F488247
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1015 | 401 | 1015 | 50 |
Family's Representative Sequence
| Representative Sequence | 3300048927|Ga0496124_0346911|Ga0496124_0346911_202_381 |
| Length | 59 |
| Sequence | MAFNPGKEHHMHISQLALTPLISLIAGVLILVMPRLLNYIVALYLIVVGLLGLFPQLAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 100 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 101 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 213 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 220 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 221 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 224 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 229 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 231 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 232 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 233 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 234 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 235 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 236 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 237 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 238 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 239 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 240 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 241 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 243 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 244 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 246 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 249 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 250 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 251 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 252 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 260 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 261 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 262 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 263 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 264 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 265 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 266 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 267 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 272 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 273 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 274 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 314 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 315 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 316 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 317 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 318 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 321 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 322 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 323 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 324 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 325 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 326 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 327 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 328 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 329 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 330 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 331 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 332 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 333 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 334 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 335 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 337 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 356 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 361 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 362 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 363 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 364 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 365 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 366 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 374 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 376 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 378 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 379 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 380 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 381 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 382 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 383 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 384 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 385 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 386 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 387 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 388 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 389 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 390 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 391 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 392 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 393 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 395 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 396 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 397 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.41 |
| Metatranscriptomes | 0.59 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.5 |
| Nodule | 0.39 |
| Rhizoplane | 3.74 |
| Rhizosphere | 73.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10013514 | 3300001979 | Bacteria | 3041 |
| 2 | JGI24740J21852_10047535 | 3300001979 | Bacteria | 1252 |
| 3 | JGI24739J22299_10002039 | 3300001989 | Bacteria | 7740 |
| 4 | JGI24735J21928_10002948 | 3300002067 | Bacteria | 5851 |
| 5 | JGI24735J21928_10040493 | 3300002067 | Bacteria | 1360 |
| 6 | JGI25155J39150_1000285 | 3300002704 | Bacteria | 17934 |
| 7 | JGI25156J39149_1000168 | 3300002705 | Bacteria | 47907 |
| 8 | JGI25156J39149_1004985 | 3300002705 | Bacteria | 3921 |
| 9 | JGI25156J39149_1014953 | 3300002705 | Bacteria | 1575 |
| 10 | JGI25162J39368_1003783 | 3300002737 | Bacteria | 4036 |
| 11 | JGI25154J39366_1000185 | 3300002738 | Bacteria | 47907 |
| 12 | JGI25154J39366_1000245 | 3300002738 | Bacteria | 35470 |
| 13 | JGI25157J39369_1000429 | 3300002741 | Bacteria | 27371 |
| 14 | JGI25157J39369_1001872 | 3300002741 | Bacteria | 6455 |
| 15 | JGI25165J46597_1000147 | 3300003214 | Bacteria | 116564 |
| 16 | rootH1_10060681 | 3300003316 | Bacteria | 1897 |
| 17 | JGI25160J50197_1042927 | 3300003354 | Bacteria | 1024 |
| 18 | Ga0055532_1000050 | 3300003758 | Bacteria | 169240 |
| 19 | Ga0055535_1008146 | 3300003761 | Bacteria | 1918 |
| 20 | Ga0055529_1009834 | 3300003763 | Bacteria | 1248 |
| 21 | Ga0055528_1052701 | 3300003790 | Bacteria | 811 |
| 22 | Ga0055530_10008439 | 3300003791 | Bacteria | 4126 |
| 23 | Ga0065165_1009352 | 3300005262 | Bacteria | 4407 |
| 24 | Ga0065165_1103783 | 3300005262 | Bacteria | 708 |
| 25 | Ga0065704_10223530 | 3300005289 | Bacteria | 1053 |
| 26 | Ga0065704_10292439 | 3300005289 | Bacteria | 901 |
| 27 | Ga0065707_10300891 | 3300005295 | Bacteria | 989 |
| 28 | Ga0070658_10314433 | 3300005327 | Bacteria | 1337 |
| 29 | Ga0070658_11172460 | 3300005327 | Unclassified | 668 |
| 30 | Ga0070658_11255454 | 3300005327 | Bacteria | 644 |
| 31 | Ga0070658_11335603 | 3300005327 | Bacteria | 622 |
| 32 | Ga0070676_10504095 | 3300005328 | Bacteria | 860 |
| 33 | Ga0070676_10544954 | 3300005328 | Bacteria | 830 |
| 34 | Ga0070676_11449390 | 3300005328 | Bacteria | 528 |
| 35 | Ga0070683_100517115 | 3300005329 | Bacteria | 1141 |
| 36 | Ga0070683_100823835 | 3300005329 | Bacteria | 890 |
| 37 | Ga0070690_100767971 | 3300005330 | Bacteria | 745 |
| 38 | Ga0070690_101565610 | 3300005330 | Bacteria | 534 |
| 39 | Ga0070670_100066337 | 3300005331 | Bacteria | 3097 |
| 40 | Ga0070670_100371230 | 3300005331 | Bacteria | 1259 |
| 41 | Ga0068869_100230828 | 3300005334 | Bacteria | 1470 |
| 42 | Ga0068869_100373316 | 3300005334 | Bacteria | 1167 |
| 43 | Ga0070666_10004869 | 3300005335 | Bacteria | 8206 |
| 44 | Ga0070666_10250629 | 3300005335 | Bacteria | 1254 |
| 45 | Ga0070682_100894205 | 3300005337 | Bacteria | 729 |
| 46 | Ga0068868_100363275 | 3300005338 | Bacteria | 1242 |
| 47 | Ga0068868_100399695 | 3300005338 | Bacteria | 1186 |
| 48 | Ga0070660_100179601 | 3300005339 | Bacteria | 1712 |
| 49 | Ga0070660_100920092 | 3300005339 | Bacteria | 738 |
| 50 | Ga0070660_101873411 | 3300005339 | Unclassified | 511 |
| 51 | Ga0070689_101003968 | 3300005340 | Bacteria | 742 |
| 52 | Ga0070691_10077465 | 3300005341 | Bacteria | 1623 |
| 53 | Ga0070691_10363956 | 3300005341 | Bacteria | 806 |
| 54 | Ga0070691_10446418 | 3300005341 | Bacteria | 738 |
| 55 | Ga0070691_11014139 | 3300005341 | Bacteria | 519 |
| 56 | Ga0070687_100047222 | 3300005343 | Bacteria | 2208 |
| 57 | Ga0070661_100046521 | 3300005344 | Bacteria | 3174 |
| 58 | Ga0070661_100886922 | 3300005344 | Bacteria | 736 |
| 59 | Ga0070661_101079581 | 3300005344 | Bacteria | 668 |
| 60 | Ga0070692_10904175 | 3300005345 | Bacteria | 610 |
| 61 | Ga0070668_100219865 | 3300005347 | Bacteria | 1566 |
| 62 | Ga0070668_100294462 | 3300005347 | Bacteria | 1359 |
| 63 | Ga0070668_100382004 | 3300005347 | Bacteria | 1199 |
| 64 | Ga0070668_100908346 | 3300005347 | Bacteria | 787 |
| 65 | Ga0070669_100262145 | 3300005353 | Bacteria | 1379 |
| 66 | Ga0070669_100753245 | 3300005353 | Bacteria | 825 |
| 67 | Ga0070669_100850399 | 3300005353 | Bacteria | 777 |
| 68 | Ga0070669_101702996 | 3300005353 | Bacteria | 549 |
| 69 | Ga0070675_100049484 | 3300005354 | Bacteria | 3450 |
| 70 | Ga0070675_100269594 | 3300005354 | Bacteria | 1493 |
| 71 | Ga0070675_100942679 | 3300005354 | Bacteria | 792 |
| 72 | Ga0070675_101080373 | 3300005354 | Bacteria | 737 |
| 73 | Ga0070671_100442975 | 3300005355 | Bacteria | 1114 |
| 74 | Ga0070674_100287186 | 3300005356 | Bacteria | 1306 |
| 75 | Ga0070674_100412160 | 3300005356 | Bacteria | 1107 |
| 76 | Ga0070674_102115227 | 3300005356 | Bacteria | 513 |
| 77 | Ga0070673_100421894 | 3300005364 | Bacteria | 1196 |
| 78 | Ga0070673_100947910 | 3300005364 | Bacteria | 800 |
| 79 | Ga0070688_100070462 | 3300005365 | Bacteria | 2235 |
| 80 | Ga0070659_100349804 | 3300005366 | Bacteria | 1239 |
| 81 | Ga0070659_100376180 | 3300005366 | Bacteria | 1196 |
| 82 | Ga0070659_101440702 | 3300005366 | Bacteria | 613 |
| 83 | Ga0070659_101461581 | 3300005366 | Bacteria | 608 |
| 84 | Ga0070667_100014791 | 3300005367 | Bacteria | 6447 |
| 85 | Ga0070667_100037624 | 3300005367 | Bacteria | 4057 |
| 86 | Ga0070667_100220162 | 3300005367 | Bacteria | 1689 |
| 87 | Ga0070667_100414315 | 3300005367 | Bacteria | 1228 |
| 88 | Ga0070667_100516892 | 3300005367 | Bacteria | 1095 |
| 89 | Ga0070667_101498056 | 3300005367 | Bacteria | 633 |
| 90 | Ga0070714_100020874 | 3300005435 | Bacteria | 5354 |
| 91 | Ga0070714_100161864 | 3300005435 | Bacteria | 2025 |
| 92 | Ga0070714_100221090 | 3300005435 | Bacteria | 1740 |
| 93 | Ga0070714_101733893 | 3300005435 | Bacteria | 610 |
| 94 | Ga0070713_100021206 | 3300005436 | Bacteria | 4993 |
| 95 | Ga0070711_100462835 | 3300005439 | Bacteria | 1040 |
| 96 | Ga0070700_100054334 | 3300005441 | Bacteria | 2502 |
| 97 | Ga0070700_101345854 | 3300005441 | Bacteria | 602 |
| 98 | Ga0070694_100038566 | 3300005444 | Bacteria | 3175 |
| 99 | Ga0070694_100531411 | 3300005444 | Bacteria | 939 |
| 100 | Ga0070663_100023376 | 3300005455 | Bacteria | 4142 |
| 101 | Ga0070663_100031241 | 3300005455 | Bacteria | 3659 |
| 102 | Ga0070663_100158000 | 3300005455 | Bacteria | 1743 |
| 103 | Ga0070663_100244805 | 3300005455 | Bacteria | 1417 |
| 104 | Ga0070663_100256293 | 3300005455 | Bacteria | 1386 |
| 105 | Ga0070663_100287791 | 3300005455 | Bacteria | 1311 |
| 106 | Ga0070663_100289085 | 3300005455 | Bacteria | 1309 |
| 107 | Ga0070663_100711292 | 3300005455 | Bacteria | 855 |
| 108 | Ga0070663_100725075 | 3300005455 | Bacteria | 847 |
| 109 | Ga0070663_101417682 | 3300005455 | Bacteria | 616 |
| 110 | Ga0070663_101836544 | 3300005455 | Bacteria | 544 |
| 111 | Ga0070663_101863546 | 3300005455 | Bacteria | 540 |
| 112 | Ga0070678_100186469 | 3300005456 | Bacteria | 1702 |
| 113 | Ga0070678_100204119 | 3300005456 | Bacteria | 1633 |
| 114 | Ga0070678_100884653 | 3300005456 | Bacteria | 816 |
| 115 | Ga0070678_100898688 | 3300005456 | Bacteria | 809 |
| 116 | Ga0070678_100943929 | 3300005456 | Bacteria | 790 |
| 117 | Ga0070678_101255587 | 3300005456 | Bacteria | 688 |
| 118 | Ga0070662_100005114 | 3300005457 | Bacteria | 8361 |
| 119 | Ga0070681_11087527 | 3300005458 | Bacteria | 720 |
| 120 | Ga0070706_100018724 | 3300005467 | Bacteria | 6384 |
| 121 | Ga0070706_100623902 | 3300005467 | Bacteria | 1001 |
| 122 | Ga0070698_100054973 | 3300005471 | Bacteria | 4040 |
| 123 | Ga0070698_100067072 | 3300005471 | Unclassified | 3610 |
| 124 | Ga0070698_101296037 | 3300005471 | Bacteria | 678 |
| 125 | Ga0070699_100585868 | 3300005518 | Bacteria | 1017 |
| 126 | Ga0070684_100524449 | 3300005535 | Bacteria | 1098 |
| 127 | Ga0070697_101840214 | 3300005536 | Bacteria | 542 |
| 128 | Ga0068853_100029492 | 3300005539 | Bacteria | 4626 |
| 129 | Ga0068853_100319291 | 3300005539 | Bacteria | 1439 |
| 130 | Ga0068853_100341109 | 3300005539 | Bacteria | 1392 |
| 131 | Ga0068853_100381560 | 3300005539 | Bacteria | 1316 |
| 132 | Ga0068853_100703249 | 3300005539 | Bacteria | 964 |
| 133 | Ga0068853_100727705 | 3300005539 | Bacteria | 947 |
| 134 | Ga0068853_100951970 | 3300005539 | Bacteria | 826 |
| 135 | Ga0068853_101209781 | 3300005539 | Bacteria | 729 |
| 136 | Ga0068853_101680477 | 3300005539 | Bacteria | 615 |
| 137 | Ga0068853_102366403 | 3300005539 | Bacteria | 514 |
| 138 | Ga0070672_101702862 | 3300005543 | Bacteria | 566 |
| 139 | Ga0070695_100085770 | 3300005545 | Bacteria | 2091 |
| 140 | Ga0070695_100351489 | 3300005545 | Bacteria | 1104 |
| 141 | Ga0070695_101777788 | 3300005545 | Bacteria | 517 |
| 142 | Ga0070693_100499626 | 3300005547 | Bacteria | 862 |
| 143 | Ga0070665_100000778 | 3300005548 | Bacteria | 41953 |
| 144 | Ga0070665_100001771 | 3300005548 | Bacteria | 24595 |
| 145 | Ga0070665_100021841 | 3300005548 | Bacteria | 6436 |
| 146 | Ga0070665_100050498 | 3300005548 | Bacteria | 4173 |
| 147 | Ga0070665_100171044 | 3300005548 | Bacteria | 2174 |
| 148 | Ga0070665_100190059 | 3300005548 | Bacteria | 2054 |
| 149 | Ga0070665_100227245 | 3300005548 | Bacteria | 1866 |
| 150 | Ga0070665_100439706 | 3300005548 | Bacteria | 1313 |
| 151 | Ga0070665_102113295 | 3300005548 | Bacteria | 568 |
| 152 | Ga0068855_100018720 | 3300005563 | Bacteria | 8326 |
| 153 | Ga0068855_100387978 | 3300005563 | Bacteria | 1532 |
| 154 | Ga0068855_100697493 | 3300005563 | Bacteria | 1087 |
| 155 | Ga0068855_101283159 | 3300005563 | Bacteria | 759 |
| 156 | Ga0068855_101426752 | 3300005563 | Bacteria | 713 |
| 157 | Ga0070664_100140986 | 3300005564 | Bacteria | 2122 |
| 158 | Ga0070664_100229728 | 3300005564 | Bacteria | 1663 |
| 159 | Ga0070664_101117259 | 3300005564 | Bacteria | 743 |
| 160 | Ga0070664_101754108 | 3300005564 | Bacteria | 589 |
| 161 | Ga0068854_100156413 | 3300005578 | Bacteria | 1762 |
| 162 | Ga0068854_101058707 | 3300005578 | Bacteria | 721 |
| 163 | Ga0068854_101536123 | 3300005578 | Bacteria | 605 |
| 164 | Ga0068856_100028271 | 3300005614 | Bacteria | 5475 |
| 165 | Ga0068856_100138824 | 3300005614 | Bacteria | 2437 |
| 166 | Ga0068856_100385836 | 3300005614 | Bacteria | 1420 |
| 167 | Ga0068856_100408509 | 3300005614 | Bacteria | 1377 |
| 168 | Ga0068856_100504705 | 3300005614 | Bacteria | 1231 |
| 169 | Ga0068856_100790700 | 3300005614 | Bacteria | 968 |
| 170 | Ga0068856_101154138 | 3300005614 | Bacteria | 791 |
| 171 | Ga0068852_100143206 | 3300005616 | Bacteria | 2214 |
| 172 | Ga0068852_100289998 | 3300005616 | Bacteria | 1580 |
| 173 | Ga0068852_100746806 | 3300005616 | Bacteria | 990 |
| 174 | Ga0068852_100756000 | 3300005616 | Bacteria | 984 |
| 175 | Ga0068852_101033037 | 3300005616 | Bacteria | 841 |
| 176 | Ga0068852_101274626 | 3300005616 | Bacteria | 756 |
| 177 | Ga0068859_100069591 | 3300005617 | Bacteria | 3554 |
| 178 | Ga0068859_100069885 | 3300005617 | Bacteria | 3547 |
| 179 | Ga0068859_101799198 | 3300005617 | Bacteria | 677 |
| 180 | Ga0068864_100528729 | 3300005618 | Bacteria | 1138 |
| 181 | Ga0068864_101001603 | 3300005618 | Bacteria | 829 |
| 182 | Ga0068864_102445082 | 3300005618 | Bacteria | 529 |
| 183 | Ga0068861_100159665 | 3300005719 | Bacteria | 1858 |
| 184 | Ga0068861_100759481 | 3300005719 | Bacteria | 906 |
| 185 | Ga0068861_101082105 | 3300005719 | Bacteria | 770 |
| 186 | Ga0068861_102694114 | 3300005719 | Bacteria | 501 |
| 187 | Ga0068851_10011579 | 3300005834 | Bacteria | 4139 |
| 188 | Ga0068851_10256520 | 3300005834 | Bacteria | 993 |
| 189 | Ga0068851_10761710 | 3300005834 | Bacteria | 599 |
| 190 | Ga0068851_10951395 | 3300005834 | Bacteria | 540 |
| 191 | Ga0068870_10463712 | 3300005840 | Bacteria | 837 |
| 192 | Ga0068863_100008576 | 3300005841 | Bacteria | 9990 |
| 193 | Ga0068863_100316694 | 3300005841 | Bacteria | 1515 |
| 194 | Ga0068863_101348929 | 3300005841 | Bacteria | 720 |
| 195 | Ga0068863_102199813 | 3300005841 | Bacteria | 561 |
| 196 | Ga0068858_100002518 | 3300005842 | Bacteria | 18454 |
| 197 | Ga0068858_100008681 | 3300005842 | Bacteria | 9755 |
| 198 | Ga0068858_102506059 | 3300005842 | Bacteria | 509 |
| 199 | Ga0068860_100064420 | 3300005843 | Bacteria | 3481 |
| 200 | Ga0068860_100228673 | 3300005843 | Bacteria | 1807 |
| 201 | Ga0068860_100393836 | 3300005843 | Bacteria | 1369 |
| 202 | Ga0068860_101024800 | 3300005843 | Bacteria | 844 |
| 203 | Ga0068860_102276117 | 3300005843 | Bacteria | 562 |
| 204 | Ga0068860_102769293 | 3300005843 | Bacteria | 508 |
| 205 | Ga0068862_100005681 | 3300005844 | Bacteria | 10409 |
| 206 | Ga0068862_100359643 | 3300005844 | Bacteria | 1352 |
| 207 | Ga0068862_100373904 | 3300005844 | Bacteria | 1327 |
| 208 | Ga0068862_100737249 | 3300005844 | Bacteria | 957 |
| 209 | Ga0068862_101011478 | 3300005844 | Bacteria | 822 |
| 210 | Ga0081538_10056531 | 3300005981 | Bacteria | 2297 |
| 211 | Ga0070717_10356939 | 3300006028 | Bacteria | 1308 |
| 212 | Ga0070717_10579511 | 3300006028 | Bacteria | 1017 |
| 213 | Ga0075365_10008054 | 3300006038 | Bacteria | 5951 |
| 214 | Ga0075365_10019410 | 3300006038 | Bacteria | 4195 |
| 215 | Ga0075365_10042042 | 3300006038 | Bacteria | 2987 |
| 216 | Ga0075365_10050844 | 3300006038 | Bacteria | 2735 |
| 217 | Ga0075365_10136515 | 3300006038 | Bacteria | 1700 |
| 218 | Ga0075365_10219305 | 3300006038 | Bacteria | 1334 |
| 219 | Ga0075365_10366096 | 3300006038 | Bacteria | 1016 |
| 220 | Ga0075368_10010145 | 3300006042 | Bacteria | 3403 |
| 221 | Ga0075368_10059835 | 3300006042 | Bacteria | 1524 |
| 222 | Ga0075368_10084686 | 3300006042 | Bacteria | 1292 |
| 223 | Ga0075368_10357698 | 3300006042 | Bacteria | 636 |
| 224 | Ga0075363_100016696 | 3300006048 | Bacteria | 3630 |
| 225 | Ga0075363_100048225 | 3300006048 | Bacteria | 2264 |
| 226 | Ga0075363_100109067 | 3300006048 | Bacteria | 1537 |
| 227 | Ga0075363_100164697 | 3300006048 | Bacteria | 1257 |
| 228 | Ga0075363_100255157 | 3300006048 | Bacteria | 1010 |
| 229 | Ga0075363_100767230 | 3300006048 | Bacteria | 585 |
| 230 | Ga0075364_10013967 | 3300006051 | Bacteria | 4949 |
| 231 | Ga0075364_10081007 | 3300006051 | Bacteria | 2146 |
| 232 | Ga0075364_10144673 | 3300006051 | Bacteria | 1600 |
| 233 | Ga0075364_10686839 | 3300006051 | Bacteria | 699 |
| 234 | Ga0070716_100262904 | 3300006173 | Bacteria | 1182 |
| 235 | Ga0070712_100489010 | 3300006175 | Bacteria | 1030 |
| 236 | Ga0075362_10034290 | 3300006177 | Bacteria | 2212 |
| 237 | Ga0075362_10043133 | 3300006177 | Bacteria | 1996 |
| 238 | Ga0075362_10047661 | 3300006177 | Bacteria | 1909 |
| 239 | Ga0075362_10081871 | 3300006177 | Bacteria | 1489 |
| 240 | Ga0075362_10094100 | 3300006177 | Bacteria | 1394 |
| 241 | Ga0075362_10210340 | 3300006177 | Bacteria | 949 |
| 242 | Ga0075367_10010494 | 3300006178 | Bacteria | 4868 |
| 243 | Ga0075367_10030565 | 3300006178 | Bacteria | 3088 |
| 244 | Ga0075367_10059422 | 3300006178 | Bacteria | 2276 |
| 245 | Ga0075367_10080622 | 3300006178 | Bacteria | 1968 |
| 246 | Ga0075367_10132711 | 3300006178 | Bacteria | 1540 |
| 247 | Ga0075367_10326650 | 3300006178 | Bacteria | 967 |
| 248 | Ga0075367_10432529 | 3300006178 | Bacteria | 833 |
| 249 | Ga0075367_10519804 | 3300006178 | Bacteria | 755 |
| 250 | Ga0075367_10751006 | 3300006178 | Bacteria | 621 |
| 251 | Ga0075369_10014365 | 3300006186 | Bacteria | 3162 |
| 252 | Ga0075369_10015191 | 3300006186 | Bacteria | 3087 |
| 253 | Ga0075369_10207810 | 3300006186 | Bacteria | 904 |
| 254 | Ga0075366_10043033 | 3300006195 | Bacteria | 2675 |
| 255 | Ga0075366_10131825 | 3300006195 | Bacteria | 1508 |
| 256 | Ga0075366_10883572 | 3300006195 | Bacteria | 557 |
| 257 | Ga0097621_100263485 | 3300006237 | Bacteria | 1513 |
| 258 | Ga0097621_101110566 | 3300006237 | Bacteria | 743 |
| 259 | Ga0097621_101845026 | 3300006237 | Bacteria | 577 |
| 260 | Ga0097621_101872621 | 3300006237 | Bacteria | 572 |
| 261 | Ga0075370_10007676 | 3300006353 | Bacteria | 5508 |
| 262 | Ga0075370_10082152 | 3300006353 | Bacteria | 1852 |
| 263 | Ga0075370_10200649 | 3300006353 | Bacteria | 1177 |
| 264 | Ga0075370_10384002 | 3300006353 | Bacteria | 841 |
| 265 | Ga0068871_100640227 | 3300006358 | Bacteria | 970 |
| 266 | Ga0068871_101116781 | 3300006358 | Bacteria | 737 |
| 267 | Ga0068871_102006879 | 3300006358 | Bacteria | 551 |
| 268 | Ga0075428_100044800 | 3300006844 | Bacteria | 4861 |
| 269 | Ga0075428_100066058 | 3300006844 | Bacteria | 3961 |
| 270 | Ga0075428_101572210 | 3300006844 | Bacteria | 688 |
| 271 | Ga0075430_100921741 | 3300006846 | Bacteria | 720 |
| 272 | Ga0075430_101408962 | 3300006846 | Bacteria | 573 |
| 273 | Ga0075431_100149210 | 3300006847 | Bacteria | 2408 |
| 274 | Ga0075431_100204554 | 3300006847 | Bacteria | 2019 |
| 275 | Ga0075433_10845724 | 3300006852 | Bacteria | 799 |
| 276 | Ga0075429_100001760 | 3300006880 | Bacteria | 17924 |
| 277 | Ga0075429_100568100 | 3300006880 | Bacteria | 994 |
| 278 | Ga0068865_100505232 | 3300006881 | Bacteria | 1008 |
| 279 | Ga0068865_100756977 | 3300006881 | Bacteria | 835 |
| 280 | Ga0068865_101013723 | 3300006881 | Bacteria | 727 |
| 281 | Ga0068865_101100683 | 3300006881 | Bacteria | 700 |
| 282 | Ga0097620_100069591 | 3300006931 | Bacteria | 3554 |
| 283 | Ga0097620_100069885 | 3300006931 | Bacteria | 3547 |
| 284 | Ga0097620_101799161 | 3300006931 | Bacteria | 677 |
| 285 | Ga0079104_1000056 | 3300006946 | Bacteria | 166276 |
| 286 | Ga0099826_10157999 | 3300006948 | Bacteria | 1288 |
| 287 | Ga0105251_10001596 | 3300009011 | Bacteria | 19332 |
| 288 | Ga0105244_10269823 | 3300009036 | Bacteria | 790 |
| 289 | Ga0105250_10112457 | 3300009092 | Bacteria | 1116 |
| 290 | Ga0105250_10212425 | 3300009092 | Bacteria | 818 |
| 291 | Ga0105250_10283495 | 3300009092 | Bacteria | 713 |
| 292 | Ga0105240_10008179 | 3300009093 | Bacteria | 14996 |
| 293 | Ga0105240_10059150 | 3300009093 | Bacteria | 4784 |
| 294 | Ga0105240_10061454 | 3300009093 | Bacteria | 4681 |
| 295 | Ga0105240_10127106 | 3300009093 | Bacteria | 3062 |
| 296 | Ga0105240_10519837 | 3300009093 | Bacteria | 1321 |
| 297 | Ga0105240_10757023 | 3300009093 | Bacteria | 1055 |
| 298 | Ga0105240_10762312 | 3300009093 | Bacteria | 1051 |
| 299 | Ga0105240_11107972 | 3300009093 | Bacteria | 842 |
| 300 | Ga0105240_11111977 | 3300009093 | Bacteria | 840 |
| 301 | Ga0105240_11497022 | 3300009093 | Bacteria | 708 |
| 302 | Ga0105240_11904074 | 3300009093 | Bacteria | 619 |
| 303 | Ga0105240_11967403 | 3300009093 | Bacteria | 608 |
| 304 | Ga0105240_12300583 | 3300009093 | Bacteria | 558 |
| 305 | Ga0105240_12371562 | 3300009093 | Unclassified | 549 |
| 306 | Ga0111539_10619587 | 3300009094 | Bacteria | 1260 |
| 307 | Ga0111539_10739501 | 3300009094 | Bacteria | 1145 |
| 308 | Ga0105245_10440947 | 3300009098 | Bacteria | 1309 |
| 309 | Ga0105245_10707052 | 3300009098 | Bacteria | 1041 |
| 310 | Ga0105245_12451026 | 3300009098 | Bacteria | 575 |
| 311 | Ga0105247_10083289 | 3300009101 | Bacteria | 2020 |
| 312 | Ga0105247_10448093 | 3300009101 | Bacteria | 930 |
| 313 | Ga0105247_10942533 | 3300009101 | Bacteria | 670 |
| 314 | Ga0105247_11002055 | 3300009101 | Bacteria | 652 |
| 315 | Ga0105247_11750672 | 3300009101 | Bacteria | 515 |
| 316 | Ga0114129_10005806 | 3300009147 | Bacteria | 17476 |
| 317 | Ga0114129_10451997 | 3300009147 | Bacteria | 1685 |
| 318 | Ga0105243_10301244 | 3300009148 | Bacteria | 1453 |
| 319 | Ga0105243_11420752 | 3300009148 | Bacteria | 715 |
| 320 | Ga0105243_11691615 | 3300009148 | Bacteria | 661 |
| 321 | Ga0105243_12610887 | 3300009148 | Bacteria | 545 |
| 322 | Ga0105241_10081072 | 3300009174 | Bacteria | 2541 |
| 323 | Ga0105241_10253459 | 3300009174 | Bacteria | 1493 |
| 324 | Ga0105241_11211629 | 3300009174 | Unclassified | 715 |
| 325 | Ga0105241_11354902 | 3300009174 | Bacteria | 680 |
| 326 | Ga0105241_11461227 | 3300009174 | Bacteria | 656 |
| 327 | Ga0105241_12008479 | 3300009174 | Bacteria | 569 |
| 328 | Ga0105241_12483104 | 3300009174 | Bacteria | 519 |
| 329 | Ga0105242_10086392 | 3300009176 | Bacteria | 2632 |
| 330 | Ga0105248_10074394 | 3300009177 | Bacteria | 3818 |
| 331 | Ga0105248_10173347 | 3300009177 | Bacteria | 2431 |
| 332 | Ga0105248_10703108 | 3300009177 | Bacteria | 1140 |
| 333 | Ga0105248_12077331 | 3300009177 | Bacteria | 646 |
| 334 | Ga0105237_10009094 | 3300009545 | Bacteria | 10676 |
| 335 | Ga0105237_10138333 | 3300009545 | Bacteria | 2430 |
| 336 | Ga0105237_10381952 | 3300009545 | Bacteria | 1413 |
| 337 | Ga0105237_10473466 | 3300009545 | Bacteria | 1258 |
| 338 | Ga0105237_10799817 | 3300009545 | Bacteria | 950 |
| 339 | Ga0105237_10947979 | 3300009545 | Bacteria | 867 |
| 340 | Ga0105237_11106922 | 3300009545 | Bacteria | 799 |
| 341 | Ga0105237_11295390 | 3300009545 | Bacteria | 735 |
| 342 | Ga0105237_11980845 | 3300009545 | Bacteria | 591 |
| 343 | Ga0105238_10003517 | 3300009551 | Bacteria | 15606 |
| 344 | Ga0105238_10052215 | 3300009551 | Bacteria | 4110 |
| 345 | Ga0105238_10122725 | 3300009551 | Bacteria | 2577 |
| 346 | Ga0105238_10191520 | 3300009551 | Bacteria | 2021 |
| 347 | Ga0105238_10254791 | 3300009551 | Bacteria | 1734 |
| 348 | Ga0105238_10282932 | 3300009551 | Bacteria | 1640 |
| 349 | Ga0105238_10291740 | 3300009551 | Bacteria | 1613 |
| 350 | Ga0105238_12250467 | 3300009551 | Unclassified | 580 |
| 351 | Ga0105238_12982749 | 3300009551 | Bacteria | 509 |
| 352 | Ga0105249_10092339 | 3300009553 | Bacteria | 2834 |
| 353 | Ga0105249_10098527 | 3300009553 | Bacteria | 2746 |
| 354 | Ga0105249_10391235 | 3300009553 | Bacteria | 1418 |
| 355 | Ga0105249_11867444 | 3300009553 | Bacteria | 673 |
| 356 | Ga0105249_13359691 | 3300009553 | Bacteria | 515 |
| 357 | Ga0105239_10099609 | 3300010375 | Bacteria | 3213 |
| 358 | Ga0105239_10118616 | 3300010375 | Bacteria | 2936 |
| 359 | Ga0105239_10158197 | 3300010375 | Bacteria | 2531 |
| 360 | Ga0105239_10164361 | 3300010375 | Bacteria | 2481 |
| 361 | Ga0105239_10171834 | 3300010375 | Bacteria | 2424 |
| 362 | Ga0105239_10181533 | 3300010375 | Bacteria | 2355 |
| 363 | Ga0105239_10209027 | 3300010375 | Bacteria | 2187 |
| 364 | Ga0105239_10267037 | 3300010375 | Bacteria | 1924 |
| 365 | Ga0105239_10335177 | 3300010375 | Bacteria | 1707 |
| 366 | Ga0105239_10436143 | 3300010375 | Bacteria | 1485 |
| 367 | Ga0105239_10540272 | 3300010375 | Bacteria | 1327 |
| 368 | Ga0105239_10729445 | 3300010375 | Bacteria | 1134 |
| 369 | Ga0105239_10759015 | 3300010375 | Bacteria | 1110 |
| 370 | Ga0105239_11388705 | 3300010375 | Bacteria | 811 |
| 371 | Ga0105239_11599131 | 3300010375 | Bacteria | 754 |
| 372 | Ga0105239_11626254 | 3300010375 | Bacteria | 747 |
| 373 | Ga0105239_13094065 | 3300010375 | Bacteria | 542 |
| 374 | Ga0105246_10217503 | 3300011119 | Bacteria | 1495 |
| 375 | Ga0105246_10529946 | 3300011119 | Bacteria | 1006 |
| 376 | Ga0105246_11262369 | 3300011119 | Bacteria | 683 |
| 377 | Ga0105246_11439485 | 3300011119 | Bacteria | 644 |
| 378 | Ga0157338_1036967 | 3300012515 | Bacteria | 649 |
| 379 | Ga0157373_10093661 | 3300013100 | Bacteria | 2116 |
| 380 | Ga0157371_11198026 | 3300013102 | Bacteria | 585 |
| 381 | Ga0157370_10180720 | 3300013104 | Bacteria | 1960 |
| 382 | Ga0157370_10220044 | 3300013104 | Bacteria | 1759 |
| 383 | Ga0157369_10171634 | 3300013105 | Bacteria | 2285 |
| 384 | Ga0157369_10497695 | 3300013105 | Bacteria | 1261 |
| 385 | Ga0157369_10783890 | 3300013105 | Bacteria | 980 |
| 386 | Ga0157369_10791152 | 3300013105 | Bacteria | 975 |
| 387 | Ga0157369_10967080 | 3300013105 | Bacteria | 872 |
| 388 | Ga0157374_10051579 | 3300013296 | Bacteria | 3829 |
| 389 | Ga0157374_10076369 | 3300013296 | Bacteria | 3168 |
| 390 | Ga0157374_10193082 | 3300013296 | Bacteria | 1992 |
| 391 | Ga0157374_10279860 | 3300013296 | Bacteria | 1647 |
| 392 | Ga0157378_10146986 | 3300013297 | Bacteria | 2193 |
| 393 | Ga0157378_11134251 | 3300013297 | Bacteria | 820 |
| 394 | Ga0157378_11250949 | 3300013297 | Bacteria | 782 |
| 395 | Ga0163162_10001141 | 3300013306 | Bacteria | 24740 |
| 396 | Ga0163162_10139381 | 3300013306 | Bacteria | 2537 |
| 397 | Ga0163162_10218040 | 3300013306 | Bacteria | 2038 |
| 398 | Ga0163162_10686908 | 3300013306 | Bacteria | 1146 |
| 399 | Ga0163162_10711412 | 3300013306 | Bacteria | 1126 |
| 400 | Ga0163162_11585151 | 3300013306 | Bacteria | 747 |
| 401 | Ga0157372_10494947 | 3300013307 | Bacteria | 1425 |
| 402 | Ga0157372_12018395 | 3300013307 | Bacteria | 663 |
| 403 | Ga0157372_12240842 | 3300013307 | Bacteria | 627 |
| 404 | Ga0157375_10764093 | 3300013308 | Bacteria | 1117 |
| 405 | Ga0157375_11849920 | 3300013308 | Bacteria | 716 |
| 406 | Ga0157375_12814828 | 3300013308 | Bacteria | 581 |
| 407 | Ga0163163_10151077 | 3300014325 | Bacteria | 2366 |
| 408 | Ga0163163_10942931 | 3300014325 | Bacteria | 926 |
| 409 | Ga0163163_11149683 | 3300014325 | Bacteria | 839 |
| 410 | Ga0157380_10441108 | 3300014326 | Bacteria | 1248 |
| 411 | Ga0157380_10977078 | 3300014326 | Bacteria | 878 |
| 412 | Ga0157380_12210898 | 3300014326 | Bacteria | 614 |
| 413 | Ga0182008_10006567 | 3300014497 | Bacteria | 6492 |
| 414 | Ga0182008_10249686 | 3300014497 | Bacteria | 915 |
| 415 | Ga0157377_10648699 | 3300014745 | Bacteria | 759 |
| 416 | Ga0157377_11732632 | 3300014745 | Bacteria | 505 |
| 417 | Ga0157379_10362897 | 3300014968 | Bacteria | 1328 |
| 418 | Ga0157379_10513640 | 3300014968 | Bacteria | 1111 |
| 419 | Ga0157379_10617552 | 3300014968 | Bacteria | 1013 |
| 420 | Ga0157379_12208812 | 3300014968 | Bacteria | 547 |
| 421 | Ga0157376_10080368 | 3300014969 | Bacteria | 2796 |
| 422 | Ga0157376_10852888 | 3300014969 | Bacteria | 926 |
| 423 | Ga0157376_10877451 | 3300014969 | Bacteria | 914 |
| 424 | Ga0157376_10975918 | 3300014969 | Bacteria | 869 |
| 425 | Ga0157376_11410968 | 3300014969 | Bacteria | 728 |
| 426 | Ga0157376_12423676 | 3300014969 | Unclassified | 564 |
| 427 | Ga0182006_1061542 | 3300015261 | Bacteria | 1415 |
| 428 | Ga0182006_1178185 | 3300015261 | Bacteria | 710 |
| 429 | Ga0163161_10109379 | 3300017792 | Bacteria | 2065 |
| 430 | Ga0163161_10110584 | 3300017792 | Bacteria | 2054 |
| 431 | Ga0163161_10580314 | 3300017792 | Bacteria | 922 |
| 432 | Ga0209435_100029 | 3300025206 | Bacteria | 176358 |
| 433 | Ga0209435_100195 | 3300025206 | Bacteria | 17815 |
| 434 | Ga0209435_110508 | 3300025206 | Bacteria | 1002 |
| 435 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 436 | Ga0209437_100053 | 3300025233 | Bacteria | 375580 |
| 437 | Ga0209258_100396 | 3300025242 | Bacteria | 54877 |
| 438 | Ga0209646_1000073 | 3300025246 | Bacteria | 224301 |
| 439 | Ga0209646_1000109 | 3300025246 | Bacteria | 158348 |
| 440 | Ga0209646_1037415 | 3300025246 | Bacteria | 625 |
| 441 | Ga0209026_1000050 | 3300025250 | Bacteria | 254994 |
| 442 | Ga0209026_1000124 | 3300025250 | Bacteria | 125673 |
| 443 | Ga0209026_1003015 | 3300025250 | Bacteria | 5811 |
| 444 | Ga0209026_1035417 | 3300025250 | Bacteria | 732 |
| 445 | Ga0209026_1062093 | 3300025250 | Bacteria | 524 |
| 446 | Ga0209148_1000032 | 3300025254 | Bacteria | 557660 |
| 447 | Ga0209759_1000108 | 3300025256 | Bacteria | 146393 |
| 448 | Ga0209759_1000706 | 3300025256 | Bacteria | 29792 |
| 449 | Ga0209759_1000891 | 3300025256 | Bacteria | 22544 |
| 450 | Ga0209759_1051238 | 3300025256 | Bacteria | 634 |
| 451 | Ga0209233_1000034 | 3300025261 | Bacteria | 578898 |
| 452 | Ga0209233_1012371 | 3300025261 | Bacteria | 2477 |
| 453 | Ga0209233_1060313 | 3300025261 | Bacteria | 734 |
| 454 | Ga0209455_1014667 | 3300025272 | Bacteria | 1762 |
| 455 | Ga0209673_1001490 | 3300025273 | Bacteria | 21797 |
| 456 | Ga0209673_1080125 | 3300025273 | Bacteria | 751 |
| 457 | Ga0209675_1045396 | 3300025291 | Bacteria | 935 |
| 458 | Ga0209758_1008143 | 3300025297 | Bacteria | 6890 |
| 459 | Ga0209050_1000202 | 3300025298 | Bacteria | 133468 |
| 460 | Ga0209050_1006802 | 3300025298 | Bacteria | 6657 |
| 461 | Ga0209256_1000049 | 3300025299 | Bacteria | 310696 |
| 462 | Ga0207426_1002546 | 3300025302 | Bacteria | 11425 |
| 463 | Ga0209051_1011287 | 3300025303 | Bacteria | 4425 |
| 464 | Ga0207697_10416142 | 3300025315 | Bacteria | 597 |
| 465 | Ga0207656_10112723 | 3300025321 | Bacteria | 1258 |
| 466 | Ga0207656_10235560 | 3300025321 | Bacteria | 893 |
| 467 | Ga0207656_10397757 | 3300025321 | Bacteria | 692 |
| 468 | Ga0207656_10427162 | 3300025321 | Bacteria | 668 |
| 469 | Ga0207696_1100059 | 3300025711 | Bacteria | 790 |
| 470 | Ga0207655_1231614 | 3300025728 | Bacteria | 533 |
| 471 | Ga0207713_1003598 | 3300025735 | Bacteria | 10451 |
| 472 | Ga0207642_10252153 | 3300025899 | Bacteria | 1002 |
| 473 | Ga0207710_10088493 | 3300025900 | Bacteria | 1446 |
| 474 | Ga0207710_10144651 | 3300025900 | Bacteria | 1150 |
| 475 | Ga0207710_10333561 | 3300025900 | Bacteria | 770 |
| 476 | Ga0207688_10350052 | 3300025901 | Bacteria | 910 |
| 477 | Ga0207688_10983844 | 3300025901 | Bacteria | 533 |
| 478 | Ga0207680_10147902 | 3300025903 | Bacteria | 1564 |
| 479 | Ga0207680_10404237 | 3300025903 | Bacteria | 965 |
| 480 | Ga0207647_10002871 | 3300025904 | Bacteria | 12977 |
| 481 | Ga0207647_10140070 | 3300025904 | Bacteria | 1418 |
| 482 | Ga0207647_10157711 | 3300025904 | Bacteria | 1325 |
| 483 | Ga0207647_10167001 | 3300025904 | Bacteria | 1282 |
| 484 | Ga0207647_10290538 | 3300025904 | Bacteria | 932 |
| 485 | Ga0207647_10343297 | 3300025904 | Bacteria | 846 |
| 486 | Ga0207647_10423436 | 3300025904 | Bacteria | 748 |
| 487 | Ga0207645_10514842 | 3300025907 | Bacteria | 811 |
| 488 | Ga0207643_10042620 | 3300025908 | Bacteria | 2559 |
| 489 | Ga0207705_10074750 | 3300025909 | Bacteria | 2460 |
| 490 | Ga0207684_10021192 | 3300025910 | Bacteria | 5550 |
| 491 | Ga0207684_10235133 | 3300025910 | Bacteria | 1581 |
| 492 | Ga0207654_10000942 | 3300025911 | Bacteria | 15994 |
| 493 | Ga0207654_10035690 | 3300025911 | Bacteria | 2772 |
| 494 | Ga0207654_10050624 | 3300025911 | Bacteria | 2388 |
| 495 | Ga0207654_10097988 | 3300025911 | Bacteria | 1801 |
| 496 | Ga0207654_10464192 | 3300025911 | Bacteria | 890 |
| 497 | Ga0207695_10004636 | 3300025913 | Bacteria | 18634 |
| 498 | Ga0207695_10044260 | 3300025913 | Bacteria | 4735 |
| 499 | Ga0207695_10063100 | 3300025913 | Bacteria | 3820 |
| 500 | Ga0207695_10068811 | 3300025913 | Bacteria | 3626 |
| 501 | Ga0207695_10241541 | 3300025913 | Bacteria | 1707 |
| 502 | Ga0207695_10426029 | 3300025913 | Bacteria | 1211 |
| 503 | Ga0207695_10616805 | 3300025913 | Bacteria | 966 |
| 504 | Ga0207695_10854637 | 3300025913 | Bacteria | 790 |
| 505 | Ga0207695_11040740 | 3300025913 | Unclassified | 698 |
| 506 | Ga0207671_10052890 | 3300025914 | Bacteria | 3010 |
| 507 | Ga0207671_10180471 | 3300025914 | Bacteria | 1643 |
| 508 | Ga0207671_10835395 | 3300025914 | Bacteria | 730 |
| 509 | Ga0207671_10858431 | 3300025914 | Bacteria | 719 |
| 510 | Ga0207671_11052088 | 3300025914 | Bacteria | 640 |
| 511 | Ga0207693_10156578 | 3300025915 | Bacteria | 1792 |
| 512 | Ga0207662_10475311 | 3300025918 | Bacteria | 858 |
| 513 | Ga0207657_10121959 | 3300025919 | Bacteria | 2144 |
| 514 | Ga0207649_10827859 | 3300025920 | Bacteria | 723 |
| 515 | Ga0207649_11109882 | 3300025920 | Bacteria | 624 |
| 516 | Ga0207681_10221538 | 3300025923 | Bacteria | 1464 |
| 517 | Ga0207681_10779388 | 3300025923 | Bacteria | 798 |
| 518 | Ga0207681_10986082 | 3300025923 | Bacteria | 707 |
| 519 | Ga0207694_10114041 | 3300025924 | Bacteria | 2152 |
| 520 | Ga0207694_10175086 | 3300025924 | Bacteria | 1739 |
| 521 | Ga0207694_10563001 | 3300025924 | Bacteria | 957 |
| 522 | Ga0207694_10904764 | 3300025924 | Bacteria | 746 |
| 523 | Ga0207694_10949165 | 3300025924 | Bacteria | 727 |
| 524 | Ga0207650_10049617 | 3300025925 | Bacteria | 3100 |
| 525 | Ga0207650_10529854 | 3300025925 | Bacteria | 986 |
| 526 | Ga0207650_10624944 | 3300025925 | Bacteria | 907 |
| 527 | Ga0207659_10035830 | 3300025926 | Bacteria | 3433 |
| 528 | Ga0207659_11225866 | 3300025926 | Bacteria | 645 |
| 529 | Ga0207659_11571856 | 3300025926 | Bacteria | 562 |
| 530 | Ga0207687_11165520 | 3300025927 | Bacteria | 662 |
| 531 | Ga0207687_11653120 | 3300025927 | Bacteria | 549 |
| 532 | Ga0207664_10129489 | 3300025929 | Bacteria | 2123 |
| 533 | Ga0207644_11793311 | 3300025931 | Bacteria | 513 |
| 534 | Ga0207690_10685398 | 3300025932 | Bacteria | 842 |
| 535 | Ga0207690_10756531 | 3300025932 | Bacteria | 801 |
| 536 | Ga0207690_11210805 | 3300025932 | Bacteria | 631 |
| 537 | Ga0207690_11263468 | 3300025932 | Bacteria | 617 |
| 538 | Ga0207706_10001802 | 3300025933 | Bacteria | 21049 |
| 539 | Ga0207706_10302853 | 3300025933 | Bacteria | 1392 |
| 540 | Ga0207706_10632786 | 3300025933 | Bacteria | 917 |
| 541 | Ga0207686_10281454 | 3300025934 | Bacteria | 1228 |
| 542 | Ga0207709_11305995 | 3300025935 | Bacteria | 600 |
| 543 | Ga0207669_10089611 | 3300025937 | Bacteria | 1998 |
| 544 | Ga0207669_10280034 | 3300025937 | Bacteria | 1257 |
| 545 | Ga0207669_10761588 | 3300025937 | Bacteria | 800 |
| 546 | Ga0207704_10099540 | 3300025938 | Bacteria | 1934 |
| 547 | Ga0207704_10657184 | 3300025938 | Bacteria | 864 |
| 548 | Ga0207704_10900818 | 3300025938 | Bacteria | 744 |
| 549 | Ga0207704_11021919 | 3300025938 | Bacteria | 700 |
| 550 | Ga0207665_10208107 | 3300025939 | Bacteria | 1428 |
| 551 | Ga0207691_10116511 | 3300025940 | Bacteria | 2371 |
| 552 | Ga0207691_10970442 | 3300025940 | Bacteria | 710 |
| 553 | Ga0207711_10062500 | 3300025941 | Bacteria | 3212 |
| 554 | Ga0207711_10113619 | 3300025941 | Bacteria | 2411 |
| 555 | Ga0207711_10413166 | 3300025941 | Bacteria | 1254 |
| 556 | Ga0207689_10162491 | 3300025942 | Bacteria | 1840 |
| 557 | Ga0207689_10636036 | 3300025942 | Bacteria | 898 |
| 558 | Ga0207689_10800584 | 3300025942 | Bacteria | 796 |
| 559 | Ga0207679_10203273 | 3300025945 | Bacteria | 1656 |
| 560 | Ga0207679_10285030 | 3300025945 | Bacteria | 1418 |
| 561 | Ga0207679_10868108 | 3300025945 | Bacteria | 824 |
| 562 | Ga0207667_10041465 | 3300025949 | Bacteria | 4895 |
| 563 | Ga0207667_10080924 | 3300025949 | Bacteria | 3365 |
| 564 | Ga0207667_10124951 | 3300025949 | Bacteria | 2650 |
| 565 | Ga0207667_10246887 | 3300025949 | Bacteria | 1826 |
| 566 | Ga0207651_10109903 | 3300025960 | Bacteria | 2067 |
| 567 | Ga0207712_10000286 | 3300025961 | Bacteria | 48199 |
| 568 | Ga0207712_10102427 | 3300025961 | Bacteria | 2131 |
| 569 | Ga0207712_10282290 | 3300025961 | Bacteria | 1356 |
| 570 | Ga0207712_10752865 | 3300025961 | Bacteria | 853 |
| 571 | Ga0207712_12135776 | 3300025961 | Bacteria | 501 |
| 572 | Ga0207668_10058070 | 3300025972 | Bacteria | 2702 |
| 573 | Ga0207668_10634649 | 3300025972 | Bacteria | 933 |
| 574 | Ga0207668_10823577 | 3300025972 | Bacteria | 823 |
| 575 | Ga0207668_10938668 | 3300025972 | Bacteria | 771 |
| 576 | Ga0207640_10334562 | 3300025981 | Bacteria | 1211 |
| 577 | Ga0207640_11206571 | 3300025981 | Bacteria | 673 |
| 578 | Ga0207640_11782461 | 3300025981 | Bacteria | 556 |
| 579 | Ga0207658_10017165 | 3300025986 | Bacteria | 4986 |
| 580 | Ga0207658_10019417 | 3300025986 | Bacteria | 4700 |
| 581 | Ga0207658_10121969 | 3300025986 | Bacteria | 2080 |
| 582 | Ga0207658_10675122 | 3300025986 | Bacteria | 932 |
| 583 | Ga0207658_11037226 | 3300025986 | Bacteria | 748 |
| 584 | Ga0207677_10506838 | 3300026023 | Bacteria | 1044 |
| 585 | Ga0207703_10002368 | 3300026035 | Bacteria | 16400 |
| 586 | Ga0207703_10005498 | 3300026035 | Bacteria | 10186 |
| 587 | Ga0207703_11395769 | 3300026035 | Bacteria | 674 |
| 588 | Ga0207639_10001087 | 3300026041 | Bacteria | 18462 |
| 589 | Ga0207639_10055044 | 3300026041 | Bacteria | 3043 |
| 590 | Ga0207639_10167800 | 3300026041 | Bacteria | 1856 |
| 591 | Ga0207639_10261893 | 3300026041 | Bacteria | 1513 |
| 592 | Ga0207639_10265260 | 3300026041 | Bacteria | 1504 |
| 593 | Ga0207639_10342719 | 3300026041 | Bacteria | 1333 |
| 594 | Ga0207639_10615886 | 3300026041 | Bacteria | 1002 |
| 595 | Ga0207678_10005043 | 3300026067 | Bacteria | 11847 |
| 596 | Ga0207678_10025302 | 3300026067 | Bacteria | 5182 |
| 597 | Ga0207678_10068252 | 3300026067 | Bacteria | 3051 |
| 598 | Ga0207678_10082193 | 3300026067 | Bacteria | 2756 |
| 599 | Ga0207678_10159219 | 3300026067 | Bacteria | 1928 |
| 600 | Ga0207678_10229319 | 3300026067 | Bacteria | 1590 |
| 601 | Ga0207678_10260325 | 3300026067 | Bacteria | 1487 |
| 602 | Ga0207678_10291214 | 3300026067 | Bacteria | 1402 |
| 603 | Ga0207678_10631644 | 3300026067 | Bacteria | 940 |
| 604 | Ga0207678_10706969 | 3300026067 | Bacteria | 887 |
| 605 | Ga0207678_10864583 | 3300026067 | Bacteria | 799 |
| 606 | Ga0207678_11262943 | 3300026067 | Bacteria | 654 |
| 607 | Ga0207678_11282106 | 3300026067 | Bacteria | 648 |
| 608 | Ga0207708_10550510 | 3300026075 | Bacteria | 973 |
| 609 | Ga0207708_11149689 | 3300026075 | Bacteria | 678 |
| 610 | Ga0207702_10020035 | 3300026078 | Bacteria | 5543 |
| 611 | Ga0207702_10094264 | 3300026078 | Bacteria | 2627 |
| 612 | Ga0207702_10102388 | 3300026078 | Bacteria | 2531 |
| 613 | Ga0207702_10124196 | 3300026078 | Bacteria | 2314 |
| 614 | Ga0207702_10289519 | 3300026078 | Bacteria | 1551 |
| 615 | Ga0207702_10481096 | 3300026078 | Bacteria | 1208 |
| 616 | Ga0207641_10000702 | 3300026088 | Bacteria | 36039 |
| 617 | Ga0207641_11005709 | 3300026088 | Bacteria | 830 |
| 618 | Ga0207641_11344920 | 3300026088 | Bacteria | 715 |
| 619 | Ga0207648_10511798 | 3300026089 | Bacteria | 1099 |
| 620 | Ga0207648_10561872 | 3300026089 | Bacteria | 1049 |
| 621 | Ga0207676_10185626 | 3300026095 | Bacteria | 1825 |
| 622 | Ga0207674_10826329 | 3300026116 | Bacteria | 894 |
| 623 | Ga0207675_100682955 | 3300026118 | Bacteria | 1035 |
| 624 | Ga0207683_10093051 | 3300026121 | Bacteria | 2686 |
| 625 | Ga0207683_10161505 | 3300026121 | Bacteria | 2026 |
| 626 | Ga0207683_10217267 | 3300026121 | Bacteria | 1741 |
| 627 | Ga0207683_10364050 | 3300026121 | Bacteria | 1328 |
| 628 | Ga0207683_12020586 | 3300026121 | Bacteria | 525 |
| 629 | Ga0207698_10339836 | 3300026142 | Bacteria | 1414 |
| 630 | Ga0207698_10340571 | 3300026142 | Bacteria | 1412 |
| 631 | Ga0207698_10466812 | 3300026142 | Bacteria | 1222 |
| 632 | Ga0207698_11138772 | 3300026142 | Bacteria | 793 |
| 633 | Ga0207698_11277228 | 3300026142 | Bacteria | 749 |
| 634 | Ga0209281_1000125 | 3300027111 | Bacteria | 200371 |
| 635 | Ga0209282_1159044 | 3300027666 | Bacteria | 1082 |
| 636 | Ga0209813_10042291 | 3300027866 | Bacteria | 1392 |
| 637 | Ga0209813_10411684 | 3300027866 | Bacteria | 547 |
| 638 | Ga0209974_10336904 | 3300027876 | Bacteria | 583 |
| 639 | Ga0207428_10474748 | 3300027907 | Bacteria | 910 |
| 640 | Ga0268266_10000007 | 3300028379 | Bacteria | 1372921 |
| 641 | Ga0268266_10001711 | 3300028379 | Bacteria | 25121 |
| 642 | Ga0268266_10002582 | 3300028379 | Bacteria | 19210 |
| 643 | Ga0268266_10013394 | 3300028379 | Bacteria | 7063 |
| 644 | Ga0268266_10052877 | 3300028379 | Bacteria | 3489 |
| 645 | Ga0268266_10215044 | 3300028379 | Bacteria | 1764 |
| 646 | Ga0268266_10264158 | 3300028379 | Bacteria | 1596 |
| 647 | Ga0268266_10276694 | 3300028379 | Bacteria | 1560 |
| 648 | Ga0268266_11789772 | 3300028379 | Bacteria | 589 |
| 649 | Ga0268265_10011961 | 3300028380 | Bacteria | 5872 |
| 650 | Ga0268265_10060136 | 3300028380 | Bacteria | 2910 |
| 651 | Ga0268265_10293536 | 3300028380 | Bacteria | 1460 |
| 652 | Ga0268265_10350717 | 3300028380 | Bacteria | 1347 |
| 653 | Ga0268265_10366679 | 3300028380 | Bacteria | 1320 |
| 654 | Ga0268265_10421317 | 3300028380 | Bacteria | 1239 |
| 655 | Ga0268264_10000375 | 3300028381 | Bacteria | 65683 |
| 656 | Ga0268264_11457193 | 3300028381 | Bacteria | 695 |
| 657 | Ga0268264_11533885 | 3300028381 | Bacteria | 677 |
| 658 | Ga0268264_11543635 | 3300028381 | Bacteria | 675 |
| 659 | Ga0268264_11640070 | 3300028381 | Bacteria | 654 |
| 660 | Ga0307517_10157202 | 3300028786 | Unclassified | 1538 |
| 661 | Ga0307515_10213160 | 3300028794 | Bacteria | 1770 |
| 662 | Ga0307515_10373703 | 3300028794 | Bacteria | 1061 |
| 663 | Ga0265760_10346975 | 3300031090 | Bacteria | 531 |
| 664 | Ga0265330_10472371 | 3300031235 | Bacteria | 533 |
| 665 | Ga0265316_10403623 | 3300031344 | Bacteria | 984 |
| 666 | Ga0307513_10000121 | 3300031456 | Bacteria | 109551 |
| 667 | Ga0307513_10454646 | 3300031456 | Bacteria | 1004 |
| 668 | Ga0307513_10503613 | 3300031456 | Unclassified | 928 |
| 669 | Ga0307408_100051176 | 3300031548 | Bacteria | 2974 |
| 670 | Ga0307408_100274192 | 3300031548 | Bacteria | 1402 |
| 671 | Ga0307508_10509540 | 3300031616 | Bacteria | 799 |
| 672 | Ga0307508_10553188 | 3300031616 | Bacteria | 749 |
| 673 | Ga0265314_10643553 | 3300031711 | Bacteria | 541 |
| 674 | Ga0307516_10002590 | 3300031730 | Bacteria | 24022 |
| 675 | Ga0307516_10107182 | 3300031730 | Bacteria | 2603 |
| 676 | Ga0307516_10487987 | 3300031730 | Bacteria | 887 |
| 677 | Ga0307405_11566839 | 3300031731 | Bacteria | 580 |
| 678 | Ga0307405_11983046 | 3300031731 | Unclassified | 521 |
| 679 | Ga0307413_10221922 | 3300031824 | Bacteria | 1381 |
| 680 | Ga0307413_10290712 | 3300031824 | Bacteria | 1234 |
| 681 | Ga0307413_10425752 | 3300031824 | Bacteria | 1047 |
| 682 | Ga0307410_10467495 | 3300031852 | Bacteria | 1032 |
| 683 | Ga0307410_11824187 | 3300031852 | Bacteria | 540 |
| 684 | Ga0307406_10000135 | 3300031901 | Bacteria | 43972 |
| 685 | Ga0307406_10083585 | 3300031901 | Bacteria | 2129 |
| 686 | Ga0307406_10714645 | 3300031901 | Bacteria | 838 |
| 687 | Ga0307407_10554041 | 3300031903 | Bacteria | 850 |
| 688 | Ga0307407_11289045 | 3300031903 | Bacteria | 573 |
| 689 | Ga0307412_10649076 | 3300031911 | Bacteria | 900 |
| 690 | Ga0307412_10758187 | 3300031911 | Bacteria | 838 |
| 691 | Ga0307412_11221729 | 3300031911 | Bacteria | 674 |
| 692 | Ga0307412_12268184 | 3300031911 | Bacteria | 506 |
| 693 | Ga0307409_100093371 | 3300031995 | Bacteria | 2472 |
| 694 | Ga0307409_102760842 | 3300031995 | Bacteria | 519 |
| 695 | Ga0307416_100055412 | 3300032002 | Bacteria | 3193 |
| 696 | Ga0307416_100103487 | 3300032002 | Bacteria | 2486 |
| 697 | Ga0307416_100356145 | 3300032002 | Bacteria | 1483 |
| 698 | Ga0307414_10151785 | 3300032004 | Bacteria | 1829 |
| 699 | Ga0307411_10074054 | 3300032005 | Bacteria | 2319 |
| 700 | Ga0307411_10366901 | 3300032005 | Bacteria | 1179 |
| 701 | Ga0307415_100147801 | 3300032126 | Bacteria | 1804 |
| 702 | Ga0307415_101624461 | 3300032126 | Bacteria | 621 |
| 703 | Ga0307415_101642738 | 3300032126 | Bacteria | 618 |
| 704 | Ga0307510_10000001 | 3300033180 | Bacteria | 1172244 |
| 705 | Ga0307510_10416343 | 3300033180 | Bacteria | 786 |
| 706 | Ga0373941_0268881 | 3300035115 | Bacteria | 671 |
| 707 | Ga0373960_0313034 | 3300035121 | Bacteria | 587 |
| 708 | Ga0372808_031413 | 3300036459 | Bacteria | 762 |
| 709 | Ga0373925_1348402 | 3300037068 | Bacteria | 585 |
| 710 | Ga0395899_0001320 | 3300037312 | Bacteria | 21369 |
| 711 | Ga0395899_0077287 | 3300037312 | Bacteria | 2428 |
| 712 | Ga0395899_0292198 | 3300037312 | Bacteria | 1105 |
| 713 | Ga0395900_0063330 | 3300037418 | Bacteria | 3801 |
| 714 | Ga0395900_0080559 | 3300037418 | Bacteria | 3346 |
| 715 | Ga0395900_0140821 | 3300037418 | Bacteria | 2470 |
| 716 | Ga0395900_0193173 | 3300037418 | Bacteria | 2064 |
| 717 | Ga0395900_0606959 | 3300037418 | Bacteria | 1034 |
| 718 | Ga0395898_0129537 | 3300037466 | Bacteria | 2417 |
| 719 | Ga0395898_0903223 | 3300037466 | Bacteria | 821 |
| 720 | Ga0395905_0017216 | 3300037471 | Bacteria | 6865 |
| 721 | Ga0395905_0082683 | 3300037471 | Bacteria | 3009 |
| 722 | Ga0395905_0142672 | 3300037471 | Bacteria | 2253 |
| 723 | Ga0395905_0373161 | 3300037471 | Bacteria | 1320 |
| 724 | Ga0395905_0750857 | 3300037471 | Bacteria | 878 |
| 725 | Ga0395905_1463581 | 3300037471 | Bacteria | 587 |
| 726 | Ga0395901_0012451 | 3300038443 | Bacteria | 8633 |
| 727 | Ga0395901_0128021 | 3300038443 | Bacteria | 2669 |
| 728 | Ga0395901_0128937 | 3300038443 | Bacteria | 2658 |
| 729 | Ga0395901_0259946 | 3300038443 | Bacteria | 1807 |
| 730 | Ga0395901_0673417 | 3300038443 | Bacteria | 1035 |
| 731 | Ga0395901_0678497 | 3300038443 | Bacteria | 1030 |
| 732 | Ga0436361_0582197 | 3300039447 | Bacteria | 1003 |
| 733 | Ga0436361_1152275 | 3300039447 | Bacteria | 616 |
| 734 | Ga0436361_1209085 | 3300039447 | Unclassified | 547 |
| 735 | Ga0436363_0335585 | 3300039450 | Bacteria | 588 |
| 736 | Ga0436363_1712487 | 3300039450 | Bacteria | 1382 |
| 737 | Ga0451789_0699448 | 3300041443 | Bacteria | 578 |
| 738 | Ga0451791_1322022 | 3300041451 | Bacteria | 817 |
| 739 | Ga0451797_0765934 | 3300041453 | Bacteria | 514 |
| 740 | Ga0451795_0778622 | 3300041456 | Bacteria | 677 |
| 741 | Ga0451798_1024392 | 3300041458 | Bacteria | 647 |
| 742 | Ga0451802_0028054 | 3300041460 | Bacteria | 585 |
| 743 | Ga0451807_1395372 | 3300041486 | Bacteria | 728 |
| 744 | Ga0451807_1424292 | 3300041486 | Bacteria | 1059 |
| 745 | Ga0451833_0278061 | 3300041491 | Bacteria | 1228 |
| 746 | Ga0451837_0136122 | 3300041494 | Bacteria | 540 |
| 747 | Ga0451837_1562523 | 3300041494 | Bacteria | 569 |
| 748 | Ga0451837_1750542 | 3300041494 | Bacteria | 552 |
| 749 | Ga0451841_0543752 | 3300041498 | Bacteria | 523 |
| 750 | Ga0451845_0714657 | 3300041501 | Bacteria | 503 |
| 751 | Ga0451853_1863186 | 3300041512 | Bacteria | 504 |
| 752 | Ga0451853_2014640 | 3300041512 | Bacteria | 792 |
| 753 | Ga0451853_2303321 | 3300041512 | Bacteria | 673 |
| 754 | Ga0451853_3343357 | 3300041512 | Bacteria | 543 |
| 755 | Ga0450900_070252 | 3300042136 | Bacteria | 555 |
| 756 | Ga0466972_0015806 | 3300044658 | Bacteria | 3773 |
| 757 | Ga0466972_0158797 | 3300044658 | Bacteria | 1062 |
| 758 | Ga0466972_0462217 | 3300044658 | Bacteria | 596 |
| 759 | Ga0466966_0162359 | 3300044684 | Bacteria | 1360 |
| 760 | Ga0466961_0832242 | 3300044693 | Bacteria | 550 |
| 761 | Ga0466963_0180843 | 3300044694 | Bacteria | 1472 |
| 762 | Ga0466968_0178091 | 3300044735 | Bacteria | 988 |
| 763 | Ga0466957_0707196 | 3300044842 | Bacteria | 711 |
| 764 | Ga0466960_0015562 | 3300044901 | Bacteria | 3281 |
| 765 | Ga0466959_0138528 | 3300045049 | Bacteria | 1721 |
| 766 | Ga0466958_0136574 | 3300045836 | Bacteria | 1542 |
| 767 | Ga0495590_0011663 | 3300046457 | Bacteria | 3282 |
| 768 | Ga0495580_0035215 | 3300046472 | Bacteria | 3600 |
| 769 | Ga0495605_0076541 | 3300046474 | Bacteria | 1571 |
| 770 | Ga0495585_0167869 | 3300046492 | Bacteria | 1135 |
| 771 | Ga0495594_0152315 | 3300046499 | Bacteria | 1313 |
| 772 | Ga0495596_0255550 | 3300046500 | Bacteria | 680 |
| 773 | Ga0495606_0090373 | 3300046507 | Bacteria | 1885 |
| 774 | Ga0495606_0532206 | 3300046507 | Bacteria | 588 |
| 775 | Ga0495606_0558899 | 3300046507 | Unclassified | 568 |
| 776 | Ga0495620_0063158 | 3300046515 | Bacteria | 1536 |
| 777 | Ga0495620_0289251 | 3300046515 | Bacteria | 623 |
| 778 | Ga0495630_0640351 | 3300046517 | Bacteria | 814 |
| 779 | Ga0495631_0230041 | 3300046518 | Bacteria | 791 |
| 780 | Ga0495632_0128243 | 3300046519 | Bacteria | 1182 |
| 781 | Ga0495632_0303925 | 3300046519 | Bacteria | 707 |
| 782 | Ga0495643_0186616 | 3300046522 | Bacteria | 1004 |
| 783 | Ga0495643_0196006 | 3300046522 | Bacteria | 972 |
| 784 | Ga0495643_0350809 | 3300046522 | Bacteria | 661 |
| 785 | Ga0495648_0187270 | 3300046524 | Unclassified | 1047 |
| 786 | Ga0495648_0512882 | 3300046524 | Bacteria | 512 |
| 787 | Ga0495663_0037129 | 3300046525 | Bacteria | 1468 |
| 788 | Ga0495666_0039580 | 3300046526 | Bacteria | 2288 |
| 789 | Ga0495642_0225414 | 3300046528 | Bacteria | 818 |
| 790 | Ga0495665_0292850 | 3300046531 | Bacteria | 834 |
| 791 | Ga0495609_0464035 | 3300046538 | Bacteria | 502 |
| 792 | Ga0495597_0159457 | 3300046542 | Bacteria | 921 |
| 793 | Ga0495645_0096835 | 3300046543 | Bacteria | 2102 |
| 794 | Ga0495633_0350884 | 3300046558 | Bacteria | 668 |
| 795 | Ga0495634_0211403 | 3300046642 | Bacteria | 1201 |
| 796 | Ga0495611_0138254 | 3300046648 | Bacteria | 1137 |
| 797 | Ga0495625_0002652 | 3300046660 | Bacteria | 19076 |
| 798 | Ga0495625_0171020 | 3300046660 | Bacteria | 1451 |
| 799 | Ga0495625_0497612 | 3300046660 | Bacteria | 746 |
| 800 | Ga0495588_0270199 | 3300046674 | Bacteria | 896 |
| 801 | Ga0495599_0207120 | 3300046678 | Bacteria | 1204 |
| 802 | Ga0495623_0090213 | 3300046679 | Bacteria | 1882 |
| 803 | Ga0495624_0080889 | 3300046690 | Bacteria | 2013 |
| 804 | Ga0495624_0833692 | 3300046690 | Bacteria | 544 |
| 805 | Ga0495670_0006980 | 3300046691 | Bacteria | 5565 |
| 806 | Ga0495670_0103497 | 3300046691 | Bacteria | 1468 |
| 807 | Ga0495649_0229977 | 3300046694 | Bacteria | 957 |
| 808 | Ga0495649_0355223 | 3300046694 | Bacteria | 740 |
| 809 | Ga0495660_0201499 | 3300046810 | Bacteria | 950 |
| 810 | Ga0495636_0166326 | 3300047318 | Bacteria | 995 |
| 811 | Ga0495687_010536 | 3300047443 | Bacteria | 5063 |
| 812 | Ga0495687_053816 | 3300047443 | Bacteria | 1693 |
| 813 | Ga0495677_0217048 | 3300047445 | Bacteria | 745 |
| 814 | Ga0495681_0082998 | 3300047470 | Bacteria | 1427 |
| 815 | Ga0495686_0100077 | 3300047472 | Bacteria | 1749 |
| 816 | Ga0495686_0211033 | 3300047472 | Bacteria | 1109 |
| 817 | Ga0495686_0236703 | 3300047472 | Bacteria | 1031 |
| 818 | Ga0495686_0238201 | 3300047472 | Bacteria | 1027 |
| 819 | Ga0495686_0340068 | 3300047472 | Bacteria | 818 |
| 820 | Ga0495593_0026405 | 3300047673 | Bacteria | 3207 |
| 821 | Ga0495602_0734669 | 3300048088 | Bacteria | 667 |
| 822 | Ga0496100_0143738 | 3300048903 | Bacteria | 1694 |
| 823 | Ga0496102_0237931 | 3300048905 | Bacteria | 1717 |
| 824 | Ga0496102_0582595 | 3300048905 | Bacteria | 1042 |
| 825 | Ga0496102_0603027 | 3300048905 | Bacteria | 1021 |
| 826 | Ga0496102_0609196 | 3300048905 | Bacteria | 1015 |
| 827 | Ga0496102_0823480 | 3300048905 | Bacteria | 850 |
| 828 | Ga0496102_1197689 | 3300048905 | Bacteria | 679 |
| 829 | Ga0496103_0330136 | 3300048906 | Bacteria | 981 |
| 830 | Ga0496103_0392709 | 3300048906 | Bacteria | 891 |
| 831 | Ga0496103_0572233 | 3300048906 | Bacteria | 720 |
| 832 | Ga0496103_0758974 | 3300048906 | Bacteria | 613 |
| 833 | Ga0496104_0254658 | 3300048907 | Bacteria | 1668 |
| 834 | Ga0496104_0670317 | 3300048907 | Bacteria | 946 |
| 835 | Ga0496104_0896937 | 3300048907 | Bacteria | 792 |
| 836 | Ga0496105_0915586 | 3300048908 | Bacteria | 660 |
| 837 | Ga0496106_1174352 | 3300048909 | Bacteria | 599 |
| 838 | Ga0496107_0971821 | 3300048910 | Bacteria | 617 |
| 839 | Ga0496110_0345184 | 3300048913 | Bacteria | 1356 |
| 840 | Ga0496110_0389745 | 3300048913 | Bacteria | 1270 |
| 841 | Ga0496110_0811729 | 3300048913 | Bacteria | 840 |
| 842 | Ga0496112_0534093 | 3300048915 | Bacteria | 1107 |
| 843 | Ga0496112_0674996 | 3300048915 | Bacteria | 962 |
| 844 | Ga0496112_0923917 | 3300048915 | Bacteria | 794 |
| 845 | Ga0496113_0232009 | 3300048916 | Bacteria | 1472 |
| 846 | Ga0496113_0328191 | 3300048916 | Bacteria | 1227 |
| 847 | Ga0496113_1453958 | 3300048916 | Bacteria | 530 |
| 848 | Ga0496114_0007282 | 3300048917 | Bacteria | 8734 |
| 849 | Ga0496114_0522183 | 3300048917 | Bacteria | 1050 |
| 850 | Ga0496114_0573759 | 3300048917 | Bacteria | 996 |
| 851 | Ga0496115_0289106 | 3300048918 | Bacteria | 1345 |
| 852 | Ga0496116_0003419 | 3300048919 | Bacteria | 15693 |
| 853 | Ga0496117_0268786 | 3300048920 | Bacteria | 920 |
| 854 | Ga0496118_0185063 | 3300048921 | Bacteria | 1253 |
| 855 | Ga0496119_0008928 | 3300048922 | Bacteria | 8707 |
| 856 | Ga0496119_0061788 | 3300048922 | Bacteria | 2235 |
| 857 | Ga0496119_0089279 | 3300048922 | Bacteria | 1755 |
| 858 | Ga0496119_0452284 | 3300048922 | Bacteria | 605 |
| 859 | Ga0496119_0558548 | 3300048922 | Bacteria | 525 |
| 860 | Ga0496120_0000104 | 3300048923 | Bacteria | 140731 |
| 861 | Ga0496120_0000455 | 3300048923 | Bacteria | 64606 |
| 862 | Ga0496120_0134647 | 3300048923 | Bacteria | 1261 |
| 863 | Ga0496120_0206465 | 3300048923 | Bacteria | 948 |
| 864 | Ga0496120_0274723 | 3300048923 | Bacteria | 781 |
| 865 | Ga0496120_0442601 | 3300048923 | Bacteria | 567 |
| 866 | Ga0496121_0004934 | 3300048924 | Bacteria | 17501 |
| 867 | Ga0496121_0293030 | 3300048924 | Bacteria | 1108 |
| 868 | Ga0496121_0365369 | 3300048924 | Bacteria | 957 |
| 869 | Ga0496121_0457284 | 3300048924 | Bacteria | 821 |
| 870 | Ga0496121_0774082 | 3300048924 | Bacteria | 567 |
| 871 | Ga0496122_0000472 | 3300048925 | Bacteria | 83803 |
| 872 | Ga0496122_0049301 | 3300048925 | Bacteria | 3227 |
| 873 | Ga0496122_0258255 | 3300048925 | Bacteria | 969 |
| 874 | Ga0496123_0000361 | 3300048926 | Bacteria | 85609 |
| 875 | Ga0496124_0000108 | 3300048927 | Bacteria | 167473 |
| 876 | Ga0496124_0099925 | 3300048927 | Bacteria | 2352 |
| 877 | Ga0496124_0346911 | 3300048927 | Bacteria | 1052 |
| 878 | Ga0496125_0000424 | 3300048928 | Bacteria | 78587 |
| 879 | Ga0496125_0013473 | 3300048928 | Bacteria | 8033 |
| 880 | Ga0496125_0027239 | 3300048928 | Bacteria | 5185 |
| 881 | Ga0496125_0043904 | 3300048928 | Bacteria | 3788 |
| 882 | Ga0496125_0052760 | 3300048928 | Bacteria | 3341 |
| 883 | Ga0496125_0110752 | 3300048928 | Bacteria | 1989 |
| 884 | Ga0496125_0615608 | 3300048928 | Bacteria | 590 |
| 885 | Ga0496125_0749497 | 3300048928 | Bacteria | 512 |
| 886 | Ga0496126_0116420 | 3300048929 | Bacteria | 2323 |
| 887 | Ga0496126_0120695 | 3300048929 | Bacteria | 2274 |
| 888 | Ga0496126_0303753 | 3300048929 | Bacteria | 1315 |
| 889 | Ga0496126_0487172 | 3300048929 | Bacteria | 987 |
| 890 | Ga0495682_0189213 | 3300049460 | Bacteria | 731 |
| 891 | Ga0501300_019362 | 3300049523 | Bacteria | 994 |
| 892 | Ga0501031_0005336 | 3300049568 | Bacteria | 8371 |
| 893 | Ga0501031_1087203 | 3300049568 | Bacteria | 510 |
| 894 | Ga0501032_0000067 | 3300049569 | Bacteria | 89910 |
| 895 | Ga0501032_0409610 | 3300049569 | Bacteria | 870 |
| 896 | Ga0501032_0636923 | 3300049569 | Bacteria | 677 |
| 897 | Ga0501032_1054198 | 3300049569 | Bacteria | 510 |
| 898 | Ga0501033_0000117 | 3300049570 | Bacteria | 75935 |
| 899 | Ga0501033_0075134 | 3300049570 | Bacteria | 2480 |
| 900 | Ga0501033_0280842 | 3300049570 | Bacteria | 1175 |
| 901 | Ga0501034_0000153 | 3300049571 | Bacteria | 129892 |
| 902 | Ga0501034_0062525 | 3300049571 | Bacteria | 3738 |
| 903 | Ga0501036_0008779 | 3300049572 | Bacteria | 8296 |
| 904 | Ga0501036_0040926 | 3300049572 | Bacteria | 3921 |
| 905 | Ga0501037_0000081 | 3300049573 | Bacteria | 86623 |
| 906 | Ga0501038_0000033 | 3300049574 | Bacteria | 129840 |
| 907 | Ga0501038_0079637 | 3300049574 | Bacteria | 2762 |
| 908 | Ga0501039_0000031 | 3300049575 | Bacteria | 129814 |
| 909 | Ga0501039_0523466 | 3300049575 | Bacteria | 931 |
| 910 | Ga0501043_0000009 | 3300049579 | Bacteria | 214823 |
| 911 | Ga0501043_0000044 | 3300049579 | Bacteria | 114304 |
| 912 | Ga0501043_0038431 | 3300049579 | Bacteria | 3763 |
| 913 | Ga0501046_0000022 | 3300049580 | Bacteria | 215451 |
| 914 | Ga0501046_0083687 | 3300049580 | Bacteria | 2462 |
| 915 | Ga0501046_0085538 | 3300049580 | Bacteria | 2431 |
| 916 | Ga0501047_0000021 | 3300049581 | Bacteria | 254841 |
| 917 | Ga0501047_0159538 | 3300049581 | Bacteria | 2127 |
| 918 | Ga0501047_0341253 | 3300049581 | Bacteria | 1335 |
| 919 | Ga0501047_1039152 | 3300049581 | Bacteria | 632 |
| 920 | Ga0501048_0000311 | 3300049582 | Bacteria | 33197 |
| 921 | Ga0501048_0198999 | 3300049582 | Bacteria | 1420 |
| 922 | Ga0501068_0947563 | 3300049584 | Bacteria | 567 |
| 923 | Ga0501070_0388710 | 3300049586 | Bacteria | 1129 |
| 924 | Ga0501070_0997363 | 3300049586 | Bacteria | 650 |
| 925 | Ga0501073_0172446 | 3300049589 | Bacteria | 1497 |
| 926 | Ga0501073_0304222 | 3300049589 | Bacteria | 1100 |
| 927 | Ga0501076_0221660 | 3300049592 | Bacteria | 1546 |
| 928 | Ga0501080_0067730 | 3300049742 | Bacteria | 3320 |
| 929 | Ga0501083_0101224 | 3300049744 | Bacteria | 1900 |
| 930 | Ga0501083_0172642 | 3300049744 | Bacteria | 1413 |
| 931 | Ga0501280_006305 | 3300049776 | Bacteria | 1675 |
| 932 | Ga0501035_0000472 | 3300049822 | Bacteria | 45098 |
| 933 | Ga0501035_0110226 | 3300049822 | Bacteria | 2412 |
| 934 | Ga0501044_0014405 | 3300049823 | Bacteria | 8538 |
| 935 | Ga0501044_0439552 | 3300049823 | Bacteria | 1212 |
| 936 | Ga0501044_0472110 | 3300049823 | Bacteria | 1158 |
| 937 | Ga0501044_0475613 | 3300049823 | Bacteria | 1153 |
| 938 | Ga0501045_0041678 | 3300049824 | Bacteria | 3341 |
| 939 | nmdc:mga03683_271346_c1 | 3300050489 | Bacteria | 791 |
| 940 | nmdc:mga03683_29779_c1 | 3300050489 | Bacteria | 2180 |
| 941 | nmdc:mga03n38_103058_c1 | 3300050490 | Bacteria | 1379 |
| 942 | nmdc:mga03n38_155457_c1 | 3300050490 | Bacteria | 1154 |
| 943 | nmdc:mga03n38_53598_c1 | 3300050490 | Bacteria | 1809 |
| 944 | nmdc:mga00v17_144100_c1 | 3300050491 | Bacteria | 1529 |
| 945 | nmdc:mga00v17_21915_c1 | 3300050491 | Bacteria | 3680 |
| 946 | nmdc:mga00v17_672799_c1 | 3300050491 | Bacteria | 665 |
| 947 | nmdc:mga00v17_81391_c1 | 3300050491 | Bacteria | 2022 |
| 948 | nmdc:mga00v17_84199_c1 | 3300050491 | Bacteria | 1990 |
| 949 | nmdc:mga0yw44_159047_c1 | 3300050492 | Bacteria | 1478 |
| 950 | nmdc:mga0yw44_253999_c1 | 3300050492 | Bacteria | 1171 |
| 951 | nmdc:mga0yw44_256489_c1 | 3300050492 | Bacteria | 1165 |
| 952 | nmdc:mga0yw44_3044_c1 | 3300050492 | Bacteria | 7334 |
| 953 | nmdc:mga0yw44_438721_c1 | 3300050492 | Bacteria | 885 |
| 954 | nmdc:mga0yw44_44151_c1 | 3300050492 | Bacteria | 2665 |
| 955 | nmdc:mga0yw44_47931_c1 | 3300050492 | Bacteria | 2574 |
| 956 | nmdc:mga0yw44_54408_c1 | 3300050492 | Bacteria | 2432 |
| 957 | nmdc:mga0k408_142381_c1 | 3300050493 | Bacteria | 1427 |
| 958 | nmdc:mga0k408_434742_c1 | 3300050493 | Bacteria | 780 |
| 959 | nmdc:mga0k408_547213_c1 | 3300050493 | Bacteria | 684 |
| 960 | nmdc:mga0k408_636169_c1 | 3300050493 | Bacteria | 628 |
| 961 | nmdc:mga06z11_13238_c1 | 3300050494 | Bacteria | 3615 |
| 962 | nmdc:mga06z11_178799_c1 | 3300050494 | Bacteria | 1222 |
| 963 | nmdc:mga06z11_290636_c1 | 3300050494 | Bacteria | 970 |
| 964 | nmdc:mga06z11_389451_c1 | 3300050494 | Bacteria | 838 |
| 965 | nmdc:mga06z11_415692_c1 | 3300050494 | Bacteria | 810 |
| 966 | nmdc:mga04h51_304655_c1 | 3300050495 | Bacteria | 650 |
| 967 | nmdc:mga04h51_69223_c1 | 3300050495 | Bacteria | 1228 |
| 968 | nmdc:mga07m45_264384_c1 | 3300050496 | Bacteria | 1001 |
| 969 | nmdc:mga07m45_32868_c1 | 3300050496 | Bacteria | 2878 |
| 970 | nmdc:mga07m45_332704_c1 | 3300050496 | Bacteria | 883 |
| 971 | nmdc:mga07m45_751787_c1 | 3300050496 | Bacteria | 560 |
| 972 | nmdc:mga05p37_397580_c1 | 3300050507 | Bacteria | 1610 |
| 973 | nmdc:mga05p37_56596_c1 | 3300050507 | Bacteria | 4829 |
| 974 | nmdc:mga09592_142_c2 | 3300050508 | Bacteria | 23737 |
| 975 | nmdc:mga0qj67_1135337_c1 | 3300050509 | Bacteria | 609 |
| 976 | nmdc:mga06r32_187262_c1 | 3300050510 | Bacteria | 2057 |
| 977 | nmdc:mga06r32_192796_c1 | 3300050510 | Bacteria | 2025 |
| 978 | nmdc:mga08y16_2132907_c1 | 3300050511 | Bacteria | 508 |
| 979 | nmdc:mga0a205_388080_c2 | 3300050515 | Bacteria | 878 |
| 980 | nmdc:mga0sz30_36074_c1 | 3300050516 | Bacteria | 2066 |
| 981 | Ga0495601_0343647 | 3300053077 | Bacteria | 971 |
| 982 | Ga0500610_0012946 | 3300053079 | Bacteria | 3861 |
| 983 | Ga0500610_0192265 | 3300053079 | Bacteria | 990 |
| 984 | Ga0495655_0032605 | 3300053083 | Bacteria | 1276 |
| 985 | Ga0500578_0000327 | 3300053086 | Bacteria | 57988 |
| 986 | Ga0500646_0012843 | 3300053090 | Bacteria | 2166 |
| 987 | Ga0500583_0023535 | 3300053092 | Bacteria | 2598 |
| 988 | Ga0500566_0530955 | 3300053094 | Bacteria | 502 |
| 989 | Ga0500641_0003956 | 3300053096 | Bacteria | 5237 |
| 990 | Ga0500641_0010765 | 3300053096 | Bacteria | 3312 |
| 991 | Ga0500650_0383878 | 3300053098 | Bacteria | 610 |
| 992 | Ga0500654_152786 | 3300053099 | Bacteria | 806 |
| 993 | Ga0500556_0067354 | 3300053104 | Bacteria | 1331 |
| 994 | Ga0500594_0021092 | 3300053118 | Bacteria | 1631 |
| 995 | Ga0500595_013715 | 3300053119 | Bacteria | 3099 |
| 996 | Ga0500595_041988 | 3300053119 | Bacteria | 1467 |
| 997 | Ga0500595_192134 | 3300053119 | Bacteria | 564 |
| 998 | Ga0500559_0235384 | 3300053136 | Unclassified | 863 |
| 999 | Ga0500568_0021526 | 3300053139 | Bacteria | 2772 |
| 1000 | Ga0500568_0286850 | 3300053139 | Bacteria | 598 |
| 1001 | Ga0500589_178529 | 3300053147 | Bacteria | 836 |
| 1002 | Ga0500590_173236 | 3300053148 | Unclassified | 946 |
| 1003 | Ga0500604_0029850 | 3300053151 | Bacteria | 1592 |
| 1004 | Ga0500604_0265557 | 3300053151 | Bacteria | 594 |
| 1005 | Ga0500620_010708 | 3300053155 | Bacteria | 2428 |
| 1006 | Ga0500620_098708 | 3300053155 | Bacteria | 1021 |
| 1007 | Ga0500627_0146894 | 3300053158 | Bacteria | 1065 |
| 1008 | Ga0500611_022925 | 3300053727 | Bacteria | 1210 |
| 1009 | Ga0500645_082862 | 3300053730 | Bacteria | 914 |
| 1010 | Ga0500587_032830 | 3300053739 | Bacteria | 719 |
| 1011 | Ga0587073_0284930 | 3300059492 | Bacteria | 532 |
| 1012 | Ga0587106_128633 | 3300059605 | Bacteria | 545 |
| 1013 | Ga0587072_154827 | 3300059643 | Bacteria | 556 |
| 1014 | Ga0587114_093791 | 3300059655 | Bacteria | 576 |
| 1015 | Ga0501082_1098539 | 3300060353 | Bacteria | 695 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005435 | Ga0070714_100221090 | Ga0070714_1002210902 | 44 |
| 2 | 3300006028 | Ga0070717_10356939 | Ga0070717_103569392 | 44 |
| 3 | 3300006175 | Ga0070712_100489010 | Ga0070712_1004890102 | 44 |
| 4 | 3300013307 | Ga0157372_12240842 | Ga0157372_122408421 | 44 |
| 5 | 3300025915 | Ga0207693_10156578 | Ga0207693_101565782 | 44 |
| 6 | 3300025929 | Ga0207664_10129489 | Ga0207664_101294892 | 44 |
| 7 | 3300044684 | Ga0466966_0162359 | Ga0466966_0162359_150_305 | 44 |
| 8 | 3300044693 | Ga0466961_0832242 | Ga0466961_0832242_303_458 | 44 |
| 9 | 3300044694 | Ga0466963_0180843 | Ga0466963_0180843_1191_1346 | 44 |
| 10 | 3300044842 | Ga0466957_0707196 | Ga0466957_0707196_186_341 | 44 |
| 11 | 3300045049 | Ga0466959_0138528 | Ga0466959_0138528_1248_1403 | 44 |
| 12 | 3300045836 | Ga0466958_0136574 | Ga0466958_0136574_436_591 | 44 |
| 13 | 3300035121 | Ga0373960_0313034 | Ga0373960_0313034_178_333 | 45 |
| 14 | 3300037312 | Ga0395899_0001320 | Ga0395899_0001320_15773_15925 | 45 |
| 15 | 3300046518 | Ga0495631_0230041 | Ga0495631_0230041_344_499 | 45 |
| 16 | 3300046642 | Ga0495634_0211403 | Ga0495634_0211403_618_770 | 45 |
| 17 | 3300005467 | Ga0070706_100018724 | Ga0070706_1000187249 | 46 |
| 18 | 3300005471 | Ga0070698_100067072 | Ga0070698_1000670728 | 46 |
| 19 | 3300005843 | Ga0068860_100393836 | Ga0068860_1003938363 | 46 |
| 20 | 3300014969 | Ga0157376_10080368 | Ga0157376_100803685 | 46 |
| 21 | 3300025910 | Ga0207684_10021192 | Ga0207684_100211924 | 46 |
| 22 | 3300028794 | Ga0307515_10373703 | Ga0307515_103737032 | 46 |
| 23 | 3300039447 | Ga0436361_0582197 | Ga0436361_0582197_758_919 | 46 |
| 24 | 3300046472 | Ga0495580_0035215 | Ga0495580_0035215_1536_1682 | 46 |
| 25 | 3300046499 | Ga0495594_0152315 | Ga0495594_0152315_434_580 | 46 |
| 26 | 3300046526 | Ga0495666_0039580 | Ga0495666_0039580_1821_1967 | 46 |
| 27 | 3300046690 | Ga0495624_0080889 | Ga0495624_0080889_554_700 | 46 |
| 28 | 3300048088 | Ga0495602_0734669 | Ga0495602_0734669_128_274 | 46 |
| 29 | 3300048927 | Ga0496124_0000108 | Ga0496124_0000108_55802_55951 | 46 |
| 30 | 3300048928 | Ga0496125_0027239 | Ga0496125_0027239_4672_4821 | 46 |
| 31 | 3300048928 | Ga0496125_0749497 | Ga0496125_0749497_93_242 | 46 |
| 32 | 3300002067 | JGI24735J21928_10002948 | JGI24735J21928_100029482 | 47 |
| 33 | 3300002704 | JGI25155J39150_1000285 | JGI25155J39150_10002853 | 47 |
| 34 | 3300002705 | JGI25156J39149_1000168 | JGI25156J39149_100016813 | 47 |
| 35 | 3300002705 | JGI25156J39149_1014953 | JGI25156J39149_10149532 | 47 |
| 36 | 3300002737 | JGI25162J39368_1003783 | JGI25162J39368_10037836 | 47 |
| 37 | 3300002738 | JGI25154J39366_1000185 | JGI25154J39366_100018513 | 47 |
| 38 | 3300002738 | JGI25154J39366_1000245 | JGI25154J39366_100024517 | 47 |
| 39 | 3300002741 | JGI25157J39369_1000429 | JGI25157J39369_100042917 | 47 |
| 40 | 3300003354 | JGI25160J50197_1042927 | JGI25160J50197_10429272 | 47 |
| 41 | 3300003758 | Ga0055532_1000050 | Ga0055532_1000050100 | 47 |
| 42 | 3300003761 | Ga0055535_1008146 | Ga0055535_10081462 | 47 |
| 43 | 3300003763 | Ga0055529_1009834 | Ga0055529_10098342 | 47 |
| 44 | 3300003790 | Ga0055528_1052701 | Ga0055528_10527012 | 47 |
| 45 | 3300003791 | Ga0055530_10008439 | Ga0055530_100084393 | 47 |
| 46 | 3300005262 | Ga0065165_1009352 | Ga0065165_10093525 | 47 |
| 47 | 3300005262 | Ga0065165_1103783 | Ga0065165_11037832 | 47 |
| 48 | 3300005327 | Ga0070658_10314433 | Ga0070658_103144331 | 47 |
| 49 | 3300005327 | Ga0070658_11172460 | Ga0070658_111724601 | 47 |
| 50 | 3300005330 | Ga0070690_100767971 | Ga0070690_1007679711 | 47 |
| 51 | 3300005331 | Ga0070670_100371230 | Ga0070670_1003712302 | 47 |
| 52 | 3300005335 | Ga0070666_10250629 | Ga0070666_102506291 | 47 |
| 53 | 3300005337 | Ga0070682_100894205 | Ga0070682_1008942051 | 47 |
| 54 | 3300005339 | Ga0070660_101873411 | Ga0070660_1018734111 | 47 |
| 55 | 3300005341 | Ga0070691_10077465 | Ga0070691_100774651 | 47 |
| 56 | 3300005341 | Ga0070691_10363956 | Ga0070691_103639562 | 47 |
| 57 | 3300005344 | Ga0070661_101079581 | Ga0070661_1010795812 | 47 |
| 58 | 3300005347 | Ga0070668_100219865 | Ga0070668_1002198652 | 47 |
| 59 | 3300005353 | Ga0070669_100753245 | Ga0070669_1007532452 | 47 |
| 60 | 3300005354 | Ga0070675_100049484 | Ga0070675_1000494841 | 47 |
| 61 | 3300005364 | Ga0070673_100421894 | Ga0070673_1004218942 | 47 |
| 62 | 3300005366 | Ga0070659_100376180 | Ga0070659_1003761801 | 47 |
| 63 | 3300005366 | Ga0070659_101461581 | Ga0070659_1014615812 | 47 |
| 64 | 3300005367 | Ga0070667_100037624 | Ga0070667_1000376242 | 47 |
| 65 | 3300005367 | Ga0070667_100220162 | Ga0070667_1002201622 | 47 |
| 66 | 3300005367 | Ga0070667_101498056 | Ga0070667_1014980562 | 47 |
| 67 | 3300005435 | Ga0070714_100020874 | Ga0070714_1000208742 | 47 |
| 68 | 3300005435 | Ga0070714_100161864 | Ga0070714_1001618643 | 47 |
| 69 | 3300005435 | Ga0070714_101733893 | Ga0070714_1017338932 | 47 |
| 70 | 3300005436 | Ga0070713_100021206 | Ga0070713_1000212064 | 47 |
| 71 | 3300005439 | Ga0070711_100462835 | Ga0070711_1004628351 | 47 |
| 72 | 3300005444 | Ga0070694_100038566 | Ga0070694_1000385662 | 47 |
| 73 | 3300005455 | Ga0070663_100244805 | Ga0070663_1002448052 | 47 |
| 74 | 3300005455 | Ga0070663_100256293 | Ga0070663_1002562932 | 47 |
| 75 | 3300005455 | Ga0070663_100289085 | Ga0070663_1002890852 | 47 |
| 76 | 3300005455 | Ga0070663_100725075 | Ga0070663_1007250752 | 47 |
| 77 | 3300005455 | Ga0070663_101836544 | Ga0070663_1018365442 | 47 |
| 78 | 3300005456 | Ga0070678_100186469 | Ga0070678_1001864692 | 47 |
| 79 | 3300005458 | Ga0070681_11087527 | Ga0070681_110875272 | 47 |
| 80 | 3300005471 | Ga0070698_100054973 | Ga0070698_1000549735 | 47 |
| 81 | 3300005535 | Ga0070684_100524449 | Ga0070684_1005244492 | 47 |
| 82 | 3300005539 | Ga0068853_100341109 | Ga0068853_1003411093 | 47 |
| 83 | 3300005539 | Ga0068853_100381560 | Ga0068853_1003815602 | 47 |
| 84 | 3300005539 | Ga0068853_100703249 | Ga0068853_1007032493 | 47 |
| 85 | 3300005539 | Ga0068853_100951970 | Ga0068853_1009519702 | 47 |
| 86 | 3300005539 | Ga0068853_101680477 | Ga0068853_1016804771 | 47 |
| 87 | 3300005543 | Ga0070672_101702862 | Ga0070672_1017028621 | 47 |
| 88 | 3300005545 | Ga0070695_100085770 | Ga0070695_1000857701 | 47 |
| 89 | 3300005545 | Ga0070695_101777788 | Ga0070695_1017777881 | 47 |
| 90 | 3300005548 | Ga0070665_100001771 | Ga0070665_10000177116 | 47 |
| 91 | 3300005548 | Ga0070665_100171044 | Ga0070665_1001710442 | 47 |
| 92 | 3300005548 | Ga0070665_100227245 | Ga0070665_1002272452 | 47 |
| 93 | 3300005563 | Ga0068855_100018720 | Ga0068855_1000187208 | 47 |
| 94 | 3300005564 | Ga0070664_100229728 | Ga0070664_1002297281 | 47 |
| 95 | 3300005564 | Ga0070664_101754108 | Ga0070664_1017541082 | 47 |
| 96 | 3300005578 | Ga0068854_100156413 | Ga0068854_1001564132 | 47 |
| 97 | 3300005614 | Ga0068856_100028271 | Ga0068856_1000282715 | 47 |
| 98 | 3300005614 | Ga0068856_100408509 | Ga0068856_1004085093 | 47 |
| 99 | 3300005616 | Ga0068852_100756000 | Ga0068852_1007560001 | 47 |
| 100 | 3300005616 | Ga0068852_101033037 | Ga0068852_1010330372 | 47 |
| 101 | 3300005617 | Ga0068859_100069885 | Ga0068859_1000698854 | 47 |
| 102 | 3300005618 | Ga0068864_101001603 | Ga0068864_1010016031 | 47 |
| 103 | 3300005834 | Ga0068851_10256520 | Ga0068851_102565202 | 47 |
| 104 | 3300005834 | Ga0068851_10761710 | Ga0068851_107617101 | 47 |
| 105 | 3300005841 | Ga0068863_100008576 | Ga0068863_1000085763 | 47 |
| 106 | 3300005842 | Ga0068858_100008681 | Ga0068858_1000086813 | 47 |
| 107 | 3300005843 | Ga0068860_100064420 | Ga0068860_1000644202 | 47 |
| 108 | 3300005843 | Ga0068860_102769293 | Ga0068860_1027692932 | 47 |
| 109 | 3300005844 | Ga0068862_100005681 | Ga0068862_1000056813 | 47 |
| 110 | 3300005981 | Ga0081538_10056531 | Ga0081538_100565312 | 47 |
| 111 | 3300006028 | Ga0070717_10579511 | Ga0070717_105795112 | 47 |
| 112 | 3300006038 | Ga0075365_10019410 | Ga0075365_100194102 | 47 |
| 113 | 3300006042 | Ga0075368_10357698 | Ga0075368_103576982 | 47 |
| 114 | 3300006048 | Ga0075363_100767230 | Ga0075363_1007672302 | 47 |
| 115 | 3300006051 | Ga0075364_10013967 | Ga0075364_100139673 | 47 |
| 116 | 3300006177 | Ga0075362_10034290 | Ga0075362_100342904 | 47 |
| 117 | 3300006177 | Ga0075362_10094100 | Ga0075362_100941002 | 47 |
| 118 | 3300006178 | Ga0075367_10326650 | Ga0075367_103266502 | 47 |
| 119 | 3300006178 | Ga0075367_10432529 | Ga0075367_104325292 | 47 |
| 120 | 3300006237 | Ga0097621_101872621 | Ga0097621_1018726212 | 47 |
| 121 | 3300006358 | Ga0068871_101116781 | Ga0068871_1011167811 | 47 |
| 122 | 3300006358 | Ga0068871_102006879 | Ga0068871_1020068792 | 47 |
| 123 | 3300006844 | Ga0075428_100044800 | Ga0075428_1000448007 | 47 |
| 124 | 3300006844 | Ga0075428_101572210 | Ga0075428_1015722103 | 47 |
| 125 | 3300006846 | Ga0075430_101408962 | Ga0075430_1014089622 | 47 |
| 126 | 3300006847 | Ga0075431_100149210 | Ga0075431_1001492103 | 47 |
| 127 | 3300006847 | Ga0075431_100204554 | Ga0075431_1002045545 | 47 |
| 128 | 3300006852 | Ga0075433_10845724 | Ga0075433_108457241 | 47 |
| 129 | 3300006880 | Ga0075429_100001760 | Ga0075429_10000176016 | 47 |
| 130 | 3300006931 | Ga0097620_100069885 | Ga0097620_1000698854 | 47 |
| 131 | 3300006946 | Ga0079104_1000056 | Ga0079104_100005647 | 47 |
| 132 | 3300006948 | Ga0099826_10157999 | Ga0099826_101579992 | 47 |
| 133 | 3300009011 | Ga0105251_10001596 | Ga0105251_1000159616 | 47 |
| 134 | 3300009036 | Ga0105244_10269823 | Ga0105244_102698231 | 47 |
| 135 | 3300009092 | Ga0105250_10112457 | Ga0105250_101124572 | 47 |
| 136 | 3300009092 | Ga0105250_10283495 | Ga0105250_102834952 | 47 |
| 137 | 3300009093 | Ga0105240_10008179 | Ga0105240_100081797 | 47 |
| 138 | 3300009093 | Ga0105240_10127106 | Ga0105240_101271063 | 47 |
| 139 | 3300009093 | Ga0105240_10519837 | Ga0105240_105198371 | 47 |
| 140 | 3300009093 | Ga0105240_10757023 | Ga0105240_107570232 | 47 |
| 141 | 3300009093 | Ga0105240_11107972 | Ga0105240_111079722 | 47 |
| 142 | 3300009093 | Ga0105240_11904074 | Ga0105240_119040741 | 47 |
| 143 | 3300009093 | Ga0105240_12371562 | Ga0105240_123715621 | 47 |
| 144 | 3300009098 | Ga0105245_12451026 | Ga0105245_124510261 | 47 |
| 145 | 3300009101 | Ga0105247_10083289 | Ga0105247_100832892 | 47 |
| 146 | 3300009101 | Ga0105247_11750672 | Ga0105247_117506722 | 47 |
| 147 | 3300009147 | Ga0114129_10005806 | Ga0114129_1000580616 | 47 |
| 148 | 3300009174 | Ga0105241_11211629 | Ga0105241_112116292 | 47 |
| 149 | 3300009174 | Ga0105241_11354902 | Ga0105241_113549021 | 47 |
| 150 | 3300009174 | Ga0105241_12008479 | Ga0105241_120084792 | 47 |
| 151 | 3300009174 | Ga0105241_12483104 | Ga0105241_124831041 | 47 |
| 152 | 3300009176 | Ga0105242_10086392 | Ga0105242_100863922 | 47 |
| 153 | 3300009177 | Ga0105248_10074394 | Ga0105248_100743944 | 47 |
| 154 | 3300009177 | Ga0105248_10703108 | Ga0105248_107031082 | 47 |
| 155 | 3300009545 | Ga0105237_10381952 | Ga0105237_103819522 | 47 |
| 156 | 3300009545 | Ga0105237_10473466 | Ga0105237_104734662 | 47 |
| 157 | 3300009545 | Ga0105237_11295390 | Ga0105237_112953901 | 47 |
| 158 | 3300009551 | Ga0105238_10052215 | Ga0105238_100522152 | 47 |
| 159 | 3300009551 | Ga0105238_10122725 | Ga0105238_101227253 | 47 |
| 160 | 3300009551 | Ga0105238_10282932 | Ga0105238_102829322 | 47 |
| 161 | 3300009551 | Ga0105238_10291740 | Ga0105238_102917403 | 47 |
| 162 | 3300009551 | Ga0105238_12250467 | Ga0105238_122504671 | 47 |
| 163 | 3300009553 | Ga0105249_10098527 | Ga0105249_100985272 | 47 |
| 164 | 3300009553 | Ga0105249_10391235 | Ga0105249_103912352 | 47 |
| 165 | 3300010375 | Ga0105239_10171834 | Ga0105239_101718345 | 47 |
| 166 | 3300010375 | Ga0105239_10209027 | Ga0105239_102090273 | 47 |
| 167 | 3300010375 | Ga0105239_11388705 | Ga0105239_113887052 | 47 |
| 168 | 3300010375 | Ga0105239_11626254 | Ga0105239_116262542 | 47 |
| 169 | 3300011119 | Ga0105246_10217503 | Ga0105246_102175032 | 47 |
| 170 | 3300013100 | Ga0157373_10093661 | Ga0157373_100936612 | 47 |
| 171 | 3300013105 | Ga0157369_10497695 | Ga0157369_104976952 | 47 |
| 172 | 3300013296 | Ga0157374_10051579 | Ga0157374_100515793 | 47 |
| 173 | 3300013296 | Ga0157374_10193082 | Ga0157374_101930822 | 47 |
| 174 | 3300013297 | Ga0157378_11134251 | Ga0157378_111342512 | 47 |
| 175 | 3300013306 | Ga0163162_10001141 | Ga0163162_1000114111 | 47 |
| 176 | 3300013306 | Ga0163162_10139381 | Ga0163162_101393813 | 47 |
| 177 | 3300013308 | Ga0157375_10764093 | Ga0157375_107640932 | 47 |
| 178 | 3300013308 | Ga0157375_12814828 | Ga0157375_128148282 | 47 |
| 179 | 3300014325 | Ga0163163_10942931 | Ga0163163_109429312 | 47 |
| 180 | 3300014325 | Ga0163163_11149683 | Ga0163163_111496832 | 47 |
| 181 | 3300014497 | Ga0182008_10006567 | Ga0182008_100065673 | 47 |
| 182 | 3300014745 | Ga0157377_10648699 | Ga0157377_106486992 | 47 |
| 183 | 3300014745 | Ga0157377_11732632 | Ga0157377_117326321 | 47 |
| 184 | 3300014969 | Ga0157376_10877451 | Ga0157376_108774512 | 47 |
| 185 | 3300014969 | Ga0157376_10975918 | Ga0157376_109759182 | 47 |
| 186 | 3300014969 | Ga0157376_12423676 | Ga0157376_124236762 | 47 |
| 187 | 3300015261 | Ga0182006_1061542 | Ga0182006_10615423 | 47 |
| 188 | 3300017792 | Ga0163161_10110584 | Ga0163161_101105842 | 47 |
| 189 | 3300025206 | Ga0209435_100029 | Ga0209435_10002975 | 47 |
| 190 | 3300025206 | Ga0209435_100195 | Ga0209435_10019516 | 47 |
| 191 | 3300025206 | Ga0209435_110508 | Ga0209435_1105082 | 47 |
| 192 | 3300025229 | Ga0209147_100004 | Ga0209147_100004466 | 47 |
| 193 | 3300025233 | Ga0209437_100053 | Ga0209437_100053102 | 47 |
| 194 | 3300025242 | Ga0209258_100396 | Ga0209258_10039644 | 47 |
| 195 | 3300025246 | Ga0209646_1000073 | Ga0209646_1000073109 | 47 |
| 196 | 3300025246 | Ga0209646_1000109 | Ga0209646_100010913 | 47 |
| 197 | 3300025246 | Ga0209646_1037415 | Ga0209646_10374152 | 47 |
| 198 | 3300025250 | Ga0209026_1000124 | Ga0209026_100012474 | 47 |
| 199 | 3300025250 | Ga0209026_1003015 | Ga0209026_10030155 | 47 |
| 200 | 3300025250 | Ga0209026_1035417 | Ga0209026_10354171 | 47 |
| 201 | 3300025256 | Ga0209759_1000108 | Ga0209759_100010857 | 47 |
| 202 | 3300025256 | Ga0209759_1000706 | Ga0209759_100070614 | 47 |
| 203 | 3300025261 | Ga0209233_1060313 | Ga0209233_10603132 | 47 |
| 204 | 3300025272 | Ga0209455_1014667 | Ga0209455_10146673 | 47 |
| 205 | 3300025273 | Ga0209673_1001490 | Ga0209673_100149014 | 47 |
| 206 | 3300025273 | Ga0209673_1080125 | Ga0209673_10801252 | 47 |
| 207 | 3300025291 | Ga0209675_1045396 | Ga0209675_10453962 | 47 |
| 208 | 3300025298 | Ga0209050_1000202 | Ga0209050_100020276 | 47 |
| 209 | 3300025298 | Ga0209050_1006802 | Ga0209050_10068027 | 47 |
| 210 | 3300025299 | Ga0209256_1000049 | Ga0209256_1000049164 | 47 |
| 211 | 3300025302 | Ga0207426_1002546 | Ga0207426_10025465 | 47 |
| 212 | 3300025303 | Ga0209051_1011287 | Ga0209051_10112874 | 47 |
| 213 | 3300025321 | Ga0207656_10427162 | Ga0207656_104271621 | 47 |
| 214 | 3300025728 | Ga0207655_1231614 | Ga0207655_12316142 | 47 |
| 215 | 3300025735 | Ga0207713_1003598 | Ga0207713_10035987 | 47 |
| 216 | 3300025900 | Ga0207710_10088493 | Ga0207710_100884932 | 47 |
| 217 | 3300025903 | Ga0207680_10147902 | Ga0207680_101479023 | 47 |
| 218 | 3300025903 | Ga0207680_10404237 | Ga0207680_104042372 | 47 |
| 219 | 3300025904 | Ga0207647_10167001 | Ga0207647_101670012 | 47 |
| 220 | 3300025904 | Ga0207647_10290538 | Ga0207647_102905382 | 47 |
| 221 | 3300025911 | Ga0207654_10000942 | Ga0207654_100009422 | 47 |
| 222 | 3300025911 | Ga0207654_10464192 | Ga0207654_104641922 | 47 |
| 223 | 3300025913 | Ga0207695_10004636 | Ga0207695_1000463616 | 47 |
| 224 | 3300025913 | Ga0207695_10426029 | Ga0207695_104260292 | 47 |
| 225 | 3300025913 | Ga0207695_10616805 | Ga0207695_106168051 | 47 |
| 226 | 3300025913 | Ga0207695_10854637 | Ga0207695_108546372 | 47 |
| 227 | 3300025913 | Ga0207695_11040740 | Ga0207695_110407402 | 47 |
| 228 | 3300025914 | Ga0207671_10858431 | Ga0207671_108584312 | 47 |
| 229 | 3300025918 | Ga0207662_10475311 | Ga0207662_104753112 | 47 |
| 230 | 3300025920 | Ga0207649_11109882 | Ga0207649_111098821 | 47 |
| 231 | 3300025923 | Ga0207681_10779388 | Ga0207681_107793881 | 47 |
| 232 | 3300025924 | Ga0207694_10904764 | Ga0207694_109047641 | 47 |
| 233 | 3300025925 | Ga0207650_10529854 | Ga0207650_105298542 | 47 |
| 234 | 3300025925 | Ga0207650_10624944 | Ga0207650_106249442 | 47 |
| 235 | 3300025926 | Ga0207659_10035830 | Ga0207659_100358305 | 47 |
| 236 | 3300025927 | Ga0207687_11653120 | Ga0207687_116531201 | 47 |
| 237 | 3300025932 | Ga0207690_11263468 | Ga0207690_112634682 | 47 |
| 238 | 3300025934 | Ga0207686_10281454 | Ga0207686_102814542 | 47 |
| 239 | 3300025937 | Ga0207669_10280034 | Ga0207669_102800342 | 47 |
| 240 | 3300025940 | Ga0207691_10970442 | Ga0207691_109704422 | 47 |
| 241 | 3300025941 | Ga0207711_10062500 | Ga0207711_100625003 | 47 |
| 242 | 3300025941 | Ga0207711_10413166 | Ga0207711_104131662 | 47 |
| 243 | 3300025945 | Ga0207679_10285030 | Ga0207679_102850302 | 47 |
| 244 | 3300025945 | Ga0207679_10868108 | Ga0207679_108681081 | 47 |
| 245 | 3300025949 | Ga0207667_10041465 | Ga0207667_100414656 | 47 |
| 246 | 3300025949 | Ga0207667_10124951 | Ga0207667_101249512 | 47 |
| 247 | 3300025960 | Ga0207651_10109903 | Ga0207651_101099032 | 47 |
| 248 | 3300025961 | Ga0207712_10102427 | Ga0207712_101024273 | 47 |
| 249 | 3300025972 | Ga0207668_10938668 | Ga0207668_109386682 | 47 |
| 250 | 3300025981 | Ga0207640_11782461 | Ga0207640_117824612 | 47 |
| 251 | 3300025986 | Ga0207658_10017165 | Ga0207658_100171655 | 47 |
| 252 | 3300025986 | Ga0207658_11037226 | Ga0207658_110372262 | 47 |
| 253 | 3300026035 | Ga0207703_10005498 | Ga0207703_100054983 | 47 |
| 254 | 3300026041 | Ga0207639_10167800 | Ga0207639_101678003 | 47 |
| 255 | 3300026041 | Ga0207639_10342719 | Ga0207639_103427192 | 47 |
| 256 | 3300026067 | Ga0207678_10005043 | Ga0207678_100050439 | 47 |
| 257 | 3300026067 | Ga0207678_10068252 | Ga0207678_100682522 | 47 |
| 258 | 3300026067 | Ga0207678_10260325 | Ga0207678_102603252 | 47 |
| 259 | 3300026067 | Ga0207678_10631644 | Ga0207678_106316442 | 47 |
| 260 | 3300026067 | Ga0207678_11282106 | Ga0207678_112821062 | 47 |
| 261 | 3300026078 | Ga0207702_10020035 | Ga0207702_100200355 | 47 |
| 262 | 3300026078 | Ga0207702_10481096 | Ga0207702_104810962 | 47 |
| 263 | 3300026088 | Ga0207641_10000702 | Ga0207641_1000070232 | 47 |
| 264 | 3300026121 | Ga0207683_10217267 | Ga0207683_102172673 | 47 |
| 265 | 3300026121 | Ga0207683_12020586 | Ga0207683_120205862 | 47 |
| 266 | 3300026142 | Ga0207698_10466812 | Ga0207698_104668122 | 47 |
| 267 | 3300026142 | Ga0207698_11138772 | Ga0207698_111387722 | 47 |
| 268 | 3300026142 | Ga0207698_11277228 | Ga0207698_112772281 | 47 |
| 269 | 3300027111 | Ga0209281_1000125 | Ga0209281_100012555 | 47 |
| 270 | 3300027666 | Ga0209282_1159044 | Ga0209282_11590442 | 47 |
| 271 | 3300027876 | Ga0209974_10336904 | Ga0209974_103369042 | 47 |
| 272 | 3300028379 | Ga0268266_10002582 | Ga0268266_1000258211 | 47 |
| 273 | 3300028379 | Ga0268266_10215044 | Ga0268266_102150442 | 47 |
| 274 | 3300028379 | Ga0268266_10276694 | Ga0268266_102766943 | 47 |
| 275 | 3300028380 | Ga0268265_10011961 | Ga0268265_100119613 | 47 |
| 276 | 3300028381 | Ga0268264_10000375 | Ga0268264_1000037528 | 47 |
| 277 | 3300028381 | Ga0268264_11640070 | Ga0268264_116400702 | 47 |
| 278 | 3300028786 | Ga0307517_10157202 | Ga0307517_101572022 | 47 |
| 279 | 3300031344 | Ga0265316_10403623 | Ga0265316_104036231 | 47 |
| 280 | 3300031456 | Ga0307513_10000121 | Ga0307513_1000012121 | 47 |
| 281 | 3300031456 | Ga0307513_10454646 | Ga0307513_104546462 | 47 |
| 282 | 3300031456 | Ga0307513_10503613 | Ga0307513_105036131 | 47 |
| 283 | 3300031548 | Ga0307408_100051176 | Ga0307408_1000511761 | 47 |
| 284 | 3300031616 | Ga0307508_10553188 | Ga0307508_105531882 | 47 |
| 285 | 3300031730 | Ga0307516_10002590 | Ga0307516_1000259018 | 47 |
| 286 | 3300031730 | Ga0307516_10107182 | Ga0307516_101071824 | 47 |
| 287 | 3300031730 | Ga0307516_10487987 | Ga0307516_104879872 | 47 |
| 288 | 3300031731 | Ga0307405_11983046 | Ga0307405_119830462 | 47 |
| 289 | 3300031901 | Ga0307406_10000135 | Ga0307406_1000013512 | 47 |
| 290 | 3300031901 | Ga0307406_10083585 | Ga0307406_100835852 | 47 |
| 291 | 3300033180 | Ga0307510_10000001 | Ga0307510_10000001877 | 47 |
| 292 | 3300037312 | Ga0395899_0077287 | Ga0395899_0077287_2253_2399 | 47 |
| 293 | 3300037418 | Ga0395900_0063330 | Ga0395900_0063330_176_322 | 47 |
| 294 | 3300037466 | Ga0395898_0129537 | Ga0395898_0129537_334_480 | 47 |
| 295 | 3300038443 | Ga0395901_0012451 | Ga0395901_0012451_1012_1158 | 47 |
| 296 | 3300039447 | Ga0436361_1152275 | Ga0436361_1152275_43_198 | 47 |
| 297 | 3300039447 | Ga0436361_1209085 | Ga0436361_1209085_80_235 | 47 |
| 298 | 3300039450 | Ga0436363_1712487 | Ga0436363_1712487_236_388 | 47 |
| 299 | 3300041443 | Ga0451789_0699448 | Ga0451789_0699448_12_164 | 47 |
| 300 | 3300041494 | Ga0451837_0136122 | Ga0451837_0136122_253_405 | 47 |
| 301 | 3300041512 | Ga0451853_2303321 | Ga0451853_2303321_368_517 | 47 |
| 302 | 3300042136 | Ga0450900_070252 | Ga0450900_070252_270_422 | 47 |
| 303 | 3300046457 | Ga0495590_0011663 | Ga0495590_0011663_56_208 | 47 |
| 304 | 3300046507 | Ga0495606_0090373 | Ga0495606_0090373_1721_1873 | 47 |
| 305 | 3300046507 | Ga0495606_0558899 | Ga0495606_0558899_63_218 | 47 |
| 306 | 3300046517 | Ga0495630_0640351 | Ga0495630_0640351_17_169 | 47 |
| 307 | 3300046524 | Ga0495648_0187270 | Ga0495648_0187270_714_869 | 47 |
| 308 | 3300046524 | Ga0495648_0512882 | Ga0495648_0512882_83_235 | 47 |
| 309 | 3300046531 | Ga0495665_0292850 | Ga0495665_0292850_629_781 | 47 |
| 310 | 3300046538 | Ga0495609_0464035 | Ga0495609_0464035_169_321 | 47 |
| 311 | 3300046660 | Ga0495625_0002652 | Ga0495625_0002652_16282_16437 | 47 |
| 312 | 3300046679 | Ga0495623_0090213 | Ga0495623_0090213_17_169 | 47 |
| 313 | 3300046690 | Ga0495624_0833692 | Ga0495624_0833692_70_222 | 47 |
| 314 | 3300046691 | Ga0495670_0006980 | Ga0495670_0006980_5189_5341 | 47 |
| 315 | 3300046694 | Ga0495649_0355223 | Ga0495649_0355223_525_677 | 47 |
| 316 | 3300047443 | Ga0495687_010536 | Ga0495687_010536_2487_2642 | 47 |
| 317 | 3300047470 | Ga0495681_0082998 | Ga0495681_0082998_105_257 | 47 |
| 318 | 3300047673 | Ga0495593_0026405 | Ga0495593_0026405_1870_2022 | 47 |
| 319 | 3300048906 | Ga0496103_0572233 | Ga0496103_0572233_56_208 | 47 |
| 320 | 3300048917 | Ga0496114_0007282 | Ga0496114_0007282_2646_2801 | 47 |
| 321 | 3300048919 | Ga0496116_0003419 | Ga0496116_0003419_14799_14954 | 47 |
| 322 | 3300048922 | Ga0496119_0008928 | Ga0496119_0008928_8314_8469 | 47 |
| 323 | 3300048923 | Ga0496120_0000104 | Ga0496120_0000104_31771_31926 | 47 |
| 324 | 3300048923 | Ga0496120_0274723 | Ga0496120_0274723_125_280 | 47 |
| 325 | 3300048924 | Ga0496121_0004934 | Ga0496121_0004934_31_183 | 47 |
| 326 | 3300048924 | Ga0496121_0293030 | Ga0496121_0293030_245_400 | 47 |
| 327 | 3300048925 | Ga0496122_0000472 | Ga0496122_0000472_67438_67593 | 47 |
| 328 | 3300048925 | Ga0496122_0049301 | Ga0496122_0049301_3025_3177 | 47 |
| 329 | 3300048926 | Ga0496123_0000361 | Ga0496123_0000361_23872_24027 | 47 |
| 330 | 3300048928 | Ga0496125_0000424 | Ga0496125_0000424_61074_61229 | 47 |
| 331 | 3300048928 | Ga0496125_0013473 | Ga0496125_0013473_5412_5567 | 47 |
| 332 | 3300048928 | Ga0496125_0052760 | Ga0496125_0052760_373_528 | 47 |
| 333 | 3300049460 | Ga0495682_0189213 | Ga0495682_0189213_62_217 | 47 |
| 334 | 3300049523 | Ga0501300_019362 | Ga0501300_019362_609_764 | 47 |
| 335 | 3300049568 | Ga0501031_1087203 | Ga0501031_1087203_17_163 | 47 |
| 336 | 3300049569 | Ga0501032_0409610 | Ga0501032_0409610_129_275 | 47 |
| 337 | 3300049569 | Ga0501032_1054198 | Ga0501032_1054198_250_405 | 47 |
| 338 | 3300049570 | Ga0501033_0075134 | Ga0501033_0075134_2047_2193 | 47 |
| 339 | 3300049571 | Ga0501034_0062525 | Ga0501034_0062525_1046_1192 | 47 |
| 340 | 3300049572 | Ga0501036_0040926 | Ga0501036_0040926_1979_2125 | 47 |
| 341 | 3300049574 | Ga0501038_0079637 | Ga0501038_0079637_2073_2219 | 47 |
| 342 | 3300049575 | Ga0501039_0523466 | Ga0501039_0523466_79_225 | 47 |
| 343 | 3300049579 | Ga0501043_0000009 | Ga0501043_0000009_79696_79851 | 47 |
| 344 | 3300049579 | Ga0501043_0038431 | Ga0501043_0038431_2641_2787 | 47 |
| 345 | 3300049580 | Ga0501046_0000022 | Ga0501046_0000022_79685_79840 | 47 |
| 346 | 3300049580 | Ga0501046_0085538 | Ga0501046_0085538_1663_1809 | 47 |
| 347 | 3300049581 | Ga0501047_0000021 | Ga0501047_0000021_79743_79898 | 47 |
| 348 | 3300049581 | Ga0501047_0159538 | Ga0501047_0159538_135_281 | 47 |
| 349 | 3300049582 | Ga0501048_0000311 | Ga0501048_0000311_7166_7321 | 47 |
| 350 | 3300049582 | Ga0501048_0198999 | Ga0501048_0198999_625_771 | 47 |
| 351 | 3300049589 | Ga0501073_0304222 | Ga0501073_0304222_797_943 | 47 |
| 352 | 3300049744 | Ga0501083_0101224 | Ga0501083_0101224_1170_1316 | 47 |
| 353 | 3300049744 | Ga0501083_0172642 | Ga0501083_0172642_932_1087 | 47 |
| 354 | 3300049776 | Ga0501280_006305 | Ga0501280_006305_1053_1208 | 47 |
| 355 | 3300049822 | Ga0501035_0110226 | Ga0501035_0110226_1032_1178 | 47 |
| 356 | 3300049823 | Ga0501044_0472110 | Ga0501044_0472110_787_933 | 47 |
| 357 | 3300049824 | Ga0501045_0041678 | Ga0501045_0041678_478_633 | 47 |
| 358 | 3300050496 | nmdc:mga07m45_264384_c1 | nmdc:mga07m45_264384_c1_775_930 | 47 |
| 359 | 3300050507 | nmdc:mga05p37_56596_c1 | nmdc:mga05p37_56596_c1_3195_3347 | 47 |
| 360 | 3300050508 | nmdc:mga09592_142_c2 | nmdc:mga09592_142_c2_13605_13757 | 47 |
| 361 | 3300050510 | nmdc:mga06r32_187262_c1 | nmdc:mga06r32_187262_c1_1784_1936 | 47 |
| 362 | 3300050510 | nmdc:mga06r32_192796_c1 | nmdc:mga06r32_192796_c1_1162_1314 | 47 |
| 363 | 3300050515 | nmdc:mga0a205_388080_c2 | nmdc:mga0a205_388080_c2_682_834 | 47 |
| 364 | 3300053086 | Ga0500578_0000327 | Ga0500578_0000327_5189_5344 | 47 |
| 365 | 3300053092 | Ga0500583_0023535 | Ga0500583_0023535_1722_1877 | 47 |
| 366 | 3300053136 | Ga0500559_0235384 | Ga0500559_0235384_522_677 | 47 |
| 367 | 3300053148 | Ga0500590_173236 | Ga0500590_173236_734_889 | 47 |
| 368 | 3300053730 | Ga0500645_082862 | Ga0500645_082862_388_540 | 47 |
| 369 | 3300060353 | Ga0501082_1098539 | Ga0501082_1098539_62_217 | 47 |
| 370 | 3300005289 | Ga0065704_10292439 | Ga0065704_102924392 | 48 |
| 371 | 3300005295 | Ga0065707_10300891 | Ga0065707_103008912 | 48 |
| 372 | 3300005328 | Ga0070676_10544954 | Ga0070676_105449542 | 48 |
| 373 | 3300005328 | Ga0070676_11449390 | Ga0070676_114493901 | 48 |
| 374 | 3300005329 | Ga0070683_100517115 | Ga0070683_1005171152 | 48 |
| 375 | 3300005330 | Ga0070690_101565610 | Ga0070690_1015656101 | 48 |
| 376 | 3300005334 | Ga0068869_100230828 | Ga0068869_1002308282 | 48 |
| 377 | 3300005334 | Ga0068869_100373316 | Ga0068869_1003733162 | 48 |
| 378 | 3300005338 | Ga0068868_100363275 | Ga0068868_1003632752 | 48 |
| 379 | 3300005340 | Ga0070689_101003968 | Ga0070689_1010039682 | 48 |
| 380 | 3300005341 | Ga0070691_10446418 | Ga0070691_104464182 | 48 |
| 381 | 3300005341 | Ga0070691_11014139 | Ga0070691_110141391 | 48 |
| 382 | 3300005343 | Ga0070687_100047222 | Ga0070687_1000472222 | 48 |
| 383 | 3300005344 | Ga0070661_100886922 | Ga0070661_1008869222 | 48 |
| 384 | 3300005345 | Ga0070692_10904175 | Ga0070692_109041751 | 48 |
| 385 | 3300005347 | Ga0070668_100294462 | Ga0070668_1002944621 | 48 |
| 386 | 3300005347 | Ga0070668_100908346 | Ga0070668_1009083462 | 48 |
| 387 | 3300005353 | Ga0070669_100262145 | Ga0070669_1002621452 | 48 |
| 388 | 3300005353 | Ga0070669_101702996 | Ga0070669_1017029962 | 48 |
| 389 | 3300005354 | Ga0070675_100269594 | Ga0070675_1002695942 | 48 |
| 390 | 3300005354 | Ga0070675_100942679 | Ga0070675_1009426792 | 48 |
| 391 | 3300005354 | Ga0070675_101080373 | Ga0070675_1010803732 | 48 |
| 392 | 3300005355 | Ga0070671_100442975 | Ga0070671_1004429752 | 48 |
| 393 | 3300005356 | Ga0070674_100287186 | Ga0070674_1002871862 | 48 |
| 394 | 3300005356 | Ga0070674_102115227 | Ga0070674_1021152271 | 48 |
| 395 | 3300005364 | Ga0070673_100947910 | Ga0070673_1009479102 | 48 |
| 396 | 3300005365 | Ga0070688_100070462 | Ga0070688_1000704622 | 48 |
| 397 | 3300005366 | Ga0070659_100349804 | Ga0070659_1003498042 | 48 |
| 398 | 3300005367 | Ga0070667_100516892 | Ga0070667_1005168922 | 48 |
| 399 | 3300005441 | Ga0070700_100054334 | Ga0070700_1000543342 | 48 |
| 400 | 3300005441 | Ga0070700_101345854 | Ga0070700_1013458542 | 48 |
| 401 | 3300005444 | Ga0070694_100531411 | Ga0070694_1005314111 | 48 |
| 402 | 3300005455 | Ga0070663_100031241 | Ga0070663_1000312414 | 48 |
| 403 | 3300005455 | Ga0070663_100711292 | Ga0070663_1007112922 | 48 |
| 404 | 3300005456 | Ga0070678_100204119 | Ga0070678_1002041192 | 48 |
| 405 | 3300005456 | Ga0070678_100898688 | Ga0070678_1008986882 | 48 |
| 406 | 3300005456 | Ga0070678_100943929 | Ga0070678_1009439291 | 48 |
| 407 | 3300005467 | Ga0070706_100623902 | Ga0070706_1006239022 | 48 |
| 408 | 3300005471 | Ga0070698_101296037 | Ga0070698_1012960372 | 48 |
| 409 | 3300005518 | Ga0070699_100585868 | Ga0070699_1005858682 | 48 |
| 410 | 3300005536 | Ga0070697_101840214 | Ga0070697_1018402142 | 48 |
| 411 | 3300005539 | Ga0068853_100319291 | Ga0068853_1003192912 | 48 |
| 412 | 3300005545 | Ga0070695_100351489 | Ga0070695_1003514893 | 48 |
| 413 | 3300005547 | Ga0070693_100499626 | Ga0070693_1004996262 | 48 |
| 414 | 3300005548 | Ga0070665_100021841 | Ga0070665_1000218414 | 48 |
| 415 | 3300005548 | Ga0070665_100190059 | Ga0070665_1001900594 | 48 |
| 416 | 3300005548 | Ga0070665_100439706 | Ga0070665_1004397061 | 48 |
| 417 | 3300005564 | Ga0070664_100140986 | Ga0070664_1001409862 | 48 |
| 418 | 3300005564 | Ga0070664_101117259 | Ga0070664_1011172592 | 48 |
| 419 | 3300005617 | Ga0068859_100069591 | Ga0068859_1000695915 | 48 |
| 420 | 3300005618 | Ga0068864_100528729 | Ga0068864_1005287293 | 48 |
| 421 | 3300005618 | Ga0068864_102445082 | Ga0068864_1024450821 | 48 |
| 422 | 3300005719 | Ga0068861_100159665 | Ga0068861_1001596654 | 48 |
| 423 | 3300005719 | Ga0068861_100759481 | Ga0068861_1007594811 | 48 |
| 424 | 3300005719 | Ga0068861_102694114 | Ga0068861_1026941141 | 48 |
| 425 | 3300005840 | Ga0068870_10463712 | Ga0068870_104637122 | 48 |
| 426 | 3300005841 | Ga0068863_101348929 | Ga0068863_1013489291 | 48 |
| 427 | 3300005841 | Ga0068863_102199813 | Ga0068863_1021998132 | 48 |
| 428 | 3300005842 | Ga0068858_102506059 | Ga0068858_1025060592 | 48 |
| 429 | 3300005843 | Ga0068860_100228673 | Ga0068860_1002286731 | 48 |
| 430 | 3300005843 | Ga0068860_101024800 | Ga0068860_1010248002 | 48 |
| 431 | 3300005843 | Ga0068860_102276117 | Ga0068860_1022761172 | 48 |
| 432 | 3300005844 | Ga0068862_100359643 | Ga0068862_1003596431 | 48 |
| 433 | 3300005844 | Ga0068862_100373904 | Ga0068862_1003739042 | 48 |
| 434 | 3300005844 | Ga0068862_100737249 | Ga0068862_1007372491 | 48 |
| 435 | 3300005844 | Ga0068862_101011478 | Ga0068862_1010114782 | 48 |
| 436 | 3300006038 | Ga0075365_10050844 | Ga0075365_100508443 | 48 |
| 437 | 3300006038 | Ga0075365_10136515 | Ga0075365_101365154 | 48 |
| 438 | 3300006038 | Ga0075365_10366096 | Ga0075365_103660962 | 48 |
| 439 | 3300006042 | Ga0075368_10084686 | Ga0075368_100846862 | 48 |
| 440 | 3300006048 | Ga0075363_100016696 | Ga0075363_1000166963 | 48 |
| 441 | 3300006048 | Ga0075363_100164697 | Ga0075363_1001646972 | 48 |
| 442 | 3300006048 | Ga0075363_100255157 | Ga0075363_1002551572 | 48 |
| 443 | 3300006051 | Ga0075364_10081007 | Ga0075364_100810072 | 48 |
| 444 | 3300006173 | Ga0070716_100262904 | Ga0070716_1002629042 | 48 |
| 445 | 3300006177 | Ga0075362_10047661 | Ga0075362_100476612 | 48 |
| 446 | 3300006178 | Ga0075367_10030565 | Ga0075367_100305652 | 48 |
| 447 | 3300006178 | Ga0075367_10519804 | Ga0075367_105198042 | 48 |
| 448 | 3300006178 | Ga0075367_10751006 | Ga0075367_107510061 | 48 |
| 449 | 3300006186 | Ga0075369_10014365 | Ga0075369_100143652 | 48 |
| 450 | 3300006186 | Ga0075369_10207810 | Ga0075369_102078101 | 48 |
| 451 | 3300006195 | Ga0075366_10131825 | Ga0075366_101318252 | 48 |
| 452 | 3300006195 | Ga0075366_10883572 | Ga0075366_108835722 | 48 |
| 453 | 3300006353 | Ga0075370_10082152 | Ga0075370_100821521 | 48 |
| 454 | 3300006353 | Ga0075370_10384002 | Ga0075370_103840022 | 48 |
| 455 | 3300006844 | Ga0075428_100066058 | Ga0075428_1000660582 | 48 |
| 456 | 3300006846 | Ga0075430_100921741 | Ga0075430_1009217411 | 48 |
| 457 | 3300006880 | Ga0075429_100568100 | Ga0075429_1005681002 | 48 |
| 458 | 3300006881 | Ga0068865_100756977 | Ga0068865_1007569772 | 48 |
| 459 | 3300006881 | Ga0068865_101013723 | Ga0068865_1010137232 | 48 |
| 460 | 3300006931 | Ga0097620_100069591 | Ga0097620_1000695915 | 48 |
| 461 | 3300009092 | Ga0105250_10212425 | Ga0105250_102124252 | 48 |
| 462 | 3300009093 | Ga0105240_12300583 | Ga0105240_123005831 | 48 |
| 463 | 3300009094 | Ga0111539_10619587 | Ga0111539_106195872 | 48 |
| 464 | 3300009094 | Ga0111539_10739501 | Ga0111539_107395012 | 48 |
| 465 | 3300009098 | Ga0105245_10707052 | Ga0105245_107070521 | 48 |
| 466 | 3300009101 | Ga0105247_10942533 | Ga0105247_109425332 | 48 |
| 467 | 3300009147 | Ga0114129_10451997 | Ga0114129_104519972 | 48 |
| 468 | 3300009148 | Ga0105243_10301244 | Ga0105243_103012442 | 48 |
| 469 | 3300009148 | Ga0105243_12610887 | Ga0105243_126108872 | 48 |
| 470 | 3300009545 | Ga0105237_11106922 | Ga0105237_111069222 | 48 |
| 471 | 3300009545 | Ga0105237_11980845 | Ga0105237_119808452 | 48 |
| 472 | 3300009553 | Ga0105249_10092339 | Ga0105249_100923394 | 48 |
| 473 | 3300009553 | Ga0105249_11867444 | Ga0105249_118674441 | 48 |
| 474 | 3300009553 | Ga0105249_13359691 | Ga0105249_133596911 | 48 |
| 475 | 3300010375 | Ga0105239_10335177 | Ga0105239_103351772 | 48 |
| 476 | 3300010375 | Ga0105239_10540272 | Ga0105239_105402723 | 48 |
| 477 | 3300010375 | Ga0105239_13094065 | Ga0105239_130940652 | 48 |
| 478 | 3300011119 | Ga0105246_10529946 | Ga0105246_105299462 | 48 |
| 479 | 3300011119 | Ga0105246_11262369 | Ga0105246_112623692 | 48 |
| 480 | 3300012515 | Ga0157338_1036967 | Ga0157338_10369672 | 48 |
| 481 | 3300013102 | Ga0157371_11198026 | Ga0157371_111980262 | 48 |
| 482 | 3300013105 | Ga0157369_10967080 | Ga0157369_109670802 | 48 |
| 483 | 3300013297 | Ga0157378_11250949 | Ga0157378_112509491 | 48 |
| 484 | 3300013306 | Ga0163162_10711412 | Ga0163162_107114122 | 48 |
| 485 | 3300013306 | Ga0163162_11585151 | Ga0163162_115851511 | 48 |
| 486 | 3300013307 | Ga0157372_12018395 | Ga0157372_120183951 | 48 |
| 487 | 3300013308 | Ga0157375_11849920 | Ga0157375_118499202 | 48 |
| 488 | 3300014326 | Ga0157380_10441108 | Ga0157380_104411082 | 48 |
| 489 | 3300014326 | Ga0157380_10977078 | Ga0157380_109770782 | 48 |
| 490 | 3300014326 | Ga0157380_12210898 | Ga0157380_122108981 | 48 |
| 491 | 3300014968 | Ga0157379_10513640 | Ga0157379_105136401 | 48 |
| 492 | 3300014968 | Ga0157379_12208812 | Ga0157379_122088121 | 48 |
| 493 | 3300014969 | Ga0157376_10852888 | Ga0157376_108528882 | 48 |
| 494 | 3300025711 | Ga0207696_1100059 | Ga0207696_11000592 | 48 |
| 495 | 3300025899 | Ga0207642_10252153 | Ga0207642_102521532 | 48 |
| 496 | 3300025900 | Ga0207710_10144651 | Ga0207710_101446512 | 48 |
| 497 | 3300025901 | Ga0207688_10350052 | Ga0207688_103500522 | 48 |
| 498 | 3300025901 | Ga0207688_10983844 | Ga0207688_109838442 | 48 |
| 499 | 3300025904 | Ga0207647_10157711 | Ga0207647_101577112 | 48 |
| 500 | 3300025904 | Ga0207647_10343297 | Ga0207647_103432972 | 48 |
| 501 | 3300025907 | Ga0207645_10514842 | Ga0207645_105148422 | 48 |
| 502 | 3300025908 | Ga0207643_10042620 | Ga0207643_100426204 | 48 |
| 503 | 3300025910 | Ga0207684_10235133 | Ga0207684_102351332 | 48 |
| 504 | 3300025920 | Ga0207649_10827859 | Ga0207649_108278592 | 48 |
| 505 | 3300025923 | Ga0207681_10221538 | Ga0207681_102215383 | 48 |
| 506 | 3300025926 | Ga0207659_11571856 | Ga0207659_115718561 | 48 |
| 507 | 3300025931 | Ga0207644_11793311 | Ga0207644_117933112 | 48 |
| 508 | 3300025932 | Ga0207690_10685398 | Ga0207690_106853982 | 48 |
| 509 | 3300025933 | Ga0207706_10632786 | Ga0207706_106327862 | 48 |
| 510 | 3300025935 | Ga0207709_11305995 | Ga0207709_113059951 | 48 |
| 511 | 3300025937 | Ga0207669_10089611 | Ga0207669_100896113 | 48 |
| 512 | 3300025938 | Ga0207704_10657184 | Ga0207704_106571841 | 48 |
| 513 | 3300025939 | Ga0207665_10208107 | Ga0207665_102081072 | 48 |
| 514 | 3300025940 | Ga0207691_10116511 | Ga0207691_101165112 | 48 |
| 515 | 3300025942 | Ga0207689_10162491 | Ga0207689_101624911 | 48 |
| 516 | 3300025942 | Ga0207689_10636036 | Ga0207689_106360362 | 48 |
| 517 | 3300025942 | Ga0207689_10800584 | Ga0207689_108005841 | 48 |
| 518 | 3300025945 | Ga0207679_10203273 | Ga0207679_102032732 | 48 |
| 519 | 3300025961 | Ga0207712_10282290 | Ga0207712_102822902 | 48 |
| 520 | 3300025961 | Ga0207712_10752865 | Ga0207712_107528651 | 48 |
| 521 | 3300025961 | Ga0207712_12135776 | Ga0207712_121357761 | 48 |
| 522 | 3300025972 | Ga0207668_10058070 | Ga0207668_100580702 | 48 |
| 523 | 3300025972 | Ga0207668_10634649 | Ga0207668_106346491 | 48 |
| 524 | 3300025986 | Ga0207658_10675122 | Ga0207658_106751221 | 48 |
| 525 | 3300026023 | Ga0207677_10506838 | Ga0207677_105068382 | 48 |
| 526 | 3300026035 | Ga0207703_11395769 | Ga0207703_113957692 | 48 |
| 527 | 3300026041 | Ga0207639_10615886 | Ga0207639_106158862 | 48 |
| 528 | 3300026067 | Ga0207678_10229319 | Ga0207678_102293192 | 48 |
| 529 | 3300026067 | Ga0207678_10706969 | Ga0207678_107069692 | 48 |
| 530 | 3300026067 | Ga0207678_11262943 | Ga0207678_112629432 | 48 |
| 531 | 3300026075 | Ga0207708_10550510 | Ga0207708_105505101 | 48 |
| 532 | 3300026075 | Ga0207708_11149689 | Ga0207708_111496892 | 48 |
| 533 | 3300026088 | Ga0207641_11005709 | Ga0207641_110057091 | 48 |
| 534 | 3300026088 | Ga0207641_11344920 | Ga0207641_113449201 | 48 |
| 535 | 3300026089 | Ga0207648_10561872 | Ga0207648_105618722 | 48 |
| 536 | 3300026095 | Ga0207676_10185626 | Ga0207676_101856262 | 48 |
| 537 | 3300026118 | Ga0207675_100682955 | Ga0207675_1006829552 | 48 |
| 538 | 3300026121 | Ga0207683_10093051 | Ga0207683_100930514 | 48 |
| 539 | 3300026121 | Ga0207683_10161505 | Ga0207683_101615053 | 48 |
| 540 | 3300027866 | Ga0209813_10411684 | Ga0209813_104116841 | 48 |
| 541 | 3300027907 | Ga0207428_10474748 | Ga0207428_104747482 | 48 |
| 542 | 3300028379 | Ga0268266_10001711 | Ga0268266_100017112 | 48 |
| 543 | 3300028380 | Ga0268265_10060136 | Ga0268265_100601365 | 48 |
| 544 | 3300028380 | Ga0268265_10293536 | Ga0268265_102935362 | 48 |
| 545 | 3300028380 | Ga0268265_10350717 | Ga0268265_103507171 | 48 |
| 546 | 3300028380 | Ga0268265_10366679 | Ga0268265_103666793 | 48 |
| 547 | 3300028380 | Ga0268265_10421317 | Ga0268265_104213172 | 48 |
| 548 | 3300028381 | Ga0268264_11457193 | Ga0268264_114571931 | 48 |
| 549 | 3300028381 | Ga0268264_11543635 | Ga0268264_115436352 | 48 |
| 550 | 3300031090 | Ga0265760_10346975 | Ga0265760_103469752 | 48 |
| 551 | 3300031235 | Ga0265330_10472371 | Ga0265330_104723712 | 48 |
| 552 | 3300031548 | Ga0307408_100274192 | Ga0307408_1002741922 | 48 |
| 553 | 3300031731 | Ga0307405_11566839 | Ga0307405_115668392 | 48 |
| 554 | 3300031824 | Ga0307413_10221922 | Ga0307413_102219222 | 48 |
| 555 | 3300031824 | Ga0307413_10290712 | Ga0307413_102907122 | 48 |
| 556 | 3300031852 | Ga0307410_10467495 | Ga0307410_104674951 | 48 |
| 557 | 3300031852 | Ga0307410_11824187 | Ga0307410_118241872 | 48 |
| 558 | 3300031901 | Ga0307406_10714645 | Ga0307406_107146451 | 48 |
| 559 | 3300031903 | Ga0307407_10554041 | Ga0307407_105540412 | 48 |
| 560 | 3300031903 | Ga0307407_11289045 | Ga0307407_112890451 | 48 |
| 561 | 3300031911 | Ga0307412_10649076 | Ga0307412_106490761 | 48 |
| 562 | 3300031911 | Ga0307412_10758187 | Ga0307412_107581871 | 48 |
| 563 | 3300031911 | Ga0307412_12268184 | Ga0307412_122681842 | 48 |
| 564 | 3300031995 | Ga0307409_100093371 | Ga0307409_1000933714 | 48 |
| 565 | 3300032002 | Ga0307416_100055412 | Ga0307416_1000554123 | 48 |
| 566 | 3300032002 | Ga0307416_100103487 | Ga0307416_1001034872 | 48 |
| 567 | 3300032002 | Ga0307416_100356145 | Ga0307416_1003561453 | 48 |
| 568 | 3300032004 | Ga0307414_10151785 | Ga0307414_101517854 | 48 |
| 569 | 3300032005 | Ga0307411_10074054 | Ga0307411_100740544 | 48 |
| 570 | 3300032005 | Ga0307411_10366901 | Ga0307411_103669012 | 48 |
| 571 | 3300032126 | Ga0307415_100147801 | Ga0307415_1001478012 | 48 |
| 572 | 3300032126 | Ga0307415_101624461 | Ga0307415_1016244612 | 48 |
| 573 | 3300032126 | Ga0307415_101642738 | Ga0307415_1016427382 | 48 |
| 574 | 3300036459 | Ga0372808_031413 | Ga0372808_031413_559_717 | 48 |
| 575 | 3300037471 | Ga0395905_1463581 | Ga0395905_1463581_254_409 | 48 |
| 576 | 3300039450 | Ga0436363_0335585 | Ga0436363_0335585_418_573 | 48 |
| 577 | 3300041458 | Ga0451798_1024392 | Ga0451798_1024392_425_580 | 48 |
| 578 | 3300041486 | Ga0451807_1424292 | Ga0451807_1424292_747_902 | 48 |
| 579 | 3300041491 | Ga0451833_0278061 | Ga0451833_0278061_636_791 | 48 |
| 580 | 3300041494 | Ga0451837_1750542 | Ga0451837_1750542_290_445 | 48 |
| 581 | 3300041512 | Ga0451853_1863186 | Ga0451853_1863186_71_226 | 48 |
| 582 | 3300044658 | Ga0466972_0462217 | Ga0466972_0462217_227_382 | 48 |
| 583 | 3300046474 | Ga0495605_0076541 | Ga0495605_0076541_1222_1377 | 48 |
| 584 | 3300046492 | Ga0495585_0167869 | Ga0495585_0167869_595_750 | 48 |
| 585 | 3300046519 | Ga0495632_0303925 | Ga0495632_0303925_79_234 | 48 |
| 586 | 3300046522 | Ga0495643_0350809 | Ga0495643_0350809_310_465 | 48 |
| 587 | 3300046525 | Ga0495663_0037129 | Ga0495663_0037129_89_244 | 48 |
| 588 | 3300046542 | Ga0495597_0159457 | Ga0495597_0159457_121_276 | 48 |
| 589 | 3300046543 | Ga0495645_0096835 | Ga0495645_0096835_504_659 | 48 |
| 590 | 3300046558 | Ga0495633_0350884 | Ga0495633_0350884_36_191 | 48 |
| 591 | 3300046648 | Ga0495611_0138254 | Ga0495611_0138254_195_350 | 48 |
| 592 | 3300046660 | Ga0495625_0497612 | Ga0495625_0497612_223_378 | 48 |
| 593 | 3300046678 | Ga0495599_0207120 | Ga0495599_0207120_585_740 | 48 |
| 594 | 3300046691 | Ga0495670_0103497 | Ga0495670_0103497_166_321 | 48 |
| 595 | 3300046694 | Ga0495649_0229977 | Ga0495649_0229977_33_188 | 48 |
| 596 | 3300047318 | Ga0495636_0166326 | Ga0495636_0166326_122_277 | 48 |
| 597 | 3300047445 | Ga0495677_0217048 | Ga0495677_0217048_87_242 | 48 |
| 598 | 3300047472 | Ga0495686_0238201 | Ga0495686_0238201_443_598 | 48 |
| 599 | 3300048903 | Ga0496100_0143738 | Ga0496100_0143738_766_921 | 48 |
| 600 | 3300048905 | Ga0496102_0237931 | Ga0496102_0237931_1131_1286 | 48 |
| 601 | 3300048905 | Ga0496102_0823480 | Ga0496102_0823480_124_279 | 48 |
| 602 | 3300048906 | Ga0496103_0330136 | Ga0496103_0330136_147_302 | 48 |
| 603 | 3300048907 | Ga0496104_0254658 | Ga0496104_0254658_1177_1332 | 48 |
| 604 | 3300048908 | Ga0496105_0915586 | Ga0496105_0915586_220_375 | 48 |
| 605 | 3300048909 | Ga0496106_1174352 | Ga0496106_1174352_27_182 | 48 |
| 606 | 3300048913 | Ga0496110_0389745 | Ga0496110_0389745_399_554 | 48 |
| 607 | 3300048913 | Ga0496110_0811729 | Ga0496110_0811729_562_717 | 48 |
| 608 | 3300048915 | Ga0496112_0674996 | Ga0496112_0674996_142_297 | 48 |
| 609 | 3300048917 | Ga0496114_0522183 | Ga0496114_0522183_308_463 | 48 |
| 610 | 3300048918 | Ga0496115_0289106 | Ga0496115_0289106_520_675 | 48 |
| 611 | 3300048921 | Ga0496118_0185063 | Ga0496118_0185063_405_560 | 48 |
| 612 | 3300048922 | Ga0496119_0061788 | Ga0496119_0061788_551_706 | 48 |
| 613 | 3300048922 | Ga0496119_0452284 | Ga0496119_0452284_318_473 | 48 |
| 614 | 3300048923 | Ga0496120_0206465 | Ga0496120_0206465_44_199 | 48 |
| 615 | 3300048924 | Ga0496121_0774082 | Ga0496121_0774082_135_290 | 48 |
| 616 | 3300048927 | Ga0496124_0099925 | Ga0496124_0099925_2000_2155 | 48 |
| 617 | 3300048928 | Ga0496125_0110752 | Ga0496125_0110752_1167_1322 | 48 |
| 618 | 3300048928 | Ga0496125_0615608 | Ga0496125_0615608_310_465 | 48 |
| 619 | 3300048929 | Ga0496126_0303753 | Ga0496126_0303753_278_433 | 48 |
| 620 | 3300048929 | Ga0496126_0487172 | Ga0496126_0487172_558_713 | 48 |
| 621 | 3300049570 | Ga0501033_0280842 | Ga0501033_0280842_439_588 | 48 |
| 622 | 3300049581 | Ga0501047_0341253 | Ga0501047_0341253_1041_1190 | 48 |
| 623 | 3300049586 | Ga0501070_0388710 | Ga0501070_0388710_480_629 | 48 |
| 624 | 3300049589 | Ga0501073_0172446 | Ga0501073_0172446_88_237 | 48 |
| 625 | 3300049592 | Ga0501076_0221660 | Ga0501076_0221660_1047_1196 | 48 |
| 626 | 3300049742 | Ga0501080_0067730 | Ga0501080_0067730_2615_2764 | 48 |
| 627 | 3300049823 | Ga0501044_0439552 | Ga0501044_0439552_502_651 | 48 |
| 628 | 3300050489 | nmdc:mga03683_271346_c1 | nmdc:mga03683_271346_c1_355_510 | 48 |
| 629 | 3300050489 | nmdc:mga03683_29779_c1 | nmdc:mga03683_29779_c1_1056_1211 | 48 |
| 630 | 3300050490 | nmdc:mga03n38_103058_c1 | nmdc:mga03n38_103058_c1_560_715 | 48 |
| 631 | 3300050490 | nmdc:mga03n38_53598_c1 | nmdc:mga03n38_53598_c1_781_936 | 48 |
| 632 | 3300050491 | nmdc:mga00v17_21915_c1 | nmdc:mga00v17_21915_c1_976_1131 | 48 |
| 633 | 3300050491 | nmdc:mga00v17_672799_c1 | nmdc:mga00v17_672799_c1_196_351 | 48 |
| 634 | 3300050492 | nmdc:mga0yw44_3044_c1 | nmdc:mga0yw44_3044_c1_1305_1460 | 48 |
| 635 | 3300050492 | nmdc:mga0yw44_438721_c1 | nmdc:mga0yw44_438721_c1_442_594 | 48 |
| 636 | 3300050492 | nmdc:mga0yw44_44151_c1 | nmdc:mga0yw44_44151_c1_1808_1963 | 48 |
| 637 | 3300050492 | nmdc:mga0yw44_47931_c1 | nmdc:mga0yw44_47931_c1_2017_2172 | 48 |
| 638 | 3300050493 | nmdc:mga0k408_142381_c1 | nmdc:mga0k408_142381_c1_344_499 | 48 |
| 639 | 3300050493 | nmdc:mga0k408_434742_c1 | nmdc:mga0k408_434742_c1_417_572 | 48 |
| 640 | 3300050493 | nmdc:mga0k408_636169_c1 | nmdc:mga0k408_636169_c1_288_443 | 48 |
| 641 | 3300050494 | nmdc:mga06z11_13238_c1 | nmdc:mga06z11_13238_c1_1638_1793 | 48 |
| 642 | 3300050494 | nmdc:mga06z11_389451_c1 | nmdc:mga06z11_389451_c1_449_604 | 48 |
| 643 | 3300050494 | nmdc:mga06z11_415692_c1 | nmdc:mga06z11_415692_c1_444_599 | 48 |
| 644 | 3300050495 | nmdc:mga04h51_304655_c1 | nmdc:mga04h51_304655_c1_475_630 | 48 |
| 645 | 3300050496 | nmdc:mga07m45_32868_c1 | nmdc:mga07m45_32868_c1_120_275 | 48 |
| 646 | 3300050496 | nmdc:mga07m45_751787_c1 | nmdc:mga07m45_751787_c1_330_485 | 48 |
| 647 | 3300050507 | nmdc:mga05p37_397580_c1 | nmdc:mga05p37_397580_c1_1346_1501 | 48 |
| 648 | 3300050509 | nmdc:mga0qj67_1135337_c1 | nmdc:mga0qj67_1135337_c1_411_566 | 48 |
| 649 | 3300050511 | nmdc:mga08y16_2132907_c1 | nmdc:mga08y16_2132907_c1_272_427 | 48 |
| 650 | 3300050516 | nmdc:mga0sz30_36074_c1 | nmdc:mga0sz30_36074_c1_1333_1488 | 48 |
| 651 | 3300053090 | Ga0500646_0012843 | Ga0500646_0012843_639_794 | 48 |
| 652 | 3300053096 | Ga0500641_0003956 | Ga0500641_0003956_4163_4318 | 48 |
| 653 | 3300053096 | Ga0500641_0010765 | Ga0500641_0010765_2250_2405 | 48 |
| 654 | 3300053099 | Ga0500654_152786 | Ga0500654_152786_49_204 | 48 |
| 655 | 3300053104 | Ga0500556_0067354 | Ga0500556_0067354_610_765 | 48 |
| 656 | 3300053118 | Ga0500594_0021092 | Ga0500594_0021092_617_772 | 48 |
| 657 | 3300053119 | Ga0500595_013715 | Ga0500595_013715_1730_1885 | 48 |
| 658 | 3300053139 | Ga0500568_0021526 | Ga0500568_0021526_466_621 | 48 |
| 659 | 3300053139 | Ga0500568_0286850 | Ga0500568_0286850_384_539 | 48 |
| 660 | 3300053147 | Ga0500589_178529 | Ga0500589_178529_405_560 | 48 |
| 661 | 3300053151 | Ga0500604_0029850 | Ga0500604_0029850_927_1082 | 48 |
| 662 | 3300053739 | Ga0500587_032830 | Ga0500587_032830_374_529 | 48 |
| 663 | 3300001979 | JGI24740J21852_10013514 | JGI24740J21852_100135143 | 49 |
| 664 | 3300001979 | JGI24740J21852_10047535 | JGI24740J21852_100475352 | 49 |
| 665 | 3300001989 | JGI24739J22299_10002039 | JGI24739J22299_100020396 | 49 |
| 666 | 3300002067 | JGI24735J21928_10040493 | JGI24735J21928_100404933 | 49 |
| 667 | 3300002705 | JGI25156J39149_1004985 | JGI25156J39149_10049854 | 49 |
| 668 | 3300002741 | JGI25157J39369_1001872 | JGI25157J39369_10018724 | 49 |
| 669 | 3300003214 | JGI25165J46597_1000147 | JGI25165J46597_100014794 | 49 |
| 670 | 3300003316 | rootH1_10060681 | rootH1_100606813 | 49 |
| 671 | 3300005289 | Ga0065704_10223530 | Ga0065704_102235302 | 49 |
| 672 | 3300005327 | Ga0070658_11255454 | Ga0070658_112554541 | 49 |
| 673 | 3300005327 | Ga0070658_11335603 | Ga0070658_113356031 | 49 |
| 674 | 3300005328 | Ga0070676_10504095 | Ga0070676_105040951 | 49 |
| 675 | 3300005329 | Ga0070683_100823835 | Ga0070683_1008238351 | 49 |
| 676 | 3300005331 | Ga0070670_100066337 | Ga0070670_1000663375 | 49 |
| 677 | 3300005335 | Ga0070666_10004869 | Ga0070666_100048695 | 49 |
| 678 | 3300005338 | Ga0068868_100399695 | Ga0068868_1003996951 | 49 |
| 679 | 3300005339 | Ga0070660_100179601 | Ga0070660_1001796013 | 49 |
| 680 | 3300005339 | Ga0070660_100920092 | Ga0070660_1009200922 | 49 |
| 681 | 3300005344 | Ga0070661_100046521 | Ga0070661_1000465211 | 49 |
| 682 | 3300005347 | Ga0070668_100382004 | Ga0070668_1003820042 | 49 |
| 683 | 3300005353 | Ga0070669_100850399 | Ga0070669_1008503992 | 49 |
| 684 | 3300005356 | Ga0070674_100412160 | Ga0070674_1004121603 | 49 |
| 685 | 3300005366 | Ga0070659_101440702 | Ga0070659_1014407022 | 49 |
| 686 | 3300005367 | Ga0070667_100014791 | Ga0070667_1000147916 | 49 |
| 687 | 3300005367 | Ga0070667_100414315 | Ga0070667_1004143153 | 49 |
| 688 | 3300005455 | Ga0070663_100023376 | Ga0070663_1000233764 | 49 |
| 689 | 3300005455 | Ga0070663_100158000 | Ga0070663_1001580002 | 49 |
| 690 | 3300005455 | Ga0070663_100287791 | Ga0070663_1002877911 | 49 |
| 691 | 3300005455 | Ga0070663_101417682 | Ga0070663_1014176821 | 49 |
| 692 | 3300005455 | Ga0070663_101863546 | Ga0070663_1018635462 | 49 |
| 693 | 3300005456 | Ga0070678_100884653 | Ga0070678_1008846531 | 49 |
| 694 | 3300005456 | Ga0070678_101255587 | Ga0070678_1012555871 | 49 |
| 695 | 3300005457 | Ga0070662_100005114 | Ga0070662_1000051145 | 49 |
| 696 | 3300005539 | Ga0068853_100029492 | Ga0068853_1000294924 | 49 |
| 697 | 3300005539 | Ga0068853_100727705 | Ga0068853_1007277051 | 49 |
| 698 | 3300005539 | Ga0068853_101209781 | Ga0068853_1012097812 | 49 |
| 699 | 3300005539 | Ga0068853_102366403 | Ga0068853_1023664031 | 49 |
| 700 | 3300005548 | Ga0070665_100000778 | Ga0070665_10000077819 | 49 |
| 701 | 3300005548 | Ga0070665_100050498 | Ga0070665_1000504984 | 49 |
| 702 | 3300005548 | Ga0070665_102113295 | Ga0070665_1021132952 | 49 |
| 703 | 3300005563 | Ga0068855_100387978 | Ga0068855_1003879783 | 49 |
| 704 | 3300005563 | Ga0068855_100697493 | Ga0068855_1006974933 | 49 |
| 705 | 3300005563 | Ga0068855_101283159 | Ga0068855_1012831592 | 49 |
| 706 | 3300005563 | Ga0068855_101426752 | Ga0068855_1014267521 | 49 |
| 707 | 3300005578 | Ga0068854_101058707 | Ga0068854_1010587072 | 49 |
| 708 | 3300005578 | Ga0068854_101536123 | Ga0068854_1015361232 | 49 |
| 709 | 3300005614 | Ga0068856_100138824 | Ga0068856_1001388242 | 49 |
| 710 | 3300005614 | Ga0068856_100385836 | Ga0068856_1003858362 | 49 |
| 711 | 3300005614 | Ga0068856_100504705 | Ga0068856_1005047052 | 49 |
| 712 | 3300005614 | Ga0068856_100790700 | Ga0068856_1007907002 | 49 |
| 713 | 3300005614 | Ga0068856_101154138 | Ga0068856_1011541381 | 49 |
| 714 | 3300005616 | Ga0068852_100143206 | Ga0068852_1001432063 | 49 |
| 715 | 3300005616 | Ga0068852_100289998 | Ga0068852_1002899982 | 49 |
| 716 | 3300005616 | Ga0068852_100746806 | Ga0068852_1007468062 | 49 |
| 717 | 3300005616 | Ga0068852_101274626 | Ga0068852_1012746262 | 49 |
| 718 | 3300005617 | Ga0068859_101799198 | Ga0068859_1017991982 | 49 |
| 719 | 3300005719 | Ga0068861_101082105 | Ga0068861_1010821052 | 49 |
| 720 | 3300005834 | Ga0068851_10011579 | Ga0068851_100115792 | 49 |
| 721 | 3300005834 | Ga0068851_10951395 | Ga0068851_109513951 | 49 |
| 722 | 3300005841 | Ga0068863_100316694 | Ga0068863_1003166943 | 49 |
| 723 | 3300005842 | Ga0068858_100002518 | Ga0068858_1000025188 | 49 |
| 724 | 3300006038 | Ga0075365_10008054 | Ga0075365_100080543 | 49 |
| 725 | 3300006038 | Ga0075365_10042042 | Ga0075365_100420423 | 49 |
| 726 | 3300006038 | Ga0075365_10219305 | Ga0075365_102193052 | 49 |
| 727 | 3300006042 | Ga0075368_10010145 | Ga0075368_100101453 | 49 |
| 728 | 3300006042 | Ga0075368_10059835 | Ga0075368_100598353 | 49 |
| 729 | 3300006048 | Ga0075363_100048225 | Ga0075363_1000482252 | 49 |
| 730 | 3300006048 | Ga0075363_100109067 | Ga0075363_1001090673 | 49 |
| 731 | 3300006051 | Ga0075364_10144673 | Ga0075364_101446733 | 49 |
| 732 | 3300006051 | Ga0075364_10686839 | Ga0075364_106868392 | 49 |
| 733 | 3300006177 | Ga0075362_10043133 | Ga0075362_100431331 | 49 |
| 734 | 3300006177 | Ga0075362_10081871 | Ga0075362_100818713 | 49 |
| 735 | 3300006177 | Ga0075362_10210340 | Ga0075362_102103402 | 49 |
| 736 | 3300006178 | Ga0075367_10010494 | Ga0075367_100104944 | 49 |
| 737 | 3300006178 | Ga0075367_10059422 | Ga0075367_100594224 | 49 |
| 738 | 3300006178 | Ga0075367_10080622 | Ga0075367_100806223 | 49 |
| 739 | 3300006178 | Ga0075367_10132711 | Ga0075367_101327112 | 49 |
| 740 | 3300006186 | Ga0075369_10015191 | Ga0075369_100151913 | 49 |
| 741 | 3300006195 | Ga0075366_10043033 | Ga0075366_100430332 | 49 |
| 742 | 3300006237 | Ga0097621_100263485 | Ga0097621_1002634853 | 49 |
| 743 | 3300006237 | Ga0097621_101110566 | Ga0097621_1011105662 | 49 |
| 744 | 3300006237 | Ga0097621_101845026 | Ga0097621_1018450262 | 49 |
| 745 | 3300006353 | Ga0075370_10007676 | Ga0075370_100076764 | 49 |
| 746 | 3300006353 | Ga0075370_10200649 | Ga0075370_102006492 | 49 |
| 747 | 3300006358 | Ga0068871_100640227 | Ga0068871_1006402273 | 49 |
| 748 | 3300006881 | Ga0068865_100505232 | Ga0068865_1005052321 | 49 |
| 749 | 3300006881 | Ga0068865_101100683 | Ga0068865_1011006831 | 49 |
| 750 | 3300006931 | Ga0097620_101799161 | Ga0097620_1017991612 | 49 |
| 751 | 3300009093 | Ga0105240_10059150 | Ga0105240_100591505 | 49 |
| 752 | 3300009093 | Ga0105240_10061454 | Ga0105240_100614544 | 49 |
| 753 | 3300009093 | Ga0105240_10762312 | Ga0105240_107623122 | 49 |
| 754 | 3300009093 | Ga0105240_11111977 | Ga0105240_111119771 | 49 |
| 755 | 3300009093 | Ga0105240_11497022 | Ga0105240_114970222 | 49 |
| 756 | 3300009093 | Ga0105240_11967403 | Ga0105240_119674031 | 49 |
| 757 | 3300009098 | Ga0105245_10440947 | Ga0105245_104409472 | 49 |
| 758 | 3300009101 | Ga0105247_10448093 | Ga0105247_104480933 | 49 |
| 759 | 3300009101 | Ga0105247_11002055 | Ga0105247_110020552 | 49 |
| 760 | 3300009148 | Ga0105243_11420752 | Ga0105243_114207522 | 49 |
| 761 | 3300009148 | Ga0105243_11691615 | Ga0105243_116916151 | 49 |
| 762 | 3300009174 | Ga0105241_10081072 | Ga0105241_100810724 | 49 |
| 763 | 3300009174 | Ga0105241_10253459 | Ga0105241_102534592 | 49 |
| 764 | 3300009174 | Ga0105241_11461227 | Ga0105241_114612272 | 49 |
| 765 | 3300009177 | Ga0105248_10173347 | Ga0105248_101733473 | 49 |
| 766 | 3300009177 | Ga0105248_12077331 | Ga0105248_120773311 | 49 |
| 767 | 3300009545 | Ga0105237_10009094 | Ga0105237_100090941 | 49 |
| 768 | 3300009545 | Ga0105237_10138333 | Ga0105237_101383333 | 49 |
| 769 | 3300009545 | Ga0105237_10799817 | Ga0105237_107998172 | 49 |
| 770 | 3300009545 | Ga0105237_10947979 | Ga0105237_109479793 | 49 |
| 771 | 3300009551 | Ga0105238_10003517 | Ga0105238_1000351710 | 49 |
| 772 | 3300009551 | Ga0105238_10191520 | Ga0105238_101915203 | 49 |
| 773 | 3300009551 | Ga0105238_10254791 | Ga0105238_102547913 | 49 |
| 774 | 3300009551 | Ga0105238_12982749 | Ga0105238_129827491 | 49 |
| 775 | 3300010375 | Ga0105239_10099609 | Ga0105239_100996093 | 49 |
| 776 | 3300010375 | Ga0105239_10118616 | Ga0105239_101186163 | 49 |
| 777 | 3300010375 | Ga0105239_10158197 | Ga0105239_101581973 | 49 |
| 778 | 3300010375 | Ga0105239_10164361 | Ga0105239_101643612 | 49 |
| 779 | 3300010375 | Ga0105239_10181533 | Ga0105239_101815333 | 49 |
| 780 | 3300010375 | Ga0105239_10267037 | Ga0105239_102670372 | 49 |
| 781 | 3300010375 | Ga0105239_10436143 | Ga0105239_104361431 | 49 |
| 782 | 3300010375 | Ga0105239_10729445 | Ga0105239_107294452 | 49 |
| 783 | 3300010375 | Ga0105239_10759015 | Ga0105239_107590152 | 49 |
| 784 | 3300010375 | Ga0105239_11599131 | Ga0105239_115991311 | 49 |
| 785 | 3300011119 | Ga0105246_11439485 | Ga0105246_114394852 | 49 |
| 786 | 3300013104 | Ga0157370_10180720 | Ga0157370_101807202 | 49 |
| 787 | 3300013104 | Ga0157370_10220044 | Ga0157370_102200443 | 49 |
| 788 | 3300013105 | Ga0157369_10171634 | Ga0157369_101716343 | 49 |
| 789 | 3300013105 | Ga0157369_10783890 | Ga0157369_107838902 | 49 |
| 790 | 3300013105 | Ga0157369_10791152 | Ga0157369_107911523 | 49 |
| 791 | 3300013296 | Ga0157374_10076369 | Ga0157374_100763693 | 49 |
| 792 | 3300013296 | Ga0157374_10279860 | Ga0157374_102798603 | 49 |
| 793 | 3300013297 | Ga0157378_10146986 | Ga0157378_101469863 | 49 |
| 794 | 3300013306 | Ga0163162_10218040 | Ga0163162_102180403 | 49 |
| 795 | 3300013306 | Ga0163162_10686908 | Ga0163162_106869083 | 49 |
| 796 | 3300013307 | Ga0157372_10494947 | Ga0157372_104949472 | 49 |
| 797 | 3300014325 | Ga0163163_10151077 | Ga0163163_101510772 | 49 |
| 798 | 3300014497 | Ga0182008_10249686 | Ga0182008_102496862 | 49 |
| 799 | 3300014968 | Ga0157379_10362897 | Ga0157379_103628972 | 49 |
| 800 | 3300014968 | Ga0157379_10617552 | Ga0157379_106175522 | 49 |
| 801 | 3300014969 | Ga0157376_11410968 | Ga0157376_114109682 | 49 |
| 802 | 3300015261 | Ga0182006_1178185 | Ga0182006_11781852 | 49 |
| 803 | 3300017792 | Ga0163161_10109379 | Ga0163161_101093792 | 49 |
| 804 | 3300017792 | Ga0163161_10580314 | Ga0163161_105803141 | 49 |
| 805 | 3300025250 | Ga0209026_1000050 | Ga0209026_1000050119 | 49 |
| 806 | 3300025250 | Ga0209026_1062093 | Ga0209026_10620931 | 49 |
| 807 | 3300025254 | Ga0209148_1000032 | Ga0209148_1000032333 | 49 |
| 808 | 3300025256 | Ga0209759_1000891 | Ga0209759_100089114 | 49 |
| 809 | 3300025256 | Ga0209759_1051238 | Ga0209759_10512382 | 49 |
| 810 | 3300025261 | Ga0209233_1000034 | Ga0209233_100003494 | 49 |
| 811 | 3300025261 | Ga0209233_1012371 | Ga0209233_10123713 | 49 |
| 812 | 3300025297 | Ga0209758_1008143 | Ga0209758_10081438 | 49 |
| 813 | 3300025315 | Ga0207697_10416142 | Ga0207697_104161421 | 49 |
| 814 | 3300025321 | Ga0207656_10112723 | Ga0207656_101127231 | 49 |
| 815 | 3300025321 | Ga0207656_10235560 | Ga0207656_102355601 | 49 |
| 816 | 3300025321 | Ga0207656_10397757 | Ga0207656_103977572 | 49 |
| 817 | 3300025900 | Ga0207710_10333561 | Ga0207710_103335612 | 49 |
| 818 | 3300025904 | Ga0207647_10002871 | Ga0207647_100028716 | 49 |
| 819 | 3300025904 | Ga0207647_10140070 | Ga0207647_101400702 | 49 |
| 820 | 3300025904 | Ga0207647_10423436 | Ga0207647_104234362 | 49 |
| 821 | 3300025909 | Ga0207705_10074750 | Ga0207705_100747503 | 49 |
| 822 | 3300025911 | Ga0207654_10035690 | Ga0207654_100356904 | 49 |
| 823 | 3300025911 | Ga0207654_10050624 | Ga0207654_100506243 | 49 |
| 824 | 3300025911 | Ga0207654_10097988 | Ga0207654_100979882 | 49 |
| 825 | 3300025913 | Ga0207695_10044260 | Ga0207695_100442604 | 49 |
| 826 | 3300025913 | Ga0207695_10063100 | Ga0207695_100631002 | 49 |
| 827 | 3300025913 | Ga0207695_10068811 | Ga0207695_100688114 | 49 |
| 828 | 3300025913 | Ga0207695_10241541 | Ga0207695_102415413 | 49 |
| 829 | 3300025914 | Ga0207671_10052890 | Ga0207671_100528901 | 49 |
| 830 | 3300025914 | Ga0207671_10180471 | Ga0207671_101804711 | 49 |
| 831 | 3300025914 | Ga0207671_10835395 | Ga0207671_108353951 | 49 |
| 832 | 3300025914 | Ga0207671_11052088 | Ga0207671_110520881 | 49 |
| 833 | 3300025919 | Ga0207657_10121959 | Ga0207657_101219592 | 49 |
| 834 | 3300025923 | Ga0207681_10986082 | Ga0207681_109860821 | 49 |
| 835 | 3300025924 | Ga0207694_10114041 | Ga0207694_101140411 | 49 |
| 836 | 3300025924 | Ga0207694_10175086 | Ga0207694_101750863 | 49 |
| 837 | 3300025924 | Ga0207694_10563001 | Ga0207694_105630012 | 49 |
| 838 | 3300025924 | Ga0207694_10949165 | Ga0207694_109491652 | 49 |
| 839 | 3300025925 | Ga0207650_10049617 | Ga0207650_100496175 | 49 |
| 840 | 3300025926 | Ga0207659_11225866 | Ga0207659_112258662 | 49 |
| 841 | 3300025927 | Ga0207687_11165520 | Ga0207687_111655202 | 49 |
| 842 | 3300025932 | Ga0207690_10756531 | Ga0207690_107565313 | 49 |
| 843 | 3300025932 | Ga0207690_11210805 | Ga0207690_112108052 | 49 |
| 844 | 3300025933 | Ga0207706_10001802 | Ga0207706_1000180215 | 49 |
| 845 | 3300025933 | Ga0207706_10302853 | Ga0207706_103028532 | 49 |
| 846 | 3300025937 | Ga0207669_10761588 | Ga0207669_107615882 | 49 |
| 847 | 3300025938 | Ga0207704_10099540 | Ga0207704_100995402 | 49 |
| 848 | 3300025938 | Ga0207704_10900818 | Ga0207704_109008181 | 49 |
| 849 | 3300025938 | Ga0207704_11021919 | Ga0207704_110219192 | 49 |
| 850 | 3300025941 | Ga0207711_10113619 | Ga0207711_101136193 | 49 |
| 851 | 3300025949 | Ga0207667_10080924 | Ga0207667_100809244 | 49 |
| 852 | 3300025949 | Ga0207667_10246887 | Ga0207667_102468873 | 49 |
| 853 | 3300025961 | Ga0207712_10000286 | Ga0207712_1000028625 | 49 |
| 854 | 3300025972 | Ga0207668_10823577 | Ga0207668_108235772 | 49 |
| 855 | 3300025981 | Ga0207640_10334562 | Ga0207640_103345622 | 49 |
| 856 | 3300025981 | Ga0207640_11206571 | Ga0207640_112065712 | 49 |
| 857 | 3300025986 | Ga0207658_10019417 | Ga0207658_100194174 | 49 |
| 858 | 3300025986 | Ga0207658_10121969 | Ga0207658_101219692 | 49 |
| 859 | 3300026035 | Ga0207703_10002368 | Ga0207703_100023687 | 49 |
| 860 | 3300026041 | Ga0207639_10001087 | Ga0207639_1000108710 | 49 |
| 861 | 3300026041 | Ga0207639_10055044 | Ga0207639_100550442 | 49 |
| 862 | 3300026041 | Ga0207639_10261893 | Ga0207639_102618931 | 49 |
| 863 | 3300026041 | Ga0207639_10265260 | Ga0207639_102652603 | 49 |
| 864 | 3300026067 | Ga0207678_10025302 | Ga0207678_100253021 | 49 |
| 865 | 3300026067 | Ga0207678_10082193 | Ga0207678_100821933 | 49 |
| 866 | 3300026067 | Ga0207678_10159219 | Ga0207678_101592192 | 49 |
| 867 | 3300026067 | Ga0207678_10291214 | Ga0207678_102912142 | 49 |
| 868 | 3300026067 | Ga0207678_10864583 | Ga0207678_108645831 | 49 |
| 869 | 3300026078 | Ga0207702_10094264 | Ga0207702_100942642 | 49 |
| 870 | 3300026078 | Ga0207702_10102388 | Ga0207702_101023881 | 49 |
| 871 | 3300026078 | Ga0207702_10124196 | Ga0207702_101241963 | 49 |
| 872 | 3300026078 | Ga0207702_10289519 | Ga0207702_102895193 | 49 |
| 873 | 3300026089 | Ga0207648_10511798 | Ga0207648_105117982 | 49 |
| 874 | 3300026116 | Ga0207674_10826329 | Ga0207674_108263292 | 49 |
| 875 | 3300026121 | Ga0207683_10364050 | Ga0207683_103640502 | 49 |
| 876 | 3300026142 | Ga0207698_10339836 | Ga0207698_103398361 | 49 |
| 877 | 3300026142 | Ga0207698_10340571 | Ga0207698_103405712 | 49 |
| 878 | 3300027866 | Ga0209813_10042291 | Ga0209813_100422912 | 49 |
| 879 | 3300028379 | Ga0268266_10000007 | Ga0268266_100000071013 | 49 |
| 880 | 3300028379 | Ga0268266_10013394 | Ga0268266_100133944 | 49 |
| 881 | 3300028379 | Ga0268266_10052877 | Ga0268266_100528773 | 49 |
| 882 | 3300028379 | Ga0268266_10264158 | Ga0268266_102641581 | 49 |
| 883 | 3300028379 | Ga0268266_11789772 | Ga0268266_117897721 | 49 |
| 884 | 3300028381 | Ga0268264_11533885 | Ga0268264_115338851 | 49 |
| 885 | 3300028794 | Ga0307515_10213160 | Ga0307515_102131602 | 49 |
| 886 | 3300031616 | Ga0307508_10509540 | Ga0307508_105095402 | 49 |
| 887 | 3300031711 | Ga0265314_10643553 | Ga0265314_106435531 | 49 |
| 888 | 3300031824 | Ga0307413_10425752 | Ga0307413_104257523 | 49 |
| 889 | 3300031911 | Ga0307412_11221729 | Ga0307412_112217291 | 49 |
| 890 | 3300031995 | Ga0307409_102760842 | Ga0307409_1027608423 | 49 |
| 891 | 3300033180 | Ga0307510_10416343 | Ga0307510_104163432 | 49 |
| 892 | 3300035115 | Ga0373941_0268881 | Ga0373941_0268881_135_284 | 49 |
| 893 | 3300037068 | Ga0373925_1348402 | Ga0373925_1348402_226_375 | 49 |
| 894 | 3300037312 | Ga0395899_0292198 | Ga0395899_0292198_846_995 | 49 |
| 895 | 3300037418 | Ga0395900_0080559 | Ga0395900_0080559_2966_3115 | 49 |
| 896 | 3300037418 | Ga0395900_0140821 | Ga0395900_0140821_88_237 | 49 |
| 897 | 3300037418 | Ga0395900_0193173 | Ga0395900_0193173_1126_1275 | 49 |
| 898 | 3300037418 | Ga0395900_0606959 | Ga0395900_0606959_283_432 | 49 |
| 899 | 3300037466 | Ga0395898_0903223 | Ga0395898_0903223_492_641 | 49 |
| 900 | 3300037471 | Ga0395905_0017216 | Ga0395905_0017216_867_1016 | 49 |
| 901 | 3300037471 | Ga0395905_0082683 | Ga0395905_0082683_2555_2704 | 49 |
| 902 | 3300037471 | Ga0395905_0142672 | Ga0395905_0142672_353_502 | 49 |
| 903 | 3300037471 | Ga0395905_0373161 | Ga0395905_0373161_395_544 | 49 |
| 904 | 3300037471 | Ga0395905_0750857 | Ga0395905_0750857_396_545 | 49 |
| 905 | 3300038443 | Ga0395901_0128021 | Ga0395901_0128021_1088_1237 | 49 |
| 906 | 3300038443 | Ga0395901_0128937 | Ga0395901_0128937_653_802 | 49 |
| 907 | 3300038443 | Ga0395901_0259946 | Ga0395901_0259946_379_528 | 49 |
| 908 | 3300038443 | Ga0395901_0673417 | Ga0395901_0673417_679_828 | 49 |
| 909 | 3300038443 | Ga0395901_0678497 | Ga0395901_0678497_429_578 | 49 |
| 910 | 3300041451 | Ga0451791_1322022 | Ga0451791_1322022_288_437 | 49 |
| 911 | 3300041453 | Ga0451797_0765934 | Ga0451797_0765934_129_278 | 49 |
| 912 | 3300041456 | Ga0451795_0778622 | Ga0451795_0778622_158_307 | 49 |
| 913 | 3300041460 | Ga0451802_0028054 | Ga0451802_0028054_13_162 | 49 |
| 914 | 3300041486 | Ga0451807_1395372 | Ga0451807_1395372_156_305 | 49 |
| 915 | 3300041494 | Ga0451837_1562523 | Ga0451837_1562523_122_271 | 49 |
| 916 | 3300041498 | Ga0451841_0543752 | Ga0451841_0543752_124_273 | 49 |
| 917 | 3300041501 | Ga0451845_0714657 | Ga0451845_0714657_205_354 | 49 |
| 918 | 3300041512 | Ga0451853_2014640 | Ga0451853_2014640_556_705 | 49 |
| 919 | 3300041512 | Ga0451853_3343357 | Ga0451853_3343357_171_320 | 49 |
| 920 | 3300044658 | Ga0466972_0015806 | Ga0466972_0015806_242_391 | 49 |
| 921 | 3300044658 | Ga0466972_0158797 | Ga0466972_0158797_250_399 | 49 |
| 922 | 3300044735 | Ga0466968_0178091 | Ga0466968_0178091_284_433 | 49 |
| 923 | 3300044901 | Ga0466960_0015562 | Ga0466960_0015562_1181_1330 | 49 |
| 924 | 3300046500 | Ga0495596_0255550 | Ga0495596_0255550_508_657 | 49 |
| 925 | 3300046507 | Ga0495606_0532206 | Ga0495606_0532206_94_243 | 49 |
| 926 | 3300046515 | Ga0495620_0063158 | Ga0495620_0063158_1147_1296 | 49 |
| 927 | 3300046515 | Ga0495620_0289251 | Ga0495620_0289251_201_350 | 49 |
| 928 | 3300046519 | Ga0495632_0128243 | Ga0495632_0128243_270_419 | 49 |
| 929 | 3300046522 | Ga0495643_0186616 | Ga0495643_0186616_580_729 | 49 |
| 930 | 3300046522 | Ga0495643_0196006 | Ga0495643_0196006_219_368 | 49 |
| 931 | 3300046528 | Ga0495642_0225414 | Ga0495642_0225414_461_610 | 49 |
| 932 | 3300046660 | Ga0495625_0171020 | Ga0495625_0171020_568_717 | 49 |
| 933 | 3300046674 | Ga0495588_0270199 | Ga0495588_0270199_689_838 | 49 |
| 934 | 3300046810 | Ga0495660_0201499 | Ga0495660_0201499_602_751 | 49 |
| 935 | 3300047443 | Ga0495687_053816 | Ga0495687_053816_576_725 | 49 |
| 936 | 3300047472 | Ga0495686_0100077 | Ga0495686_0100077_1514_1663 | 49 |
| 937 | 3300047472 | Ga0495686_0211033 | Ga0495686_0211033_723_872 | 49 |
| 938 | 3300047472 | Ga0495686_0236703 | Ga0495686_0236703_426_575 | 49 |
| 939 | 3300047472 | Ga0495686_0340068 | Ga0495686_0340068_547_696 | 49 |
| 940 | 3300048905 | Ga0496102_0582595 | Ga0496102_0582595_721_870 | 49 |
| 941 | 3300048905 | Ga0496102_0603027 | Ga0496102_0603027_224_373 | 49 |
| 942 | 3300048905 | Ga0496102_0609196 | Ga0496102_0609196_44_193 | 49 |
| 943 | 3300048905 | Ga0496102_1197689 | Ga0496102_1197689_134_283 | 49 |
| 944 | 3300048906 | Ga0496103_0392709 | Ga0496103_0392709_695_844 | 49 |
| 945 | 3300048906 | Ga0496103_0758974 | Ga0496103_0758974_82_231 | 49 |
| 946 | 3300048907 | Ga0496104_0670317 | Ga0496104_0670317_781_930 | 49 |
| 947 | 3300048907 | Ga0496104_0896937 | Ga0496104_0896937_289_438 | 49 |
| 948 | 3300048910 | Ga0496107_0971821 | Ga0496107_0971821_40_189 | 49 |
| 949 | 3300048913 | Ga0496110_0345184 | Ga0496110_0345184_1077_1226 | 49 |
| 950 | 3300048915 | Ga0496112_0534093 | Ga0496112_0534093_175_324 | 49 |
| 951 | 3300048915 | Ga0496112_0923917 | Ga0496112_0923917_599_748 | 49 |
| 952 | 3300048916 | Ga0496113_0232009 | Ga0496113_0232009_1309_1458 | 49 |
| 953 | 3300048916 | Ga0496113_0328191 | Ga0496113_0328191_170_319 | 49 |
| 954 | 3300048916 | Ga0496113_1453958 | Ga0496113_1453958_211_360 | 49 |
| 955 | 3300048917 | Ga0496114_0573759 | Ga0496114_0573759_329_478 | 49 |
| 956 | 3300048920 | Ga0496117_0268786 | Ga0496117_0268786_163_312 | 49 |
| 957 | 3300048922 | Ga0496119_0089279 | Ga0496119_0089279_701_850 | 49 |
| 958 | 3300048922 | Ga0496119_0558548 | Ga0496119_0558548_278_427 | 49 |
| 959 | 3300048923 | Ga0496120_0000455 | Ga0496120_0000455_1118_1267 | 49 |
| 960 | 3300048923 | Ga0496120_0134647 | Ga0496120_0134647_227_376 | 49 |
| 961 | 3300048923 | Ga0496120_0442601 | Ga0496120_0442601_77_226 | 49 |
| 962 | 3300048924 | Ga0496121_0365369 | Ga0496121_0365369_125_274 | 49 |
| 963 | 3300048924 | Ga0496121_0457284 | Ga0496121_0457284_609_758 | 49 |
| 964 | 3300048925 | Ga0496122_0258255 | Ga0496122_0258255_296_445 | 49 |
| 965 | 3300048927 | Ga0496124_0346911 | Ga0496124_0346911_202_381 | 49 |
| 966 | 3300048928 | Ga0496125_0043904 | Ga0496125_0043904_904_1053 | 49 |
| 967 | 3300048929 | Ga0496126_0116420 | Ga0496126_0116420_671_820 | 49 |
| 968 | 3300048929 | Ga0496126_0120695 | Ga0496126_0120695_998_1147 | 49 |
| 969 | 3300049568 | Ga0501031_0005336 | Ga0501031_0005336_4972_5121 | 49 |
| 970 | 3300049569 | Ga0501032_0000067 | Ga0501032_0000067_10271_10420 | 49 |
| 971 | 3300049569 | Ga0501032_0636923 | Ga0501032_0636923_501_650 | 49 |
| 972 | 3300049570 | Ga0501033_0000117 | Ga0501033_0000117_4972_5121 | 49 |
| 973 | 3300049571 | Ga0501034_0000153 | Ga0501034_0000153_50253_50402 | 49 |
| 974 | 3300049572 | Ga0501036_0008779 | Ga0501036_0008779_4995_5144 | 49 |
| 975 | 3300049573 | Ga0501037_0000081 | Ga0501037_0000081_7805_7954 | 49 |
| 976 | 3300049574 | Ga0501038_0000033 | Ga0501038_0000033_79491_79640 | 49 |
| 977 | 3300049575 | Ga0501039_0000031 | Ga0501039_0000031_50203_50352 | 49 |
| 978 | 3300049579 | Ga0501043_0000044 | Ga0501043_0000044_34665_34814 | 49 |
| 979 | 3300049580 | Ga0501046_0083687 | Ga0501046_0083687_1199_1348 | 49 |
| 980 | 3300049581 | Ga0501047_1039152 | Ga0501047_1039152_379_528 | 49 |
| 981 | 3300049584 | Ga0501068_0947563 | Ga0501068_0947563_63_212 | 49 |
| 982 | 3300049586 | Ga0501070_0997363 | Ga0501070_0997363_435_584 | 49 |
| 983 | 3300049822 | Ga0501035_0000472 | Ga0501035_0000472_4979_5128 | 49 |
| 984 | 3300049823 | Ga0501044_0014405 | Ga0501044_0014405_3410_3559 | 49 |
| 985 | 3300049823 | Ga0501044_0475613 | Ga0501044_0475613_975_1124 | 49 |
| 986 | 3300050490 | nmdc:mga03n38_155457_c1 | nmdc:mga03n38_155457_c1_245_394 | 49 |
| 987 | 3300050491 | nmdc:mga00v17_144100_c1 | nmdc:mga00v17_144100_c1_678_827 | 49 |
| 988 | 3300050491 | nmdc:mga00v17_81391_c1 | nmdc:mga00v17_81391_c1_1708_1857 | 49 |
| 989 | 3300050491 | nmdc:mga00v17_84199_c1 | nmdc:mga00v17_84199_c1_210_359 | 49 |
| 990 | 3300050492 | nmdc:mga0yw44_159047_c1 | nmdc:mga0yw44_159047_c1_623_772 | 49 |
| 991 | 3300050492 | nmdc:mga0yw44_253999_c1 | nmdc:mga0yw44_253999_c1_732_881 | 49 |
| 992 | 3300050492 | nmdc:mga0yw44_256489_c1 | nmdc:mga0yw44_256489_c1_959_1108 | 49 |
| 993 | 3300050492 | nmdc:mga0yw44_54408_c1 | nmdc:mga0yw44_54408_c1_2008_2163 | 49 |
| 994 | 3300050493 | nmdc:mga0k408_547213_c1 | nmdc:mga0k408_547213_c1_175_324 | 49 |
| 995 | 3300050494 | nmdc:mga06z11_178799_c1 | nmdc:mga06z11_178799_c1_784_933 | 49 |
| 996 | 3300050494 | nmdc:mga06z11_290636_c1 | nmdc:mga06z11_290636_c1_243_392 | 49 |
| 997 | 3300050495 | nmdc:mga04h51_69223_c1 | nmdc:mga04h51_69223_c1_1040_1189 | 49 |
| 998 | 3300050496 | nmdc:mga07m45_332704_c1 | nmdc:mga07m45_332704_c1_578_727 | 49 |
| 999 | 3300053077 | Ga0495601_0343647 | Ga0495601_0343647_434_583 | 49 |
| 1000 | 3300053079 | Ga0500610_0012946 | Ga0500610_0012946_1084_1233 | 49 |
| 1001 | 3300053079 | Ga0500610_0192265 | Ga0500610_0192265_721_870 | 49 |
| 1002 | 3300053083 | Ga0495655_0032605 | Ga0495655_0032605_894_1043 | 49 |
| 1003 | 3300053094 | Ga0500566_0530955 | Ga0500566_0530955_95_244 | 49 |
| 1004 | 3300053098 | Ga0500650_0383878 | Ga0500650_0383878_75_224 | 49 |
| 1005 | 3300053119 | Ga0500595_041988 | Ga0500595_041988_669_818 | 49 |
| 1006 | 3300053119 | Ga0500595_192134 | Ga0500595_192134_33_182 | 49 |
| 1007 | 3300053151 | Ga0500604_0265557 | Ga0500604_0265557_267_416 | 49 |
| 1008 | 3300053155 | Ga0500620_010708 | Ga0500620_010708_1969_2118 | 49 |
| 1009 | 3300053155 | Ga0500620_098708 | Ga0500620_098708_388_537 | 49 |
| 1010 | 3300053158 | Ga0500627_0146894 | Ga0500627_0146894_892_1041 | 49 |
| 1011 | 3300053727 | Ga0500611_022925 | Ga0500611_022925_17_166 | 49 |
| 1012 | 3300059492 | Ga0587073_0284930 | Ga0587073_0284930_341_490 | 49 |
| 1013 | 3300059605 | Ga0587106_128633 | Ga0587106_128633_323_472 | 49 |
| 1014 | 3300059643 | Ga0587072_154827 | Ga0587072_154827_53_202 | 49 |
| 1015 | 3300059655 | Ga0587114_093791 | Ga0587114_093791_377_526 | 49 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar