501047_0341253 Ga0501047_0341253_1041_1190 48
623 3300049586 Ga0501070_0388710 Ga0501070_0388710_480_629 48
624 3300049589 Ga0501073_0172446 Ga0501073_0172446_88_237 48
625 3300049592 Ga0501076_0221660 Ga0501076_0221660_1047_1196 48
626 3300049742 Ga0501080_0067730 Ga0501080_0067730_2615_2764 48
627 3300049823 Ga0501044_0439552 Ga0501044_0439552_502_651 48
628 3300050489 nmdc:mga03683_271346_c1 nmdc:mga03683_271346_c1_355_510 48
629 3300050489 nmdc:mga03683_29779_c1 nmdc:mga03683_29779_c1_1056_1211 48
630 3300050490 nmdc:mga03n38_103058_c1 nmdc:mga03n38_103058_c1_560_715 48
631 3300050490 nmdc:mga03n38_53598_c1 nmdc:mga03n38_53598_c1_781_936 48
632 3300050491 nmdc:mga00v17_21915_c1 nmdc:mga00v17_21915_c1_976_1131 48
633 3300050491 nmdc:mga00v17_672799_c1 nmdc:mga00v17_672799_c1_196_351 48
634 3300050492 nmdc:mga0yw44_3044_c1 nmdc:mga0yw44_3044_c1_1305_1460 48
635 3300050492 nmdc:mga0yw44_438721_c1 nmdc:mga0yw44_438721_c1_442_594 48
636 3300050492 nmdc:mga0yw44_44151_c1 nmdc:mga0yw44_44151_c1_1808_1963 48
637 3300050492 nmdc:mga0yw44_47931_c1 nmdc:mga0yw44_47931_c1_2017_2172 48
638 3300050493 nmdc:mga0k408_142381_c1 nmdc:mga0k408_142381_c1_344_499 48
639 3300050493 nmdc:mga0k408_434742_c1 nmdc:mga0k408_434742_c1_417_572 48
640 3300050493 nmdc:mga0k408_636169_c1 nmdc:mga0k408_636169_c1_288_443 48
641 3300050494 nmdc:mga06z11_13238_c1 nmdc:mga06z11_13238_c1_1638_1793 48
642 3300050494 nmdc:mga06z11_389451_c1 nmdc:mga06z11_389451_c1_449_604 48
643 3300050494 nmdc:mga06z11_415692_c1 nmdc:mga06z11_415692_c1_444_599 48
644 3300050495 nmdc:mga04h51_304655_c1 nmdc:mga04h51_304655_c1_475_630 48
645 3300050496 nmdc:mga07m45_32868_c1 nmdc:mga07m45_32868_c1_120_275 48
646 3300050496 nmdc:mga07m45_751787_c1 nmdc:mga07m45_751787_c1_330_485 48
647 3300050507 nmdc:mga05p37_397580_c1 nmdc:mga05p37_397580_c1_1346_1501 48
648 3300050509 nmdc:mga0qj67_1135337_c1 nmdc:mga0qj67_1135337_c1_411_566 48
649 3300050511 nmdc:mga08y16_2132907_c1 nmdc:mga08y16_2132907_c1_272_427 48
650 3300050516 nmdc:mga0sz30_36074_c1 nmdc:mga0sz30_36074_c1_1333_1488 48
651 3300053090 Ga0500646_0012843 Ga0500646_0012843_639_794 48
652 3300053096 Ga0500641_0003956 Ga0500641_0003956_4163_4318 48
653 3300053096 Ga0500641_0010765 Ga0500641_0010765_2250_2405 48
654 3300053099 Ga0500654_152786 Ga0500654_152786_49_204 48
655 3300053104 Ga0500556_0067354 Ga0500556_0067354_610_765 48
656 3300053118 Ga0500594_0021092 Ga0500594_0021092_617_772 48
657 3300053119 Ga0500595_013715 Ga0500595_013715_1730_1885 48
658 3300053139 Ga0500568_0021526 Ga0500568_0021526_466_621 48
659 3300053139 Ga0500568_0286850 Ga0500568_0286850_384_539 48
660 3300053147 Ga0500589_178529 Ga0500589_178529_405_560 48
661 3300053151 Ga0500604_0029850 Ga0500604_0029850_927_1082 48
662 3300053739 Ga0500587_032830 Ga0500587_032830_374_529 48
663 3300001979 JGI24740J21852_10013514 JGI24740J21852_100135143 49
664 3300001979 JGI24740J21852_10047535 JGI24740J21852_100475352 49
665 3300001989 JGI24739J22299_10002039 JGI24739J22299_100020396 49
666 3300002067 JGI24735J21928_10040493 JGI24735J21928_100404933 49
667 3300002705 JGI25156J39149_1004985 JGI25156J39149_10049854 49
668 3300002741 JGI25157J39369_1001872 JGI25157J39369_10018724 49
669 3300003214 JGI25165J46597_1000147 JGI25165J46597_100014794 49
670 3300003316 rootH1_10060681 rootH1_100606813 49
671 3300005289 Ga0065704_10223530 Ga0065704_102235302 49
672 3300005327 Ga0070658_11255454 Ga0070658_112554541 49
673 3300005327 Ga0070658_11335603 Ga0070658_113356031 49
674 3300005328 Ga0070676_10504095 Ga0070676_105040951 49
675 3300005329 Ga0070683_100823835 Ga0070683_1008238351 49
676 3300005331 Ga0070670_100066337 Ga0070670_1000663375 49
677 3300005335 Ga0070666_10004869 Ga0070666_100048695 49
678 3300005338 Ga0068868_100399695 Ga0068868_1003996951 49
679 3300005339 Ga0070660_100179601 Ga0070660_1001796013 49
680 3300005339 Ga0070660_100920092 Ga0070660_1009200922 49
681 3300005344 Ga0070661_100046521 Ga0070661_1000465211 49
682 3300005347 Ga0070668_100382004 Ga0070668_1003820042 49
683 3300005353 Ga0070669_100850399 Ga0070669_1008503992 49
684 3300005356 Ga0070674_100412160 Ga0070674_1004121603 49
685 3300005366 Ga0070659_101440702 Ga0070659_1014407022 49
686 3300005367 Ga0070667_100014791 Ga0070667_1000147916 49
687 3300005367 Ga0070667_100414315 Ga0070667_1004143153 49
688 3300005455 Ga0070663_100023376 Ga0070663_1000233764 49
689 3300005455 Ga0070663_100158000 Ga0070663_1001580002 49
690 3300005455 Ga0070663_100287791 Ga0070663_1002877911 49
691 3300005455 Ga0070663_101417682 Ga0070663_1014176821 49
692 3300005455 Ga0070663_101863546 Ga0070663_1018635462 49
693 3300005456 Ga0070678_100884653 Ga0070678_1008846531 49
694 3300005456 Ga0070678_101255587 Ga0070678_1012555871 49
695 3300005457 Ga0070662_100005114 Ga0070662_1000051145 49
696 3300005539 Ga0068853_100029492 Ga0068853_1000294924 49
697 3300005539 Ga0068853_100727705 Ga0068853_1007277051 49
698 3300005539 Ga0068853_101209781 Ga0068853_1012097812 49
699 3300005539 Ga0068853_102366403 Ga0068853_1023664031 49
700 3300005548 Ga0070665_100000778 Ga0070665_10000077819 49
701 3300005548 Ga0070665_100050498 Ga0070665_1000504984 49
702 3300005548 Ga0070665_102113295 Ga0070665_1021132952 49
703 3300005563 Ga0068855_100387978 Ga0068855_1003879783 49
704 3300005563 Ga0068855_100697493 Ga0068855_1006974933 49
705 3300005563 Ga0068855_101283159 Ga0068855_1012831592 49
706 3300005563 Ga0068855_101426752 Ga0068855_1014267521 49
707 3300005578 Ga0068854_101058707 Ga0068854_1010587072 49
708 3300005578 Ga0068854_101536123 Ga0068854_1015361232 49
709 3300005614 Ga0068856_100138824 Ga0068856_1001388242 49
710 3300005614 Ga0068856_100385836 Ga0068856_1003858362 49
711 3300005614 Ga0068856_100504705 Ga0068856_1005047052 49
712 3300005614 Ga0068856_100790700 Ga0068856_1007907002 49
713 3300005614 Ga0068856_101154138 Ga0068856_1011541381 49
714 3300005616 Ga0068852_100143206 Ga0068852_1001432063 49
715 3300005616 Ga0068852_100289998 Ga0068852_1002899982 49
716 3300005616 Ga0068852_100746806 Ga0068852_1007468062 49
717 3300005616 Ga0068852_101274626 Ga0068852_1012746262 49
718 3300005617 Ga0068859_101799198 Ga0068859_1017991982 49
719 3300005719 Ga0068861_101082105 Ga0068861_1010821052 49
720 3300005834 Ga0068851_10011579 Ga0068851_100115792 49
721 3300005834 Ga0068851_10951395 Ga0068851_109513951 49
722 3300005841 Ga0068863_100316694 Ga0068863_1003166943 49
723 3300005842 Ga0068858_100002518 Ga0068858_1000025188 49
724 3300006038 Ga0075365_10008054 Ga0075365_100080543 49
725 3300006038 Ga0075365_10042042 Ga0075365_100420423 49
726 3300006038 Ga0075365_10219305 Ga0075365_102193052 49
727 3300006042 Ga0075368_10010145 Ga0075368_100101453 49
728 3300006042 Ga0075368_10059835 Ga0075368_100598353 49
729 3300006048 Ga0075363_100048225 Ga0075363_1000482252 49
730 3300006048 Ga0075363_100109067 Ga0075363_1001090673 49
731 3300006051 Ga0075364_10144673 Ga0075364_101446733 49
732 3300006051 Ga0075364_10686839 Ga0075364_106868392 49
733 3300006177 Ga0075362_10043133 Ga0075362_100431331 49
734 3300006177 Ga0075362_10081871 Ga0075362_100818713 49
735 3300006177 Ga0075362_10210340 Ga0075362_102103402 49
736 3300006178 Ga0075367_10010494 Ga0075367_100104944 49
737 3300006178 Ga0075367_10059422 Ga0075367_100594224 49
738 3300006178 Ga0075367_10080622 Ga0075367_100806223 49
739 3300006178 Ga0075367_10132711 Ga0075367_101327112 49
740 3300006186 Ga0075369_10015191 Ga0075369_100151913 49
741 3300006195 Ga0075366_10043033 Ga0075366_100430332 49
742 3300006237 Ga0097621_100263485 Ga0097621_1002634853 49
743 3300006237 Ga0097621_101110566 Ga0097621_1011105662 49
744 3300006237 Ga0097621_101845026 Ga0097621_1018450262 49
745 3300006353 Ga0075370_10007676 Ga0075370_100076764 49
746 3300006353 Ga0075370_10200649 Ga0075370_102006492 49
747 3300006358 Ga0068871_100640227 Ga0068871_1006402273 49
748 3300006881 Ga0068865_100505232 Ga0068865_1005052321 49
749 3300006881 Ga0068865_101100683 Ga0068865_1011006831 49
750 3300006931 Ga0097620_101799161 Ga0097620_1017991612 49
751 3300009093 Ga0105240_10059150 Ga0105240_100591505 49
752 3300009093 Ga0105240_10061454 Ga0105240_100614544 49
753 3300009093 Ga0105240_10762312 Ga0105240_107623122 49
754 3300009093 Ga0105240_11111977 Ga0105240_111119771 49
755 3300009093 Ga0105240_11497022 Ga0105240_114970222 49
756 3300009093 Ga0105240_11967403 Ga0105240_119674031 49
757 3300009098 Ga0105245_10440947 Ga0105245_104409472 49
758 3300009101 Ga0105247_10448093 Ga0105247_104480933 49
759 3300009101 Ga0105247_11002055 Ga0105247_110020552 49
760 3300009148 Ga0105243_11420752 Ga0105243_114207522 49
761 3300009148 Ga0105243_11691615 Ga0105243_116916151 49
762 3300009174 Ga0105241_10081072 Ga0105241_100810724 49
763 3300009174 Ga0105241_10253459 Ga0105241_102534592 49
764 3300009174 Ga0105241_11461227 Ga0105241_114612272 49
765 3300009177 Ga0105248_10173347 Ga0105248_101733473 49
766 3300009177 Ga0105248_12077331 Ga0105248_120773311 49
767 3300009545 Ga0105237_10009094 Ga0105237_100090941 49
768 3300009545 Ga0105237_10138333 Ga0105237_101383333 49
769 3300009545 Ga0105237_10799817 Ga0105237_107998172 49
770 3300009545 Ga0105237_10947979 Ga0105237_109479793 49
771 3300009551 Ga0105238_10003517 Ga0105238_1000351710 49
772 3300009551 Ga0105238_10191520 Ga0105238_101915203 49
773 3300009551 Ga0105238_10254791 Ga0105238_102547913 49
774 3300009551 Ga0105238_12982749 Ga0105238_129827491 49
775 3300010375 Ga0105239_10099609 Ga0105239_100996093 49
776 3300010375 Ga0105239_10118616 Ga0105239_101186163 49
777 3300010375 Ga0105239_10158197 Ga0105239_101581973 49
778 3300010375 Ga0105239_10164361 Ga0105239_101643612 49
779 3300010375 Ga0105239_10181533 Ga0105239_101815333 49
780 3300010375 Ga0105239_10267037 Ga0105239_102670372 49
781 3300010375 Ga0105239_10436143 Ga0105239_104361431 49
782 3300010375 Ga0105239_10729445 Ga0105239_107294452 49
783 3300010375 Ga0105239_10759015 Ga0105239_107590152 49
784 3300010375 Ga0105239_11599131 Ga0105239_115991311 49
785 3300011119 Ga0105246_11439485 Ga0105246_114394852 49
786 3300013104 Ga0157370_10180720 Ga0157370_101807202 49
787 3300013104 Ga0157370_10220044 Ga0157370_102200443 49
788 3300013105 Ga0157369_10171634 Ga0157369_101716343 49
789 3300013105 Ga0157369_10783890 Ga0157369_107838902 49
790 3300013105 Ga0157369_10791152 Ga0157369_107911523 49
791 3300013296 Ga0157374_10076369 Ga0157374_100763693 49
792 3300013296 Ga0157374_10279860 Ga0157374_102798603 49
793 3300013297 Ga0157378_10146986 Ga0157378_101469863 49
794 3300013306 Ga0163162_10218040 Ga0163162_102180403 49
795 3300013306 Ga0163162_10686908 Ga0163162_106869083 49
796 3300013307 Ga0157372_10494947 Ga0157372_104949472 49
797 3300014325 Ga0163163_10151077 Ga0163163_101510772 49
798 3300014497 Ga0182008_10249686 Ga0182008_102496862 49
799 3300014968 Ga0157379_10362897 Ga0157379_103628972 49
800 3300014968 Ga0157379_10617552 Ga0157379_106175522 49
801 3300014969 Ga0157376_11410968 Ga0157376_114109682 49
802 3300015261 Ga0182006_1178185 Ga0182006_11781852 49
803 3300017792 Ga0163161_10109379 Ga0163161_101093792 49
804 3300017792 Ga0163161_10580314 Ga0163161_105803141 49
805 3300025250 Ga0209026_1000050 Ga0209026_1000050119 49
806 3300025250 Ga0209026_1062093 Ga0209026_10620931 49
807 3300025254 Ga0209148_1000032 Ga0209148_1000032333 49
808 3300025256 Ga0209759_1000891 Ga0209759_100089114 49
809 3300025256 Ga0209759_1051238 Ga0209759_10512382 49
810 3300025261 Ga0209233_1000034 Ga0209233_100003494 49
811 3300025261 Ga0209233_1012371 Ga0209233_10123713 49
812 3300025297 Ga0209758_1008143 Ga0209758_10081438 49
813 3300025315 Ga0207697_10416142 Ga0207697_104161421 49
814 3300025321 Ga0207656_10112723 Ga0207656_101127231 49
815 3300025321 Ga0207656_10235560 Ga0207656_102355601 49
816 3300025321 Ga0207656_10397757 Ga0207656_103977572 49
817 3300025900 Ga0207710_10333561 Ga0207710_103335612 49
818 3300025904 Ga0207647_10002871 Ga0207647_100028716 49
819 3300025904 Ga0207647_10140070 Ga0207647_101400702 49
820 3300025904 Ga0207647_10423436 Ga0207647_104234362 49
821 3300025909 Ga0207705_10074750 Ga0207705_100747503 49
822 3300025911 Ga0207654_10035690 Ga0207654_100356904 49
823 3300025911 Ga0207654_10050624 Ga0207654_100506243 49
824 3300025911 Ga0207654_10097988 Ga0207654_100979882 49
825 3300025913 Ga0207695_10044260 Ga0207695_100442604 49
826 3300025913 Ga0207695_10063100 Ga0207695_100631002 49
827 3300025913 Ga0207695_10068811 Ga0207695_100688114 49
828 3300025913 Ga0207695_10241541 Ga0207695_102415413 49
829 3300025914 Ga0207671_10052890 Ga0207671_100528901 49
830 3300025914 Ga0207671_10180471 Ga0207671_101804711 49
831 3300025914 Ga0207671_10835395 Ga0207671_108353951 49
832 3300025914 Ga0207671_11052088 Ga0207671_110520881 49
833 3300025919 Ga0207657_10121959 Ga0207657_101219592 49
834 3300025923 Ga0207681_10986082 Ga0207681_109860821 49
835 3300025924 Ga0207694_10114041 Ga0207694_101140411 49
836 3300025924 Ga0207694_10175086 Ga0207694_101750863 49
837 3300025924 Ga0207694_10563001 Ga0207694_105630012 49
838 3300025924 Ga0207694_10949165 Ga0207694_109491652 49
839 3300025925 Ga0207650_10049617 Ga0207650_100496175 49
840 3300025926 Ga0207659_11225866 Ga0207659_112258662 49
841 3300025927 Ga0207687_11165520 Ga0207687_111655202 49
842 3300025932 Ga0207690_10756531 Ga0207690_107565313 49
843 3300025932 Ga0207690_11210805 Ga0207690_112108052 49
844 3300025933 Ga0207706_10001802 Ga0207706_1000180215 49
845 3300025933 Ga0207706_10302853 Ga0207706_103028532 49
846 3300025937 Ga0207669_10761588 Ga0207669_107615882 49
847 3300025938 Ga0207704_10099540 Ga0207704_100995402 49
848 3300025938 Ga0207704_10900818 Ga0207704_109008181 49
849 3300025938 Ga0207704_11021919 Ga0207704_110219192 49
850 3300025941 Ga0207711_10113619 Ga0207711_101136193 49
851 3300025949 Ga0207667_10080924 Ga0207667_100809244 49
852 3300025949 Ga0207667_10246887 Ga0207667_102468873 49
853 3300025961 Ga0207712_10000286 Ga0207712_1000028625 49
854 3300025972 Ga0207668_10823577 Ga0207668_108235772 49
855 3300025981 Ga0207640_10334562 Ga0207640_103345622 49
856 3300025981 Ga0207640_11206571 Ga0207640_112065712 49
857 3300025986 Ga0207658_10019417 Ga0207658_100194174 49
858 3300025986 Ga0207658_10121969 Ga0207658_101219692 49
859 3300026035 Ga0207703_10002368 Ga0207703_100023687 49
860 3300026041 Ga0207639_10001087 Ga0207639_1000108710 49
861 3300026041 Ga0207639_10055044 Ga0207639_100550442 49
862 3300026041 Ga0207639_10261893 Ga0207639_102618931 49
863 3300026041 Ga0207639_10265260 Ga0207639_102652603 49
864 3300026067 Ga0207678_10025302 Ga0207678_100253021 49
865 3300026067 Ga0207678_10082193 Ga0207678_100821933 49
866 3300026067 Ga0207678_10159219 Ga0207678_101592192 49
867 3300026067 Ga0207678_10291214 Ga0207678_102912142 49
868 3300026067 Ga0207678_10864583 Ga0207678_108645831 49
869 3300026078 Ga0207702_10094264 Ga0207702_100942642 49
870 3300026078 Ga0207702_10102388 Ga0207702_101023881 49
871 3300026078 Ga0207702_10124196 Ga0207702_101241963 49
872 3300026078 Ga0207702_10289519 Ga0207702_102895193 49
873 3300026089 Ga0207648_10511798 Ga0207648_105117982 49
874 3300026116 Ga0207674_10826329 Ga0207674_108263292 49
875 3300026121 Ga0207683_10364050 Ga0207683_103640502 49
876 3300026142 Ga0207698_10339836 Ga0207698_103398361 49
877 3300026142 Ga0207698_10340571 Ga0207698_103405712 49
878 3300027866 Ga0209813_10042291 Ga0209813_100422912 49
879 3300028379 Ga0268266_10000007 Ga0268266_100000071013 49
880 3300028379 Ga0268266_10013394 Ga0268266_100133944 49
881 3300028379 Ga0268266_10052877 Ga0268266_100528773 49
882 3300028379 Ga0268266_10264158 Ga0268266_102641581 49
883 3300028379 Ga0268266_11789772 Ga0268266_117897721 49
884 3300028381 Ga0268264_11533885 Ga0268264_115338851 49
885 3300028794 Ga0307515_10213160 Ga0307515_102131602 49
886 3300031616 Ga0307508_10509540 Ga0307508_105095402 49
887 3300031711 Ga0265314_10643553 Ga0265314_106435531 49
888 3300031824 Ga0307413_10425752 Ga0307413_104257523 49
889 3300031911 Ga0307412_11221729 Ga0307412_112217291 49
890 3300031995 Ga0307409_102760842 Ga0307409_1027608423 49
891 3300033180 Ga0307510_10416343 Ga0307510_104163432 49
892 3300035115 Ga0373941_0268881 Ga0373941_0268881_135_284 49
893 3300037068 Ga0373925_1348402 Ga0373925_1348402_226_375 49
894 3300037312 Ga0395899_0292198 Ga0395899_0292198_846_995 49
895 3300037418 Ga0395900_0080559 Ga0395900_0080559_2966_3115 49
896 3300037418 Ga0395900_0140821 Ga0395900_0140821_88_237 49
897 3300037418 Ga0395900_0193173 Ga0395900_0193173_1126_1275 49
898 3300037418 Ga0395900_0606959 Ga0395900_0606959_283_432 49
899 3300037466 Ga0395898_0903223 Ga0395898_0903223_492_641 49
900 3300037471 Ga0395905_0017216 Ga0395905_0017216_867_1016 49
901 3300037471 Ga0395905_0082683 Ga0395905_0082683_2555_2704 49
902 3300037471 Ga0395905_0142672 Ga0395905_0142672_353_502 49
903 3300037471 Ga0395905_0373161 Ga0395905_0373161_395_544 49
904 3300037471 Ga0395905_0750857 Ga0395905_0750857_396_545 49
905 3300038443 Ga0395901_0128021 Ga0395901_0128021_1088_1237 49
906 3300038443 Ga0395901_0128937 Ga0395901_0128937_653_802 49
907 3300038443 Ga0395901_0259946 Ga0395901_0259946_379_528 49
908 3300038443 Ga0395901_0673417 Ga0395901_0673417_679_828 49
909 3300038443 Ga0395901_0678497 Ga0395901_0678497_429_578 49
910 3300041451 Ga0451791_1322022 Ga0451791_1322022_288_437 49
911 3300041453 Ga0451797_0765934 Ga0451797_0765934_129_278 49
912 3300041456 Ga0451795_0778622 Ga0451795_0778622_158_307 49
913 3300041460 Ga0451802_0028054 Ga0451802_0028054_13_162 49
914 3300041486 Ga0451807_1395372 Ga0451807_1395372_156_305 49
915 3300041494 Ga0451837_1562523 Ga0451837_1562523_122_271 49
916 3300041498 Ga0451841_0543752 Ga0451841_0543752_124_273 49
917 3300041501 Ga0451845_0714657 Ga0451845_0714657_205_354 49
918 3300041512 Ga0451853_2014640 Ga0451853_2014640_556_705 49
919 3300041512 Ga0451853_3343357 Ga0451853_3343357_171_320 49
920 3300044658 Ga0466972_0015806 Ga0466972_0015806_242_391 49
921 3300044658 Ga0466972_0158797 Ga0466972_0158797_250_399 49
922 3300044735 Ga0466968_0178091 Ga0466968_0178091_284_433 49
923 3300044901 Ga0466960_0015562 Ga0466960_0015562_1181_1330 49
924 3300046500 Ga0495596_0255550 Ga0495596_0255550_508_657 49
925 3300046507 Ga0495606_0532206 Ga0495606_0532206_94_243 49
926 3300046515 Ga0495620_0063158 Ga0495620_0063158_1147_1296 49
927 3300046515 Ga0495620_0289251 Ga0495620_0289251_201_350 49
928 3300046519 Ga0495632_0128243 Ga0495632_0128243_270_419 49
929 3300046522 Ga0495643_0186616 Ga0495643_0186616_580_729 49
930 3300046522 Ga0495643_0196006 Ga0495643_0196006_219_368 49
931 3300046528 Ga0495642_0225414 Ga0495642_0225414_461_610 49
932 3300046660 Ga0495625_0171020 Ga0495625_0171020_568_717 49
933 3300046674 Ga0495588_0270199 Ga0495588_0270199_689_838 49
934 3300046810 Ga0495660_0201499 Ga0495660_0201499_602_751 49
935 3300047443 Ga0495687_053816 Ga0495687_053816_576_725 49
936 3300047472 Ga0495686_0100077 Ga0495686_0100077_1514_1663 49
937 3300047472 Ga0495686_0211033 Ga0495686_0211033_723_872 49
938 3300047472 Ga0495686_0236703 Ga0495686_0236703_426_575 49
939 3300047472 Ga0495686_0340068 Ga0495686_0340068_547_696 49
940 3300048905 Ga0496102_0582595 Ga0496102_0582595_721_870 49
941 3300048905 Ga0496102_0603027 Ga0496102_0603027_224_373 49
942 3300048905 Ga0496102_0609196 Ga0496102_0609196_44_193 49
943 3300048905 Ga0496102_1197689 Ga0496102_1197689_134_283 49
944 3300048906 Ga0496103_0392709 Ga0496103_0392709_695_844 49
945 3300048906 Ga0496103_0758974 Ga0496103_0758974_82_231 49
946 3300048907 Ga0496104_0670317 Ga0496104_0670317_781_930 49
947 3300048907 Ga0496104_0896937 Ga0496104_0896937_289_438 49
948 3300048910 Ga0496107_0971821 Ga0496107_0971821_40_189 49
949 3300048913 Ga0496110_0345184 Ga0496110_0345184_1077_1226 49
950 3300048915 Ga0496112_0534093 Ga0496112_0534093_175_324 49
951 3300048915 Ga0496112_0923917 Ga0496112_0923917_599_748 49
952 3300048916 Ga0496113_0232009 Ga0496113_0232009_1309_1458 49
953 3300048916 Ga0496113_0328191 Ga0496113_0328191_170_319 49
954 3300048916 Ga0496113_1453958 Ga0496113_1453958_211_360 49
955 3300048917 Ga0496114_0573759 Ga0496114_0573759_329_478 49
956 3300048920 Ga0496117_0268786 Ga0496117_0268786_163_312 49
957 3300048922 Ga0496119_0089279 Ga0496119_0089279_701_850 49
958 3300048922 Ga0496119_0558548 Ga0496119_0558548_278_427 49
959 3300048923 Ga0496120_0000455 Ga0496120_0000455_1118_1267 49
960 3300048923 Ga0496120_0134647 Ga0496120_0134647_227_376 49
961 3300048923 Ga0496120_0442601 Ga0496120_0442601_77_226 49
962 3300048924 Ga0496121_0365369 Ga0496121_0365369_125_274 49
963 3300048924 Ga0496121_0457284 Ga0496121_0457284_609_758 49
964 3300048925 Ga0496122_0258255 Ga0496122_0258255_296_445 49
965 3300048927 Ga0496124_0346911 Ga0496124_0346911_202_381 49
966 3300048928 Ga0496125_0043904 Ga0496125_0043904_904_1053 49
967 3300048929 Ga0496126_0116420 Ga0496126_0116420_671_820 49
968 3300048929 Ga0496126_0120695 Ga0496126_0120695_998_1147 49
969 3300049568 Ga0501031_0005336 Ga0501031_0005336_4972_5121 49
970 3300049569 Ga0501032_0000067 Ga0501032_0000067_10271_10420 49
971 3300049569 Ga0501032_0636923 Ga0501032_0636923_501_650 49
972 3300049570 Ga0501033_0000117 Ga0501033_0000117_4972_5121 49
973 3300049571 Ga0501034_0000153 Ga0501034_0000153_50253_50402 49
974 3300049572 Ga0501036_0008779 Ga0501036_0008779_4995_5144 49
975 3300049573 Ga0501037_0000081 Ga0501037_0000081_7805_7954 49
976 3300049574 Ga0501038_0000033 Ga0501038_0000033_79491_79640 49
977 3300049575 Ga0501039_0000031 Ga0501039_0000031_50203_50352 49
978 3300049579 Ga0501043_0000044 Ga0501043_0000044_34665_34814 49
979 3300049580 Ga0501046_0083687 Ga0501046_0083687_1199_1348 49
980 3300049581 Ga0501047_1039152 Ga0501047_1039152_379_528 49
981 3300049584 Ga0501068_0947563 Ga0501068_0947563_63_212 49
982 3300049586 Ga0501070_0997363 Ga0501070_0997363_435_584 49
983 3300049822 Ga0501035_0000472 Ga0501035_0000472_4979_5128 49
984 3300049823 Ga0501044_0014405 Ga0501044_0014405_3410_3559 49
985 3300049823 Ga0501044_0475613 Ga0501044_0475613_975_1124 49
986 3300050490 nmdc:mga03n38_155457_c1 nmdc:mga03n38_155457_c1_245_394 49
987 3300050491 nmdc:mga00v17_144100_c1 nmdc:mga00v17_144100_c1_678_827 49
988 3300050491 nmdc:mga00v17_81391_c1 nmdc:mga00v17_81391_c1_1708_1857 49
989 3300050491 nmdc:mga00v17_84199_c1 nmdc:mga00v17_84199_c1_210_359 49
990 3300050492 nmdc:mga0yw44_159047_c1 nmdc:mga0yw44_159047_c1_623_772 49
991 3300050492 nmdc:mga0yw44_253999_c1 nmdc:mga0yw44_253999_c1_732_881 49
992 3300050492 nmdc:mga0yw44_256489_c1 nmdc:mga0yw44_256489_c1_959_1108 49
993 3300050492 nmdc:mga0yw44_54408_c1 nmdc:mga0yw44_54408_c1_2008_2163 49
994 3300050493 nmdc:mga0k408_547213_c1 nmdc:mga0k408_547213_c1_175_324 49
995 3300050494 nmdc:mga06z11_178799_c1 nmdc:mga06z11_178799_c1_784_933 49
996 3300050494 nmdc:mga06z11_290636_c1 nmdc:mga06z11_290636_c1_243_392 49
997 3300050495 nmdc:mga04h51_69223_c1 nmdc:mga04h51_69223_c1_1040_1189 49
998 3300050496 nmdc:mga07m45_332704_c1 nmdc:mga07m45_332704_c1_578_727 49
999 3300053077 Ga0495601_0343647 Ga0495601_0343647_434_583 49
1000 3300053079 Ga0500610_0012946 Ga0500610_0012946_1084_1233 49
1001 3300053079 Ga0500610_0192265 Ga0500610_0192265_721_870 49
1002 3300053083 Ga0495655_0032605 Ga0495655_0032605_894_1043 49
1003 3300053094 Ga0500566_0530955 Ga0500566_0530955_95_244 49
1004 3300053098 Ga0500650_0383878 Ga0500650_0383878_75_224 49
1005 3300053119 Ga0500595_041988 Ga0500595_041988_669_818 49
1006 3300053119 Ga0500595_192134 Ga0500595_192134_33_182 49
1007 3300053151 Ga0500604_0265557 Ga0500604_0265557_267_416 49
1008 3300053155 Ga0500620_010708 Ga0500620_010708_1969_2118 49
1009 3300053155 Ga0500620_098708 Ga0500620_098708_388_537 49
1010 3300053158 Ga0500627_0146894 Ga0500627_0146894_892_1041 49
1011 3300053727 Ga0500611_022925 Ga0500611_022925_17_166 49
1012 3300059492 Ga0587073_0284930 Ga0587073_0284930_341_490 49
1013 3300059605 Ga0587106_128633 Ga0587106_128633_323_472 49
1014 3300059643 Ga0587072_154827 Ga0587072_154827_53_202 49
1015 3300059655 Ga0587114_093791 Ga0587114_093791_377_526 49

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11295

DUF3096

Protein of unknown function (DUF3096)

20

56

0.97

Feature Viewer

pLDDT pTM Quality
86.33 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map