F488161

General Info

Members Datasets Scaffolds Average Seq Length
1012 403 2024 319

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100332522|Ga0070667_1003325222
Length 341
Sequence MSGARPRPKEMGDSVRRDIVYLTVTLAIVALATTAQAQEQNYPNRPVHILAAAAPGGNPDVLARLLSQRLSDILGQPFVVENVPGAGGILAAKRIADAAPDGYTLMLNDSGALAININMSPEATYKLKDFTPITALATVPTALVIIPSVPASNLSEFIALAKSKPDAMSYGSAGAGSIHHLTMEIFAERTGIKLLHVPYRGGSALVNGLLTGEIQAGWSGLPNVISHINAGKLRGLCVSVRKRAVSLPDVPTCDELGIKGFDIADMLGLQGPAGISVKAVERLQAAIAKTMREPAMAERMAILGMDMQENGTASYVRFMQDDLDRYSKVIDRLGLSRKGNK

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
114 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
144 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
146 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
217 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
218 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
219 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
220 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
221 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
222 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
223 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
224 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
227 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
228 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
229 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
230 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
231 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
232 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
233 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
234 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
235 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
237 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
239 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
240 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
241 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
242 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
243 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
244 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
245 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
246 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
247 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
248 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
249 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
250 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
255 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
260 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
264 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
265 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
266 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
267 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
268 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
269 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
275 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
278 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
279 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
283 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
284 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
285 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
286 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
287 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
288 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
289 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
290 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
291 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
292 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
293 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
294 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
295 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
296 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
297 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
300 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
305 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
306 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
307 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
308 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
309 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
310 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
311 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
312 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
313 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
314 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
315 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
316 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
317 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
318 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
319 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
320 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
321 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
322 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
323 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
324 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
325 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
326 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
327 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
328 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
329 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
330 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
331 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
332 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
333 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
347 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
363 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
364 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
365 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
366 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
367 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
368 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
369 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
370 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
374 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
375 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
376 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
377 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
378 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
379 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
380 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
381 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
382 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
383 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
384 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
385 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
386 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
387 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
388 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
389 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
390 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
391 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
392 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
393 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
394 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
395 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
396 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
397 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
398 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
399 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
400 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
401 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
402 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
403 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.57
Nodule 0
Rhizoplane 10.28
Rhizosphere 86.36
Stem 0
Stem Tuber 0
Unclassified 6.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100332522 3300005367 Unclassified 1373
2 JGI24746J21847_1001454 3300001977 Bacteria 3765
3 JGI24739J22299_10002355 3300001989 Bacteria 7280
4 JGI24737J22298_10005173 3300001990 Bacteria 4517
5 JGI24743J22301_10000279 3300001991 Bacteria 5527
6 JGI24738J21930_10002285 3300002075 Bacteria 5069
7 JGI24749J21850_1000800 3300002076 Bacteria 4518
8 JGI24749J21850_1003432 3300002076 Bacteria 2217
9 JGI24744J21845_10003450 3300002077 Unclassified 3250
10 JGI24034J26672_10000501 3300002239 Bacteria 5062
11 JGI24742J22300_10000285 3300002244 Bacteria 7636
12 JGI24742J22300_10000731 3300002244 Bacteria 5000
13 JGI24751J29686_10002085 3300002459 Bacteria 4059
14 JGI25406J46586_10039898 3300003203 Bacteria 1669
15 Ga0065712_10087858 3300005290 Unclassified 2551
16 Ga0065707_10105003 3300005295 Bacteria 2653
17 Ga0070658_10066646 3300005327 Bacteria 2941
18 Ga0070676_10014663 3300005328 Bacteria 4311
19 Ga0070683_100010349 3300005329 Bacteria 8022
20 Ga0070683_100127360 3300005329 Bacteria 2407
21 Ga0070690_100000235 3300005330 Bacteria 28411
22 Ga0070690_100004036 3300005330 Bacteria 8123
23 Ga0070690_100006864 3300005330 Bacteria 6476
24 Ga0070690_100075479 3300005330 Unclassified 2198
25 Ga0070670_100013045 3300005331 Bacteria 7118
26 Ga0070670_100081348 3300005331 Bacteria 2784
27 Ga0070670_100083494 3300005331 Unclassified 2745
28 Ga0070670_100139759 3300005331 Bacteria 2094
29 Ga0070670_100501100 3300005331 Bacteria 1080
30 Ga0070677_10000940 3300005333 Bacteria 9465
31 Ga0068869_100000629 3300005334 Bacteria 19915
32 Ga0068869_100289764 3300005334 Bacteria 1319
33 Ga0070666_10012126 3300005335 Bacteria 5429
34 Ga0070666_10012842 3300005335 Bacteria 5296
35 Ga0070680_100001167 3300005336 Bacteria 18875
36 Ga0070680_100013671 3300005336 Bacteria 6328
37 Ga0070680_100078608 3300005336 Unclassified 2718
38 Ga0070680_100082086 3300005336 Bacteria 2660
39 Ga0070680_100134955 3300005336 Bacteria 2067
40 Ga0070682_100002926 3300005337 Bacteria 9474
41 Ga0070682_100003053 3300005337 Bacteria 9270
42 Ga0070682_100013021 3300005337 Bacteria 4775
43 Ga0070682_100014773 3300005337 Bacteria 4517
44 Ga0068868_100003444 3300005338 Bacteria 11016
45 Ga0068868_100006182 3300005338 Bacteria 8469
46 Ga0068868_100176490 3300005338 Unclassified 1771
47 Ga0070660_100268830 3300005339 Bacteria 1393
48 Ga0070660_100379117 3300005339 Unclassified 1167
49 Ga0070689_100000188 3300005340 Bacteria 37400
50 Ga0070689_100001782 3300005340 Bacteria 13823
51 Ga0070689_100019391 3300005340 Bacteria 5030
52 Ga0070689_100019765 3300005340 Bacteria 4984
53 Ga0070689_100068707 3300005340 Bacteria 2763
54 Ga0070689_100084840 3300005340 Bacteria 2490
55 Ga0070689_100169166 3300005340 Unclassified 1770
56 Ga0070691_10001176 3300005341 Bacteria 10947
57 Ga0070691_10004002 3300005341 Bacteria 6671
58 Ga0070687_100000069 3300005343 Bacteria 33055
59 Ga0070687_100062271 3300005343 Bacteria 1975
60 Ga0070687_100130224 3300005343 Bacteria 1452
61 Ga0070661_100023192 3300005344 Bacteria 4447
62 Ga0070661_100049805 3300005344 Bacteria 3066
63 Ga0070661_100105805 3300005344 Bacteria 2098
64 Ga0070692_10001429 3300005345 Bacteria 8658
65 Ga0070692_10006313 3300005345 Bacteria 5140
66 Ga0070692_10030102 3300005345 Bacteria 2712
67 Ga0070668_100032033 3300005347 Bacteria 4000
68 Ga0070669_100006075 3300005353 Bacteria 8717
69 Ga0070669_100010102 3300005353 Bacteria 6714
70 Ga0070669_100115916 3300005353 Bacteria 2038
71 Ga0070669_100208680 3300005353 Bacteria 1540
72 Ga0070675_100010884 3300005354 Bacteria 7115
73 Ga0070675_100014476 3300005354 Bacteria 6221
74 Ga0070675_100180260 3300005354 Bacteria 1826
75 Ga0070671_100001554 3300005355 Bacteria 17283
76 Ga0070671_100005261 3300005355 Bacteria 10314
77 Ga0070671_100013065 3300005355 Bacteria 6691
78 Ga0070671_100018682 3300005355 Bacteria 5633
79 Ga0070671_100227984 3300005355 Bacteria 1581
80 Ga0070674_100012344 3300005356 Bacteria 5245
81 Ga0070674_100047974 3300005356 Bacteria 2929
82 Ga0070674_100062574 3300005356 Bacteria 2601
83 Ga0070674_100079402 3300005356 Bacteria 2341
84 Ga0070673_100029758 3300005364 Bacteria 4076
85 Ga0070673_100043853 3300005364 Bacteria 3460
86 Ga0070673_100056615 3300005364 Bacteria 3094
87 Ga0070673_100171311 3300005364 Unclassified 1853
88 Ga0070673_100256335 3300005364 Bacteria 1526
89 Ga0070688_100000518 3300005365 Bacteria 19476
90 Ga0070688_100013493 3300005365 Bacteria 4608
91 Ga0070659_100001996 3300005366 Bacteria 14594
92 Ga0070659_100014760 3300005366 Bacteria 5842
93 Ga0070667_100009832 3300005367 Bacteria 7929
94 Ga0070667_100017349 3300005367 Bacteria 5965
95 Ga0070667_100361981 3300005367 Unclassified 1315
96 Ga0070703_10009245 3300005406 Bacteria 2781
97 Ga0070709_10005005 3300005434 Bacteria 7157
98 Ga0070714_100025390 3300005435 Bacteria 4890
99 Ga0070714_100048803 3300005435 Bacteria 3601
100 Ga0070713_100004683 3300005436 Bacteria 9236
101 Ga0070713_100005212 3300005436 Bacteria 8855
102 Ga0070713_100012790 3300005436 Bacteria 6170
103 Ga0070713_100086923 3300005436 Bacteria 2681
104 Ga0070713_100176838 3300005436 Bacteria 1916
105 Ga0070710_10002248 3300005437 Bacteria 9140
106 Ga0070710_10025506 3300005437 Bacteria 3131
107 Ga0070710_10245413 3300005437 Bacteria 1149
108 Ga0070701_10000142 3300005438 Bacteria 21810
109 Ga0070701_10000603 3300005438 Bacteria 12535
110 Ga0070701_10048521 3300005438 Bacteria 2191
111 Ga0070701_10095759 3300005438 Bacteria 1635
112 Ga0070711_100031939 3300005439 Bacteria 3498
113 Ga0070711_100045830 3300005439 Bacteria 2977
114 Ga0070711_100250167 3300005439 Bacteria 1390
115 Ga0070705_100001149 3300005440 Bacteria 14607
116 Ga0070705_100004550 3300005440 Bacteria 6748
117 Ga0070705_100051420 3300005440 Bacteria 2402
118 Ga0070700_100001129 3300005441 Bacteria 13230
119 Ga0070700_100008783 3300005441 Bacteria 5518
120 Ga0070694_100111339 3300005444 Bacteria 1951
121 Ga0070708_100077012 3300005445 Bacteria 3013
122 Ga0070708_100111072 3300005445 Unclassified 2520
123 Ga0070663_100167391 3300005455 Bacteria 1696
124 Ga0070678_100004056 3300005456 Bacteria 8245
125 Ga0070678_100067528 3300005456 Bacteria 2662
126 Ga0070678_100157223 3300005456 Bacteria 1837
127 Ga0070678_100234125 3300005456 Unclassified 1533
128 Ga0070678_100291110 3300005456 Bacteria 1384
129 Ga0070662_100092393 3300005457 Bacteria 2275
130 Ga0070662_100101095 3300005457 Bacteria 2182
131 Ga0070681_10000688 3300005458 Bacteria 28034
132 Ga0070681_10021720 3300005458 Bacteria 6436
133 Ga0070681_10058690 3300005458 Bacteria 3828
134 Ga0070681_10071117 3300005458 Bacteria 3444
135 Ga0070681_10199381 3300005458 Bacteria 1920
136 Ga0068867_100000296 3300005459 Bacteria 32704
137 Ga0068867_100008754 3300005459 Bacteria 7145
138 Ga0068867_100009922 3300005459 Bacteria 6708
139 Ga0068867_100048435 3300005459 Bacteria 3126
140 Ga0068867_100264046 3300005459 Unclassified 1405
141 Ga0070685_10001300 3300005466 Bacteria 13163
142 Ga0070685_10002735 3300005466 Bacteria 9033
143 Ga0070707_100249502 3300005468 Bacteria 1727
144 Ga0070699_100011236 3300005518 Bacteria 7734
145 Ga0070699_100034931 3300005518 Bacteria 4344
146 Ga0070679_100040411 3300005530 Bacteria 4641
147 Ga0070679_100059353 3300005530 Unclassified 3813
148 Ga0070679_100085012 3300005530 Bacteria 3151
149 Ga0070684_100011160 3300005535 Bacteria 7152
150 Ga0070684_100065689 3300005535 Bacteria 3184
151 Ga0070684_100207309 3300005535 Bacteria 1786
152 Ga0070697_100031782 3300005536 Bacteria 4247
153 Ga0070697_100038388 3300005536 Bacteria 3869
154 Ga0070697_100088797 3300005536 Bacteria 2553
155 Ga0070697_100172720 3300005536 Bacteria 1830
156 Ga0068853_100029841 3300005539 Bacteria 4601
157 Ga0070672_100003208 3300005543 Bacteria 10585
158 Ga0070686_100000090 3300005544 Bacteria 63246
159 Ga0070686_100001797 3300005544 Bacteria 11965
160 Ga0070686_100003371 3300005544 Bacteria 8754
161 Ga0070686_100005651 3300005544 Bacteria 6927
162 Ga0070686_100183848 3300005544 Bacteria 1487
163 Ga0070695_100004621 3300005545 Bacteria 8087
164 Ga0070695_100050402 3300005545 Bacteria 2668
165 Ga0070695_100103084 3300005545 Bacteria 1924
166 Ga0070696_100000719 3300005546 Bacteria 21155
167 Ga0070696_100002632 3300005546 Bacteria 11903
168 Ga0070693_100000525 3300005547 Bacteria 17212
169 Ga0070693_100027503 3300005547 Bacteria 3084
170 Ga0070665_100004366 3300005548 Bacteria 14875
171 Ga0070665_100178977 3300005548 Bacteria 2121
172 Ga0070665_100215084 3300005548 Unclassified 1923
173 Ga0070665_100238168 3300005548 Bacteria 1820
174 Ga0070665_100526485 3300005548 Bacteria 1194
175 Ga0070704_100000168 3300005549 Bacteria 26018
176 Ga0070704_100008425 3300005549 Bacteria 6183
177 Ga0070704_100135656 3300005549 Bacteria 1914
178 Ga0070704_100160863 3300005549 Bacteria 1776
179 Ga0068855_100000833 3300005563 Bacteria 38155
180 Ga0068855_100037836 3300005563 Bacteria 5734
181 Ga0068855_100039748 3300005563 Bacteria 5584
182 Ga0070664_100006958 3300005564 Bacteria 9117
183 Ga0070664_100021837 3300005564 Bacteria 5277
184 Ga0070664_100071588 3300005564 Bacteria 2971
185 Ga0070664_100503293 3300005564 Bacteria 1117
186 Ga0068857_100000715 3300005577 Bacteria 24767
187 Ga0068857_100487283 3300005577 Bacteria 1156
188 Ga0068854_100000657 3300005578 Bacteria 20579
189 Ga0068854_100005118 3300005578 Bacteria 8262
190 Ga0068854_100020739 3300005578 Bacteria 4453
191 Ga0068856_100003103 3300005614 Bacteria 16966
192 Ga0068856_100045035 3300005614 Bacteria 4343
193 Ga0068856_100071466 3300005614 Bacteria 3436
194 Ga0068856_100130262 3300005614 Bacteria 2520
195 Ga0068856_100231558 3300005614 Bacteria 1863
196 Ga0070702_100000002 3300005615 Bacteria 83999
197 Ga0070702_100004841 3300005615 Bacteria 6192
198 Ga0070702_100038455 3300005615 Bacteria 2664
199 Ga0070702_100166682 3300005615 Bacteria 1429
200 Ga0068852_100006185 3300005616 Bacteria 8632
201 Ga0068852_100048049 3300005616 Bacteria 3645
202 Ga0068852_100205984 3300005616 Bacteria 1863
203 Ga0068859_100000195 3300005617 Bacteria 59015
204 Ga0068859_100014349 3300005617 Bacteria 7947
205 Ga0068859_100254846 3300005617 Bacteria 1845
206 Ga0068864_100006237 3300005618 Bacteria 9780
207 Ga0068864_100006919 3300005618 Bacteria 9300
208 Ga0068864_100057324 3300005618 Bacteria 3366
209 Ga0068866_10001095 3300005718 Bacteria 11931
210 Ga0068866_10015715 3300005718 Bacteria 3368
211 Ga0068861_100000043 3300005719 Bacteria 57807
212 Ga0068861_100010394 3300005719 Bacteria 6457
213 Ga0068861_100182339 3300005719 Bacteria 1749
214 Ga0068870_10000073 3300005840 Bacteria 31807
215 Ga0068870_10032369 3300005840 Bacteria 2658
216 Ga0068863_100021006 3300005841 Bacteria 6235
217 Ga0068863_100032749 3300005841 Bacteria 4952
218 Ga0068863_100359868 3300005841 Bacteria 1418
219 Ga0068858_100005138 3300005842 Bacteria 12824
220 Ga0068858_100033913 3300005842 Bacteria 4735
221 Ga0068858_100041152 3300005842 Bacteria 4286
222 Ga0068860_100002559 3300005843 Bacteria 19020
223 Ga0068860_100019005 3300005843 Bacteria 6673
224 Ga0068860_100053202 3300005843 Bacteria 3850
225 Ga0068860_100207386 3300005843 Bacteria 1901
226 Ga0068860_100413103 3300005843 Unclassified 1337
227 Ga0068860_100464273 3300005843 Bacteria 1260
228 Ga0068862_100013767 3300005844 Bacteria 6704
229 Ga0068862_100016944 3300005844 Bacteria 6065
230 Ga0068862_100020336 3300005844 Bacteria 5544
231 Ga0081455_10000048 3300005937 Bacteria 126551
232 Ga0081455_10009739 3300005937 Bacteria 9848
233 Ga0081455_10014368 3300005937 Bacteria 7767
234 Ga0081455_10111300 3300005937 Bacteria 2175
235 Ga0081538_10041314 3300005981 Bacteria 2929
236 Ga0081540_1000282 3300005983 Bacteria 52922
237 Ga0081540_1005411 3300005983 Bacteria 9530
238 Ga0081540_1095518 3300005983 Bacteria 1295
239 Ga0081539_10000233 3300005985 Bacteria 130647
240 Ga0081539_10017035 3300005985 Bacteria 5134
241 Ga0070717_10007633 3300006028 Bacteria 8039
242 Ga0070717_10100107 3300006028 Bacteria 2460
243 Ga0075365_10019452 3300006038 Bacteria 4192
244 Ga0075365_10022809 3300006038 Bacteria 3927
245 Ga0070715_10004215 3300006163 Bacteria 4688
246 Ga0070715_10032230 3300006163 Bacteria 2133
247 Ga0070715_10069673 3300006163 Bacteria 1567
248 Ga0070716_100001791 3300006173 Bacteria 9730
249 Ga0070716_100104875 3300006173 Bacteria 1741
250 Ga0070712_100013910 3300006175 Bacteria 5153
251 Ga0070712_100076460 3300006175 Bacteria 2411
252 Ga0070712_100157181 3300006175 Bacteria 1752
253 Ga0075362_10096558 3300006177 Bacteria 1377
254 Ga0075367_10037700 3300006178 Bacteria 2810
255 Ga0075367_10086588 3300006178 Bacteria 1902
256 Ga0075369_10029300 3300006186 Bacteria 2311
257 Ga0097621_100002618 3300006237 Bacteria 12322
258 Ga0097621_100019693 3300006237 Bacteria 5186
259 Ga0097621_100021417 3300006237 Bacteria 5000
260 Ga0097621_100319335 3300006237 Bacteria 1375
261 Ga0075370_10085558 3300006353 Bacteria 1815
262 Ga0068871_100000040 3300006358 Bacteria 69044
263 Ga0068871_100024067 3300006358 Bacteria 4718
264 Ga0068871_100026506 3300006358 Bacteria 4523
265 Ga0068871_100072279 3300006358 Unclassified 2840
266 Ga0075428_100269981 3300006844 Bacteria 1830
267 Ga0075428_100443647 3300006844 Bacteria 1390
268 Ga0075430_100019382 3300006846 Bacteria 5785
269 Ga0075430_100112622 3300006846 Bacteria 2268
270 Ga0075431_100078929 3300006847 Bacteria 3398
271 Ga0075433_10037623 3300006852 Bacteria 4175
272 Ga0075433_10066445 3300006852 Unclassified 3164
273 Ga0075433_10149539 3300006852 Bacteria 2077
274 Ga0075434_100000006 3300006871 Bacteria 96966
275 Ga0075434_100000554 3300006871 Bacteria 28632
276 Ga0075434_100009283 3300006871 Bacteria 9165
277 Ga0075434_100037538 3300006871 Bacteria 4797
278 Ga0075434_100058798 3300006871 Bacteria 3821
279 Ga0075429_100031900 3300006880 Bacteria 4580
280 Ga0075429_100036481 3300006880 Bacteria 4275
281 Ga0068865_100006295 3300006881 Bacteria 7230
282 Ga0068865_100041108 3300006881 Bacteria 3145
283 Ga0075436_100000174 3300006914 Bacteria 40099
284 Ga0075436_100012987 3300006914 Bacteria 5710
285 Ga0075436_100030588 3300006914 Bacteria 3706
286 Ga0075436_100286672 3300006914 Unclassified 1178
287 Ga0097620_100000195 3300006931 Bacteria 59015
288 Ga0097620_100014349 3300006931 Bacteria 7947
289 Ga0097620_100254841 3300006931 Bacteria 1845
290 Ga0075435_100001000 3300007076 Bacteria 17911
291 Ga0075435_100006264 3300007076 Bacteria 8398
292 Ga0075435_100015067 3300007076 Bacteria 5803
293 Ga0075435_100081550 3300007076 Bacteria 2657
294 Ga0075435_100245323 3300007076 Bacteria 1524
295 Ga0099794_10011097 3300007265 Bacteria 3850
296 Ga0099795_10072793 3300007788 Bacteria 1300
297 Ga0105251_10006368 3300009011 Bacteria 7536
298 Ga0105250_10084818 3300009092 Bacteria 1286
299 Ga0105240_10657004 3300009093 Unclassified 1148
300 Ga0111539_10036658 3300009094 Bacteria 5926
301 Ga0111539_10064158 3300009094 Bacteria 4347
302 Ga0111539_10137730 3300009094 Bacteria 2858
303 Ga0111539_10172965 3300009094 Bacteria 2523
304 Ga0111539_10429434 3300009094 Bacteria 1538
305 Ga0111539_10462377 3300009094 Bacteria 1478
306 Ga0105245_10008500 3300009098 Bacteria 8956
307 Ga0105245_10009922 3300009098 Bacteria 8294
308 Ga0105245_10125792 3300009098 Bacteria 2400
309 Ga0105245_10154565 3300009098 Bacteria 2172
310 Ga0105245_10245765 3300009098 Bacteria 1737
311 Ga0105247_10054860 3300009101 Bacteria 2459
312 Ga0105247_10063271 3300009101 Bacteria 2296
313 Ga0114129_10155536 3300009147 Bacteria 3127
314 Ga0114129_10279410 3300009147 Bacteria 2231
315 Ga0114129_10536133 3300009147 Bacteria 1524
316 Ga0114129_10546916 3300009147 Bacteria 1506
317 Ga0105243_10000035 3300009148 Bacteria 177598
318 Ga0105243_10002936 3300009148 Bacteria 14105
319 Ga0105243_10020666 3300009148 Bacteria 4992
320 Ga0105243_10024008 3300009148 Bacteria 4647
321 Ga0105243_10107421 3300009148 Bacteria 2328
322 Ga0105241_10006170 3300009174 Bacteria 8841
323 Ga0105241_10080124 3300009174 Bacteria 2555
324 Ga0105242_10001935 3300009176 Bacteria 16290
325 Ga0105242_10002145 3300009176 Bacteria 15580
326 Ga0105242_10036794 3300009176 Bacteria 3929
327 Ga0105242_10302215 3300009176 Bacteria 1461
328 Ga0105248_10004376 3300009177 Bacteria 15630
329 Ga0105248_10006012 3300009177 Bacteria 13318
330 Ga0105248_10036378 3300009177 Bacteria 5505
331 Ga0105248_10085076 3300009177 Bacteria 3559
332 Ga0105237_10040741 3300009545 Bacteria 4684
333 Ga0105237_10060786 3300009545 Bacteria 3778
334 Ga0105237_10177871 3300009545 Bacteria 2128
335 Ga0105238_10059058 3300009551 Bacteria 3843
336 Ga0105249_10004810 3300009553 Bacteria 11656
337 Ga0105249_10019086 3300009553 Bacteria 6116
338 Ga0105249_10148881 3300009553 Bacteria 2251
339 Ga0105249_10387756 3300009553 Bacteria 1424
340 Ga0105249_10482476 3300009553 Bacteria 1283
341 Ga0105239_10017272 3300010375 Bacteria 7978
342 Ga0105239_10170414 3300010375 Bacteria 2434
343 Ga0105246_10001697 3300011119 Bacteria 13131
344 Ga0105246_10019691 3300011119 Bacteria 4318
345 Ga0105246_10112956 3300011119 Bacteria 1999
346 Ga0105246_10365658 3300011119 Bacteria 1187
347 Ga0157373_10110891 3300013100 Bacteria 1929
348 Ga0157369_10249435 3300013105 Bacteria 1853
349 Ga0157374_10005071 3300013296 Bacteria 11046
350 Ga0157374_10021058 3300013296 Bacteria 5795
351 Ga0157374_10048947 3300013296 Bacteria 3924
352 Ga0157374_10122968 3300013296 Bacteria 2506
353 Ga0157378_10001996 3300013297 Bacteria 18243
354 Ga0157378_10004058 3300013297 Bacteria 12931
355 Ga0157378_10004134 3300013297 Bacteria 12821
356 Ga0163162_10024841 3300013306 Bacteria 5918
357 Ga0163162_10044461 3300013306 Bacteria 4448
358 Ga0163162_10344836 3300013306 Bacteria 1622
359 Ga0157372_10138483 3300013307 Bacteria 2804
360 Ga0157372_10550620 3300013307 Bacteria 1345
361 Ga0157375_10217463 3300013308 Bacteria 2069
362 Ga0157375_10307770 3300013308 Bacteria 1749
363 Ga0163163_10002390 3300014325 Bacteria 15890
364 Ga0163163_10015764 3300014325 Bacteria 6999
365 Ga0163163_10051069 3300014325 Bacteria 4076
366 Ga0163163_10322637 3300014325 Bacteria 1598
367 Ga0163163_10335264 3300014325 Bacteria 1567
368 Ga0163163_10418214 3300014325 Bacteria 1399
369 Ga0157380_10037273 3300014326 Bacteria 3766
370 Ga0157380_10039831 3300014326 Bacteria 3656
371 Ga0157380_10191070 3300014326 Bacteria 1808
372 Ga0157377_10009511 3300014745 Bacteria 4772
373 Ga0157377_10017489 3300014745 Bacteria 3708
374 Ga0157377_10029278 3300014745 Bacteria 2971
375 Ga0157379_10016149 3300014968 Bacteria 6567
376 Ga0157379_10026672 3300014968 Bacteria 5143
377 Ga0157376_10000403 3300014969 Bacteria 28093
378 Ga0157376_10041561 3300014969 Bacteria 3765
379 Ga0157376_10043024 3300014969 Bacteria 3705
380 Ga0157376_10091968 3300014969 Bacteria 2629
381 Ga0163161_10005378 3300017792 Bacteria 8893
382 Ga0163161_10023098 3300017792 Bacteria 4383
383 Ga0163161_10059915 3300017792 Bacteria 2769
384 Ga0163161_10189495 3300017792 Bacteria 1580
385 Ga0213876_10052786 3300021384 Bacteria 2148
386 Ga0213876_10070535 3300021384 Bacteria 1846
387 Ga0213875_10000067 3300021388 Bacteria 127481
388 Ga0207666_1000154 3300025271 Bacteria 10649
389 Ga0207673_1000507 3300025290 Bacteria 4115
390 Ga0209758_1000274 3300025297 Bacteria 102644
391 Ga0207697_10000024 3300025315 Bacteria 53113
392 Ga0207656_10012299 3300025321 Bacteria 3252
393 Ga0207653_10006002 3300025885 Unclassified 3788
394 Ga0207653_10079562 3300025885 Unclassified 1133
395 Ga0207682_10000708 3300025893 Bacteria 15474
396 Ga0207682_10032204 3300025893 Bacteria 2107
397 Ga0207692_10001001 3300025898 Bacteria 10294
398 Ga0207642_10001465 3300025899 Bacteria 7300
399 Ga0207710_10000382 3300025900 Bacteria 30360
400 Ga0207710_10031356 3300025900 Bacteria 2324
401 Ga0207688_10000275 3300025901 Bacteria 23509
402 Ga0207688_10001362 3300025901 Bacteria 12697
403 Ga0207688_10048405 3300025901 Bacteria 2375
404 Ga0207680_10005838 3300025903 Bacteria 5908
405 Ga0207680_10010069 3300025903 Bacteria 4716
406 Ga0207647_10000612 3300025904 Bacteria 27777
407 Ga0207685_10001765 3300025905 Bacteria 4706
408 Ga0207685_10014555 3300025905 Bacteria 2466
409 Ga0207699_10002836 3300025906 Bacteria 8208
410 Ga0207699_10101095 3300025906 Bacteria 1830
411 Ga0207645_10000507 3300025907 Bacteria 32224
412 Ga0207645_10044250 3300025907 Bacteria 2849
413 Ga0207645_10050204 3300025907 Bacteria 2663
414 Ga0207645_10067622 3300025907 Bacteria 2284
415 Ga0207643_10000568 3300025908 Bacteria 23402
416 Ga0207643_10002081 3300025908 Bacteria 11021
417 Ga0207643_10032068 3300025908 Bacteria 2932
418 Ga0207643_10081608 3300025908 Bacteria 1874
419 Ga0207705_10053294 3300025909 Bacteria 2914
420 Ga0207705_10234931 3300025909 Bacteria 1395
421 Ga0207654_10021158 3300025911 Unclassified 3456
422 Ga0207707_10004169 3300025912 Bacteria 12805
423 Ga0207707_10019399 3300025912 Bacteria 5935
424 Ga0207707_10050919 3300025912 Bacteria 3606
425 Ga0207671_10025782 3300025914 Bacteria 4412
426 Ga0207693_10001038 3300025915 Bacteria 24865
427 Ga0207693_10079340 3300025915 Unclassified 2569
428 Ga0207693_10085910 3300025915 Bacteria 2465
429 Ga0207693_10216830 3300025915 Bacteria 1504
430 Ga0207693_10251160 3300025915 Bacteria 1388
431 Ga0207663_10014896 3300025916 Bacteria 4273
432 Ga0207663_10069352 3300025916 Bacteria 2268
433 Ga0207663_10087083 3300025916 Bacteria 2062
434 Ga0207660_10013054 3300025917 Bacteria 5439
435 Ga0207660_10014844 3300025917 Bacteria 5133
436 Ga0207660_10098275 3300025917 Bacteria 2183
437 Ga0207660_10116786 3300025917 Bacteria 2016
438 Ga0207660_10147197 3300025917 Unclassified 1806
439 Ga0207660_10233808 3300025917 Bacteria 1446
440 Ga0207662_10000006 3300025918 Bacteria 105457
441 Ga0207662_10000180 3300025918 Bacteria 30030
442 Ga0207662_10008191 3300025918 Bacteria 5717
443 Ga0207657_10007922 3300025919 Bacteria 10835
444 Ga0207657_10054706 3300025919 Bacteria 3450
445 Ga0207657_10055391 3300025919 Bacteria 3425
446 Ga0207649_10014224 3300025920 Bacteria 4452
447 Ga0207649_10082214 3300025920 Bacteria 2088
448 Ga0207649_10229671 3300025920 Unclassified 1326
449 Ga0207652_10028309 3300025921 Bacteria 4675
450 Ga0207646_10209542 3300025922 Bacteria 1760
451 Ga0207681_10002030 3300025923 Bacteria 13006
452 Ga0207681_10086586 3300025923 Bacteria 2226
453 Ga0207681_10255113 3300025923 Bacteria 1371
454 Ga0207681_10271949 3300025923 Bacteria 1330
455 Ga0207650_10006571 3300025925 Bacteria 7931
456 Ga0207650_10048838 3300025925 Bacteria 3122
457 Ga0207650_10061845 3300025925 Bacteria 2796
458 Ga0207650_10063076 3300025925 Unclassified 2770
459 Ga0207659_10002151 3300025926 Bacteria 11705
460 Ga0207659_10021087 3300025926 Bacteria 4318
461 Ga0207687_10002607 3300025927 Bacteria 12234
462 Ga0207687_10202396 3300025927 Bacteria 1553
463 Ga0207700_10019191 3300025928 Bacteria 4614
464 Ga0207700_10049928 3300025928 Bacteria 3114
465 Ga0207700_10174121 3300025928 Bacteria 1797
466 Ga0207700_10225312 3300025928 Unclassified 1591
467 Ga0207700_10228292 3300025928 Bacteria 1581
468 Ga0207664_10016403 3300025929 Bacteria 5404
469 Ga0207664_10029863 3300025929 Bacteria 4157
470 Ga0207664_10363131 3300025929 Unclassified 1283
471 Ga0207644_10007818 3300025931 Bacteria 6985
472 Ga0207644_10022652 3300025931 Bacteria 4293
473 Ga0207686_10003280 3300025934 Bacteria 8699
474 Ga0207686_10044349 3300025934 Bacteria 2730
475 Ga0207686_10105479 3300025934 Bacteria 1890
476 Ga0207709_10001302 3300025935 Bacteria 17772
477 Ga0207709_10004543 3300025935 Bacteria 7999
478 Ga0207709_10010356 3300025935 Bacteria 5134
479 Ga0207709_10011063 3300025935 Bacteria 4976
480 Ga0207709_10138093 3300025935 Bacteria 1672
481 Ga0207670_10001377 3300025936 Bacteria 12776
482 Ga0207670_10011557 3300025936 Bacteria 5131
483 Ga0207670_10078840 3300025936 Bacteria 2298
484 Ga0207670_10090481 3300025936 Bacteria 2162
485 Ga0207670_10112000 3300025936 Bacteria 1968
486 Ga0207670_10151403 3300025936 Bacteria 1722
487 Ga0207670_10210360 3300025936 Unclassified 1483
488 Ga0207669_10000408 3300025937 Bacteria 18868
489 Ga0207669_10072895 3300025937 Bacteria 2164
490 Ga0207704_10002368 3300025938 Bacteria 8473
491 Ga0207704_10008627 3300025938 Bacteria 4884
492 Ga0207704_10044170 3300025938 Bacteria 2638
493 Ga0207704_10077740 3300025938 Bacteria 2132
494 Ga0207665_10001067 3300025939 Bacteria 18428
495 Ga0207665_10003994 3300025939 Bacteria 9854
496 Ga0207665_10057692 3300025939 Bacteria 2623
497 Ga0207665_10088912 3300025939 Bacteria 2138
498 Ga0207691_10003119 3300025940 Bacteria 16188
499 Ga0207691_10331807 3300025940 Bacteria 1303
500 Ga0207691_10334059 3300025940 Bacteria 1298
501 Ga0207711_10004559 3300025941 Bacteria 11784
502 Ga0207711_10006069 3300025941 Bacteria 10208
503 Ga0207711_10014575 3300025941 Bacteria 6532
504 Ga0207711_10022668 3300025941 Bacteria 5252
505 Ga0207711_10145105 3300025941 Bacteria 2138
506 Ga0207689_10000082 3300025942 Bacteria 76708
507 Ga0207689_10000332 3300025942 Bacteria 43928
508 Ga0207689_10033746 3300025942 Bacteria 4252
509 Ga0207689_10195992 3300025942 Bacteria 1667
510 Ga0207661_10003166 3300025944 Bacteria 11415
511 Ga0207679_10001592 3300025945 Bacteria 14183
512 Ga0207679_10054349 3300025945 Bacteria 2947
513 Ga0207679_10379996 3300025945 Bacteria 1238
514 Ga0207679_10420411 3300025945 Bacteria 1179
515 Ga0207667_10087026 3300025949 Unclassified 3232
516 Ga0207667_10101374 3300025949 Bacteria 2970
517 Ga0207651_10004753 3300025960 Bacteria 6903
518 Ga0207651_10054962 3300025960 Bacteria 2731
519 Ga0207651_10221266 3300025960 Bacteria 1530
520 Ga0207712_10001343 3300025961 Bacteria 16854
521 Ga0207712_10012089 3300025961 Bacteria 5512
522 Ga0207668_10023743 3300025972 Bacteria 3947
523 Ga0207668_10027920 3300025972 Bacteria 3683
524 Ga0207640_10002417 3300025981 Bacteria 9990
525 Ga0207640_10045385 3300025981 Bacteria 2822
526 Ga0207658_10004726 3300025986 Bacteria 9428
527 Ga0207658_10016503 3300025986 Bacteria 5079
528 Ga0207658_10174417 3300025986 Bacteria 1774
529 Ga0207677_10002853 3300026023 Bacteria 9118
530 Ga0207677_10004878 3300026023 Bacteria 7241
531 Ga0207703_10005585 3300026035 Bacteria 10097
532 Ga0207703_10006036 3300026035 Bacteria 9692
533 Ga0207703_10015837 3300026035 Bacteria 5882
534 Ga0207703_10040924 3300026035 Bacteria 3711
535 Ga0207639_10009264 3300026041 Bacteria 6790
536 Ga0207639_10202500 3300026041 Bacteria 1703
537 Ga0207639_10227142 3300026041 Bacteria 1616
538 Ga0207678_10000216 3300026067 Bacteria 51220
539 Ga0207678_10012430 3300026067 Bacteria 7474
540 Ga0207678_10012502 3300026067 Bacteria 7455
541 Ga0207678_10049557 3300026067 Bacteria 3630
542 Ga0207708_10000936 3300026075 Bacteria 21857
543 Ga0207708_10005888 3300026075 Bacteria 9067
544 Ga0207708_10012141 3300026075 Bacteria 6423
545 Ga0207708_10033019 3300026075 Bacteria 3930
546 Ga0207702_10013898 3300026078 Bacteria 6687
547 Ga0207702_10039756 3300026078 Bacteria 3943
548 Ga0207702_10137572 3300026078 Bacteria 2206
549 Ga0207702_10568422 3300026078 Bacteria 1110
550 Ga0207641_10046962 3300026088 Bacteria 3640
551 Ga0207641_10064350 3300026088 Bacteria 3134
552 Ga0207648_10000316 3300026089 Bacteria 52941
553 Ga0207648_10003365 3300026089 Bacteria 16795
554 Ga0207648_10006843 3300026089 Bacteria 11297
555 Ga0207648_10007668 3300026089 Bacteria 10564
556 Ga0207648_10152119 3300026089 Bacteria 2042
557 Ga0207676_10011932 3300026095 Bacteria 6217
558 Ga0207676_10027419 3300026095 Bacteria 4242
559 Ga0207676_10028159 3300026095 Bacteria 4194
560 Ga0207676_10093450 3300026095 Bacteria 2476
561 Ga0207674_10003382 3300026116 Bacteria 19581
562 Ga0207675_100000064 3300026118 Bacteria 79279
563 Ga0207675_100004008 3300026118 Bacteria 14284
564 Ga0207675_100004550 3300026118 Bacteria 13374
565 Ga0207675_100011531 3300026118 Bacteria 8267
566 Ga0207675_100153637 3300026118 Bacteria 2192
567 Ga0207683_10000293 3300026121 Bacteria 44928
568 Ga0207683_10010609 3300026121 Bacteria 7858
569 Ga0207683_10020006 3300026121 Bacteria 5719
570 Ga0207683_10053516 3300026121 Bacteria 3540
571 Ga0207683_10076226 3300026121 Bacteria 2969
572 Ga0207698_10011482 3300026142 Bacteria 5748
573 Ga0207698_10022751 3300026142 Bacteria 4364
574 Ga0207698_10065097 3300026142 Bacteria 2861
575 Ga0209998_10001967 3300027717 Bacteria 4820
576 Ga0209974_10003644 3300027876 Bacteria 5528
577 Ga0207428_10001592 3300027907 Bacteria 23650
578 Ga0268266_10003041 3300028379 Bacteria 17192
579 Ga0268266_10099788 3300028379 Bacteria 2556
580 Ga0268266_10287846 3300028379 Bacteria 1529
581 Ga0268265_10004268 3300028380 Bacteria 9978
582 Ga0268265_10011670 3300028380 Bacteria 5942
583 Ga0268265_10036013 3300028380 Bacteria 3621
584 Ga0268265_10079802 3300028380 Bacteria 2579
585 Ga0268264_10003570 3300028381 Bacteria 13393
586 Ga0268264_10008485 3300028381 Bacteria 8544
587 Ga0268264_10051709 3300028381 Bacteria 3425
588 Ga0265332_10002624 3300031238 Bacteria 9065
589 Ga0265325_10000339 3300031241 Bacteria 33103
590 Ga0265325_10001832 3300031241 Bacteria 14693
591 Ga0265340_10001806 3300031247 Bacteria 12218
592 Ga0265339_10009221 3300031249 Bacteria 6222
593 Ga0265339_10114210 3300031249 Unclassified 1394
594 Ga0265331_10015974 3300031250 Bacteria 3950
595 Ga0265331_10054922 3300031250 Bacteria 1896
596 Ga0307513_10304361 3300031456 Bacteria 1359
597 Ga0265313_10056362 3300031595 Bacteria 1858
598 Ga0265314_10011592 3300031711 Bacteria 7262
599 Ga0265342_10000011 3300031712 Bacteria 208435
600 Ga0307416_100060311 3300032002 Bacteria 3089
601 Ga0307416_100121848 3300032002 Bacteria 2326
602 Ga0307416_100503641 3300032002 Bacteria 1276
603 Ga0307416_100909833 3300032002 Bacteria 980
604 Ga0373930_0007487 3300034816 Bacteria 1881
605 Ga0373938_0027965 3300034957 Unclassified 1190
606 Ga0373926_0077545 3300035083 Bacteria 1226
607 Ga0373928_0002816 3300035084 Bacteria 3348
608 Ga0373929_0002823 3300035085 Unclassified 3173
609 Ga0373934_0012402 3300035086 Bacteria 3218
610 Ga0373944_0000780 3300035089 Bacteria 7769
611 Ga0373944_0046225 3300035089 Bacteria 1360
612 Ga0373949_0014990 3300035090 Unclassified 1728
613 Ga0373949_0066341 3300035090 Unclassified 938
614 Ga0373952_0021169 3300035092 Bacteria 1371
615 Ga0373923_0000279 3300035111 Bacteria 11187
616 Ga0373923_0070040 3300035111 Unclassified 1504
617 Ga0373932_0002369 3300035112 Bacteria 4784
618 Ga0373936_0002310 3300035113 Bacteria 7136
619 Ga0373936_0015026 3300035113 Bacteria 2964
620 Ga0373936_0070123 3300035113 Bacteria 1443
621 Ga0373939_0001142 3300035114 Bacteria 6530
622 Ga0373939_0033354 3300035114 Bacteria 1503
623 Ga0373941_0000650 3300035115 Bacteria 7041
624 Ga0373941_0053278 3300035115 Bacteria 1293
625 Ga0373945_0000024 3300035116 Bacteria 30607
626 Ga0373945_0023430 3300035116 Bacteria 2132
627 Ga0373953_0006179 3300035117 Bacteria 3934
628 Ga0373954_0002504 3300035118 Bacteria 7704
629 Ga0373954_0153684 3300035118 Bacteria 1125
630 Ga0373956_0034271 3300035119 Bacteria 2235
631 Ga0373957_0002002 3300035120 Bacteria 5692
632 Ga0373943_0007172 3300035170 Bacteria 5000
633 Ga0373943_0008956 3300035170 Bacteria 4485
634 Ga0373943_0009551 3300035170 Bacteria 4348
635 Ga0373943_0036375 3300035170 Bacteria 2358
636 Ga0373946_0001561 3300035171 Bacteria 7978
637 Ga0373946_0006931 3300035171 Bacteria 4128
638 Ga0373946_0102054 3300035171 Bacteria 1287
639 Ga0373955_0025348 3300035172 Bacteria 3044
640 Ga0373955_0097150 3300035172 Unclassified 1686
641 Ga0373955_0219690 3300035172 Bacteria 1135
642 Ga0373961_0003645 3300035241 Unclassified 3780
643 Ga0373962_0010757 3300035242 Bacteria 2287
644 Ga0373924_0052677 3300035410 Bacteria 1689
645 Ga0373931_0006810 3300035691 Bacteria 5370
646 Ga0373931_0008696 3300035691 Bacteria 4829
647 Ga0373931_0117187 3300035691 Bacteria 1518
648 Ga0373931_0155895 3300035691 Unclassified 1335
649 Ga0373935_0005019 3300035692 Bacteria 7796
650 Ga0373935_0007141 3300035692 Bacteria 6668
651 Ga0373935_0134334 3300035692 Bacteria 1665
652 Ga0373927_0004242 3300035695 Bacteria 10067
653 Ga0373927_0017951 3300035695 Bacteria 4653
654 Ga0373927_0042410 3300035695 Bacteria 2947
655 Ga0373927_0073015 3300035695 Bacteria 2221
656 Ga0373933_0023256 3300035724 Bacteria 3538
657 Ga0373933_0049697 3300035724 Unclassified 2501
658 Ga0373933_0261374 3300035724 Unclassified 1116
659 Ga0373947_0010970 3300035725 Bacteria 5199
660 Ga0373947_0011761 3300035725 Bacteria 5014
661 Ga0373947_0031535 3300035725 Bacteria 3120
662 Ga0373947_0088702 3300035725 Bacteria 1925
663 Ga0373937_0000655 3300036401 Bacteria 30381
664 Ga0373937_0028017 3300036401 Bacteria 5096
665 Ga0373937_0054868 3300036401 Bacteria 3657
666 Ga0373925_0022231 3300037068 Bacteria 4625
667 Ga0373925_0118311 3300037068 Bacteria 2054
668 Ga0373925_0118424 3300037068 Bacteria 2053
669 Ga0395900_0010527 3300037418 Bacteria 9461
670 Ga0395898_0019086 3300037466 Bacteria 6979
671 Ga0436364_1125377 3300037853 Bacteria 21036
672 Ga0395901_0098845 3300038443 Bacteria 3060
673 Ga0436365_0124605 3300039437 Bacteria 3889
674 Ga0436365_1895534 3300039437 Bacteria 1639
675 Ga0436361_0430694 3300039447 Bacteria 4834
676 Ga0451853_3454574 3300041512 Bacteria 3506
677 Ga0451577_0012669 3300042876 Bacteria 7912
678 Ga0466963_0209296 3300044694 Unclassified 1365
679 Ga0466964_0018031 3300044706 Bacteria 2705
680 Ga0466957_0051069 3300044842 Bacteria 2517
681 Ga0466960_0194166 3300044901 Bacteria 1106
682 Ga0451576_0000822 3300045051 Bacteria 60600
683 Ga0466967_0002637 3300045976 Bacteria 11300
684 Ga0466967_0199071 3300045976 Unclassified 1896
685 Ga0495592_0002464 3300046454 Bacteria 13072
686 Ga0495603_0019055 3300046455 Bacteria 4155
687 Ga0495603_0090047 3300046455 Bacteria 1794
688 Ga0495603_0095018 3300046455 Bacteria 1741
689 Ga0495590_0082404 3300046457 Bacteria 1134
690 Ga0495591_038540 3300046458 Unclassified 1375
691 Ga0495629_0001465 3300046459 Bacteria 18592
692 Ga0495629_0053367 3300046459 Bacteria 2828
693 Ga0495629_0099250 3300046459 Bacteria 2032
694 Ga0495638_0005705 3300046460 Bacteria 9168
695 Ga0495641_0002445 3300046461 Bacteria 14659
696 Ga0495651_0002003 3300046462 Bacteria 15754
697 Ga0495651_0002165 3300046462 Bacteria 15211
698 Ga0495653_0118398 3300046463 Bacteria 1891
699 Ga0495653_0119132 3300046463 Bacteria 1885
700 Ga0495653_0356431 3300046463 Bacteria 939
701 Ga0495580_0006345 3300046472 Bacteria 9645
702 Ga0495580_0023170 3300046472 Bacteria 4562
703 Ga0495580_0093435 3300046472 Bacteria 2093
704 Ga0495580_0157402 3300046472 Bacteria 1573
705 Ga0495582_0001749 3300046473 Bacteria 12255
706 Ga0495582_0108676 3300046473 Bacteria 1557
707 Ga0495582_0208146 3300046473 Unclassified 1118
708 Ga0495639_0014565 3300046475 Bacteria 3405
709 Ga0495662_0055538 3300046476 Unclassified 1913
710 Ga0495664_0000563 3300046477 Bacteria 18692
711 Ga0495664_0003135 3300046477 Bacteria 8982
712 Ga0495664_0017138 3300046477 Bacteria 4139
713 Ga0495584_0009466 3300046491 Bacteria 5019
714 Ga0495584_0062997 3300046491 Bacteria 1864
715 Ga0495594_0009159 3300046499 Bacteria 5108
716 Ga0495594_0017917 3300046499 Bacteria 3747
717 Ga0495608_0000428 3300046511 Bacteria 29274
718 Ga0495608_0008200 3300046511 Bacteria 7334
719 Ga0495616_0015414 3300046513 Bacteria 4252
720 Ga0495618_0006811 3300046514 Bacteria 6923
721 Ga0495628_0019849 3300046516 Bacteria 5552
722 Ga0495628_0064096 3300046516 Bacteria 2878
723 Ga0495628_0160000 3300046516 Bacteria 1712
724 Ga0495630_0012330 3300046517 Bacteria 6203
725 Ga0495630_0027392 3300046517 Bacteria 4228
726 Ga0495630_0159869 3300046517 Bacteria 1715
727 Ga0495630_0515885 3300046517 Bacteria 916
728 Ga0495666_0000400 3300046526 Bacteria 19058
729 Ga0495652_0267034 3300046529 Bacteria 1260
730 Ga0495652_0318004 3300046529 Bacteria 1125
731 Ga0495640_0013977 3300046533 Bacteria 6090
732 Ga0495640_0019186 3300046533 Bacteria 5051
733 Ga0495587_0006341 3300046536 Bacteria 7713
734 Ga0495587_0018948 3300046536 Bacteria 4265
735 Ga0495598_0006601 3300046537 Bacteria 2627
736 Ga0495645_0100626 3300046543 Bacteria 2055
737 Ga0495622_0000406 3300046557 Bacteria 28954
738 Ga0495633_0014925 3300046558 Bacteria 4039
739 Ga0495633_0031919 3300046558 Bacteria 2548
740 Ga0495667_0004194 3300046559 Bacteria 9710
741 Ga0495656_0000661 3300046615 Bacteria 11018
742 Ga0495656_0007374 3300046615 Bacteria 3885
743 Ga0495668_0095410 3300046616 Bacteria 1628
744 Ga0495634_0036732 3300046642 Bacteria 3349
745 Ga0495611_0018537 3300046648 Bacteria 2985
746 Ga0495635_0012606 3300046663 Bacteria 5928
747 Ga0495635_0014382 3300046663 Bacteria 5536
748 Ga0495588_0000318 3300046674 Bacteria 32296
749 Ga0495657_0030733 3300046675 Bacteria 3758
750 Ga0495599_0017299 3300046678 Bacteria 4482
751 Ga0495599_0032734 3300046678 Bacteria 3263
752 Ga0495623_0001886 3300046679 Bacteria 14077
753 Ga0495646_0018816 3300046680 Bacteria 4374
754 Ga0495646_0027257 3300046680 Bacteria 3584
755 Ga0495647_0002144 3300046681 Bacteria 6170
756 Ga0495647_0007416 3300046681 Bacteria 3673
757 Ga0495647_0011789 3300046681 Bacteria 2999
758 Ga0495647_0021133 3300046681 Bacteria 2341
759 Ga0495658_0000237 3300046683 Bacteria 31696
760 Ga0495658_0006930 3300046683 Bacteria 5588
761 Ga0495658_0010307 3300046683 Bacteria 4675
762 Ga0495669_0041658 3300046684 Bacteria 2040
763 Ga0495669_0076310 3300046684 Bacteria 1534
764 Ga0495669_0120930 3300046684 Unclassified 1227
765 Ga0495613_0000793 3300046689 Bacteria 24573
766 Ga0495613_0001097 3300046689 Bacteria 20676
767 Ga0495613_0205306 3300046689 Unclassified 1387
768 Ga0495624_0003149 3300046690 Bacteria 12304
769 Ga0495624_0026092 3300046690 Bacteria 3831
770 Ga0495624_0067797 3300046690 Bacteria 2225
771 Ga0495670_0000558 3300046691 Bacteria 17740
772 Ga0495600_0000453 3300046809 Bacteria 21249
773 Ga0495600_0028346 3300046809 Bacteria 3622
774 Ga0495581_0017498 3300047315 Bacteria 4164
775 Ga0495581_0029185 3300047315 Bacteria 3197
776 Ga0495581_0081328 3300047315 Bacteria 1875
777 Ga0495604_0001023 3300047317 Bacteria 23306
778 Ga0495604_0005688 3300047317 Bacteria 9886
779 Ga0495604_0087533 3300047317 Bacteria 2320
780 Ga0495604_0216708 3300047317 Unclassified 1320
781 Ga0495674_0180597 3300047319 Unclassified 1757
782 Ga0495674_0233078 3300047319 Bacteria 1519
783 Ga0495674_0276738 3300047319 Bacteria 1376
784 Ga0495672_0078932 3300047320 Bacteria 1840
785 Ga0495672_0136388 3300047320 Bacteria 1286
786 Ga0495676_0023292 3300047321 Bacteria 5376
787 Ga0495676_0038413 3300047321 Bacteria 3976
788 Ga0495676_0047669 3300047321 Bacteria 3461
789 Ga0495680_0014392 3300047322 Bacteria 6853
790 Ga0495680_0022162 3300047322 Bacteria 5303
791 Ga0495680_0028274 3300047322 Bacteria 4598
792 Ga0495680_0094090 3300047322 Bacteria 2242
793 Ga0495675_0023707 3300047444 Bacteria 3910
794 Ga0495677_0028641 3300047445 Bacteria 2024
795 Ga0495679_031560 3300047446 Bacteria 1708
796 Ga0495684_0024943 3300047471 Bacteria 4598
797 Ga0495684_0135229 3300047471 Unclassified 1850
798 Ga0495684_0165348 3300047471 Bacteria 1648
799 Ga0495684_0268174 3300047471 Unclassified 1236
800 Ga0495686_0222256 3300047472 Bacteria 1074
801 Ga0495593_0001023 3300047673 Bacteria 16401
802 Ga0495602_0047540 3300048088 Bacteria 3865
803 Ga0495614_0034423 3300048089 Bacteria 2178
804 Ga0495626_0065940 3300048091 Bacteria 1638
805 Ga0496100_0003675 3300048903 Bacteria 8028
806 Ga0496100_0005737 3300048903 Bacteria 6715
807 Ga0496100_0143653 3300048903 Bacteria 1694
808 Ga0496101_0002231 3300048904 Bacteria 11842
809 Ga0496101_0006527 3300048904 Bacteria 7512
810 Ga0496101_0020096 3300048904 Bacteria 4566
811 Ga0496101_0034825 3300048904 Bacteria 3559
812 Ga0496101_0041132 3300048904 Bacteria 3294
813 Ga0496101_0071028 3300048904 Bacteria 2551
814 Ga0496101_0120326 3300048904 Bacteria 1984
815 Ga0496102_0019812 3300048905 Bacteria 5930
816 Ga0496102_0019821 3300048905 Bacteria 5928
817 Ga0496102_0020092 3300048905 Bacteria 5896
818 Ga0496102_0033077 3300048905 Bacteria 4645
819 Ga0496102_0042674 3300048905 Bacteria 4110
820 Ga0496102_0071073 3300048905 Bacteria 3195
821 Ga0496102_0240912 3300048905 Bacteria 1705
822 Ga0496102_0456723 3300048905 Bacteria 1198
823 Ga0496103_0002716 3300048906 Bacteria 11034
824 Ga0496103_0005324 3300048906 Bacteria 7712
825 Ga0496103_0006852 3300048906 Bacteria 6802
826 Ga0496103_0016376 3300048906 Bacteria 4424
827 Ga0496103_0061470 3300048906 Bacteria 2336
828 Ga0496104_0003499 3300048907 Bacteria 13545
829 Ga0496104_0008528 3300048907 Bacteria 9110
830 Ga0496104_0044483 3300048907 Bacteria 4172
831 Ga0496104_0048378 3300048907 Bacteria 4009
832 Ga0496104_0067135 3300048907 Bacteria 3406
833 Ga0496104_0131004 3300048907 Bacteria 2408
834 Ga0496104_0140999 3300048907 Bacteria 2315
835 Ga0496104_0143202 3300048907 Bacteria 2296
836 Ga0496105_0004200 3300048908 Bacteria 10816
837 Ga0496105_0025968 3300048908 Bacteria 4773
838 Ga0496105_0033375 3300048908 Bacteria 4226
839 Ga0496105_0097484 3300048908 Bacteria 2428
840 Ga0496105_0148348 3300048908 Bacteria 1928
841 Ga0496105_0155514 3300048908 Bacteria 1878
842 Ga0496105_0282674 3300048908 Bacteria 1337
843 Ga0496106_0003558 3300048909 Bacteria 11602
844 Ga0496106_0016339 3300048909 Bacteria 5491
845 Ga0496106_0019678 3300048909 Bacteria 5008
846 Ga0496106_0028478 3300048909 Bacteria 4161
847 Ga0496106_0040623 3300048909 Bacteria 3484
848 Ga0496106_0122055 3300048909 Unclassified 2037
849 Ga0496106_0281049 3300048909 Bacteria 1333
850 Ga0496107_0012234 3300048910 Bacteria 5988
851 Ga0496107_0021259 3300048910 Bacteria 4587
852 Ga0496107_0036978 3300048910 Bacteria 3503
853 Ga0496107_0041550 3300048910 Bacteria 3301
854 Ga0496107_0049417 3300048910 Bacteria 3031
855 Ga0496107_0059395 3300048910 Unclassified 2767
856 Ga0496107_0091946 3300048910 Bacteria 2217
857 Ga0496107_0157388 3300048910 Bacteria 1683
858 Ga0496108_0001828 3300048911 Bacteria 17001
859 Ga0496108_0007255 3300048911 Bacteria 8989
860 Ga0496108_0094003 3300048911 Bacteria 2551
861 Ga0496108_0135338 3300048911 Unclassified 2119
862 Ga0496108_0139395 3300048911 Bacteria 2089
863 Ga0496108_0173426 3300048911 Bacteria 1866
864 Ga0496108_0495282 3300048911 Bacteria 1067
865 Ga0496109_0007856 3300048912 Bacteria 9036
866 Ga0496109_0008549 3300048912 Bacteria 8706
867 Ga0496109_0018179 3300048912 Bacteria 6172
868 Ga0496109_0065176 3300048912 Bacteria 3335
869 Ga0496109_0066205 3300048912 Bacteria 3307
870 Ga0496109_0133144 3300048912 Bacteria 2322
871 Ga0496109_0204286 3300048912 Bacteria 1857
872 Ga0496109_0273572 3300048912 Bacteria 1591
873 Ga0496110_0027307 3300048913 Bacteria 4892
874 Ga0496110_0067091 3300048913 Unclassified 3174
875 Ga0496110_0088896 3300048913 Bacteria 2760
876 Ga0496110_0096561 3300048913 Bacteria 2648
877 Ga0496111_0002519 3300048914 Bacteria 11047
878 Ga0496111_0022283 3300048914 Bacteria 4432
879 Ga0496111_0031896 3300048914 Bacteria 3755
880 Ga0496111_0057641 3300048914 Bacteria 2812
881 Ga0496111_0082688 3300048914 Bacteria 2346
882 Ga0496112_0009068 3300048915 Bacteria 8937
883 Ga0496112_0019528 3300048915 Bacteria 6397
884 Ga0496112_0039463 3300048915 Bacteria 4614
885 Ga0496112_0059028 3300048915 Bacteria 3780
886 Ga0496112_0064454 3300048915 Bacteria 3616
887 Ga0496112_0082610 3300048915 Bacteria 3177
888 Ga0496112_0217225 3300048915 Bacteria 1868
889 Ga0496112_0365043 3300048915 Bacteria 1386
890 Ga0496113_0006338 3300048916 Bacteria 7484
891 Ga0496113_0010185 3300048916 Bacteria 6206
892 Ga0496113_0037480 3300048916 Unclassified 3558
893 Ga0496113_0041029 3300048916 Bacteria 3412
894 Ga0496113_0226212 3300048916 Bacteria 1491
895 Ga0496113_0276275 3300048916 Bacteria 1343
896 Ga0496113_0414995 3300048916 Bacteria 1081
897 Ga0496114_0014950 3300048917 Bacteria 6238
898 Ga0496114_0025741 3300048917 Bacteria 4811
899 Ga0496114_0026354 3300048917 Bacteria 4758
900 Ga0496114_0031259 3300048917 Bacteria 4380
901 Ga0496114_0085635 3300048917 Bacteria 2669
902 Ga0496114_0134794 3300048917 Bacteria 2135
903 Ga0496115_0006207 3300048918 Bacteria 8740
904 Ga0496115_0008489 3300048918 Bacteria 7598
905 Ga0496115_0046138 3300048918 Bacteria 3481
906 Ga0496115_0101320 3300048918 Bacteria 2361
907 Ga0496115_0102656 3300048918 Bacteria 2345
908 Ga0496115_0441876 3300048918 Unclassified 1052
909 Ga0501031_0050060 3300049568 Bacteria 2723
910 Ga0501031_0062055 3300049568 Bacteria 2436
911 Ga0501033_0036415 3300049570 Bacteria 3687
912 Ga0501033_0053143 3300049570 Bacteria 3001
913 Ga0501033_0068471 3300049570 Bacteria 2609
914 Ga0501033_0099433 3300049570 Bacteria 2124
915 Ga0501033_0219364 3300049570 Bacteria 1354
916 Ga0501034_0042753 3300049571 Bacteria 4587
917 Ga0501034_0074785 3300049571 Bacteria 3395
918 Ga0501034_0097651 3300049571 Bacteria 2933
919 Ga0501036_0174863 3300049572 Bacteria 1808
920 Ga0501037_0157408 3300049573 Bacteria 1621
921 Ga0501038_0089945 3300049574 Bacteria 2574
922 Ga0501039_0028654 3300049575 Bacteria 4287
923 Ga0501039_0130743 3300049575 Bacteria 1970
924 Ga0501041_0043008 3300049577 Bacteria 2746
925 Ga0501042_0037352 3300049578 Bacteria 3448
926 Ga0501046_0006964 3300049580 Bacteria 9963
927 Ga0501047_0015389 3300049581 Bacteria 7286
928 Ga0501047_0091710 3300049581 Bacteria 2916
929 Ga0501047_0171989 3300049581 Bacteria 2035
930 Ga0501048_0069083 3300049582 Bacteria 2495
931 Ga0501067_0004377 3300049583 Bacteria 7783
932 Ga0501068_0082284 3300049584 Bacteria 1977
933 Ga0501069_0032657 3300049585 Bacteria 2865
934 Ga0501074_0080884 3300049590 Bacteria 2330
935 Ga0501075_0035908 3300049591 Bacteria 3698
936 Ga0501079_0090925 3300049741 Bacteria 2365
937 Ga0501080_0115363 3300049742 Bacteria 2490
938 Ga0501081_0219624 3300049743 Bacteria 1382
939 Ga0501083_0014044 3300049744 Bacteria 5598
940 Ga0501035_0054484 3300049822 Bacteria 3573
941 Ga0501044_0000173 3300049823 Bacteria 79909
942 Ga0501044_0229711 3300049823 Bacteria 1803
943 Ga0501045_0120901 3300049824 Bacteria 1945
944 nmdc:mga03683_61708_c1 3300050489 Bacteria 1586
945 nmdc:mga00v17_83073_c1 3300050491 Bacteria 2003
946 nmdc:mga0yw44_170432_c1 3300050492 Bacteria 1429
947 nmdc:mga0yw44_6262_c1 3300050492 Bacteria 5731
948 nmdc:mga0k408_29747_c1 3300050493 Bacteria 3111
949 nmdc:mga0k408_67288_c1 3300050493 Bacteria 2087
950 nmdc:mga06z11_129794_c1 3300050494 Bacteria 1414
951 nmdc:mga05p37_157546_c1 3300050507 Bacteria 2774
952 nmdc:mga05p37_204703_c1 3300050507 Bacteria 2388
953 nmdc:mga05p37_302232_c1 3300050507 Bacteria 1901
954 nmdc:mga05p37_670874_c1 3300050507 Bacteria 1157
955 nmdc:mga05p37_69456_c1 3300050507 Bacteria 4333
956 nmdc:mga09592_120809_c1 3300050508 Bacteria 2250
957 nmdc:mga0qj67_288710_c1 3300050509 Bacteria 1329
958 nmdc:mga0qj67_45862_c1 3300050509 Bacteria 3449
959 nmdc:mga0qj67_6924_c1 3300050509 Bacteria 8346
960 nmdc:mga0qj67_98072_c1 3300050509 Bacteria 2361
961 nmdc:mga06r32_69686_c1 3300050510 Bacteria 3399
962 nmdc:mga08y16_160742_c1 3300050511 Bacteria 2334
963 nmdc:mga08y16_23656_c1 3300050511 Bacteria 6487
964 nmdc:mga08y16_33457_c1 3300050511 Bacteria 5399
965 nmdc:mga08y16_428577_c1 3300050511 Bacteria 1351
966 nmdc:mga08y16_53521_c1 3300050511 Bacteria 4220
967 nmdc:mga0n895_10980_c1 3300050512 Bacteria 8050
968 nmdc:mga0n895_14260_c1 3300050512 Bacteria 7212
969 nmdc:mga0n895_211403_c1 3300050512 Unclassified 1970
970 nmdc:mga0n895_63475_c1 3300050512 Bacteria 3653
971 nmdc:mga0n895_850525_c1 3300050512 Bacteria 900
972 nmdc:mga0n895_86_c1 3300050512 Bacteria 53794
973 nmdc:mga0rr50_210677_c1 3300050513 Unclassified 1601
974 nmdc:mga0rr50_3472_c1 3300050513 Bacteria 9077
975 nmdc:mga0rr50_382571_c1 3300050513 Bacteria 1187
976 nmdc:mga0rr50_664_c1 3300050513 Bacteria 18446
977 nmdc:mga0rr50_740_c1 3300050513 Bacteria 17608
978 nmdc:mga0rr50_79065_c1 3300050513 Bacteria 2532
979 nmdc:mga08x19_1310_c1 3300050514 Bacteria 15454
980 nmdc:mga08x19_183953_c1 3300050514 Bacteria 1427
981 nmdc:mga08x19_32895_c1 3300050514 Bacteria 3271
982 nmdc:mga0a205_1448_c1 3300050515 Bacteria 20218
983 nmdc:mga0a205_23839_c1 3300050515 Bacteria 2001
984 nmdc:mga0a205_31489_c1 3300050515 Bacteria 5081
985 nmdc:mga0a205_55341_c1 3300050515 Bacteria 3832
986 nmdc:mga0a205_8069_c1 3300050515 Bacteria 9573
987 Ga0495601_0030200 3300053077 Bacteria 3364
988 Ga0495612_0002701 3300053078 Bacteria 7332
989 Ga0495612_0028807 3300053078 Bacteria 2236
990 Ga0495612_0036716 3300053078 Bacteria 1988
991 Ga0495655_0004315 3300053083 Bacteria 2421
992 Ga0495655_0022022 3300053083 Bacteria 1450
993 Ga0495595_0000574 3300053084 Bacteria 14080
994 Ga0495595_0001515 3300053084 Bacteria 9079
995 Ga0495595_0002744 3300053084 Bacteria 6914
996 Ga0495619_0000045 3300053085 Bacteria 108543
997 Ga0495619_0000484 3300053085 Bacteria 26647
998 Ga0495619_0010412 3300053085 Bacteria 5851
999 Ga0495619_0026207 3300053085 Bacteria 3749
1000 Ga0495619_0032329 3300053085 Bacteria 3394
1001 Ga0495619_0090687 3300053085 Unclassified 2069
1002 Ga0500566_0004523 3300053094 Bacteria 8304
1003 Ga0500641_0003963 3300053096 Bacteria 5235
1004 Ga0500554_001737 3300053102 Bacteria 4199
1005 Ga0500593_006659 3300053117 Bacteria 4637
1006 Ga0500595_001694 3300053119 Bacteria 11554
1007 Ga0500577_0054240 3300053142 Bacteria 1518
1008 Ga0500603_006016 3300053150 Bacteria 2628
1009 Ga0500616_0053185 3300053153 Bacteria 2126
1010 Ga0500638_032029 3300053162 Bacteria 2537
1011 Ga0500639_059717 3300053163 Bacteria 1968
1012 Ga0500637_0000263 3300053178 Bacteria 19691
1013 Ga0070667_100332522
1014 JGI24746J21847_1001454
1015 JGI24739J22299_10002355
1016 JGI24737J22298_10005173
1017 JGI24743J22301_10000279
1018 JGI24738J21930_10002285
1019 JGI24749J21850_1000800
1020 JGI24749J21850_1003432
1021 JGI24744J21845_10003450
1022 JGI24034J26672_10000501
1023 JGI24742J22300_10000285
1024 JGI24742J22300_10000731
1025 JGI24751J29686_10002085
1026 JGI25406J46586_10039898
1027 Ga0065712_10087858
1028 Ga0065707_10105003
1029 Ga0070658_10066646
1030 Ga0070676_10014663
1031 Ga0070683_100010349
1032 Ga0070683_100127360
1033 Ga0070690_100000235
1034 Ga0070690_100004036
1035 Ga0070690_100006864
1036 Ga0070690_100075479
1037 Ga0070670_100013045
1038 Ga0070670_100081348
1039 Ga0070670_100083494
1040 Ga0070670_100139759
1041 Ga0070670_100501100
1042 Ga0070677_10000940
1043 Ga0068869_100000629
1044 Ga0068869_100289764
1045 Ga0070666_10012126
1046 Ga0070666_10012842
1047 Ga0070680_100001167
1048 Ga0070680_100013671
1049 Ga0070680_100078608
1050 Ga0070680_100082086
1051 Ga0070680_100134955
1052 Ga0070682_100002926
1053 Ga0070682_100003053
1054 Ga0070682_100013021
1055 Ga0070682_100014773
1056 Ga0068868_100003444
1057 Ga0068868_100006182
1058 Ga0068868_100176490
1059 Ga0070660_100268830
1060 Ga0070660_100379117
1061 Ga0070689_100000188
1062 Ga0070689_100001782
1063 Ga0070689_100019391
1064 Ga0070689_100019765
1065 Ga0070689_100068707
1066 Ga0070689_100084840
1067 Ga0070689_100169166
1068 Ga0070691_10001176
1069 Ga0070691_10004002
1070 Ga0070687_100000069
1071 Ga0070687_100062271
1072 Ga0070687_100130224
1073 Ga0070661_100023192
1074 Ga0070661_100049805
1075 Ga0070661_100105805
1076 Ga0070692_10001429
1077 Ga0070692_10006313
1078 Ga0070692_10030102
1079 Ga0070668_100032033
1080 Ga0070669_100006075
1081 Ga0070669_100010102
1082 Ga0070669_100115916
1083 Ga0070669_100208680
1084 Ga0070675_100010884
1085 Ga0070675_100014476
1086 Ga0070675_100180260
1087 Ga0070671_100001554
1088 Ga0070671_100005261
1089 Ga0070671_100013065
1090 Ga0070671_100018682
1091 Ga0070671_100227984
1092 Ga0070674_100012344
1093 Ga0070674_100047974
1094 Ga0070674_100062574
1095 Ga0070674_100079402
1096 Ga0070673_100029758
1097 Ga0070673_100043853
1098 Ga0070673_100056615
1099 Ga0070673_100171311
1100 Ga0070673_100256335
1101 Ga0070688_100000518
1102 Ga0070688_100013493
1103 Ga0070659_100001996
1104 Ga0070659_100014760
1105 Ga0070667_100009832
1106 Ga0070667_100017349
1107 Ga0070667_100361981
1108 Ga0070703_10009245
1109 Ga0070709_10005005
1110 Ga0070714_100025390
1111 Ga0070714_100048803
1112 Ga0070713_100004683
1113 Ga0070713_100005212
1114 Ga0070713_100012790
1115 Ga0070713_100086923
1116 Ga0070713_100176838
1117 Ga0070710_10002248
1118 Ga0070710_10025506
1119 Ga0070710_10245413
1120 Ga0070701_10000142
1121 Ga0070701_10000603
1122 Ga0070701_10048521
1123 Ga0070701_10095759
1124 Ga0070711_100031939
1125 Ga0070711_100045830
1126 Ga0070711_100250167
1127 Ga0070705_100001149
1128 Ga0070705_100004550
1129 Ga0070705_100051420
1130 Ga0070700_100001129
1131 Ga0070700_100008783
1132 Ga0070694_100111339
1133 Ga0070708_100077012
1134 Ga0070708_100111072
1135 Ga0070663_100167391
1136 Ga0070678_100004056
1137 Ga0070678_100067528
1138 Ga0070678_100157223
1139 Ga0070678_100234125
1140 Ga0070678_100291110
1141 Ga0070662_100092393
1142 Ga0070662_100101095
1143 Ga0070681_10000688
1144 Ga0070681_10021720
1145 Ga0070681_10058690
1146 Ga0070681_10071117
1147 Ga0070681_10199381
1148 Ga0068867_100000296
1149 Ga0068867_100008754
1150 Ga0068867_100009922
1151 Ga0068867_100048435
1152 Ga0068867_100264046
1153 Ga0070685_10001300
1154 Ga0070685_10002735
1155 Ga0070707_100249502
1156 Ga0070699_100011236
1157 Ga0070699_100034931
1158 Ga0070679_100040411
1159 Ga0070679_100059353
1160 Ga0070679_100085012
1161 Ga0070684_100011160
1162 Ga0070684_100065689
1163 Ga0070684_100207309
1164 Ga0070697_100031782
1165 Ga0070697_100038388
1166 Ga0070697_100088797
1167 Ga0070697_100172720
1168 Ga0068853_100029841
1169 Ga0070672_100003208
1170 Ga0070686_100000090
1171 Ga0070686_100001797
1172 Ga0070686_100003371
1173 Ga0070686_100005651
1174 Ga0070686_100183848
1175 Ga0070695_100004621
1176 Ga0070695_100050402
1177 Ga0070695_100103084
1178 Ga0070696_100000719
1179 Ga0070696_100002632
1180 Ga0070693_100000525
1181 Ga0070693_100027503
1182 Ga0070665_100004366
1183 Ga0070665_100178977
1184 Ga0070665_100215084
1185 Ga0070665_100238168
1186 Ga0070665_100526485
1187 Ga0070704_100000168
1188 Ga0070704_100008425
1189 Ga0070704_100135656
1190 Ga0070704_100160863
1191 Ga0068855_100000833
1192 Ga0068855_100037836
1193 Ga0068855_100039748
1194 Ga0070664_100006958
1195 Ga0070664_100021837
1196 Ga0070664_100071588
1197 Ga0070664_100503293
1198 Ga0068857_100000715
1199 Ga0068857_100487283
1200 Ga0068854_100000657
1201 Ga0068854_100005118
1202 Ga0068854_100020739
1203 Ga0068856_100003103
1204 Ga0068856_100045035
1205 Ga0068856_100071466
1206 Ga0068856_100130262
1207 Ga0068856_100231558
1208 Ga0070702_100000002
1209 Ga0070702_100004841
1210 Ga0070702_100038455
1211 Ga0070702_100166682
1212 Ga0068852_100006185
1213 Ga0068852_100048049
1214 Ga0068852_100205984
1215 Ga0068859_100000195
1216 Ga0068859_100014349
1217 Ga0068859_100254846
1218 Ga0068864_100006237
1219 Ga0068864_100006919
1220 Ga0068864_100057324
1221 Ga0068866_10001095
1222 Ga0068866_10015715
1223 Ga0068861_100000043
1224 Ga0068861_100010394
1225 Ga0068861_100182339
1226 Ga0068870_10000073
1227 Ga0068870_10032369
1228 Ga0068863_100021006
1229 Ga0068863_100032749
1230 Ga0068863_100359868
1231 Ga0068858_100005138
1232 Ga0068858_100033913
1233 Ga0068858_100041152
1234 Ga0068860_100002559
1235 Ga0068860_100019005
1236 Ga0068860_100053202
1237 Ga0068860_100207386
1238 Ga0068860_100413103
1239 Ga0068860_100464273
1240 Ga0068862_100013767
1241 Ga0068862_100016944
1242 Ga0068862_100020336
1243 Ga0081455_10000048
1244 Ga0081455_10009739
1245 Ga0081455_10014368
1246 Ga0081455_10111300
1247 Ga0081538_10041314
1248 Ga0081540_1000282
1249 Ga0081540_1005411
1250 Ga0081540_1095518
1251 Ga0081539_10000233
1252 Ga0081539_10017035
1253 Ga0070717_10007633
1254 Ga0070717_10100107
1255 Ga0075365_10019452
1256 Ga0075365_10022809
1257 Ga0070715_10004215
1258 Ga0070715_10032230
1259 Ga0070715_10069673
1260 Ga0070716_100001791
1261 Ga0070716_100104875
1262 Ga0070712_100013910
1263 Ga0070712_100076460
1264 Ga0070712_100157181
1265 Ga0075362_10096558
1266 Ga0075367_10037700
1267 Ga0075367_10086588
1268 Ga0075369_10029300
1269 Ga0097621_100002618
1270 Ga0097621_100019693
1271 Ga0097621_100021417
1272 Ga0097621_100319335
1273 Ga0075370_10085558
1274 Ga0068871_100000040
1275 Ga0068871_100024067
1276 Ga0068871_100026506
1277 Ga0068871_100072279
1278 Ga0075428_100269981
1279 Ga0075428_100443647
1280 Ga0075430_100019382
1281 Ga0075430_100112622
1282 Ga0075431_100078929
1283 Ga0075433_10037623
1284 Ga0075433_10066445
1285 Ga0075433_10149539
1286 Ga0075434_100000006
1287 Ga0075434_100000554
1288 Ga0075434_100009283
1289 Ga0075434_100037538
1290 Ga0075434_100058798
1291 Ga0075429_100031900
1292 Ga0075429_100036481
1293 Ga0068865_100006295
1294 Ga0068865_100041108
1295 Ga0075436_100000174
1296 Ga0075436_100012987
1297 Ga0075436_100030588
1298 Ga0075436_100286672
1299 Ga0097620_100000195
1300 Ga0097620_100014349
1301 Ga0097620_100254841
1302 Ga0075435_100001000
1303 Ga0075435_100006264
1304 Ga0075435_100015067
1305 Ga0075435_100081550
1306 Ga0075435_100245323
1307 Ga0099794_10011097
1308 Ga0099795_10072793
1309 Ga0105251_10006368
1310 Ga0105250_10084818
1311 Ga0105240_10657004
1312 Ga0111539_10036658
1313 Ga0111539_10064158
1314 Ga0111539_10137730
1315 Ga0111539_10172965
1316 Ga0111539_10429434
1317 Ga0111539_10462377
1318 Ga0105245_10008500
1319 Ga0105245_10009922
1320 Ga0105245_10125792
1321 Ga0105245_10154565
1322 Ga0105245_10245765
1323 Ga0105247_10054860
1324 Ga0105247_10063271
1325 Ga0114129_10155536
1326 Ga0114129_10279410
1327 Ga0114129_10536133
1328 Ga0114129_10546916
1329 Ga0105243_10000035
1330 Ga0105243_10002936
1331 Ga0105243_10020666
1332 Ga0105243_10024008
1333 Ga0105243_10107421
1334 Ga0105241_10006170
1335 Ga0105241_10080124
1336 Ga0105242_10001935
1337 Ga0105242_10002145
1338 Ga0105242_10036794
1339 Ga0105242_10302215
1340 Ga0105248_10004376
1341 Ga0105248_10006012
1342 Ga0105248_10036378
1343 Ga0105248_10085076
1344 Ga0105237_10040741
1345 Ga0105237_10060786
1346 Ga0105237_10177871
1347 Ga0105238_10059058
1348 Ga0105249_10004810
1349 Ga0105249_10019086
1350 Ga0105249_10148881
1351 Ga0105249_10387756
1352 Ga0105249_10482476
1353 Ga0105239_10017272
1354 Ga0105239_10170414
1355 Ga0105246_10001697
1356 Ga0105246_10019691
1357 Ga0105246_10112956
1358 Ga0105246_10365658
1359 Ga0157373_10110891
1360 Ga0157369_10249435
1361 Ga0157374_10005071
1362 Ga0157374_10021058
1363 Ga0157374_10048947
1364 Ga0157374_10122968
1365 Ga0157378_10001996
1366 Ga0157378_10004058
1367 Ga0157378_10004134
1368 Ga0163162_10024841
1369 Ga0163162_10044461
1370 Ga0163162_10344836
1371 Ga0157372_10138483
1372 Ga0157372_10550620
1373 Ga0157375_10217463
1374 Ga0157375_10307770
1375 Ga0163163_10002390
1376 Ga0163163_10015764
1377 Ga0163163_10051069
1378 Ga0163163_10322637
1379 Ga0163163_10335264
1380 Ga0163163_10418214
1381 Ga0157380_10037273
1382 Ga0157380_10039831
1383 Ga0157380_10191070
1384 Ga0157377_10009511
1385 Ga0157377_10017489
1386 Ga0157377_10029278
1387 Ga0157379_10016149
1388 Ga0157379_10026672
1389 Ga0157376_10000403
1390 Ga0157376_10041561
1391 Ga0157376_10043024
1392 Ga0157376_10091968
1393 Ga0163161_10005378
1394 Ga0163161_10023098
1395 Ga0163161_10059915
1396 Ga0163161_10189495
1397 Ga0213876_10052786
1398 Ga0213876_10070535
1399 Ga0213875_10000067
1400 Ga0207666_1000154
1401 Ga0207673_1000507
1402 Ga0209758_1000274
1403 Ga0207697_10000024
1404 Ga0207656_10012299
1405 Ga0207653_10006002
1406 Ga0207653_10079562
1407 Ga0207682_10000708
1408 Ga0207682_10032204
1409 Ga0207692_10001001
1410 Ga0207642_10001465
1411 Ga0207710_10000382
1412 Ga0207710_10031356
1413 Ga0207688_10000275
1414 Ga0207688_10001362
1415 Ga0207688_10048405
1416 Ga0207680_10005838
1417 Ga0207680_10010069
1418 Ga0207647_10000612
1419 Ga0207685_10001765
1420 Ga0207685_10014555
1421 Ga0207699_10002836
1422 Ga0207699_10101095
1423 Ga0207645_10000507
1424 Ga0207645_10044250
1425 Ga0207645_10050204
1426 Ga0207645_10067622
1427 Ga0207643_10000568
1428 Ga0207643_10002081
1429 Ga0207643_10032068
1430 Ga0207643_10081608
1431 Ga0207705_10053294
1432 Ga0207705_10234931
1433 Ga0207654_10021158
1434 Ga0207707_10004169
1435 Ga0207707_10019399
1436 Ga0207707_10050919
1437 Ga0207671_10025782
1438 Ga0207693_10001038
1439 Ga0207693_10079340
1440 Ga0207693_10085910
1441 Ga0207693_10216830
1442 Ga0207693_10251160
1443 Ga0207663_10014896
1444 Ga0207663_10069352
1445 Ga0207663_10087083
1446 Ga0207660_10013054
1447 Ga0207660_10014844
1448 Ga0207660_10098275
1449 Ga0207660_10116786
1450 Ga0207660_10147197
1451 Ga0207660_10233808
1452 Ga0207662_10000006
1453 Ga0207662_10000180
1454 Ga0207662_10008191
1455 Ga0207657_10007922
1456 Ga0207657_10054706
1457 Ga0207657_10055391
1458 Ga0207649_10014224
1459 Ga0207649_10082214
1460 Ga0207649_10229671
1461 Ga0207652_10028309
1462 Ga0207646_10209542
1463 Ga0207681_10002030
1464 Ga0207681_10086586
1465 Ga0207681_10255113
1466 Ga0207681_10271949
1467 Ga0207650_10006571
1468 Ga0207650_10048838
1469 Ga0207650_10061845
1470 Ga0207650_10063076
1471 Ga0207659_10002151
1472 Ga0207659_10021087
1473 Ga0207687_10002607
1474 Ga0207687_10202396
1475 Ga0207700_10019191
1476 Ga0207700_10049928
1477 Ga0207700_10174121
1478 Ga0207700_10225312
1479 Ga0207700_10228292
1480 Ga0207664_10016403
1481 Ga0207664_10029863
1482 Ga0207664_10363131
1483 Ga0207644_10007818
1484 Ga0207644_10022652
1485 Ga0207686_10003280
1486 Ga0207686_10044349
1487 Ga0207686_10105479
1488 Ga0207709_10001302
1489 Ga0207709_10004543
1490 Ga0207709_10010356
1491 Ga0207709_10011063
1492 Ga0207709_10138093
1493 Ga0207670_10001377
1494 Ga0207670_10011557
1495 Ga0207670_10078840
1496 Ga0207670_10090481
1497 Ga0207670_10112000
1498 Ga0207670_10151403
1499 Ga0207670_10210360
1500 Ga0207669_10000408
1501 Ga0207669_10072895
1502 Ga0207704_10002368
1503 Ga0207704_10008627
1504 Ga0207704_10044170
1505 Ga0207704_10077740
1506 Ga0207665_10001067
1507 Ga0207665_10003994
1508 Ga0207665_10057692
1509 Ga0207665_10088912
1510 Ga0207691_10003119
1511 Ga0207691_10331807
1512 Ga0207691_10334059
1513 Ga0207711_10004559
1514 Ga0207711_10006069
1515 Ga0207711_10014575
1516 Ga0207711_10022668
1517 Ga0207711_10145105
1518 Ga0207689_10000082
1519 Ga0207689_10000332
1520 Ga0207689_10033746
1521 Ga0207689_10195992
1522 Ga0207661_10003166
1523 Ga0207679_10001592
1524 Ga0207679_10054349
1525 Ga0207679_10379996
1526 Ga0207679_10420411
1527 Ga0207667_10087026
1528 Ga0207667_10101374
1529 Ga0207651_10004753
1530 Ga0207651_10054962
1531 Ga0207651_10221266
1532 Ga0207712_10001343
1533 Ga0207712_10012089
1534 Ga0207668_10023743
1535 Ga0207668_10027920
1536 Ga0207640_10002417
1537 Ga0207640_10045385
1538 Ga0207658_10004726
1539 Ga0207658_10016503
1540 Ga0207658_10174417
1541 Ga0207677_10002853
1542 Ga0207677_10004878
1543 Ga0207703_10005585
1544 Ga0207703_10006036
1545 Ga0207703_10015837
1546 Ga0207703_10040924
1547 Ga0207639_10009264
1548 Ga0207639_10202500
1549 Ga0207639_10227142
1550 Ga0207678_10000216
1551 Ga0207678_10012430
1552 Ga0207678_10012502
1553 Ga0207678_10049557
1554 Ga0207708_10000936
1555 Ga0207708_10005888
1556 Ga0207708_10012141
1557 Ga0207708_10033019
1558 Ga0207702_10013898
1559 Ga0207702_10039756
1560 Ga0207702_10137572
1561 Ga0207702_10568422
1562 Ga0207641_10046962
1563 Ga0207641_10064350
1564 Ga0207648_10000316
1565 Ga0207648_10003365
1566 Ga0207648_10006843
1567 Ga0207648_10007668
1568 Ga0207648_10152119
1569 Ga0207676_10011932
1570 Ga0207676_10027419
1571 Ga0207676_10028159
1572 Ga0207676_10093450
1573 Ga0207674_10003382
1574 Ga0207675_100000064
1575 Ga0207675_100004008
1576 Ga0207675_100004550
1577 Ga0207675_100011531
1578 Ga0207675_100153637
1579 Ga0207683_10000293
1580 Ga0207683_10010609
1581 Ga0207683_10020006
1582 Ga0207683_10053516
1583 Ga0207683_10076226
1584 Ga0207698_10011482
1585 Ga0207698_10022751
1586 Ga0207698_10065097
1587 Ga0209998_10001967
1588 Ga0209974_10003644
1589 Ga0207428_10001592
1590 Ga0268266_10003041
1591 Ga0268266_10099788
1592 Ga0268266_10287846
1593 Ga0268265_10004268
1594 Ga0268265_10011670
1595 Ga0268265_10036013
1596 Ga0268265_10079802
1597 Ga0268264_10003570
1598 Ga0268264_10008485
1599 Ga0268264_10051709
1600 Ga0265332_10002624
1601 Ga0265325_10000339
1602 Ga0265325_10001832
1603 Ga0265340_10001806
1604 Ga0265339_10009221
1605 Ga0265339_10114210
1606 Ga0265331_10015974
1607 Ga0265331_10054922
1608 Ga0307513_10304361
1609 Ga0265313_10056362
1610 Ga0265314_10011592
1611 Ga0265342_10000011
1612 Ga0307416_100060311
1613 Ga0307416_100121848
1614 Ga0307416_100503641
1615 Ga0307416_100909833
1616 Ga0373930_0007487
1617 Ga0373938_0027965
1618 Ga0373926_0077545
1619 Ga0373928_0002816
1620 Ga0373929_0002823
1621 Ga0373934_0012402
1622 Ga0373944_0000780
1623 Ga0373944_0046225
1624 Ga0373949_0014990
1625 Ga0373949_0066341
1626 Ga0373952_0021169
1627 Ga0373923_0000279
1628 Ga0373923_0070040
1629 Ga0373932_0002369
1630 Ga0373936_0002310
1631 Ga0373936_0015026
1632 Ga0373936_0070123
1633 Ga0373939_0001142
1634 Ga0373939_0033354
1635 Ga0373941_0000650
1636 Ga0373941_0053278
1637 Ga0373945_0000024
1638 Ga0373945_0023430
1639 Ga0373953_0006179
1640 Ga0373954_0002504
1641 Ga0373954_0153684
1642 Ga0373956_0034271
1643 Ga0373957_0002002
1644 Ga0373943_0007172
1645 Ga0373943_0008956
1646 Ga0373943_0009551
1647 Ga0373943_0036375
1648 Ga0373946_0001561
1649 Ga0373946_0006931
1650 Ga0373946_0102054
1651 Ga0373955_0025348
1652 Ga0373955_0097150
1653 Ga0373955_0219690
1654 Ga0373961_0003645
1655 Ga0373962_0010757
1656 Ga0373924_0052677
1657 Ga0373931_0006810
1658 Ga0373931_0008696
1659 Ga0373931_0117187
1660 Ga0373931_0155895
1661 Ga0373935_0005019
1662 Ga0373935_0007141
1663 Ga0373935_0134334
1664 Ga0373927_0004242
1665 Ga0373927_0017951
1666 Ga0373927_0042410
1667 Ga0373927_0073015
1668 Ga0373933_0023256
1669 Ga0373933_0049697
1670 Ga0373933_0261374
1671 Ga0373947_0010970
1672 Ga0373947_0011761
1673 Ga0373947_0031535
1674 Ga0373947_0088702
1675 Ga0373937_0000655
1676 Ga0373937_0028017
1677 Ga0373937_0054868
1678 Ga0373925_0022231
1679 Ga0373925_0118311
1680 Ga0373925_0118424
1681 Ga0395900_0010527
1682 Ga0395898_0019086
1683 Ga0436364_1125377
1684 Ga0395901_0098845
1685 Ga0436365_0124605
1686 Ga0436365_1895534
1687 Ga0436361_0430694
1688 Ga0451853_3454574
1689 Ga0451577_0012669
1690 Ga0466963_0209296
1691 Ga0466964_0018031
1692 Ga0466957_0051069
1693 Ga0466960_0194166
1694 Ga0451576_0000822
1695 Ga0466967_0002637
1696 Ga0466967_0199071
1697 Ga0495592_0002464
1698 Ga0495603_0019055
1699 Ga0495603_0090047
1700 Ga0495603_0095018
1701 Ga0495590_0082404
1702 Ga0495591_038540
1703 Ga0495629_0001465
1704 Ga0495629_0053367
1705 Ga0495629_0099250
1706 Ga0495638_0005705
1707 Ga0495641_0002445
1708 Ga0495651_0002003
1709 Ga0495651_0002165
1710 Ga0495653_0118398
1711 Ga0495653_0119132
1712 Ga0495653_0356431
1713 Ga0495580_0006345
1714 Ga0495580_0023170
1715 Ga0495580_0093435
1716 Ga0495580_0157402
1717 Ga0495582_0001749
1718 Ga0495582_0108676
1719 Ga0495582_0208146
1720 Ga0495639_0014565
1721 Ga0495662_0055538
1722 Ga0495664_0000563
1723 Ga0495664_0003135
1724 Ga0495664_0017138
1725 Ga0495584_0009466
1726 Ga0495584_0062997
1727 Ga0495594_0009159
1728 Ga0495594_0017917
1729 Ga0495608_0000428
1730 Ga0495608_0008200
1731 Ga0495616_0015414
1732 Ga0495618_0006811
1733 Ga0495628_0019849
1734 Ga0495628_0064096
1735 Ga0495628_0160000
1736 Ga0495630_0012330
1737 Ga0495630_0027392
1738 Ga0495630_0159869
1739 Ga0495630_0515885
1740 Ga0495666_0000400
1741 Ga0495652_0267034
1742 Ga0495652_0318004
1743 Ga0495640_0013977
1744 Ga0495640_0019186
1745 Ga0495587_0006341
1746 Ga0495587_0018948
1747 Ga0495598_0006601
1748 Ga0495645_0100626
1749 Ga0495622_0000406
1750 Ga0495633_0014925
1751 Ga0495633_0031919
1752 Ga0495667_0004194
1753 Ga0495656_0000661
1754 Ga0495656_0007374
1755 Ga0495668_0095410
1756 Ga0495634_0036732
1757 Ga0495611_0018537
1758 Ga0495635_0012606
1759 Ga0495635_0014382
1760 Ga0495588_0000318
1761 Ga0495657_0030733
1762 Ga0495599_0017299
1763 Ga0495599_0032734
1764 Ga0495623_0001886
1765 Ga0495646_0018816
1766 Ga0495646_0027257
1767 Ga0495647_0002144
1768 Ga0495647_0007416
1769 Ga0495647_0011789
1770 Ga0495647_0021133
1771 Ga0495658_0000237
1772 Ga0495658_0006930
1773 Ga0495658_0010307
1774 Ga0495669_0041658
1775 Ga0495669_0076310
1776 Ga0495669_0120930
1777 Ga0495613_0000793
1778 Ga0495613_0001097
1779 Ga0495613_0205306
1780 Ga0495624_0003149
1781 Ga0495624_0026092
1782 Ga0495624_0067797
1783 Ga0495670_0000558
1784 Ga0495600_0000453
1785 Ga0495600_0028346
1786 Ga0495581_0017498
1787 Ga0495581_0029185
1788 Ga0495581_0081328
1789 Ga0495604_0001023
1790 Ga0495604_0005688
1791 Ga0495604_0087533
1792 Ga0495604_0216708
1793 Ga0495674_0180597
1794 Ga0495674_0233078
1795 Ga0495674_0276738
1796 Ga0495672_0078932
1797 Ga0495672_0136388
1798 Ga0495676_0023292
1799 Ga0495676_0038413
1800 Ga0495676_0047669
1801 Ga0495680_0014392
1802 Ga0495680_0022162
1803 Ga0495680_0028274
1804 Ga0495680_0094090
1805 Ga0495675_0023707
1806 Ga0495677_0028641
1807 Ga0495679_031560
1808 Ga0495684_0024943
1809 Ga0495684_0135229
1810 Ga0495684_0165348
1811 Ga0495684_0268174
1812 Ga0495686_0222256
1813 Ga0495593_0001023
1814 Ga0495602_0047540
1815 Ga0495614_0034423
1816 Ga0495626_0065940
1817 Ga0496100_0003675
1818 Ga0496100_0005737
1819 Ga0496100_0143653
1820 Ga0496101_0002231
1821 Ga0496101_0006527
1822 Ga0496101_0020096
1823 Ga0496101_0034825
1824 Ga0496101_0041132
1825 Ga0496101_0071028
1826 Ga0496101_0120326
1827 Ga0496102_0019812
1828 Ga0496102_0019821
1829 Ga0496102_0020092
1830 Ga0496102_0033077
1831 Ga0496102_0042674
1832 Ga0496102_0071073
1833 Ga0496102_0240912
1834 Ga0496102_0456723
1835 Ga0496103_0002716
1836 Ga0496103_0005324
1837 Ga0496103_0006852
1838 Ga0496103_0016376
1839 Ga0496103_0061470
1840 Ga0496104_0003499
1841 Ga0496104_0008528
1842 Ga0496104_0044483
1843 Ga0496104_0048378
1844 Ga0496104_0067135
1845 Ga0496104_0131004
1846 Ga0496104_0140999
1847 Ga0496104_0143202
1848 Ga0496105_0004200
1849 Ga0496105_0025968
1850 Ga0496105_0033375
1851 Ga0496105_0097484
1852 Ga0496105_0148348
1853 Ga0496105_0155514
1854 Ga0496105_0282674
1855 Ga0496106_0003558
1856 Ga0496106_0016339
1857 Ga0496106_0019678
1858 Ga0496106_0028478
1859 Ga0496106_0040623
1860 Ga0496106_0122055
1861 Ga0496106_0281049
1862 Ga0496107_0012234
1863 Ga0496107_0021259
1864 Ga0496107_0036978
1865 Ga0496107_0041550
1866 Ga0496107_0049417
1867 Ga0496107_0059395
1868 Ga0496107_0091946
1869 Ga0496107_0157388
1870 Ga0496108_0001828
1871 Ga0496108_0007255
1872 Ga0496108_0094003
1873 Ga0496108_0135338
1874 Ga0496108_0139395
1875 Ga0496108_0173426
1876 Ga0496108_0495282
1877 Ga0496109_0007856
1878 Ga0496109_0008549
1879 Ga0496109_0018179
1880 Ga0496109_0065176
1881 Ga0496109_0066205
1882 Ga0496109_0133144
1883 Ga0496109_0204286
1884 Ga0496109_0273572
1885 Ga0496110_0027307
1886 Ga0496110_0067091
1887 Ga0496110_0088896
1888 Ga0496110_0096561
1889 Ga0496111_0002519
1890 Ga0496111_0022283
1891 Ga0496111_0031896
1892 Ga0496111_0057641
1893 Ga0496111_0082688
1894 Ga0496112_0009068
1895 Ga0496112_0019528
1896 Ga0496112_0039463
1897 Ga0496112_0059028
1898 Ga0496112_0064454
1899 Ga0496112_0082610
1900 Ga0496112_0217225
1901 Ga0496112_0365043
1902 Ga0496113_0006338
1903 Ga0496113_0010185
1904 Ga0496113_0037480
1905 Ga0496113_0041029
1906 Ga0496113_0226212
1907 Ga0496113_0276275
1908 Ga0496113_0414995
1909 Ga0496114_0014950
1910 Ga0496114_0025741
1911 Ga0496114_0026354
1912 Ga0496114_0031259
1913 Ga0496114_0085635
1914 Ga0496114_0134794
1915 Ga0496115_0006207
1916 Ga0496115_0008489
1917 Ga0496115_0046138
1918 Ga0496115_0101320
1919 Ga0496115_0102656
1920 Ga0496115_0441876
1921 Ga0501031_0050060
1922 Ga0501031_0062055
1923 Ga0501033_0036415
1924 Ga0501033_0053143
1925 Ga0501033_0068471
1926 Ga0501033_0099433
1927 Ga0501033_0219364
1928 Ga0501034_0042753
1929 Ga0501034_0074785
1930 Ga0501034_0097651
1931 Ga0501036_0174863
1932 Ga0501037_0157408
1933 Ga0501038_0089945
1934 Ga0501039_0028654
1935 Ga0501039_0130743
1936 Ga0501041_0043008
1937 Ga0501042_0037352
1938 Ga0501046_0006964
1939 Ga0501047_0015389
1940 Ga0501047_0091710
1941 Ga0501047_0171989
1942 Ga0501048_0069083
1943 Ga0501067_0004377
1944 Ga0501068_0082284
1945 Ga0501069_0032657
1946 Ga0501074_0080884
1947 Ga0501075_0035908
1948 Ga0501079_0090925
1949 Ga0501080_0115363
1950 Ga0501081_0219624
1951 Ga0501083_0014044
1952 Ga0501035_0054484
1953 Ga0501044_0000173
1954 Ga0501044_0229711
1955 Ga0501045_0120901
1956 nmdc:mga03683_61708_c1
1957 nmdc:mga00v17_83073_c1
1958 nmdc:mga0yw44_170432_c1
1959 nmdc:mga0yw44_6262_c1
1960 nmdc:mga0k408_29747_c1
1961 nmdc:mga0k408_67288_c1
1962 nmdc:mga06z11_129794_c1
1963 nmdc:mga05p37_157546_c1
1964 nmdc:mga05p37_204703_c1
1965 nmdc:mga05p37_302232_c1
1966 nmdc:mga05p37_670874_c1
1967 nmdc:mga05p37_69456_c1
1968 nmdc:mga09592_120809_c1
1969 nmdc:mga0qj67_288710_c1
1970 nmdc:mga0qj67_45862_c1
1971 nmdc:mga0qj67_6924_c1
1972 nmdc:mga0qj67_98072_c1
1973 nmdc:mga06r32_69686_c1
1974 nmdc:mga08y16_160742_c1
1975 nmdc:mga08y16_23656_c1
1976 nmdc:mga08y16_33457_c1
1977 nmdc:mga08y16_428577_c1
1978 nmdc:mga08y16_53521_c1
1979 nmdc:mga0n895_10980_c1
1980 nmdc:mga0n895_14260_c1
1981 nmdc:mga0n895_211403_c1
1982 nmdc:mga0n895_63475_c1
1983 nmdc:mga0n895_850525_c1
1984 nmdc:mga0n895_86_c1
1985 nmdc:mga0rr50_210677_c1
1986 nmdc:mga0rr50_3472_c1
1987 nmdc:mga0rr50_382571_c1
1988 nmdc:mga0rr50_664_c1
1989 nmdc:mga0rr50_740_c1
1990 nmdc:mga0rr50_79065_c1
1991 nmdc:mga08x19_1310_c1
1992 nmdc:mga08x19_183953_c1
1993 nmdc:mga08x19_32895_c1
1994 nmdc:mga0a205_1448_c1
1995 nmdc:mga0a205_23839_c1
1996 nmdc:mga0a205_31489_c1
1997 nmdc:mga0a205_55341_c1
1998 nmdc:mga0a205_8069_c1
1999 Ga0495601_0030200
2000 Ga0495612_0002701
2001 Ga0495612_0028807
2002 Ga0495612_0036716
2003 Ga0495655_0004315
2004 Ga0495655_0022022
2005 Ga0495595_0000574
2006 Ga0495595_0001515
2007 Ga0495595_0002744
2008 Ga0495619_0000045
2009 Ga0495619_0000484
2010 Ga0495619_0010412
2011 Ga0495619_0026207
2012 Ga0495619_0032329
2013 Ga0495619_0090687
2014 Ga0500566_0004523
2015 Ga0500641_0003963
2016 Ga0500554_001737
2017 Ga0500593_006659
2018 Ga0500595_001694
2019 Ga0500577_0054240
2020 Ga0500603_006016
2021 Ga0500616_0053185
2022 Ga0500638_032029
2023 Ga0500639_059717
2024 Ga0500637_0000263

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

62

335

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9597 27 319
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9568 31 323
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9535 27 321
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.938 27 319
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9361 27 323
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9585 126 248 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9511 126 244 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9499 126 243 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9437 126 248 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9366 127 248 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A844TKW8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9819 27 323
AF-A0A1F4DZ02-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9791 24 323
AF-A0A7J4VHT1-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.979 27 315
AF-A0A1B2R0B6-F1-model_v4 ABC transporter substrate-binding protein 0.9771 27 323
AF-A0A1F4AHA8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9768 52 320

Map