F488161
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1012 | 403 | 2024 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300005367|Ga0070667_100332522|Ga0070667_1003325222 |
| Length | 341 |
| Sequence | MSGARPRPKEMGDSVRRDIVYLTVTLAIVALATTAQAQEQNYPNRPVHILAAAAPGGNPDVLARLLSQRLSDILGQPFVVENVPGAGGILAAKRIADAAPDGYTLMLNDSGALAININMSPEATYKLKDFTPITALATVPTALVIIPSVPASNLSEFIALAKSKPDAMSYGSAGAGSIHHLTMEIFAERTGIKLLHVPYRGGSALVNGLLTGEIQAGWSGLPNVISHINAGKLRGLCVSVRKRAVSLPDVPTCDELGIKGFDIADMLGLQGPAGISVKAVERLQAAIAKTMREPAMAERMAILGMDMQENGTASYVRFMQDDLDRYSKVIDRLGLSRKGNK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 112 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 113 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 143 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 144 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 218 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 219 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 222 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 227 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 228 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 229 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 231 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 235 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 239 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 243 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 245 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 250 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 251 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 254 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 255 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 256 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 259 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 260 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 261 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 262 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 263 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 264 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 265 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 266 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 267 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 268 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 269 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 270 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 271 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 272 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 338 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 339 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 340 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 341 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 342 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 345 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 346 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 347 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 348 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 349 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 350 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 375 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 376 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 377 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 378 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 379 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 394 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 395 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 396 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 397 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 398 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 399 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 400 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 401 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 402 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 403 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.57 |
| Nodule | 0 |
| Rhizoplane | 10.28 |
| Rhizosphere | 86.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070667_100332522 | 3300005367 | Unclassified | 1373 |
| 2 | JGI24746J21847_1001454 | 3300001977 | Bacteria | 3765 |
| 3 | JGI24739J22299_10002355 | 3300001989 | Bacteria | 7280 |
| 4 | JGI24737J22298_10005173 | 3300001990 | Bacteria | 4517 |
| 5 | JGI24743J22301_10000279 | 3300001991 | Bacteria | 5527 |
| 6 | JGI24738J21930_10002285 | 3300002075 | Bacteria | 5069 |
| 7 | JGI24749J21850_1000800 | 3300002076 | Bacteria | 4518 |
| 8 | JGI24749J21850_1003432 | 3300002076 | Bacteria | 2217 |
| 9 | JGI24744J21845_10003450 | 3300002077 | Unclassified | 3250 |
| 10 | JGI24034J26672_10000501 | 3300002239 | Bacteria | 5062 |
| 11 | JGI24742J22300_10000285 | 3300002244 | Bacteria | 7636 |
| 12 | JGI24742J22300_10000731 | 3300002244 | Bacteria | 5000 |
| 13 | JGI24751J29686_10002085 | 3300002459 | Bacteria | 4059 |
| 14 | JGI25406J46586_10039898 | 3300003203 | Bacteria | 1669 |
| 15 | Ga0065712_10087858 | 3300005290 | Unclassified | 2551 |
| 16 | Ga0065707_10105003 | 3300005295 | Bacteria | 2653 |
| 17 | Ga0070658_10066646 | 3300005327 | Bacteria | 2941 |
| 18 | Ga0070676_10014663 | 3300005328 | Bacteria | 4311 |
| 19 | Ga0070683_100010349 | 3300005329 | Bacteria | 8022 |
| 20 | Ga0070683_100127360 | 3300005329 | Bacteria | 2407 |
| 21 | Ga0070690_100000235 | 3300005330 | Bacteria | 28411 |
| 22 | Ga0070690_100004036 | 3300005330 | Bacteria | 8123 |
| 23 | Ga0070690_100006864 | 3300005330 | Bacteria | 6476 |
| 24 | Ga0070690_100075479 | 3300005330 | Unclassified | 2198 |
| 25 | Ga0070670_100013045 | 3300005331 | Bacteria | 7118 |
| 26 | Ga0070670_100081348 | 3300005331 | Bacteria | 2784 |
| 27 | Ga0070670_100083494 | 3300005331 | Unclassified | 2745 |
| 28 | Ga0070670_100139759 | 3300005331 | Bacteria | 2094 |
| 29 | Ga0070670_100501100 | 3300005331 | Bacteria | 1080 |
| 30 | Ga0070677_10000940 | 3300005333 | Bacteria | 9465 |
| 31 | Ga0068869_100000629 | 3300005334 | Bacteria | 19915 |
| 32 | Ga0068869_100289764 | 3300005334 | Bacteria | 1319 |
| 33 | Ga0070666_10012126 | 3300005335 | Bacteria | 5429 |
| 34 | Ga0070666_10012842 | 3300005335 | Bacteria | 5296 |
| 35 | Ga0070680_100001167 | 3300005336 | Bacteria | 18875 |
| 36 | Ga0070680_100013671 | 3300005336 | Bacteria | 6328 |
| 37 | Ga0070680_100078608 | 3300005336 | Unclassified | 2718 |
| 38 | Ga0070680_100082086 | 3300005336 | Bacteria | 2660 |
| 39 | Ga0070680_100134955 | 3300005336 | Bacteria | 2067 |
| 40 | Ga0070682_100002926 | 3300005337 | Bacteria | 9474 |
| 41 | Ga0070682_100003053 | 3300005337 | Bacteria | 9270 |
| 42 | Ga0070682_100013021 | 3300005337 | Bacteria | 4775 |
| 43 | Ga0070682_100014773 | 3300005337 | Bacteria | 4517 |
| 44 | Ga0068868_100003444 | 3300005338 | Bacteria | 11016 |
| 45 | Ga0068868_100006182 | 3300005338 | Bacteria | 8469 |
| 46 | Ga0068868_100176490 | 3300005338 | Unclassified | 1771 |
| 47 | Ga0070660_100268830 | 3300005339 | Bacteria | 1393 |
| 48 | Ga0070660_100379117 | 3300005339 | Unclassified | 1167 |
| 49 | Ga0070689_100000188 | 3300005340 | Bacteria | 37400 |
| 50 | Ga0070689_100001782 | 3300005340 | Bacteria | 13823 |
| 51 | Ga0070689_100019391 | 3300005340 | Bacteria | 5030 |
| 52 | Ga0070689_100019765 | 3300005340 | Bacteria | 4984 |
| 53 | Ga0070689_100068707 | 3300005340 | Bacteria | 2763 |
| 54 | Ga0070689_100084840 | 3300005340 | Bacteria | 2490 |
| 55 | Ga0070689_100169166 | 3300005340 | Unclassified | 1770 |
| 56 | Ga0070691_10001176 | 3300005341 | Bacteria | 10947 |
| 57 | Ga0070691_10004002 | 3300005341 | Bacteria | 6671 |
| 58 | Ga0070687_100000069 | 3300005343 | Bacteria | 33055 |
| 59 | Ga0070687_100062271 | 3300005343 | Bacteria | 1975 |
| 60 | Ga0070687_100130224 | 3300005343 | Bacteria | 1452 |
| 61 | Ga0070661_100023192 | 3300005344 | Bacteria | 4447 |
| 62 | Ga0070661_100049805 | 3300005344 | Bacteria | 3066 |
| 63 | Ga0070661_100105805 | 3300005344 | Bacteria | 2098 |
| 64 | Ga0070692_10001429 | 3300005345 | Bacteria | 8658 |
| 65 | Ga0070692_10006313 | 3300005345 | Bacteria | 5140 |
| 66 | Ga0070692_10030102 | 3300005345 | Bacteria | 2712 |
| 67 | Ga0070668_100032033 | 3300005347 | Bacteria | 4000 |
| 68 | Ga0070669_100006075 | 3300005353 | Bacteria | 8717 |
| 69 | Ga0070669_100010102 | 3300005353 | Bacteria | 6714 |
| 70 | Ga0070669_100115916 | 3300005353 | Bacteria | 2038 |
| 71 | Ga0070669_100208680 | 3300005353 | Bacteria | 1540 |
| 72 | Ga0070675_100010884 | 3300005354 | Bacteria | 7115 |
| 73 | Ga0070675_100014476 | 3300005354 | Bacteria | 6221 |
| 74 | Ga0070675_100180260 | 3300005354 | Bacteria | 1826 |
| 75 | Ga0070671_100001554 | 3300005355 | Bacteria | 17283 |
| 76 | Ga0070671_100005261 | 3300005355 | Bacteria | 10314 |
| 77 | Ga0070671_100013065 | 3300005355 | Bacteria | 6691 |
| 78 | Ga0070671_100018682 | 3300005355 | Bacteria | 5633 |
| 79 | Ga0070671_100227984 | 3300005355 | Bacteria | 1581 |
| 80 | Ga0070674_100012344 | 3300005356 | Bacteria | 5245 |
| 81 | Ga0070674_100047974 | 3300005356 | Bacteria | 2929 |
| 82 | Ga0070674_100062574 | 3300005356 | Bacteria | 2601 |
| 83 | Ga0070674_100079402 | 3300005356 | Bacteria | 2341 |
| 84 | Ga0070673_100029758 | 3300005364 | Bacteria | 4076 |
| 85 | Ga0070673_100043853 | 3300005364 | Bacteria | 3460 |
| 86 | Ga0070673_100056615 | 3300005364 | Bacteria | 3094 |
| 87 | Ga0070673_100171311 | 3300005364 | Unclassified | 1853 |
| 88 | Ga0070673_100256335 | 3300005364 | Bacteria | 1526 |
| 89 | Ga0070688_100000518 | 3300005365 | Bacteria | 19476 |
| 90 | Ga0070688_100013493 | 3300005365 | Bacteria | 4608 |
| 91 | Ga0070659_100001996 | 3300005366 | Bacteria | 14594 |
| 92 | Ga0070659_100014760 | 3300005366 | Bacteria | 5842 |
| 93 | Ga0070667_100009832 | 3300005367 | Bacteria | 7929 |
| 94 | Ga0070667_100017349 | 3300005367 | Bacteria | 5965 |
| 95 | Ga0070667_100361981 | 3300005367 | Unclassified | 1315 |
| 96 | Ga0070703_10009245 | 3300005406 | Bacteria | 2781 |
| 97 | Ga0070709_10005005 | 3300005434 | Bacteria | 7157 |
| 98 | Ga0070714_100025390 | 3300005435 | Bacteria | 4890 |
| 99 | Ga0070714_100048803 | 3300005435 | Bacteria | 3601 |
| 100 | Ga0070713_100004683 | 3300005436 | Bacteria | 9236 |
| 101 | Ga0070713_100005212 | 3300005436 | Bacteria | 8855 |
| 102 | Ga0070713_100012790 | 3300005436 | Bacteria | 6170 |
| 103 | Ga0070713_100086923 | 3300005436 | Bacteria | 2681 |
| 104 | Ga0070713_100176838 | 3300005436 | Bacteria | 1916 |
| 105 | Ga0070710_10002248 | 3300005437 | Bacteria | 9140 |
| 106 | Ga0070710_10025506 | 3300005437 | Bacteria | 3131 |
| 107 | Ga0070710_10245413 | 3300005437 | Bacteria | 1149 |
| 108 | Ga0070701_10000142 | 3300005438 | Bacteria | 21810 |
| 109 | Ga0070701_10000603 | 3300005438 | Bacteria | 12535 |
| 110 | Ga0070701_10048521 | 3300005438 | Bacteria | 2191 |
| 111 | Ga0070701_10095759 | 3300005438 | Bacteria | 1635 |
| 112 | Ga0070711_100031939 | 3300005439 | Bacteria | 3498 |
| 113 | Ga0070711_100045830 | 3300005439 | Bacteria | 2977 |
| 114 | Ga0070711_100250167 | 3300005439 | Bacteria | 1390 |
| 115 | Ga0070705_100001149 | 3300005440 | Bacteria | 14607 |
| 116 | Ga0070705_100004550 | 3300005440 | Bacteria | 6748 |
| 117 | Ga0070705_100051420 | 3300005440 | Bacteria | 2402 |
| 118 | Ga0070700_100001129 | 3300005441 | Bacteria | 13230 |
| 119 | Ga0070700_100008783 | 3300005441 | Bacteria | 5518 |
| 120 | Ga0070694_100111339 | 3300005444 | Bacteria | 1951 |
| 121 | Ga0070708_100077012 | 3300005445 | Bacteria | 3013 |
| 122 | Ga0070708_100111072 | 3300005445 | Unclassified | 2520 |
| 123 | Ga0070663_100167391 | 3300005455 | Bacteria | 1696 |
| 124 | Ga0070678_100004056 | 3300005456 | Bacteria | 8245 |
| 125 | Ga0070678_100067528 | 3300005456 | Bacteria | 2662 |
| 126 | Ga0070678_100157223 | 3300005456 | Bacteria | 1837 |
| 127 | Ga0070678_100234125 | 3300005456 | Unclassified | 1533 |
| 128 | Ga0070678_100291110 | 3300005456 | Bacteria | 1384 |
| 129 | Ga0070662_100092393 | 3300005457 | Bacteria | 2275 |
| 130 | Ga0070662_100101095 | 3300005457 | Bacteria | 2182 |
| 131 | Ga0070681_10000688 | 3300005458 | Bacteria | 28034 |
| 132 | Ga0070681_10021720 | 3300005458 | Bacteria | 6436 |
| 133 | Ga0070681_10058690 | 3300005458 | Bacteria | 3828 |
| 134 | Ga0070681_10071117 | 3300005458 | Bacteria | 3444 |
| 135 | Ga0070681_10199381 | 3300005458 | Bacteria | 1920 |
| 136 | Ga0068867_100000296 | 3300005459 | Bacteria | 32704 |
| 137 | Ga0068867_100008754 | 3300005459 | Bacteria | 7145 |
| 138 | Ga0068867_100009922 | 3300005459 | Bacteria | 6708 |
| 139 | Ga0068867_100048435 | 3300005459 | Bacteria | 3126 |
| 140 | Ga0068867_100264046 | 3300005459 | Unclassified | 1405 |
| 141 | Ga0070685_10001300 | 3300005466 | Bacteria | 13163 |
| 142 | Ga0070685_10002735 | 3300005466 | Bacteria | 9033 |
| 143 | Ga0070707_100249502 | 3300005468 | Bacteria | 1727 |
| 144 | Ga0070699_100011236 | 3300005518 | Bacteria | 7734 |
| 145 | Ga0070699_100034931 | 3300005518 | Bacteria | 4344 |
| 146 | Ga0070679_100040411 | 3300005530 | Bacteria | 4641 |
| 147 | Ga0070679_100059353 | 3300005530 | Unclassified | 3813 |
| 148 | Ga0070679_100085012 | 3300005530 | Bacteria | 3151 |
| 149 | Ga0070684_100011160 | 3300005535 | Bacteria | 7152 |
| 150 | Ga0070684_100065689 | 3300005535 | Bacteria | 3184 |
| 151 | Ga0070684_100207309 | 3300005535 | Bacteria | 1786 |
| 152 | Ga0070697_100031782 | 3300005536 | Bacteria | 4247 |
| 153 | Ga0070697_100038388 | 3300005536 | Bacteria | 3869 |
| 154 | Ga0070697_100088797 | 3300005536 | Bacteria | 2553 |
| 155 | Ga0070697_100172720 | 3300005536 | Bacteria | 1830 |
| 156 | Ga0068853_100029841 | 3300005539 | Bacteria | 4601 |
| 157 | Ga0070672_100003208 | 3300005543 | Bacteria | 10585 |
| 158 | Ga0070686_100000090 | 3300005544 | Bacteria | 63246 |
| 159 | Ga0070686_100001797 | 3300005544 | Bacteria | 11965 |
| 160 | Ga0070686_100003371 | 3300005544 | Bacteria | 8754 |
| 161 | Ga0070686_100005651 | 3300005544 | Bacteria | 6927 |
| 162 | Ga0070686_100183848 | 3300005544 | Bacteria | 1487 |
| 163 | Ga0070695_100004621 | 3300005545 | Bacteria | 8087 |
| 164 | Ga0070695_100050402 | 3300005545 | Bacteria | 2668 |
| 165 | Ga0070695_100103084 | 3300005545 | Bacteria | 1924 |
| 166 | Ga0070696_100000719 | 3300005546 | Bacteria | 21155 |
| 167 | Ga0070696_100002632 | 3300005546 | Bacteria | 11903 |
| 168 | Ga0070693_100000525 | 3300005547 | Bacteria | 17212 |
| 169 | Ga0070693_100027503 | 3300005547 | Bacteria | 3084 |
| 170 | Ga0070665_100004366 | 3300005548 | Bacteria | 14875 |
| 171 | Ga0070665_100178977 | 3300005548 | Bacteria | 2121 |
| 172 | Ga0070665_100215084 | 3300005548 | Unclassified | 1923 |
| 173 | Ga0070665_100238168 | 3300005548 | Bacteria | 1820 |
| 174 | Ga0070665_100526485 | 3300005548 | Bacteria | 1194 |
| 175 | Ga0070704_100000168 | 3300005549 | Bacteria | 26018 |
| 176 | Ga0070704_100008425 | 3300005549 | Bacteria | 6183 |
| 177 | Ga0070704_100135656 | 3300005549 | Bacteria | 1914 |
| 178 | Ga0070704_100160863 | 3300005549 | Bacteria | 1776 |
| 179 | Ga0068855_100000833 | 3300005563 | Bacteria | 38155 |
| 180 | Ga0068855_100037836 | 3300005563 | Bacteria | 5734 |
| 181 | Ga0068855_100039748 | 3300005563 | Bacteria | 5584 |
| 182 | Ga0070664_100006958 | 3300005564 | Bacteria | 9117 |
| 183 | Ga0070664_100021837 | 3300005564 | Bacteria | 5277 |
| 184 | Ga0070664_100071588 | 3300005564 | Bacteria | 2971 |
| 185 | Ga0070664_100503293 | 3300005564 | Bacteria | 1117 |
| 186 | Ga0068857_100000715 | 3300005577 | Bacteria | 24767 |
| 187 | Ga0068857_100487283 | 3300005577 | Bacteria | 1156 |
| 188 | Ga0068854_100000657 | 3300005578 | Bacteria | 20579 |
| 189 | Ga0068854_100005118 | 3300005578 | Bacteria | 8262 |
| 190 | Ga0068854_100020739 | 3300005578 | Bacteria | 4453 |
| 191 | Ga0068856_100003103 | 3300005614 | Bacteria | 16966 |
| 192 | Ga0068856_100045035 | 3300005614 | Bacteria | 4343 |
| 193 | Ga0068856_100071466 | 3300005614 | Bacteria | 3436 |
| 194 | Ga0068856_100130262 | 3300005614 | Bacteria | 2520 |
| 195 | Ga0068856_100231558 | 3300005614 | Bacteria | 1863 |
| 196 | Ga0070702_100000002 | 3300005615 | Bacteria | 83999 |
| 197 | Ga0070702_100004841 | 3300005615 | Bacteria | 6192 |
| 198 | Ga0070702_100038455 | 3300005615 | Bacteria | 2664 |
| 199 | Ga0070702_100166682 | 3300005615 | Bacteria | 1429 |
| 200 | Ga0068852_100006185 | 3300005616 | Bacteria | 8632 |
| 201 | Ga0068852_100048049 | 3300005616 | Bacteria | 3645 |
| 202 | Ga0068852_100205984 | 3300005616 | Bacteria | 1863 |
| 203 | Ga0068859_100000195 | 3300005617 | Bacteria | 59015 |
| 204 | Ga0068859_100014349 | 3300005617 | Bacteria | 7947 |
| 205 | Ga0068859_100254846 | 3300005617 | Bacteria | 1845 |
| 206 | Ga0068864_100006237 | 3300005618 | Bacteria | 9780 |
| 207 | Ga0068864_100006919 | 3300005618 | Bacteria | 9300 |
| 208 | Ga0068864_100057324 | 3300005618 | Bacteria | 3366 |
| 209 | Ga0068866_10001095 | 3300005718 | Bacteria | 11931 |
| 210 | Ga0068866_10015715 | 3300005718 | Bacteria | 3368 |
| 211 | Ga0068861_100000043 | 3300005719 | Bacteria | 57807 |
| 212 | Ga0068861_100010394 | 3300005719 | Bacteria | 6457 |
| 213 | Ga0068861_100182339 | 3300005719 | Bacteria | 1749 |
| 214 | Ga0068870_10000073 | 3300005840 | Bacteria | 31807 |
| 215 | Ga0068870_10032369 | 3300005840 | Bacteria | 2658 |
| 216 | Ga0068863_100021006 | 3300005841 | Bacteria | 6235 |
| 217 | Ga0068863_100032749 | 3300005841 | Bacteria | 4952 |
| 218 | Ga0068863_100359868 | 3300005841 | Bacteria | 1418 |
| 219 | Ga0068858_100005138 | 3300005842 | Bacteria | 12824 |
| 220 | Ga0068858_100033913 | 3300005842 | Bacteria | 4735 |
| 221 | Ga0068858_100041152 | 3300005842 | Bacteria | 4286 |
| 222 | Ga0068860_100002559 | 3300005843 | Bacteria | 19020 |
| 223 | Ga0068860_100019005 | 3300005843 | Bacteria | 6673 |
| 224 | Ga0068860_100053202 | 3300005843 | Bacteria | 3850 |
| 225 | Ga0068860_100207386 | 3300005843 | Bacteria | 1901 |
| 226 | Ga0068860_100413103 | 3300005843 | Unclassified | 1337 |
| 227 | Ga0068860_100464273 | 3300005843 | Bacteria | 1260 |
| 228 | Ga0068862_100013767 | 3300005844 | Bacteria | 6704 |
| 229 | Ga0068862_100016944 | 3300005844 | Bacteria | 6065 |
| 230 | Ga0068862_100020336 | 3300005844 | Bacteria | 5544 |
| 231 | Ga0081455_10000048 | 3300005937 | Bacteria | 126551 |
| 232 | Ga0081455_10009739 | 3300005937 | Bacteria | 9848 |
| 233 | Ga0081455_10014368 | 3300005937 | Bacteria | 7767 |
| 234 | Ga0081455_10111300 | 3300005937 | Bacteria | 2175 |
| 235 | Ga0081538_10041314 | 3300005981 | Bacteria | 2929 |
| 236 | Ga0081540_1000282 | 3300005983 | Bacteria | 52922 |
| 237 | Ga0081540_1005411 | 3300005983 | Bacteria | 9530 |
| 238 | Ga0081540_1095518 | 3300005983 | Bacteria | 1295 |
| 239 | Ga0081539_10000233 | 3300005985 | Bacteria | 130647 |
| 240 | Ga0081539_10017035 | 3300005985 | Bacteria | 5134 |
| 241 | Ga0070717_10007633 | 3300006028 | Bacteria | 8039 |
| 242 | Ga0070717_10100107 | 3300006028 | Bacteria | 2460 |
| 243 | Ga0075365_10019452 | 3300006038 | Bacteria | 4192 |
| 244 | Ga0075365_10022809 | 3300006038 | Bacteria | 3927 |
| 245 | Ga0070715_10004215 | 3300006163 | Bacteria | 4688 |
| 246 | Ga0070715_10032230 | 3300006163 | Bacteria | 2133 |
| 247 | Ga0070715_10069673 | 3300006163 | Bacteria | 1567 |
| 248 | Ga0070716_100001791 | 3300006173 | Bacteria | 9730 |
| 249 | Ga0070716_100104875 | 3300006173 | Bacteria | 1741 |
| 250 | Ga0070712_100013910 | 3300006175 | Bacteria | 5153 |
| 251 | Ga0070712_100076460 | 3300006175 | Bacteria | 2411 |
| 252 | Ga0070712_100157181 | 3300006175 | Bacteria | 1752 |
| 253 | Ga0075362_10096558 | 3300006177 | Bacteria | 1377 |
| 254 | Ga0075367_10037700 | 3300006178 | Bacteria | 2810 |
| 255 | Ga0075367_10086588 | 3300006178 | Bacteria | 1902 |
| 256 | Ga0075369_10029300 | 3300006186 | Bacteria | 2311 |
| 257 | Ga0097621_100002618 | 3300006237 | Bacteria | 12322 |
| 258 | Ga0097621_100019693 | 3300006237 | Bacteria | 5186 |
| 259 | Ga0097621_100021417 | 3300006237 | Bacteria | 5000 |
| 260 | Ga0097621_100319335 | 3300006237 | Bacteria | 1375 |
| 261 | Ga0075370_10085558 | 3300006353 | Bacteria | 1815 |
| 262 | Ga0068871_100000040 | 3300006358 | Bacteria | 69044 |
| 263 | Ga0068871_100024067 | 3300006358 | Bacteria | 4718 |
| 264 | Ga0068871_100026506 | 3300006358 | Bacteria | 4523 |
| 265 | Ga0068871_100072279 | 3300006358 | Unclassified | 2840 |
| 266 | Ga0075428_100269981 | 3300006844 | Bacteria | 1830 |
| 267 | Ga0075428_100443647 | 3300006844 | Bacteria | 1390 |
| 268 | Ga0075430_100019382 | 3300006846 | Bacteria | 5785 |
| 269 | Ga0075430_100112622 | 3300006846 | Bacteria | 2268 |
| 270 | Ga0075431_100078929 | 3300006847 | Bacteria | 3398 |
| 271 | Ga0075433_10037623 | 3300006852 | Bacteria | 4175 |
| 272 | Ga0075433_10066445 | 3300006852 | Unclassified | 3164 |
| 273 | Ga0075433_10149539 | 3300006852 | Bacteria | 2077 |
| 274 | Ga0075434_100000006 | 3300006871 | Bacteria | 96966 |
| 275 | Ga0075434_100000554 | 3300006871 | Bacteria | 28632 |
| 276 | Ga0075434_100009283 | 3300006871 | Bacteria | 9165 |
| 277 | Ga0075434_100037538 | 3300006871 | Bacteria | 4797 |
| 278 | Ga0075434_100058798 | 3300006871 | Bacteria | 3821 |
| 279 | Ga0075429_100031900 | 3300006880 | Bacteria | 4580 |
| 280 | Ga0075429_100036481 | 3300006880 | Bacteria | 4275 |
| 281 | Ga0068865_100006295 | 3300006881 | Bacteria | 7230 |
| 282 | Ga0068865_100041108 | 3300006881 | Bacteria | 3145 |
| 283 | Ga0075436_100000174 | 3300006914 | Bacteria | 40099 |
| 284 | Ga0075436_100012987 | 3300006914 | Bacteria | 5710 |
| 285 | Ga0075436_100030588 | 3300006914 | Bacteria | 3706 |
| 286 | Ga0075436_100286672 | 3300006914 | Unclassified | 1178 |
| 287 | Ga0097620_100000195 | 3300006931 | Bacteria | 59015 |
| 288 | Ga0097620_100014349 | 3300006931 | Bacteria | 7947 |
| 289 | Ga0097620_100254841 | 3300006931 | Bacteria | 1845 |
| 290 | Ga0075435_100001000 | 3300007076 | Bacteria | 17911 |
| 291 | Ga0075435_100006264 | 3300007076 | Bacteria | 8398 |
| 292 | Ga0075435_100015067 | 3300007076 | Bacteria | 5803 |
| 293 | Ga0075435_100081550 | 3300007076 | Bacteria | 2657 |
| 294 | Ga0075435_100245323 | 3300007076 | Bacteria | 1524 |
| 295 | Ga0099794_10011097 | 3300007265 | Bacteria | 3850 |
| 296 | Ga0099795_10072793 | 3300007788 | Bacteria | 1300 |
| 297 | Ga0105251_10006368 | 3300009011 | Bacteria | 7536 |
| 298 | Ga0105250_10084818 | 3300009092 | Bacteria | 1286 |
| 299 | Ga0105240_10657004 | 3300009093 | Unclassified | 1148 |
| 300 | Ga0111539_10036658 | 3300009094 | Bacteria | 5926 |
| 301 | Ga0111539_10064158 | 3300009094 | Bacteria | 4347 |
| 302 | Ga0111539_10137730 | 3300009094 | Bacteria | 2858 |
| 303 | Ga0111539_10172965 | 3300009094 | Bacteria | 2523 |
| 304 | Ga0111539_10429434 | 3300009094 | Bacteria | 1538 |
| 305 | Ga0111539_10462377 | 3300009094 | Bacteria | 1478 |
| 306 | Ga0105245_10008500 | 3300009098 | Bacteria | 8956 |
| 307 | Ga0105245_10009922 | 3300009098 | Bacteria | 8294 |
| 308 | Ga0105245_10125792 | 3300009098 | Bacteria | 2400 |
| 309 | Ga0105245_10154565 | 3300009098 | Bacteria | 2172 |
| 310 | Ga0105245_10245765 | 3300009098 | Bacteria | 1737 |
| 311 | Ga0105247_10054860 | 3300009101 | Bacteria | 2459 |
| 312 | Ga0105247_10063271 | 3300009101 | Bacteria | 2296 |
| 313 | Ga0114129_10155536 | 3300009147 | Bacteria | 3127 |
| 314 | Ga0114129_10279410 | 3300009147 | Bacteria | 2231 |
| 315 | Ga0114129_10536133 | 3300009147 | Bacteria | 1524 |
| 316 | Ga0114129_10546916 | 3300009147 | Bacteria | 1506 |
| 317 | Ga0105243_10000035 | 3300009148 | Bacteria | 177598 |
| 318 | Ga0105243_10002936 | 3300009148 | Bacteria | 14105 |
| 319 | Ga0105243_10020666 | 3300009148 | Bacteria | 4992 |
| 320 | Ga0105243_10024008 | 3300009148 | Bacteria | 4647 |
| 321 | Ga0105243_10107421 | 3300009148 | Bacteria | 2328 |
| 322 | Ga0105241_10006170 | 3300009174 | Bacteria | 8841 |
| 323 | Ga0105241_10080124 | 3300009174 | Bacteria | 2555 |
| 324 | Ga0105242_10001935 | 3300009176 | Bacteria | 16290 |
| 325 | Ga0105242_10002145 | 3300009176 | Bacteria | 15580 |
| 326 | Ga0105242_10036794 | 3300009176 | Bacteria | 3929 |
| 327 | Ga0105242_10302215 | 3300009176 | Bacteria | 1461 |
| 328 | Ga0105248_10004376 | 3300009177 | Bacteria | 15630 |
| 329 | Ga0105248_10006012 | 3300009177 | Bacteria | 13318 |
| 330 | Ga0105248_10036378 | 3300009177 | Bacteria | 5505 |
| 331 | Ga0105248_10085076 | 3300009177 | Bacteria | 3559 |
| 332 | Ga0105237_10040741 | 3300009545 | Bacteria | 4684 |
| 333 | Ga0105237_10060786 | 3300009545 | Bacteria | 3778 |
| 334 | Ga0105237_10177871 | 3300009545 | Bacteria | 2128 |
| 335 | Ga0105238_10059058 | 3300009551 | Bacteria | 3843 |
| 336 | Ga0105249_10004810 | 3300009553 | Bacteria | 11656 |
| 337 | Ga0105249_10019086 | 3300009553 | Bacteria | 6116 |
| 338 | Ga0105249_10148881 | 3300009553 | Bacteria | 2251 |
| 339 | Ga0105249_10387756 | 3300009553 | Bacteria | 1424 |
| 340 | Ga0105249_10482476 | 3300009553 | Bacteria | 1283 |
| 341 | Ga0105239_10017272 | 3300010375 | Bacteria | 7978 |
| 342 | Ga0105239_10170414 | 3300010375 | Bacteria | 2434 |
| 343 | Ga0105246_10001697 | 3300011119 | Bacteria | 13131 |
| 344 | Ga0105246_10019691 | 3300011119 | Bacteria | 4318 |
| 345 | Ga0105246_10112956 | 3300011119 | Bacteria | 1999 |
| 346 | Ga0105246_10365658 | 3300011119 | Bacteria | 1187 |
| 347 | Ga0157373_10110891 | 3300013100 | Bacteria | 1929 |
| 348 | Ga0157369_10249435 | 3300013105 | Bacteria | 1853 |
| 349 | Ga0157374_10005071 | 3300013296 | Bacteria | 11046 |
| 350 | Ga0157374_10021058 | 3300013296 | Bacteria | 5795 |
| 351 | Ga0157374_10048947 | 3300013296 | Bacteria | 3924 |
| 352 | Ga0157374_10122968 | 3300013296 | Bacteria | 2506 |
| 353 | Ga0157378_10001996 | 3300013297 | Bacteria | 18243 |
| 354 | Ga0157378_10004058 | 3300013297 | Bacteria | 12931 |
| 355 | Ga0157378_10004134 | 3300013297 | Bacteria | 12821 |
| 356 | Ga0163162_10024841 | 3300013306 | Bacteria | 5918 |
| 357 | Ga0163162_10044461 | 3300013306 | Bacteria | 4448 |
| 358 | Ga0163162_10344836 | 3300013306 | Bacteria | 1622 |
| 359 | Ga0157372_10138483 | 3300013307 | Bacteria | 2804 |
| 360 | Ga0157372_10550620 | 3300013307 | Bacteria | 1345 |
| 361 | Ga0157375_10217463 | 3300013308 | Bacteria | 2069 |
| 362 | Ga0157375_10307770 | 3300013308 | Bacteria | 1749 |
| 363 | Ga0163163_10002390 | 3300014325 | Bacteria | 15890 |
| 364 | Ga0163163_10015764 | 3300014325 | Bacteria | 6999 |
| 365 | Ga0163163_10051069 | 3300014325 | Bacteria | 4076 |
| 366 | Ga0163163_10322637 | 3300014325 | Bacteria | 1598 |
| 367 | Ga0163163_10335264 | 3300014325 | Bacteria | 1567 |
| 368 | Ga0163163_10418214 | 3300014325 | Bacteria | 1399 |
| 369 | Ga0157380_10037273 | 3300014326 | Bacteria | 3766 |
| 370 | Ga0157380_10039831 | 3300014326 | Bacteria | 3656 |
| 371 | Ga0157380_10191070 | 3300014326 | Bacteria | 1808 |
| 372 | Ga0157377_10009511 | 3300014745 | Bacteria | 4772 |
| 373 | Ga0157377_10017489 | 3300014745 | Bacteria | 3708 |
| 374 | Ga0157377_10029278 | 3300014745 | Bacteria | 2971 |
| 375 | Ga0157379_10016149 | 3300014968 | Bacteria | 6567 |
| 376 | Ga0157379_10026672 | 3300014968 | Bacteria | 5143 |
| 377 | Ga0157376_10000403 | 3300014969 | Bacteria | 28093 |
| 378 | Ga0157376_10041561 | 3300014969 | Bacteria | 3765 |
| 379 | Ga0157376_10043024 | 3300014969 | Bacteria | 3705 |
| 380 | Ga0157376_10091968 | 3300014969 | Bacteria | 2629 |
| 381 | Ga0163161_10005378 | 3300017792 | Bacteria | 8893 |
| 382 | Ga0163161_10023098 | 3300017792 | Bacteria | 4383 |
| 383 | Ga0163161_10059915 | 3300017792 | Bacteria | 2769 |
| 384 | Ga0163161_10189495 | 3300017792 | Bacteria | 1580 |
| 385 | Ga0213876_10052786 | 3300021384 | Bacteria | 2148 |
| 386 | Ga0213876_10070535 | 3300021384 | Bacteria | 1846 |
| 387 | Ga0213875_10000067 | 3300021388 | Bacteria | 127481 |
| 388 | Ga0207666_1000154 | 3300025271 | Bacteria | 10649 |
| 389 | Ga0207673_1000507 | 3300025290 | Bacteria | 4115 |
| 390 | Ga0209758_1000274 | 3300025297 | Bacteria | 102644 |
| 391 | Ga0207697_10000024 | 3300025315 | Bacteria | 53113 |
| 392 | Ga0207656_10012299 | 3300025321 | Bacteria | 3252 |
| 393 | Ga0207653_10006002 | 3300025885 | Unclassified | 3788 |
| 394 | Ga0207653_10079562 | 3300025885 | Unclassified | 1133 |
| 395 | Ga0207682_10000708 | 3300025893 | Bacteria | 15474 |
| 396 | Ga0207682_10032204 | 3300025893 | Bacteria | 2107 |
| 397 | Ga0207692_10001001 | 3300025898 | Bacteria | 10294 |
| 398 | Ga0207642_10001465 | 3300025899 | Bacteria | 7300 |
| 399 | Ga0207710_10000382 | 3300025900 | Bacteria | 30360 |
| 400 | Ga0207710_10031356 | 3300025900 | Bacteria | 2324 |
| 401 | Ga0207688_10000275 | 3300025901 | Bacteria | 23509 |
| 402 | Ga0207688_10001362 | 3300025901 | Bacteria | 12697 |
| 403 | Ga0207688_10048405 | 3300025901 | Bacteria | 2375 |
| 404 | Ga0207680_10005838 | 3300025903 | Bacteria | 5908 |
| 405 | Ga0207680_10010069 | 3300025903 | Bacteria | 4716 |
| 406 | Ga0207647_10000612 | 3300025904 | Bacteria | 27777 |
| 407 | Ga0207685_10001765 | 3300025905 | Bacteria | 4706 |
| 408 | Ga0207685_10014555 | 3300025905 | Bacteria | 2466 |
| 409 | Ga0207699_10002836 | 3300025906 | Bacteria | 8208 |
| 410 | Ga0207699_10101095 | 3300025906 | Bacteria | 1830 |
| 411 | Ga0207645_10000507 | 3300025907 | Bacteria | 32224 |
| 412 | Ga0207645_10044250 | 3300025907 | Bacteria | 2849 |
| 413 | Ga0207645_10050204 | 3300025907 | Bacteria | 2663 |
| 414 | Ga0207645_10067622 | 3300025907 | Bacteria | 2284 |
| 415 | Ga0207643_10000568 | 3300025908 | Bacteria | 23402 |
| 416 | Ga0207643_10002081 | 3300025908 | Bacteria | 11021 |
| 417 | Ga0207643_10032068 | 3300025908 | Bacteria | 2932 |
| 418 | Ga0207643_10081608 | 3300025908 | Bacteria | 1874 |
| 419 | Ga0207705_10053294 | 3300025909 | Bacteria | 2914 |
| 420 | Ga0207705_10234931 | 3300025909 | Bacteria | 1395 |
| 421 | Ga0207654_10021158 | 3300025911 | Unclassified | 3456 |
| 422 | Ga0207707_10004169 | 3300025912 | Bacteria | 12805 |
| 423 | Ga0207707_10019399 | 3300025912 | Bacteria | 5935 |
| 424 | Ga0207707_10050919 | 3300025912 | Bacteria | 3606 |
| 425 | Ga0207671_10025782 | 3300025914 | Bacteria | 4412 |
| 426 | Ga0207693_10001038 | 3300025915 | Bacteria | 24865 |
| 427 | Ga0207693_10079340 | 3300025915 | Unclassified | 2569 |
| 428 | Ga0207693_10085910 | 3300025915 | Bacteria | 2465 |
| 429 | Ga0207693_10216830 | 3300025915 | Bacteria | 1504 |
| 430 | Ga0207693_10251160 | 3300025915 | Bacteria | 1388 |
| 431 | Ga0207663_10014896 | 3300025916 | Bacteria | 4273 |
| 432 | Ga0207663_10069352 | 3300025916 | Bacteria | 2268 |
| 433 | Ga0207663_10087083 | 3300025916 | Bacteria | 2062 |
| 434 | Ga0207660_10013054 | 3300025917 | Bacteria | 5439 |
| 435 | Ga0207660_10014844 | 3300025917 | Bacteria | 5133 |
| 436 | Ga0207660_10098275 | 3300025917 | Bacteria | 2183 |
| 437 | Ga0207660_10116786 | 3300025917 | Bacteria | 2016 |
| 438 | Ga0207660_10147197 | 3300025917 | Unclassified | 1806 |
| 439 | Ga0207660_10233808 | 3300025917 | Bacteria | 1446 |
| 440 | Ga0207662_10000006 | 3300025918 | Bacteria | 105457 |
| 441 | Ga0207662_10000180 | 3300025918 | Bacteria | 30030 |
| 442 | Ga0207662_10008191 | 3300025918 | Bacteria | 5717 |
| 443 | Ga0207657_10007922 | 3300025919 | Bacteria | 10835 |
| 444 | Ga0207657_10054706 | 3300025919 | Bacteria | 3450 |
| 445 | Ga0207657_10055391 | 3300025919 | Bacteria | 3425 |
| 446 | Ga0207649_10014224 | 3300025920 | Bacteria | 4452 |
| 447 | Ga0207649_10082214 | 3300025920 | Bacteria | 2088 |
| 448 | Ga0207649_10229671 | 3300025920 | Unclassified | 1326 |
| 449 | Ga0207652_10028309 | 3300025921 | Bacteria | 4675 |
| 450 | Ga0207646_10209542 | 3300025922 | Bacteria | 1760 |
| 451 | Ga0207681_10002030 | 3300025923 | Bacteria | 13006 |
| 452 | Ga0207681_10086586 | 3300025923 | Bacteria | 2226 |
| 453 | Ga0207681_10255113 | 3300025923 | Bacteria | 1371 |
| 454 | Ga0207681_10271949 | 3300025923 | Bacteria | 1330 |
| 455 | Ga0207650_10006571 | 3300025925 | Bacteria | 7931 |
| 456 | Ga0207650_10048838 | 3300025925 | Bacteria | 3122 |
| 457 | Ga0207650_10061845 | 3300025925 | Bacteria | 2796 |
| 458 | Ga0207650_10063076 | 3300025925 | Unclassified | 2770 |
| 459 | Ga0207659_10002151 | 3300025926 | Bacteria | 11705 |
| 460 | Ga0207659_10021087 | 3300025926 | Bacteria | 4318 |
| 461 | Ga0207687_10002607 | 3300025927 | Bacteria | 12234 |
| 462 | Ga0207687_10202396 | 3300025927 | Bacteria | 1553 |
| 463 | Ga0207700_10019191 | 3300025928 | Bacteria | 4614 |
| 464 | Ga0207700_10049928 | 3300025928 | Bacteria | 3114 |
| 465 | Ga0207700_10174121 | 3300025928 | Bacteria | 1797 |
| 466 | Ga0207700_10225312 | 3300025928 | Unclassified | 1591 |
| 467 | Ga0207700_10228292 | 3300025928 | Bacteria | 1581 |
| 468 | Ga0207664_10016403 | 3300025929 | Bacteria | 5404 |
| 469 | Ga0207664_10029863 | 3300025929 | Bacteria | 4157 |
| 470 | Ga0207664_10363131 | 3300025929 | Unclassified | 1283 |
| 471 | Ga0207644_10007818 | 3300025931 | Bacteria | 6985 |
| 472 | Ga0207644_10022652 | 3300025931 | Bacteria | 4293 |
| 473 | Ga0207686_10003280 | 3300025934 | Bacteria | 8699 |
| 474 | Ga0207686_10044349 | 3300025934 | Bacteria | 2730 |
| 475 | Ga0207686_10105479 | 3300025934 | Bacteria | 1890 |
| 476 | Ga0207709_10001302 | 3300025935 | Bacteria | 17772 |
| 477 | Ga0207709_10004543 | 3300025935 | Bacteria | 7999 |
| 478 | Ga0207709_10010356 | 3300025935 | Bacteria | 5134 |
| 479 | Ga0207709_10011063 | 3300025935 | Bacteria | 4976 |
| 480 | Ga0207709_10138093 | 3300025935 | Bacteria | 1672 |
| 481 | Ga0207670_10001377 | 3300025936 | Bacteria | 12776 |
| 482 | Ga0207670_10011557 | 3300025936 | Bacteria | 5131 |
| 483 | Ga0207670_10078840 | 3300025936 | Bacteria | 2298 |
| 484 | Ga0207670_10090481 | 3300025936 | Bacteria | 2162 |
| 485 | Ga0207670_10112000 | 3300025936 | Bacteria | 1968 |
| 486 | Ga0207670_10151403 | 3300025936 | Bacteria | 1722 |
| 487 | Ga0207670_10210360 | 3300025936 | Unclassified | 1483 |
| 488 | Ga0207669_10000408 | 3300025937 | Bacteria | 18868 |
| 489 | Ga0207669_10072895 | 3300025937 | Bacteria | 2164 |
| 490 | Ga0207704_10002368 | 3300025938 | Bacteria | 8473 |
| 491 | Ga0207704_10008627 | 3300025938 | Bacteria | 4884 |
| 492 | Ga0207704_10044170 | 3300025938 | Bacteria | 2638 |
| 493 | Ga0207704_10077740 | 3300025938 | Bacteria | 2132 |
| 494 | Ga0207665_10001067 | 3300025939 | Bacteria | 18428 |
| 495 | Ga0207665_10003994 | 3300025939 | Bacteria | 9854 |
| 496 | Ga0207665_10057692 | 3300025939 | Bacteria | 2623 |
| 497 | Ga0207665_10088912 | 3300025939 | Bacteria | 2138 |
| 498 | Ga0207691_10003119 | 3300025940 | Bacteria | 16188 |
| 499 | Ga0207691_10331807 | 3300025940 | Bacteria | 1303 |
| 500 | Ga0207691_10334059 | 3300025940 | Bacteria | 1298 |
| 501 | Ga0207711_10004559 | 3300025941 | Bacteria | 11784 |
| 502 | Ga0207711_10006069 | 3300025941 | Bacteria | 10208 |
| 503 | Ga0207711_10014575 | 3300025941 | Bacteria | 6532 |
| 504 | Ga0207711_10022668 | 3300025941 | Bacteria | 5252 |
| 505 | Ga0207711_10145105 | 3300025941 | Bacteria | 2138 |
| 506 | Ga0207689_10000082 | 3300025942 | Bacteria | 76708 |
| 507 | Ga0207689_10000332 | 3300025942 | Bacteria | 43928 |
| 508 | Ga0207689_10033746 | 3300025942 | Bacteria | 4252 |
| 509 | Ga0207689_10195992 | 3300025942 | Bacteria | 1667 |
| 510 | Ga0207661_10003166 | 3300025944 | Bacteria | 11415 |
| 511 | Ga0207679_10001592 | 3300025945 | Bacteria | 14183 |
| 512 | Ga0207679_10054349 | 3300025945 | Bacteria | 2947 |
| 513 | Ga0207679_10379996 | 3300025945 | Bacteria | 1238 |
| 514 | Ga0207679_10420411 | 3300025945 | Bacteria | 1179 |
| 515 | Ga0207667_10087026 | 3300025949 | Unclassified | 3232 |
| 516 | Ga0207667_10101374 | 3300025949 | Bacteria | 2970 |
| 517 | Ga0207651_10004753 | 3300025960 | Bacteria | 6903 |
| 518 | Ga0207651_10054962 | 3300025960 | Bacteria | 2731 |
| 519 | Ga0207651_10221266 | 3300025960 | Bacteria | 1530 |
| 520 | Ga0207712_10001343 | 3300025961 | Bacteria | 16854 |
| 521 | Ga0207712_10012089 | 3300025961 | Bacteria | 5512 |
| 522 | Ga0207668_10023743 | 3300025972 | Bacteria | 3947 |
| 523 | Ga0207668_10027920 | 3300025972 | Bacteria | 3683 |
| 524 | Ga0207640_10002417 | 3300025981 | Bacteria | 9990 |
| 525 | Ga0207640_10045385 | 3300025981 | Bacteria | 2822 |
| 526 | Ga0207658_10004726 | 3300025986 | Bacteria | 9428 |
| 527 | Ga0207658_10016503 | 3300025986 | Bacteria | 5079 |
| 528 | Ga0207658_10174417 | 3300025986 | Bacteria | 1774 |
| 529 | Ga0207677_10002853 | 3300026023 | Bacteria | 9118 |
| 530 | Ga0207677_10004878 | 3300026023 | Bacteria | 7241 |
| 531 | Ga0207703_10005585 | 3300026035 | Bacteria | 10097 |
| 532 | Ga0207703_10006036 | 3300026035 | Bacteria | 9692 |
| 533 | Ga0207703_10015837 | 3300026035 | Bacteria | 5882 |
| 534 | Ga0207703_10040924 | 3300026035 | Bacteria | 3711 |
| 535 | Ga0207639_10009264 | 3300026041 | Bacteria | 6790 |
| 536 | Ga0207639_10202500 | 3300026041 | Bacteria | 1703 |
| 537 | Ga0207639_10227142 | 3300026041 | Bacteria | 1616 |
| 538 | Ga0207678_10000216 | 3300026067 | Bacteria | 51220 |
| 539 | Ga0207678_10012430 | 3300026067 | Bacteria | 7474 |
| 540 | Ga0207678_10012502 | 3300026067 | Bacteria | 7455 |
| 541 | Ga0207678_10049557 | 3300026067 | Bacteria | 3630 |
| 542 | Ga0207708_10000936 | 3300026075 | Bacteria | 21857 |
| 543 | Ga0207708_10005888 | 3300026075 | Bacteria | 9067 |
| 544 | Ga0207708_10012141 | 3300026075 | Bacteria | 6423 |
| 545 | Ga0207708_10033019 | 3300026075 | Bacteria | 3930 |
| 546 | Ga0207702_10013898 | 3300026078 | Bacteria | 6687 |
| 547 | Ga0207702_10039756 | 3300026078 | Bacteria | 3943 |
| 548 | Ga0207702_10137572 | 3300026078 | Bacteria | 2206 |
| 549 | Ga0207702_10568422 | 3300026078 | Bacteria | 1110 |
| 550 | Ga0207641_10046962 | 3300026088 | Bacteria | 3640 |
| 551 | Ga0207641_10064350 | 3300026088 | Bacteria | 3134 |
| 552 | Ga0207648_10000316 | 3300026089 | Bacteria | 52941 |
| 553 | Ga0207648_10003365 | 3300026089 | Bacteria | 16795 |
| 554 | Ga0207648_10006843 | 3300026089 | Bacteria | 11297 |
| 555 | Ga0207648_10007668 | 3300026089 | Bacteria | 10564 |
| 556 | Ga0207648_10152119 | 3300026089 | Bacteria | 2042 |
| 557 | Ga0207676_10011932 | 3300026095 | Bacteria | 6217 |
| 558 | Ga0207676_10027419 | 3300026095 | Bacteria | 4242 |
| 559 | Ga0207676_10028159 | 3300026095 | Bacteria | 4194 |
| 560 | Ga0207676_10093450 | 3300026095 | Bacteria | 2476 |
| 561 | Ga0207674_10003382 | 3300026116 | Bacteria | 19581 |
| 562 | Ga0207675_100000064 | 3300026118 | Bacteria | 79279 |
| 563 | Ga0207675_100004008 | 3300026118 | Bacteria | 14284 |
| 564 | Ga0207675_100004550 | 3300026118 | Bacteria | 13374 |
| 565 | Ga0207675_100011531 | 3300026118 | Bacteria | 8267 |
| 566 | Ga0207675_100153637 | 3300026118 | Bacteria | 2192 |
| 567 | Ga0207683_10000293 | 3300026121 | Bacteria | 44928 |
| 568 | Ga0207683_10010609 | 3300026121 | Bacteria | 7858 |
| 569 | Ga0207683_10020006 | 3300026121 | Bacteria | 5719 |
| 570 | Ga0207683_10053516 | 3300026121 | Bacteria | 3540 |
| 571 | Ga0207683_10076226 | 3300026121 | Bacteria | 2969 |
| 572 | Ga0207698_10011482 | 3300026142 | Bacteria | 5748 |
| 573 | Ga0207698_10022751 | 3300026142 | Bacteria | 4364 |
| 574 | Ga0207698_10065097 | 3300026142 | Bacteria | 2861 |
| 575 | Ga0209998_10001967 | 3300027717 | Bacteria | 4820 |
| 576 | Ga0209974_10003644 | 3300027876 | Bacteria | 5528 |
| 577 | Ga0207428_10001592 | 3300027907 | Bacteria | 23650 |
| 578 | Ga0268266_10003041 | 3300028379 | Bacteria | 17192 |
| 579 | Ga0268266_10099788 | 3300028379 | Bacteria | 2556 |
| 580 | Ga0268266_10287846 | 3300028379 | Bacteria | 1529 |
| 581 | Ga0268265_10004268 | 3300028380 | Bacteria | 9978 |
| 582 | Ga0268265_10011670 | 3300028380 | Bacteria | 5942 |
| 583 | Ga0268265_10036013 | 3300028380 | Bacteria | 3621 |
| 584 | Ga0268265_10079802 | 3300028380 | Bacteria | 2579 |
| 585 | Ga0268264_10003570 | 3300028381 | Bacteria | 13393 |
| 586 | Ga0268264_10008485 | 3300028381 | Bacteria | 8544 |
| 587 | Ga0268264_10051709 | 3300028381 | Bacteria | 3425 |
| 588 | Ga0265332_10002624 | 3300031238 | Bacteria | 9065 |
| 589 | Ga0265325_10000339 | 3300031241 | Bacteria | 33103 |
| 590 | Ga0265325_10001832 | 3300031241 | Bacteria | 14693 |
| 591 | Ga0265340_10001806 | 3300031247 | Bacteria | 12218 |
| 592 | Ga0265339_10009221 | 3300031249 | Bacteria | 6222 |
| 593 | Ga0265339_10114210 | 3300031249 | Unclassified | 1394 |
| 594 | Ga0265331_10015974 | 3300031250 | Bacteria | 3950 |
| 595 | Ga0265331_10054922 | 3300031250 | Bacteria | 1896 |
| 596 | Ga0307513_10304361 | 3300031456 | Bacteria | 1359 |
| 597 | Ga0265313_10056362 | 3300031595 | Bacteria | 1858 |
| 598 | Ga0265314_10011592 | 3300031711 | Bacteria | 7262 |
| 599 | Ga0265342_10000011 | 3300031712 | Bacteria | 208435 |
| 600 | Ga0307416_100060311 | 3300032002 | Bacteria | 3089 |
| 601 | Ga0307416_100121848 | 3300032002 | Bacteria | 2326 |
| 602 | Ga0307416_100503641 | 3300032002 | Bacteria | 1276 |
| 603 | Ga0307416_100909833 | 3300032002 | Bacteria | 980 |
| 604 | Ga0373930_0007487 | 3300034816 | Bacteria | 1881 |
| 605 | Ga0373938_0027965 | 3300034957 | Unclassified | 1190 |
| 606 | Ga0373926_0077545 | 3300035083 | Bacteria | 1226 |
| 607 | Ga0373928_0002816 | 3300035084 | Bacteria | 3348 |
| 608 | Ga0373929_0002823 | 3300035085 | Unclassified | 3173 |
| 609 | Ga0373934_0012402 | 3300035086 | Bacteria | 3218 |
| 610 | Ga0373944_0000780 | 3300035089 | Bacteria | 7769 |
| 611 | Ga0373944_0046225 | 3300035089 | Bacteria | 1360 |
| 612 | Ga0373949_0014990 | 3300035090 | Unclassified | 1728 |
| 613 | Ga0373949_0066341 | 3300035090 | Unclassified | 938 |
| 614 | Ga0373952_0021169 | 3300035092 | Bacteria | 1371 |
| 615 | Ga0373923_0000279 | 3300035111 | Bacteria | 11187 |
| 616 | Ga0373923_0070040 | 3300035111 | Unclassified | 1504 |
| 617 | Ga0373932_0002369 | 3300035112 | Bacteria | 4784 |
| 618 | Ga0373936_0002310 | 3300035113 | Bacteria | 7136 |
| 619 | Ga0373936_0015026 | 3300035113 | Bacteria | 2964 |
| 620 | Ga0373936_0070123 | 3300035113 | Bacteria | 1443 |
| 621 | Ga0373939_0001142 | 3300035114 | Bacteria | 6530 |
| 622 | Ga0373939_0033354 | 3300035114 | Bacteria | 1503 |
| 623 | Ga0373941_0000650 | 3300035115 | Bacteria | 7041 |
| 624 | Ga0373941_0053278 | 3300035115 | Bacteria | 1293 |
| 625 | Ga0373945_0000024 | 3300035116 | Bacteria | 30607 |
| 626 | Ga0373945_0023430 | 3300035116 | Bacteria | 2132 |
| 627 | Ga0373953_0006179 | 3300035117 | Bacteria | 3934 |
| 628 | Ga0373954_0002504 | 3300035118 | Bacteria | 7704 |
| 629 | Ga0373954_0153684 | 3300035118 | Bacteria | 1125 |
| 630 | Ga0373956_0034271 | 3300035119 | Bacteria | 2235 |
| 631 | Ga0373957_0002002 | 3300035120 | Bacteria | 5692 |
| 632 | Ga0373943_0007172 | 3300035170 | Bacteria | 5000 |
| 633 | Ga0373943_0008956 | 3300035170 | Bacteria | 4485 |
| 634 | Ga0373943_0009551 | 3300035170 | Bacteria | 4348 |
| 635 | Ga0373943_0036375 | 3300035170 | Bacteria | 2358 |
| 636 | Ga0373946_0001561 | 3300035171 | Bacteria | 7978 |
| 637 | Ga0373946_0006931 | 3300035171 | Bacteria | 4128 |
| 638 | Ga0373946_0102054 | 3300035171 | Bacteria | 1287 |
| 639 | Ga0373955_0025348 | 3300035172 | Bacteria | 3044 |
| 640 | Ga0373955_0097150 | 3300035172 | Unclassified | 1686 |
| 641 | Ga0373955_0219690 | 3300035172 | Bacteria | 1135 |
| 642 | Ga0373961_0003645 | 3300035241 | Unclassified | 3780 |
| 643 | Ga0373962_0010757 | 3300035242 | Bacteria | 2287 |
| 644 | Ga0373924_0052677 | 3300035410 | Bacteria | 1689 |
| 645 | Ga0373931_0006810 | 3300035691 | Bacteria | 5370 |
| 646 | Ga0373931_0008696 | 3300035691 | Bacteria | 4829 |
| 647 | Ga0373931_0117187 | 3300035691 | Bacteria | 1518 |
| 648 | Ga0373931_0155895 | 3300035691 | Unclassified | 1335 |
| 649 | Ga0373935_0005019 | 3300035692 | Bacteria | 7796 |
| 650 | Ga0373935_0007141 | 3300035692 | Bacteria | 6668 |
| 651 | Ga0373935_0134334 | 3300035692 | Bacteria | 1665 |
| 652 | Ga0373927_0004242 | 3300035695 | Bacteria | 10067 |
| 653 | Ga0373927_0017951 | 3300035695 | Bacteria | 4653 |
| 654 | Ga0373927_0042410 | 3300035695 | Bacteria | 2947 |
| 655 | Ga0373927_0073015 | 3300035695 | Bacteria | 2221 |
| 656 | Ga0373933_0023256 | 3300035724 | Bacteria | 3538 |
| 657 | Ga0373933_0049697 | 3300035724 | Unclassified | 2501 |
| 658 | Ga0373933_0261374 | 3300035724 | Unclassified | 1116 |
| 659 | Ga0373947_0010970 | 3300035725 | Bacteria | 5199 |
| 660 | Ga0373947_0011761 | 3300035725 | Bacteria | 5014 |
| 661 | Ga0373947_0031535 | 3300035725 | Bacteria | 3120 |
| 662 | Ga0373947_0088702 | 3300035725 | Bacteria | 1925 |
| 663 | Ga0373937_0000655 | 3300036401 | Bacteria | 30381 |
| 664 | Ga0373937_0028017 | 3300036401 | Bacteria | 5096 |
| 665 | Ga0373937_0054868 | 3300036401 | Bacteria | 3657 |
| 666 | Ga0373925_0022231 | 3300037068 | Bacteria | 4625 |
| 667 | Ga0373925_0118311 | 3300037068 | Bacteria | 2054 |
| 668 | Ga0373925_0118424 | 3300037068 | Bacteria | 2053 |
| 669 | Ga0395900_0010527 | 3300037418 | Bacteria | 9461 |
| 670 | Ga0395898_0019086 | 3300037466 | Bacteria | 6979 |
| 671 | Ga0436364_1125377 | 3300037853 | Bacteria | 21036 |
| 672 | Ga0395901_0098845 | 3300038443 | Bacteria | 3060 |
| 673 | Ga0436365_0124605 | 3300039437 | Bacteria | 3889 |
| 674 | Ga0436365_1895534 | 3300039437 | Bacteria | 1639 |
| 675 | Ga0436361_0430694 | 3300039447 | Bacteria | 4834 |
| 676 | Ga0451853_3454574 | 3300041512 | Bacteria | 3506 |
| 677 | Ga0451577_0012669 | 3300042876 | Bacteria | 7912 |
| 678 | Ga0466963_0209296 | 3300044694 | Unclassified | 1365 |
| 679 | Ga0466964_0018031 | 3300044706 | Bacteria | 2705 |
| 680 | Ga0466957_0051069 | 3300044842 | Bacteria | 2517 |
| 681 | Ga0466960_0194166 | 3300044901 | Bacteria | 1106 |
| 682 | Ga0451576_0000822 | 3300045051 | Bacteria | 60600 |
| 683 | Ga0466967_0002637 | 3300045976 | Bacteria | 11300 |
| 684 | Ga0466967_0199071 | 3300045976 | Unclassified | 1896 |
| 685 | Ga0495592_0002464 | 3300046454 | Bacteria | 13072 |
| 686 | Ga0495603_0019055 | 3300046455 | Bacteria | 4155 |
| 687 | Ga0495603_0090047 | 3300046455 | Bacteria | 1794 |
| 688 | Ga0495603_0095018 | 3300046455 | Bacteria | 1741 |
| 689 | Ga0495590_0082404 | 3300046457 | Bacteria | 1134 |
| 690 | Ga0495591_038540 | 3300046458 | Unclassified | 1375 |
| 691 | Ga0495629_0001465 | 3300046459 | Bacteria | 18592 |
| 692 | Ga0495629_0053367 | 3300046459 | Bacteria | 2828 |
| 693 | Ga0495629_0099250 | 3300046459 | Bacteria | 2032 |
| 694 | Ga0495638_0005705 | 3300046460 | Bacteria | 9168 |
| 695 | Ga0495641_0002445 | 3300046461 | Bacteria | 14659 |
| 696 | Ga0495651_0002003 | 3300046462 | Bacteria | 15754 |
| 697 | Ga0495651_0002165 | 3300046462 | Bacteria | 15211 |
| 698 | Ga0495653_0118398 | 3300046463 | Bacteria | 1891 |
| 699 | Ga0495653_0119132 | 3300046463 | Bacteria | 1885 |
| 700 | Ga0495653_0356431 | 3300046463 | Bacteria | 939 |
| 701 | Ga0495580_0006345 | 3300046472 | Bacteria | 9645 |
| 702 | Ga0495580_0023170 | 3300046472 | Bacteria | 4562 |
| 703 | Ga0495580_0093435 | 3300046472 | Bacteria | 2093 |
| 704 | Ga0495580_0157402 | 3300046472 | Bacteria | 1573 |
| 705 | Ga0495582_0001749 | 3300046473 | Bacteria | 12255 |
| 706 | Ga0495582_0108676 | 3300046473 | Bacteria | 1557 |
| 707 | Ga0495582_0208146 | 3300046473 | Unclassified | 1118 |
| 708 | Ga0495639_0014565 | 3300046475 | Bacteria | 3405 |
| 709 | Ga0495662_0055538 | 3300046476 | Unclassified | 1913 |
| 710 | Ga0495664_0000563 | 3300046477 | Bacteria | 18692 |
| 711 | Ga0495664_0003135 | 3300046477 | Bacteria | 8982 |
| 712 | Ga0495664_0017138 | 3300046477 | Bacteria | 4139 |
| 713 | Ga0495584_0009466 | 3300046491 | Bacteria | 5019 |
| 714 | Ga0495584_0062997 | 3300046491 | Bacteria | 1864 |
| 715 | Ga0495594_0009159 | 3300046499 | Bacteria | 5108 |
| 716 | Ga0495594_0017917 | 3300046499 | Bacteria | 3747 |
| 717 | Ga0495608_0000428 | 3300046511 | Bacteria | 29274 |
| 718 | Ga0495608_0008200 | 3300046511 | Bacteria | 7334 |
| 719 | Ga0495616_0015414 | 3300046513 | Bacteria | 4252 |
| 720 | Ga0495618_0006811 | 3300046514 | Bacteria | 6923 |
| 721 | Ga0495628_0019849 | 3300046516 | Bacteria | 5552 |
| 722 | Ga0495628_0064096 | 3300046516 | Bacteria | 2878 |
| 723 | Ga0495628_0160000 | 3300046516 | Bacteria | 1712 |
| 724 | Ga0495630_0012330 | 3300046517 | Bacteria | 6203 |
| 725 | Ga0495630_0027392 | 3300046517 | Bacteria | 4228 |
| 726 | Ga0495630_0159869 | 3300046517 | Bacteria | 1715 |
| 727 | Ga0495630_0515885 | 3300046517 | Bacteria | 916 |
| 728 | Ga0495666_0000400 | 3300046526 | Bacteria | 19058 |
| 729 | Ga0495652_0267034 | 3300046529 | Bacteria | 1260 |
| 730 | Ga0495652_0318004 | 3300046529 | Bacteria | 1125 |
| 731 | Ga0495640_0013977 | 3300046533 | Bacteria | 6090 |
| 732 | Ga0495640_0019186 | 3300046533 | Bacteria | 5051 |
| 733 | Ga0495587_0006341 | 3300046536 | Bacteria | 7713 |
| 734 | Ga0495587_0018948 | 3300046536 | Bacteria | 4265 |
| 735 | Ga0495598_0006601 | 3300046537 | Bacteria | 2627 |
| 736 | Ga0495645_0100626 | 3300046543 | Bacteria | 2055 |
| 737 | Ga0495622_0000406 | 3300046557 | Bacteria | 28954 |
| 738 | Ga0495633_0014925 | 3300046558 | Bacteria | 4039 |
| 739 | Ga0495633_0031919 | 3300046558 | Bacteria | 2548 |
| 740 | Ga0495667_0004194 | 3300046559 | Bacteria | 9710 |
| 741 | Ga0495656_0000661 | 3300046615 | Bacteria | 11018 |
| 742 | Ga0495656_0007374 | 3300046615 | Bacteria | 3885 |
| 743 | Ga0495668_0095410 | 3300046616 | Bacteria | 1628 |
| 744 | Ga0495634_0036732 | 3300046642 | Bacteria | 3349 |
| 745 | Ga0495611_0018537 | 3300046648 | Bacteria | 2985 |
| 746 | Ga0495635_0012606 | 3300046663 | Bacteria | 5928 |
| 747 | Ga0495635_0014382 | 3300046663 | Bacteria | 5536 |
| 748 | Ga0495588_0000318 | 3300046674 | Bacteria | 32296 |
| 749 | Ga0495657_0030733 | 3300046675 | Bacteria | 3758 |
| 750 | Ga0495599_0017299 | 3300046678 | Bacteria | 4482 |
| 751 | Ga0495599_0032734 | 3300046678 | Bacteria | 3263 |
| 752 | Ga0495623_0001886 | 3300046679 | Bacteria | 14077 |
| 753 | Ga0495646_0018816 | 3300046680 | Bacteria | 4374 |
| 754 | Ga0495646_0027257 | 3300046680 | Bacteria | 3584 |
| 755 | Ga0495647_0002144 | 3300046681 | Bacteria | 6170 |
| 756 | Ga0495647_0007416 | 3300046681 | Bacteria | 3673 |
| 757 | Ga0495647_0011789 | 3300046681 | Bacteria | 2999 |
| 758 | Ga0495647_0021133 | 3300046681 | Bacteria | 2341 |
| 759 | Ga0495658_0000237 | 3300046683 | Bacteria | 31696 |
| 760 | Ga0495658_0006930 | 3300046683 | Bacteria | 5588 |
| 761 | Ga0495658_0010307 | 3300046683 | Bacteria | 4675 |
| 762 | Ga0495669_0041658 | 3300046684 | Bacteria | 2040 |
| 763 | Ga0495669_0076310 | 3300046684 | Bacteria | 1534 |
| 764 | Ga0495669_0120930 | 3300046684 | Unclassified | 1227 |
| 765 | Ga0495613_0000793 | 3300046689 | Bacteria | 24573 |
| 766 | Ga0495613_0001097 | 3300046689 | Bacteria | 20676 |
| 767 | Ga0495613_0205306 | 3300046689 | Unclassified | 1387 |
| 768 | Ga0495624_0003149 | 3300046690 | Bacteria | 12304 |
| 769 | Ga0495624_0026092 | 3300046690 | Bacteria | 3831 |
| 770 | Ga0495624_0067797 | 3300046690 | Bacteria | 2225 |
| 771 | Ga0495670_0000558 | 3300046691 | Bacteria | 17740 |
| 772 | Ga0495600_0000453 | 3300046809 | Bacteria | 21249 |
| 773 | Ga0495600_0028346 | 3300046809 | Bacteria | 3622 |
| 774 | Ga0495581_0017498 | 3300047315 | Bacteria | 4164 |
| 775 | Ga0495581_0029185 | 3300047315 | Bacteria | 3197 |
| 776 | Ga0495581_0081328 | 3300047315 | Bacteria | 1875 |
| 777 | Ga0495604_0001023 | 3300047317 | Bacteria | 23306 |
| 778 | Ga0495604_0005688 | 3300047317 | Bacteria | 9886 |
| 779 | Ga0495604_0087533 | 3300047317 | Bacteria | 2320 |
| 780 | Ga0495604_0216708 | 3300047317 | Unclassified | 1320 |
| 781 | Ga0495674_0180597 | 3300047319 | Unclassified | 1757 |
| 782 | Ga0495674_0233078 | 3300047319 | Bacteria | 1519 |
| 783 | Ga0495674_0276738 | 3300047319 | Bacteria | 1376 |
| 784 | Ga0495672_0078932 | 3300047320 | Bacteria | 1840 |
| 785 | Ga0495672_0136388 | 3300047320 | Bacteria | 1286 |
| 786 | Ga0495676_0023292 | 3300047321 | Bacteria | 5376 |
| 787 | Ga0495676_0038413 | 3300047321 | Bacteria | 3976 |
| 788 | Ga0495676_0047669 | 3300047321 | Bacteria | 3461 |
| 789 | Ga0495680_0014392 | 3300047322 | Bacteria | 6853 |
| 790 | Ga0495680_0022162 | 3300047322 | Bacteria | 5303 |
| 791 | Ga0495680_0028274 | 3300047322 | Bacteria | 4598 |
| 792 | Ga0495680_0094090 | 3300047322 | Bacteria | 2242 |
| 793 | Ga0495675_0023707 | 3300047444 | Bacteria | 3910 |
| 794 | Ga0495677_0028641 | 3300047445 | Bacteria | 2024 |
| 795 | Ga0495679_031560 | 3300047446 | Bacteria | 1708 |
| 796 | Ga0495684_0024943 | 3300047471 | Bacteria | 4598 |
| 797 | Ga0495684_0135229 | 3300047471 | Unclassified | 1850 |
| 798 | Ga0495684_0165348 | 3300047471 | Bacteria | 1648 |
| 799 | Ga0495684_0268174 | 3300047471 | Unclassified | 1236 |
| 800 | Ga0495686_0222256 | 3300047472 | Bacteria | 1074 |
| 801 | Ga0495593_0001023 | 3300047673 | Bacteria | 16401 |
| 802 | Ga0495602_0047540 | 3300048088 | Bacteria | 3865 |
| 803 | Ga0495614_0034423 | 3300048089 | Bacteria | 2178 |
| 804 | Ga0495626_0065940 | 3300048091 | Bacteria | 1638 |
| 805 | Ga0496100_0003675 | 3300048903 | Bacteria | 8028 |
| 806 | Ga0496100_0005737 | 3300048903 | Bacteria | 6715 |
| 807 | Ga0496100_0143653 | 3300048903 | Bacteria | 1694 |
| 808 | Ga0496101_0002231 | 3300048904 | Bacteria | 11842 |
| 809 | Ga0496101_0006527 | 3300048904 | Bacteria | 7512 |
| 810 | Ga0496101_0020096 | 3300048904 | Bacteria | 4566 |
| 811 | Ga0496101_0034825 | 3300048904 | Bacteria | 3559 |
| 812 | Ga0496101_0041132 | 3300048904 | Bacteria | 3294 |
| 813 | Ga0496101_0071028 | 3300048904 | Bacteria | 2551 |
| 814 | Ga0496101_0120326 | 3300048904 | Bacteria | 1984 |
| 815 | Ga0496102_0019812 | 3300048905 | Bacteria | 5930 |
| 816 | Ga0496102_0019821 | 3300048905 | Bacteria | 5928 |
| 817 | Ga0496102_0020092 | 3300048905 | Bacteria | 5896 |
| 818 | Ga0496102_0033077 | 3300048905 | Bacteria | 4645 |
| 819 | Ga0496102_0042674 | 3300048905 | Bacteria | 4110 |
| 820 | Ga0496102_0071073 | 3300048905 | Bacteria | 3195 |
| 821 | Ga0496102_0240912 | 3300048905 | Bacteria | 1705 |
| 822 | Ga0496102_0456723 | 3300048905 | Bacteria | 1198 |
| 823 | Ga0496103_0002716 | 3300048906 | Bacteria | 11034 |
| 824 | Ga0496103_0005324 | 3300048906 | Bacteria | 7712 |
| 825 | Ga0496103_0006852 | 3300048906 | Bacteria | 6802 |
| 826 | Ga0496103_0016376 | 3300048906 | Bacteria | 4424 |
| 827 | Ga0496103_0061470 | 3300048906 | Bacteria | 2336 |
| 828 | Ga0496104_0003499 | 3300048907 | Bacteria | 13545 |
| 829 | Ga0496104_0008528 | 3300048907 | Bacteria | 9110 |
| 830 | Ga0496104_0044483 | 3300048907 | Bacteria | 4172 |
| 831 | Ga0496104_0048378 | 3300048907 | Bacteria | 4009 |
| 832 | Ga0496104_0067135 | 3300048907 | Bacteria | 3406 |
| 833 | Ga0496104_0131004 | 3300048907 | Bacteria | 2408 |
| 834 | Ga0496104_0140999 | 3300048907 | Bacteria | 2315 |
| 835 | Ga0496104_0143202 | 3300048907 | Bacteria | 2296 |
| 836 | Ga0496105_0004200 | 3300048908 | Bacteria | 10816 |
| 837 | Ga0496105_0025968 | 3300048908 | Bacteria | 4773 |
| 838 | Ga0496105_0033375 | 3300048908 | Bacteria | 4226 |
| 839 | Ga0496105_0097484 | 3300048908 | Bacteria | 2428 |
| 840 | Ga0496105_0148348 | 3300048908 | Bacteria | 1928 |
| 841 | Ga0496105_0155514 | 3300048908 | Bacteria | 1878 |
| 842 | Ga0496105_0282674 | 3300048908 | Bacteria | 1337 |
| 843 | Ga0496106_0003558 | 3300048909 | Bacteria | 11602 |
| 844 | Ga0496106_0016339 | 3300048909 | Bacteria | 5491 |
| 845 | Ga0496106_0019678 | 3300048909 | Bacteria | 5008 |
| 846 | Ga0496106_0028478 | 3300048909 | Bacteria | 4161 |
| 847 | Ga0496106_0040623 | 3300048909 | Bacteria | 3484 |
| 848 | Ga0496106_0122055 | 3300048909 | Unclassified | 2037 |
| 849 | Ga0496106_0281049 | 3300048909 | Bacteria | 1333 |
| 850 | Ga0496107_0012234 | 3300048910 | Bacteria | 5988 |
| 851 | Ga0496107_0021259 | 3300048910 | Bacteria | 4587 |
| 852 | Ga0496107_0036978 | 3300048910 | Bacteria | 3503 |
| 853 | Ga0496107_0041550 | 3300048910 | Bacteria | 3301 |
| 854 | Ga0496107_0049417 | 3300048910 | Bacteria | 3031 |
| 855 | Ga0496107_0059395 | 3300048910 | Unclassified | 2767 |
| 856 | Ga0496107_0091946 | 3300048910 | Bacteria | 2217 |
| 857 | Ga0496107_0157388 | 3300048910 | Bacteria | 1683 |
| 858 | Ga0496108_0001828 | 3300048911 | Bacteria | 17001 |
| 859 | Ga0496108_0007255 | 3300048911 | Bacteria | 8989 |
| 860 | Ga0496108_0094003 | 3300048911 | Bacteria | 2551 |
| 861 | Ga0496108_0135338 | 3300048911 | Unclassified | 2119 |
| 862 | Ga0496108_0139395 | 3300048911 | Bacteria | 2089 |
| 863 | Ga0496108_0173426 | 3300048911 | Bacteria | 1866 |
| 864 | Ga0496108_0495282 | 3300048911 | Bacteria | 1067 |
| 865 | Ga0496109_0007856 | 3300048912 | Bacteria | 9036 |
| 866 | Ga0496109_0008549 | 3300048912 | Bacteria | 8706 |
| 867 | Ga0496109_0018179 | 3300048912 | Bacteria | 6172 |
| 868 | Ga0496109_0065176 | 3300048912 | Bacteria | 3335 |
| 869 | Ga0496109_0066205 | 3300048912 | Bacteria | 3307 |
| 870 | Ga0496109_0133144 | 3300048912 | Bacteria | 2322 |
| 871 | Ga0496109_0204286 | 3300048912 | Bacteria | 1857 |
| 872 | Ga0496109_0273572 | 3300048912 | Bacteria | 1591 |
| 873 | Ga0496110_0027307 | 3300048913 | Bacteria | 4892 |
| 874 | Ga0496110_0067091 | 3300048913 | Unclassified | 3174 |
| 875 | Ga0496110_0088896 | 3300048913 | Bacteria | 2760 |
| 876 | Ga0496110_0096561 | 3300048913 | Bacteria | 2648 |
| 877 | Ga0496111_0002519 | 3300048914 | Bacteria | 11047 |
| 878 | Ga0496111_0022283 | 3300048914 | Bacteria | 4432 |
| 879 | Ga0496111_0031896 | 3300048914 | Bacteria | 3755 |
| 880 | Ga0496111_0057641 | 3300048914 | Bacteria | 2812 |
| 881 | Ga0496111_0082688 | 3300048914 | Bacteria | 2346 |
| 882 | Ga0496112_0009068 | 3300048915 | Bacteria | 8937 |
| 883 | Ga0496112_0019528 | 3300048915 | Bacteria | 6397 |
| 884 | Ga0496112_0039463 | 3300048915 | Bacteria | 4614 |
| 885 | Ga0496112_0059028 | 3300048915 | Bacteria | 3780 |
| 886 | Ga0496112_0064454 | 3300048915 | Bacteria | 3616 |
| 887 | Ga0496112_0082610 | 3300048915 | Bacteria | 3177 |
| 888 | Ga0496112_0217225 | 3300048915 | Bacteria | 1868 |
| 889 | Ga0496112_0365043 | 3300048915 | Bacteria | 1386 |
| 890 | Ga0496113_0006338 | 3300048916 | Bacteria | 7484 |
| 891 | Ga0496113_0010185 | 3300048916 | Bacteria | 6206 |
| 892 | Ga0496113_0037480 | 3300048916 | Unclassified | 3558 |
| 893 | Ga0496113_0041029 | 3300048916 | Bacteria | 3412 |
| 894 | Ga0496113_0226212 | 3300048916 | Bacteria | 1491 |
| 895 | Ga0496113_0276275 | 3300048916 | Bacteria | 1343 |
| 896 | Ga0496113_0414995 | 3300048916 | Bacteria | 1081 |
| 897 | Ga0496114_0014950 | 3300048917 | Bacteria | 6238 |
| 898 | Ga0496114_0025741 | 3300048917 | Bacteria | 4811 |
| 899 | Ga0496114_0026354 | 3300048917 | Bacteria | 4758 |
| 900 | Ga0496114_0031259 | 3300048917 | Bacteria | 4380 |
| 901 | Ga0496114_0085635 | 3300048917 | Bacteria | 2669 |
| 902 | Ga0496114_0134794 | 3300048917 | Bacteria | 2135 |
| 903 | Ga0496115_0006207 | 3300048918 | Bacteria | 8740 |
| 904 | Ga0496115_0008489 | 3300048918 | Bacteria | 7598 |
| 905 | Ga0496115_0046138 | 3300048918 | Bacteria | 3481 |
| 906 | Ga0496115_0101320 | 3300048918 | Bacteria | 2361 |
| 907 | Ga0496115_0102656 | 3300048918 | Bacteria | 2345 |
| 908 | Ga0496115_0441876 | 3300048918 | Unclassified | 1052 |
| 909 | Ga0501031_0050060 | 3300049568 | Bacteria | 2723 |
| 910 | Ga0501031_0062055 | 3300049568 | Bacteria | 2436 |
| 911 | Ga0501033_0036415 | 3300049570 | Bacteria | 3687 |
| 912 | Ga0501033_0053143 | 3300049570 | Bacteria | 3001 |
| 913 | Ga0501033_0068471 | 3300049570 | Bacteria | 2609 |
| 914 | Ga0501033_0099433 | 3300049570 | Bacteria | 2124 |
| 915 | Ga0501033_0219364 | 3300049570 | Bacteria | 1354 |
| 916 | Ga0501034_0042753 | 3300049571 | Bacteria | 4587 |
| 917 | Ga0501034_0074785 | 3300049571 | Bacteria | 3395 |
| 918 | Ga0501034_0097651 | 3300049571 | Bacteria | 2933 |
| 919 | Ga0501036_0174863 | 3300049572 | Bacteria | 1808 |
| 920 | Ga0501037_0157408 | 3300049573 | Bacteria | 1621 |
| 921 | Ga0501038_0089945 | 3300049574 | Bacteria | 2574 |
| 922 | Ga0501039_0028654 | 3300049575 | Bacteria | 4287 |
| 923 | Ga0501039_0130743 | 3300049575 | Bacteria | 1970 |
| 924 | Ga0501041_0043008 | 3300049577 | Bacteria | 2746 |
| 925 | Ga0501042_0037352 | 3300049578 | Bacteria | 3448 |
| 926 | Ga0501046_0006964 | 3300049580 | Bacteria | 9963 |
| 927 | Ga0501047_0015389 | 3300049581 | Bacteria | 7286 |
| 928 | Ga0501047_0091710 | 3300049581 | Bacteria | 2916 |
| 929 | Ga0501047_0171989 | 3300049581 | Bacteria | 2035 |
| 930 | Ga0501048_0069083 | 3300049582 | Bacteria | 2495 |
| 931 | Ga0501067_0004377 | 3300049583 | Bacteria | 7783 |
| 932 | Ga0501068_0082284 | 3300049584 | Bacteria | 1977 |
| 933 | Ga0501069_0032657 | 3300049585 | Bacteria | 2865 |
| 934 | Ga0501074_0080884 | 3300049590 | Bacteria | 2330 |
| 935 | Ga0501075_0035908 | 3300049591 | Bacteria | 3698 |
| 936 | Ga0501079_0090925 | 3300049741 | Bacteria | 2365 |
| 937 | Ga0501080_0115363 | 3300049742 | Bacteria | 2490 |
| 938 | Ga0501081_0219624 | 3300049743 | Bacteria | 1382 |
| 939 | Ga0501083_0014044 | 3300049744 | Bacteria | 5598 |
| 940 | Ga0501035_0054484 | 3300049822 | Bacteria | 3573 |
| 941 | Ga0501044_0000173 | 3300049823 | Bacteria | 79909 |
| 942 | Ga0501044_0229711 | 3300049823 | Bacteria | 1803 |
| 943 | Ga0501045_0120901 | 3300049824 | Bacteria | 1945 |
| 944 | nmdc:mga03683_61708_c1 | 3300050489 | Bacteria | 1586 |
| 945 | nmdc:mga00v17_83073_c1 | 3300050491 | Bacteria | 2003 |
| 946 | nmdc:mga0yw44_170432_c1 | 3300050492 | Bacteria | 1429 |
| 947 | nmdc:mga0yw44_6262_c1 | 3300050492 | Bacteria | 5731 |
| 948 | nmdc:mga0k408_29747_c1 | 3300050493 | Bacteria | 3111 |
| 949 | nmdc:mga0k408_67288_c1 | 3300050493 | Bacteria | 2087 |
| 950 | nmdc:mga06z11_129794_c1 | 3300050494 | Bacteria | 1414 |
| 951 | nmdc:mga05p37_157546_c1 | 3300050507 | Bacteria | 2774 |
| 952 | nmdc:mga05p37_204703_c1 | 3300050507 | Bacteria | 2388 |
| 953 | nmdc:mga05p37_302232_c1 | 3300050507 | Bacteria | 1901 |
| 954 | nmdc:mga05p37_670874_c1 | 3300050507 | Bacteria | 1157 |
| 955 | nmdc:mga05p37_69456_c1 | 3300050507 | Bacteria | 4333 |
| 956 | nmdc:mga09592_120809_c1 | 3300050508 | Bacteria | 2250 |
| 957 | nmdc:mga0qj67_288710_c1 | 3300050509 | Bacteria | 1329 |
| 958 | nmdc:mga0qj67_45862_c1 | 3300050509 | Bacteria | 3449 |
| 959 | nmdc:mga0qj67_6924_c1 | 3300050509 | Bacteria | 8346 |
| 960 | nmdc:mga0qj67_98072_c1 | 3300050509 | Bacteria | 2361 |
| 961 | nmdc:mga06r32_69686_c1 | 3300050510 | Bacteria | 3399 |
| 962 | nmdc:mga08y16_160742_c1 | 3300050511 | Bacteria | 2334 |
| 963 | nmdc:mga08y16_23656_c1 | 3300050511 | Bacteria | 6487 |
| 964 | nmdc:mga08y16_33457_c1 | 3300050511 | Bacteria | 5399 |
| 965 | nmdc:mga08y16_428577_c1 | 3300050511 | Bacteria | 1351 |
| 966 | nmdc:mga08y16_53521_c1 | 3300050511 | Bacteria | 4220 |
| 967 | nmdc:mga0n895_10980_c1 | 3300050512 | Bacteria | 8050 |
| 968 | nmdc:mga0n895_14260_c1 | 3300050512 | Bacteria | 7212 |
| 969 | nmdc:mga0n895_211403_c1 | 3300050512 | Unclassified | 1970 |
| 970 | nmdc:mga0n895_63475_c1 | 3300050512 | Bacteria | 3653 |
| 971 | nmdc:mga0n895_850525_c1 | 3300050512 | Bacteria | 900 |
| 972 | nmdc:mga0n895_86_c1 | 3300050512 | Bacteria | 53794 |
| 973 | nmdc:mga0rr50_210677_c1 | 3300050513 | Unclassified | 1601 |
| 974 | nmdc:mga0rr50_3472_c1 | 3300050513 | Bacteria | 9077 |
| 975 | nmdc:mga0rr50_382571_c1 | 3300050513 | Bacteria | 1187 |
| 976 | nmdc:mga0rr50_664_c1 | 3300050513 | Bacteria | 18446 |
| 977 | nmdc:mga0rr50_740_c1 | 3300050513 | Bacteria | 17608 |
| 978 | nmdc:mga0rr50_79065_c1 | 3300050513 | Bacteria | 2532 |
| 979 | nmdc:mga08x19_1310_c1 | 3300050514 | Bacteria | 15454 |
| 980 | nmdc:mga08x19_183953_c1 | 3300050514 | Bacteria | 1427 |
| 981 | nmdc:mga08x19_32895_c1 | 3300050514 | Bacteria | 3271 |
| 982 | nmdc:mga0a205_1448_c1 | 3300050515 | Bacteria | 20218 |
| 983 | nmdc:mga0a205_23839_c1 | 3300050515 | Bacteria | 2001 |
| 984 | nmdc:mga0a205_31489_c1 | 3300050515 | Bacteria | 5081 |
| 985 | nmdc:mga0a205_55341_c1 | 3300050515 | Bacteria | 3832 |
| 986 | nmdc:mga0a205_8069_c1 | 3300050515 | Bacteria | 9573 |
| 987 | Ga0495601_0030200 | 3300053077 | Bacteria | 3364 |
| 988 | Ga0495612_0002701 | 3300053078 | Bacteria | 7332 |
| 989 | Ga0495612_0028807 | 3300053078 | Bacteria | 2236 |
| 990 | Ga0495612_0036716 | 3300053078 | Bacteria | 1988 |
| 991 | Ga0495655_0004315 | 3300053083 | Bacteria | 2421 |
| 992 | Ga0495655_0022022 | 3300053083 | Bacteria | 1450 |
| 993 | Ga0495595_0000574 | 3300053084 | Bacteria | 14080 |
| 994 | Ga0495595_0001515 | 3300053084 | Bacteria | 9079 |
| 995 | Ga0495595_0002744 | 3300053084 | Bacteria | 6914 |
| 996 | Ga0495619_0000045 | 3300053085 | Bacteria | 108543 |
| 997 | Ga0495619_0000484 | 3300053085 | Bacteria | 26647 |
| 998 | Ga0495619_0010412 | 3300053085 | Bacteria | 5851 |
| 999 | Ga0495619_0026207 | 3300053085 | Bacteria | 3749 |
| 1000 | Ga0495619_0032329 | 3300053085 | Bacteria | 3394 |
| 1001 | Ga0495619_0090687 | 3300053085 | Unclassified | 2069 |
| 1002 | Ga0500566_0004523 | 3300053094 | Bacteria | 8304 |
| 1003 | Ga0500641_0003963 | 3300053096 | Bacteria | 5235 |
| 1004 | Ga0500554_001737 | 3300053102 | Bacteria | 4199 |
| 1005 | Ga0500593_006659 | 3300053117 | Bacteria | 4637 |
| 1006 | Ga0500595_001694 | 3300053119 | Bacteria | 11554 |
| 1007 | Ga0500577_0054240 | 3300053142 | Bacteria | 1518 |
| 1008 | Ga0500603_006016 | 3300053150 | Bacteria | 2628 |
| 1009 | Ga0500616_0053185 | 3300053153 | Bacteria | 2126 |
| 1010 | Ga0500638_032029 | 3300053162 | Bacteria | 2537 |
| 1011 | Ga0500639_059717 | 3300053163 | Bacteria | 1968 |
| 1012 | Ga0500637_0000263 | 3300053178 | Bacteria | 19691 |
| 1013 | Ga0070667_100332522 | |||
| 1014 | JGI24746J21847_1001454 | |||
| 1015 | JGI24739J22299_10002355 | |||
| 1016 | JGI24737J22298_10005173 | |||
| 1017 | JGI24743J22301_10000279 | |||
| 1018 | JGI24738J21930_10002285 | |||
| 1019 | JGI24749J21850_1000800 | |||
| 1020 | JGI24749J21850_1003432 | |||
| 1021 | JGI24744J21845_10003450 | |||
| 1022 | JGI24034J26672_10000501 | |||
| 1023 | JGI24742J22300_10000285 | |||
| 1024 | JGI24742J22300_10000731 | |||
| 1025 | JGI24751J29686_10002085 | |||
| 1026 | JGI25406J46586_10039898 | |||
| 1027 | Ga0065712_10087858 | |||
| 1028 | Ga0065707_10105003 | |||
| 1029 | Ga0070658_10066646 | |||
| 1030 | Ga0070676_10014663 | |||
| 1031 | Ga0070683_100010349 | |||
| 1032 | Ga0070683_100127360 | |||
| 1033 | Ga0070690_100000235 | |||
| 1034 | Ga0070690_100004036 | |||
| 1035 | Ga0070690_100006864 | |||
| 1036 | Ga0070690_100075479 | |||
| 1037 | Ga0070670_100013045 | |||
| 1038 | Ga0070670_100081348 | |||
| 1039 | Ga0070670_100083494 | |||
| 1040 | Ga0070670_100139759 | |||
| 1041 | Ga0070670_100501100 | |||
| 1042 | Ga0070677_10000940 | |||
| 1043 | Ga0068869_100000629 | |||
| 1044 | Ga0068869_100289764 | |||
| 1045 | Ga0070666_10012126 | |||
| 1046 | Ga0070666_10012842 | |||
| 1047 | Ga0070680_100001167 | |||
| 1048 | Ga0070680_100013671 | |||
| 1049 | Ga0070680_100078608 | |||
| 1050 | Ga0070680_100082086 | |||
| 1051 | Ga0070680_100134955 | |||
| 1052 | Ga0070682_100002926 | |||
| 1053 | Ga0070682_100003053 | |||
| 1054 | Ga0070682_100013021 | |||
| 1055 | Ga0070682_100014773 | |||
| 1056 | Ga0068868_100003444 | |||
| 1057 | Ga0068868_100006182 | |||
| 1058 | Ga0068868_100176490 | |||
| 1059 | Ga0070660_100268830 | |||
| 1060 | Ga0070660_100379117 | |||
| 1061 | Ga0070689_100000188 | |||
| 1062 | Ga0070689_100001782 | |||
| 1063 | Ga0070689_100019391 | |||
| 1064 | Ga0070689_100019765 | |||
| 1065 | Ga0070689_100068707 | |||
| 1066 | Ga0070689_100084840 | |||
| 1067 | Ga0070689_100169166 | |||
| 1068 | Ga0070691_10001176 | |||
| 1069 | Ga0070691_10004002 | |||
| 1070 | Ga0070687_100000069 | |||
| 1071 | Ga0070687_100062271 | |||
| 1072 | Ga0070687_100130224 | |||
| 1073 | Ga0070661_100023192 | |||
| 1074 | Ga0070661_100049805 | |||
| 1075 | Ga0070661_100105805 | |||
| 1076 | Ga0070692_10001429 | |||
| 1077 | Ga0070692_10006313 | |||
| 1078 | Ga0070692_10030102 | |||
| 1079 | Ga0070668_100032033 | |||
| 1080 | Ga0070669_100006075 | |||
| 1081 | Ga0070669_100010102 | |||
| 1082 | Ga0070669_100115916 | |||
| 1083 | Ga0070669_100208680 | |||
| 1084 | Ga0070675_100010884 | |||
| 1085 | Ga0070675_100014476 | |||
| 1086 | Ga0070675_100180260 | |||
| 1087 | Ga0070671_100001554 | |||
| 1088 | Ga0070671_100005261 | |||
| 1089 | Ga0070671_100013065 | |||
| 1090 | Ga0070671_100018682 | |||
| 1091 | Ga0070671_100227984 | |||
| 1092 | Ga0070674_100012344 | |||
| 1093 | Ga0070674_100047974 | |||
| 1094 | Ga0070674_100062574 | |||
| 1095 | Ga0070674_100079402 | |||
| 1096 | Ga0070673_100029758 | |||
| 1097 | Ga0070673_100043853 | |||
| 1098 | Ga0070673_100056615 | |||
| 1099 | Ga0070673_100171311 | |||
| 1100 | Ga0070673_100256335 | |||
| 1101 | Ga0070688_100000518 | |||
| 1102 | Ga0070688_100013493 | |||
| 1103 | Ga0070659_100001996 | |||
| 1104 | Ga0070659_100014760 | |||
| 1105 | Ga0070667_100009832 | |||
| 1106 | Ga0070667_100017349 | |||
| 1107 | Ga0070667_100361981 | |||
| 1108 | Ga0070703_10009245 | |||
| 1109 | Ga0070709_10005005 | |||
| 1110 | Ga0070714_100025390 | |||
| 1111 | Ga0070714_100048803 | |||
| 1112 | Ga0070713_100004683 | |||
| 1113 | Ga0070713_100005212 | |||
| 1114 | Ga0070713_100012790 | |||
| 1115 | Ga0070713_100086923 | |||
| 1116 | Ga0070713_100176838 | |||
| 1117 | Ga0070710_10002248 | |||
| 1118 | Ga0070710_10025506 | |||
| 1119 | Ga0070710_10245413 | |||
| 1120 | Ga0070701_10000142 | |||
| 1121 | Ga0070701_10000603 | |||
| 1122 | Ga0070701_10048521 | |||
| 1123 | Ga0070701_10095759 | |||
| 1124 | Ga0070711_100031939 | |||
| 1125 | Ga0070711_100045830 | |||
| 1126 | Ga0070711_100250167 | |||
| 1127 | Ga0070705_100001149 | |||
| 1128 | Ga0070705_100004550 | |||
| 1129 | Ga0070705_100051420 | |||
| 1130 | Ga0070700_100001129 | |||
| 1131 | Ga0070700_100008783 | |||
| 1132 | Ga0070694_100111339 | |||
| 1133 | Ga0070708_100077012 | |||
| 1134 | Ga0070708_100111072 | |||
| 1135 | Ga0070663_100167391 | |||
| 1136 | Ga0070678_100004056 | |||
| 1137 | Ga0070678_100067528 | |||
| 1138 | Ga0070678_100157223 | |||
| 1139 | Ga0070678_100234125 | |||
| 1140 | Ga0070678_100291110 | |||
| 1141 | Ga0070662_100092393 | |||
| 1142 | Ga0070662_100101095 | |||
| 1143 | Ga0070681_10000688 | |||
| 1144 | Ga0070681_10021720 | |||
| 1145 | Ga0070681_10058690 | |||
| 1146 | Ga0070681_10071117 | |||
| 1147 | Ga0070681_10199381 | |||
| 1148 | Ga0068867_100000296 | |||
| 1149 | Ga0068867_100008754 | |||
| 1150 | Ga0068867_100009922 | |||
| 1151 | Ga0068867_100048435 | |||
| 1152 | Ga0068867_100264046 | |||
| 1153 | Ga0070685_10001300 | |||
| 1154 | Ga0070685_10002735 | |||
| 1155 | Ga0070707_100249502 | |||
| 1156 | Ga0070699_100011236 | |||
| 1157 | Ga0070699_100034931 | |||
| 1158 | Ga0070679_100040411 | |||
| 1159 | Ga0070679_100059353 | |||
| 1160 | Ga0070679_100085012 | |||
| 1161 | Ga0070684_100011160 | |||
| 1162 | Ga0070684_100065689 | |||
| 1163 | Ga0070684_100207309 | |||
| 1164 | Ga0070697_100031782 | |||
| 1165 | Ga0070697_100038388 | |||
| 1166 | Ga0070697_100088797 | |||
| 1167 | Ga0070697_100172720 | |||
| 1168 | Ga0068853_100029841 | |||
| 1169 | Ga0070672_100003208 | |||
| 1170 | Ga0070686_100000090 | |||
| 1171 | Ga0070686_100001797 | |||
| 1172 | Ga0070686_100003371 | |||
| 1173 | Ga0070686_100005651 | |||
| 1174 | Ga0070686_100183848 | |||
| 1175 | Ga0070695_100004621 | |||
| 1176 | Ga0070695_100050402 | |||
| 1177 | Ga0070695_100103084 | |||
| 1178 | Ga0070696_100000719 | |||
| 1179 | Ga0070696_100002632 | |||
| 1180 | Ga0070693_100000525 | |||
| 1181 | Ga0070693_100027503 | |||
| 1182 | Ga0070665_100004366 | |||
| 1183 | Ga0070665_100178977 | |||
| 1184 | Ga0070665_100215084 | |||
| 1185 | Ga0070665_100238168 | |||
| 1186 | Ga0070665_100526485 | |||
| 1187 | Ga0070704_100000168 | |||
| 1188 | Ga0070704_100008425 | |||
| 1189 | Ga0070704_100135656 | |||
| 1190 | Ga0070704_100160863 | |||
| 1191 | Ga0068855_100000833 | |||
| 1192 | Ga0068855_100037836 | |||
| 1193 | Ga0068855_100039748 | |||
| 1194 | Ga0070664_100006958 | |||
| 1195 | Ga0070664_100021837 | |||
| 1196 | Ga0070664_100071588 | |||
| 1197 | Ga0070664_100503293 | |||
| 1198 | Ga0068857_100000715 | |||
| 1199 | Ga0068857_100487283 | |||
| 1200 | Ga0068854_100000657 | |||
| 1201 | Ga0068854_100005118 | |||
| 1202 | Ga0068854_100020739 | |||
| 1203 | Ga0068856_100003103 | |||
| 1204 | Ga0068856_100045035 | |||
| 1205 | Ga0068856_100071466 | |||
| 1206 | Ga0068856_100130262 | |||
| 1207 | Ga0068856_100231558 | |||
| 1208 | Ga0070702_100000002 | |||
| 1209 | Ga0070702_100004841 | |||
| 1210 | Ga0070702_100038455 | |||
| 1211 | Ga0070702_100166682 | |||
| 1212 | Ga0068852_100006185 | |||
| 1213 | Ga0068852_100048049 | |||
| 1214 | Ga0068852_100205984 | |||
| 1215 | Ga0068859_100000195 | |||
| 1216 | Ga0068859_100014349 | |||
| 1217 | Ga0068859_100254846 | |||
| 1218 | Ga0068864_100006237 | |||
| 1219 | Ga0068864_100006919 | |||
| 1220 | Ga0068864_100057324 | |||
| 1221 | Ga0068866_10001095 | |||
| 1222 | Ga0068866_10015715 | |||
| 1223 | Ga0068861_100000043 | |||
| 1224 | Ga0068861_100010394 | |||
| 1225 | Ga0068861_100182339 | |||
| 1226 | Ga0068870_10000073 | |||
| 1227 | Ga0068870_10032369 | |||
| 1228 | Ga0068863_100021006 | |||
| 1229 | Ga0068863_100032749 | |||
| 1230 | Ga0068863_100359868 | |||
| 1231 | Ga0068858_100005138 | |||
| 1232 | Ga0068858_100033913 | |||
| 1233 | Ga0068858_100041152 | |||
| 1234 | Ga0068860_100002559 | |||
| 1235 | Ga0068860_100019005 | |||
| 1236 | Ga0068860_100053202 | |||
| 1237 | Ga0068860_100207386 | |||
| 1238 | Ga0068860_100413103 | |||
| 1239 | Ga0068860_100464273 | |||
| 1240 | Ga0068862_100013767 | |||
| 1241 | Ga0068862_100016944 | |||
| 1242 | Ga0068862_100020336 | |||
| 1243 | Ga0081455_10000048 | |||
| 1244 | Ga0081455_10009739 | |||
| 1245 | Ga0081455_10014368 | |||
| 1246 | Ga0081455_10111300 | |||
| 1247 | Ga0081538_10041314 | |||
| 1248 | Ga0081540_1000282 | |||
| 1249 | Ga0081540_1005411 | |||
| 1250 | Ga0081540_1095518 | |||
| 1251 | Ga0081539_10000233 | |||
| 1252 | Ga0081539_10017035 | |||
| 1253 | Ga0070717_10007633 | |||
| 1254 | Ga0070717_10100107 | |||
| 1255 | Ga0075365_10019452 | |||
| 1256 | Ga0075365_10022809 | |||
| 1257 | Ga0070715_10004215 | |||
| 1258 | Ga0070715_10032230 | |||
| 1259 | Ga0070715_10069673 | |||
| 1260 | Ga0070716_100001791 | |||
| 1261 | Ga0070716_100104875 | |||
| 1262 | Ga0070712_100013910 | |||
| 1263 | Ga0070712_100076460 | |||
| 1264 | Ga0070712_100157181 | |||
| 1265 | Ga0075362_10096558 | |||
| 1266 | Ga0075367_10037700 | |||
| 1267 | Ga0075367_10086588 | |||
| 1268 | Ga0075369_10029300 | |||
| 1269 | Ga0097621_100002618 | |||
| 1270 | Ga0097621_100019693 | |||
| 1271 | Ga0097621_100021417 | |||
| 1272 | Ga0097621_100319335 | |||
| 1273 | Ga0075370_10085558 | |||
| 1274 | Ga0068871_100000040 | |||
| 1275 | Ga0068871_100024067 | |||
| 1276 | Ga0068871_100026506 | |||
| 1277 | Ga0068871_100072279 | |||
| 1278 | Ga0075428_100269981 | |||
| 1279 | Ga0075428_100443647 | |||
| 1280 | Ga0075430_100019382 | |||
| 1281 | Ga0075430_100112622 | |||
| 1282 | Ga0075431_100078929 | |||
| 1283 | Ga0075433_10037623 | |||
| 1284 | Ga0075433_10066445 | |||
| 1285 | Ga0075433_10149539 | |||
| 1286 | Ga0075434_100000006 | |||
| 1287 | Ga0075434_100000554 | |||
| 1288 | Ga0075434_100009283 | |||
| 1289 | Ga0075434_100037538 | |||
| 1290 | Ga0075434_100058798 | |||
| 1291 | Ga0075429_100031900 | |||
| 1292 | Ga0075429_100036481 | |||
| 1293 | Ga0068865_100006295 | |||
| 1294 | Ga0068865_100041108 | |||
| 1295 | Ga0075436_100000174 | |||
| 1296 | Ga0075436_100012987 | |||
| 1297 | Ga0075436_100030588 | |||
| 1298 | Ga0075436_100286672 | |||
| 1299 | Ga0097620_100000195 | |||
| 1300 | Ga0097620_100014349 | |||
| 1301 | Ga0097620_100254841 | |||
| 1302 | Ga0075435_100001000 | |||
| 1303 | Ga0075435_100006264 | |||
| 1304 | Ga0075435_100015067 | |||
| 1305 | Ga0075435_100081550 | |||
| 1306 | Ga0075435_100245323 | |||
| 1307 | Ga0099794_10011097 | |||
| 1308 | Ga0099795_10072793 | |||
| 1309 | Ga0105251_10006368 | |||
| 1310 | Ga0105250_10084818 | |||
| 1311 | Ga0105240_10657004 | |||
| 1312 | Ga0111539_10036658 | |||
| 1313 | Ga0111539_10064158 | |||
| 1314 | Ga0111539_10137730 | |||
| 1315 | Ga0111539_10172965 | |||
| 1316 | Ga0111539_10429434 | |||
| 1317 | Ga0111539_10462377 | |||
| 1318 | Ga0105245_10008500 | |||
| 1319 | Ga0105245_10009922 | |||
| 1320 | Ga0105245_10125792 | |||
| 1321 | Ga0105245_10154565 | |||
| 1322 | Ga0105245_10245765 | |||
| 1323 | Ga0105247_10054860 | |||
| 1324 | Ga0105247_10063271 | |||
| 1325 | Ga0114129_10155536 | |||
| 1326 | Ga0114129_10279410 | |||
| 1327 | Ga0114129_10536133 | |||
| 1328 | Ga0114129_10546916 | |||
| 1329 | Ga0105243_10000035 | |||
| 1330 | Ga0105243_10002936 | |||
| 1331 | Ga0105243_10020666 | |||
| 1332 | Ga0105243_10024008 | |||
| 1333 | Ga0105243_10107421 | |||
| 1334 | Ga0105241_10006170 | |||
| 1335 | Ga0105241_10080124 | |||
| 1336 | Ga0105242_10001935 | |||
| 1337 | Ga0105242_10002145 | |||
| 1338 | Ga0105242_10036794 | |||
| 1339 | Ga0105242_10302215 | |||
| 1340 | Ga0105248_10004376 | |||
| 1341 | Ga0105248_10006012 | |||
| 1342 | Ga0105248_10036378 | |||
| 1343 | Ga0105248_10085076 | |||
| 1344 | Ga0105237_10040741 | |||
| 1345 | Ga0105237_10060786 | |||
| 1346 | Ga0105237_10177871 | |||
| 1347 | Ga0105238_10059058 | |||
| 1348 | Ga0105249_10004810 | |||
| 1349 | Ga0105249_10019086 | |||
| 1350 | Ga0105249_10148881 | |||
| 1351 | Ga0105249_10387756 | |||
| 1352 | Ga0105249_10482476 | |||
| 1353 | Ga0105239_10017272 | |||
| 1354 | Ga0105239_10170414 | |||
| 1355 | Ga0105246_10001697 | |||
| 1356 | Ga0105246_10019691 | |||
| 1357 | Ga0105246_10112956 | |||
| 1358 | Ga0105246_10365658 | |||
| 1359 | Ga0157373_10110891 | |||
| 1360 | Ga0157369_10249435 | |||
| 1361 | Ga0157374_10005071 | |||
| 1362 | Ga0157374_10021058 | |||
| 1363 | Ga0157374_10048947 | |||
| 1364 | Ga0157374_10122968 | |||
| 1365 | Ga0157378_10001996 | |||
| 1366 | Ga0157378_10004058 | |||
| 1367 | Ga0157378_10004134 | |||
| 1368 | Ga0163162_10024841 | |||
| 1369 | Ga0163162_10044461 | |||
| 1370 | Ga0163162_10344836 | |||
| 1371 | Ga0157372_10138483 | |||
| 1372 | Ga0157372_10550620 | |||
| 1373 | Ga0157375_10217463 | |||
| 1374 | Ga0157375_10307770 | |||
| 1375 | Ga0163163_10002390 | |||
| 1376 | Ga0163163_10015764 | |||
| 1377 | Ga0163163_10051069 | |||
| 1378 | Ga0163163_10322637 | |||
| 1379 | Ga0163163_10335264 | |||
| 1380 | Ga0163163_10418214 | |||
| 1381 | Ga0157380_10037273 | |||
| 1382 | Ga0157380_10039831 | |||
| 1383 | Ga0157380_10191070 | |||
| 1384 | Ga0157377_10009511 | |||
| 1385 | Ga0157377_10017489 | |||
| 1386 | Ga0157377_10029278 | |||
| 1387 | Ga0157379_10016149 | |||
| 1388 | Ga0157379_10026672 | |||
| 1389 | Ga0157376_10000403 | |||
| 1390 | Ga0157376_10041561 | |||
| 1391 | Ga0157376_10043024 | |||
| 1392 | Ga0157376_10091968 | |||
| 1393 | Ga0163161_10005378 | |||
| 1394 | Ga0163161_10023098 | |||
| 1395 | Ga0163161_10059915 | |||
| 1396 | Ga0163161_10189495 | |||
| 1397 | Ga0213876_10052786 | |||
| 1398 | Ga0213876_10070535 | |||
| 1399 | Ga0213875_10000067 | |||
| 1400 | Ga0207666_1000154 | |||
| 1401 | Ga0207673_1000507 | |||
| 1402 | Ga0209758_1000274 | |||
| 1403 | Ga0207697_10000024 | |||
| 1404 | Ga0207656_10012299 | |||
| 1405 | Ga0207653_10006002 | |||
| 1406 | Ga0207653_10079562 | |||
| 1407 | Ga0207682_10000708 | |||
| 1408 | Ga0207682_10032204 | |||
| 1409 | Ga0207692_10001001 | |||
| 1410 | Ga0207642_10001465 | |||
| 1411 | Ga0207710_10000382 | |||
| 1412 | Ga0207710_10031356 | |||
| 1413 | Ga0207688_10000275 | |||
| 1414 | Ga0207688_10001362 | |||
| 1415 | Ga0207688_10048405 | |||
| 1416 | Ga0207680_10005838 | |||
| 1417 | Ga0207680_10010069 | |||
| 1418 | Ga0207647_10000612 | |||
| 1419 | Ga0207685_10001765 | |||
| 1420 | Ga0207685_10014555 | |||
| 1421 | Ga0207699_10002836 | |||
| 1422 | Ga0207699_10101095 | |||
| 1423 | Ga0207645_10000507 | |||
| 1424 | Ga0207645_10044250 | |||
| 1425 | Ga0207645_10050204 | |||
| 1426 | Ga0207645_10067622 | |||
| 1427 | Ga0207643_10000568 | |||
| 1428 | Ga0207643_10002081 | |||
| 1429 | Ga0207643_10032068 | |||
| 1430 | Ga0207643_10081608 | |||
| 1431 | Ga0207705_10053294 | |||
| 1432 | Ga0207705_10234931 | |||
| 1433 | Ga0207654_10021158 | |||
| 1434 | Ga0207707_10004169 | |||
| 1435 | Ga0207707_10019399 | |||
| 1436 | Ga0207707_10050919 | |||
| 1437 | Ga0207671_10025782 | |||
| 1438 | Ga0207693_10001038 | |||
| 1439 | Ga0207693_10079340 | |||
| 1440 | Ga0207693_10085910 | |||
| 1441 | Ga0207693_10216830 | |||
| 1442 | Ga0207693_10251160 | |||
| 1443 | Ga0207663_10014896 | |||
| 1444 | Ga0207663_10069352 | |||
| 1445 | Ga0207663_10087083 | |||
| 1446 | Ga0207660_10013054 | |||
| 1447 | Ga0207660_10014844 | |||
| 1448 | Ga0207660_10098275 | |||
| 1449 | Ga0207660_10116786 | |||
| 1450 | Ga0207660_10147197 | |||
| 1451 | Ga0207660_10233808 | |||
| 1452 | Ga0207662_10000006 | |||
| 1453 | Ga0207662_10000180 | |||
| 1454 | Ga0207662_10008191 | |||
| 1455 | Ga0207657_10007922 | |||
| 1456 | Ga0207657_10054706 | |||
| 1457 | Ga0207657_10055391 | |||
| 1458 | Ga0207649_10014224 | |||
| 1459 | Ga0207649_10082214 | |||
| 1460 | Ga0207649_10229671 | |||
| 1461 | Ga0207652_10028309 | |||
| 1462 | Ga0207646_10209542 | |||
| 1463 | Ga0207681_10002030 | |||
| 1464 | Ga0207681_10086586 | |||
| 1465 | Ga0207681_10255113 | |||
| 1466 | Ga0207681_10271949 | |||
| 1467 | Ga0207650_10006571 | |||
| 1468 | Ga0207650_10048838 | |||
| 1469 | Ga0207650_10061845 | |||
| 1470 | Ga0207650_10063076 | |||
| 1471 | Ga0207659_10002151 | |||
| 1472 | Ga0207659_10021087 | |||
| 1473 | Ga0207687_10002607 | |||
| 1474 | Ga0207687_10202396 | |||
| 1475 | Ga0207700_10019191 | |||
| 1476 | Ga0207700_10049928 | |||
| 1477 | Ga0207700_10174121 | |||
| 1478 | Ga0207700_10225312 | |||
| 1479 | Ga0207700_10228292 | |||
| 1480 | Ga0207664_10016403 | |||
| 1481 | Ga0207664_10029863 | |||
| 1482 | Ga0207664_10363131 | |||
| 1483 | Ga0207644_10007818 | |||
| 1484 | Ga0207644_10022652 | |||
| 1485 | Ga0207686_10003280 | |||
| 1486 | Ga0207686_10044349 | |||
| 1487 | Ga0207686_10105479 | |||
| 1488 | Ga0207709_10001302 | |||
| 1489 | Ga0207709_10004543 | |||
| 1490 | Ga0207709_10010356 | |||
| 1491 | Ga0207709_10011063 | |||
| 1492 | Ga0207709_10138093 | |||
| 1493 | Ga0207670_10001377 | |||
| 1494 | Ga0207670_10011557 | |||
| 1495 | Ga0207670_10078840 | |||
| 1496 | Ga0207670_10090481 | |||
| 1497 | Ga0207670_10112000 | |||
| 1498 | Ga0207670_10151403 | |||
| 1499 | Ga0207670_10210360 | |||
| 1500 | Ga0207669_10000408 | |||
| 1501 | Ga0207669_10072895 | |||
| 1502 | Ga0207704_10002368 | |||
| 1503 | Ga0207704_10008627 | |||
| 1504 | Ga0207704_10044170 | |||
| 1505 | Ga0207704_10077740 | |||
| 1506 | Ga0207665_10001067 | |||
| 1507 | Ga0207665_10003994 | |||
| 1508 | Ga0207665_10057692 | |||
| 1509 | Ga0207665_10088912 | |||
| 1510 | Ga0207691_10003119 | |||
| 1511 | Ga0207691_10331807 | |||
| 1512 | Ga0207691_10334059 | |||
| 1513 | Ga0207711_10004559 | |||
| 1514 | Ga0207711_10006069 | |||
| 1515 | Ga0207711_10014575 | |||
| 1516 | Ga0207711_10022668 | |||
| 1517 | Ga0207711_10145105 | |||
| 1518 | Ga0207689_10000082 | |||
| 1519 | Ga0207689_10000332 | |||
| 1520 | Ga0207689_10033746 | |||
| 1521 | Ga0207689_10195992 | |||
| 1522 | Ga0207661_10003166 | |||
| 1523 | Ga0207679_10001592 | |||
| 1524 | Ga0207679_10054349 | |||
| 1525 | Ga0207679_10379996 | |||
| 1526 | Ga0207679_10420411 | |||
| 1527 | Ga0207667_10087026 | |||
| 1528 | Ga0207667_10101374 | |||
| 1529 | Ga0207651_10004753 | |||
| 1530 | Ga0207651_10054962 | |||
| 1531 | Ga0207651_10221266 | |||
| 1532 | Ga0207712_10001343 | |||
| 1533 | Ga0207712_10012089 | |||
| 1534 | Ga0207668_10023743 | |||
| 1535 | Ga0207668_10027920 | |||
| 1536 | Ga0207640_10002417 | |||
| 1537 | Ga0207640_10045385 | |||
| 1538 | Ga0207658_10004726 | |||
| 1539 | Ga0207658_10016503 | |||
| 1540 | Ga0207658_10174417 | |||
| 1541 | Ga0207677_10002853 | |||
| 1542 | Ga0207677_10004878 | |||
| 1543 | Ga0207703_10005585 | |||
| 1544 | Ga0207703_10006036 | |||
| 1545 | Ga0207703_10015837 | |||
| 1546 | Ga0207703_10040924 | |||
| 1547 | Ga0207639_10009264 | |||
| 1548 | Ga0207639_10202500 | |||
| 1549 | Ga0207639_10227142 | |||
| 1550 | Ga0207678_10000216 | |||
| 1551 | Ga0207678_10012430 | |||
| 1552 | Ga0207678_10012502 | |||
| 1553 | Ga0207678_10049557 | |||
| 1554 | Ga0207708_10000936 | |||
| 1555 | Ga0207708_10005888 | |||
| 1556 | Ga0207708_10012141 | |||
| 1557 | Ga0207708_10033019 | |||
| 1558 | Ga0207702_10013898 | |||
| 1559 | Ga0207702_10039756 | |||
| 1560 | Ga0207702_10137572 | |||
| 1561 | Ga0207702_10568422 | |||
| 1562 | Ga0207641_10046962 | |||
| 1563 | Ga0207641_10064350 | |||
| 1564 | Ga0207648_10000316 | |||
| 1565 | Ga0207648_10003365 | |||
| 1566 | Ga0207648_10006843 | |||
| 1567 | Ga0207648_10007668 | |||
| 1568 | Ga0207648_10152119 | |||
| 1569 | Ga0207676_10011932 | |||
| 1570 | Ga0207676_10027419 | |||
| 1571 | Ga0207676_10028159 | |||
| 1572 | Ga0207676_10093450 | |||
| 1573 | Ga0207674_10003382 | |||
| 1574 | Ga0207675_100000064 | |||
| 1575 | Ga0207675_100004008 | |||
| 1576 | Ga0207675_100004550 | |||
| 1577 | Ga0207675_100011531 | |||
| 1578 | Ga0207675_100153637 | |||
| 1579 | Ga0207683_10000293 | |||
| 1580 | Ga0207683_10010609 | |||
| 1581 | Ga0207683_10020006 | |||
| 1582 | Ga0207683_10053516 | |||
| 1583 | Ga0207683_10076226 | |||
| 1584 | Ga0207698_10011482 | |||
| 1585 | Ga0207698_10022751 | |||
| 1586 | Ga0207698_10065097 | |||
| 1587 | Ga0209998_10001967 | |||
| 1588 | Ga0209974_10003644 | |||
| 1589 | Ga0207428_10001592 | |||
| 1590 | Ga0268266_10003041 | |||
| 1591 | Ga0268266_10099788 | |||
| 1592 | Ga0268266_10287846 | |||
| 1593 | Ga0268265_10004268 | |||
| 1594 | Ga0268265_10011670 | |||
| 1595 | Ga0268265_10036013 | |||
| 1596 | Ga0268265_10079802 | |||
| 1597 | Ga0268264_10003570 | |||
| 1598 | Ga0268264_10008485 | |||
| 1599 | Ga0268264_10051709 | |||
| 1600 | Ga0265332_10002624 | |||
| 1601 | Ga0265325_10000339 | |||
| 1602 | Ga0265325_10001832 | |||
| 1603 | Ga0265340_10001806 | |||
| 1604 | Ga0265339_10009221 | |||
| 1605 | Ga0265339_10114210 | |||
| 1606 | Ga0265331_10015974 | |||
| 1607 | Ga0265331_10054922 | |||
| 1608 | Ga0307513_10304361 | |||
| 1609 | Ga0265313_10056362 | |||
| 1610 | Ga0265314_10011592 | |||
| 1611 | Ga0265342_10000011 | |||
| 1612 | Ga0307416_100060311 | |||
| 1613 | Ga0307416_100121848 | |||
| 1614 | Ga0307416_100503641 | |||
| 1615 | Ga0307416_100909833 | |||
| 1616 | Ga0373930_0007487 | |||
| 1617 | Ga0373938_0027965 | |||
| 1618 | Ga0373926_0077545 | |||
| 1619 | Ga0373928_0002816 | |||
| 1620 | Ga0373929_0002823 | |||
| 1621 | Ga0373934_0012402 | |||
| 1622 | Ga0373944_0000780 | |||
| 1623 | Ga0373944_0046225 | |||
| 1624 | Ga0373949_0014990 | |||
| 1625 | Ga0373949_0066341 | |||
| 1626 | Ga0373952_0021169 | |||
| 1627 | Ga0373923_0000279 | |||
| 1628 | Ga0373923_0070040 | |||
| 1629 | Ga0373932_0002369 | |||
| 1630 | Ga0373936_0002310 | |||
| 1631 | Ga0373936_0015026 | |||
| 1632 | Ga0373936_0070123 | |||
| 1633 | Ga0373939_0001142 | |||
| 1634 | Ga0373939_0033354 | |||
| 1635 | Ga0373941_0000650 | |||
| 1636 | Ga0373941_0053278 | |||
| 1637 | Ga0373945_0000024 | |||
| 1638 | Ga0373945_0023430 | |||
| 1639 | Ga0373953_0006179 | |||
| 1640 | Ga0373954_0002504 | |||
| 1641 | Ga0373954_0153684 | |||
| 1642 | Ga0373956_0034271 | |||
| 1643 | Ga0373957_0002002 | |||
| 1644 | Ga0373943_0007172 | |||
| 1645 | Ga0373943_0008956 | |||
| 1646 | Ga0373943_0009551 | |||
| 1647 | Ga0373943_0036375 | |||
| 1648 | Ga0373946_0001561 | |||
| 1649 | Ga0373946_0006931 | |||
| 1650 | Ga0373946_0102054 | |||
| 1651 | Ga0373955_0025348 | |||
| 1652 | Ga0373955_0097150 | |||
| 1653 | Ga0373955_0219690 | |||
| 1654 | Ga0373961_0003645 | |||
| 1655 | Ga0373962_0010757 | |||
| 1656 | Ga0373924_0052677 | |||
| 1657 | Ga0373931_0006810 | |||
| 1658 | Ga0373931_0008696 | |||
| 1659 | Ga0373931_0117187 | |||
| 1660 | Ga0373931_0155895 | |||
| 1661 | Ga0373935_0005019 | |||
| 1662 | Ga0373935_0007141 | |||
| 1663 | Ga0373935_0134334 | |||
| 1664 | Ga0373927_0004242 | |||
| 1665 | Ga0373927_0017951 | |||
| 1666 | Ga0373927_0042410 | |||
| 1667 | Ga0373927_0073015 | |||
| 1668 | Ga0373933_0023256 | |||
| 1669 | Ga0373933_0049697 | |||
| 1670 | Ga0373933_0261374 | |||
| 1671 | Ga0373947_0010970 | |||
| 1672 | Ga0373947_0011761 | |||
| 1673 | Ga0373947_0031535 | |||
| 1674 | Ga0373947_0088702 | |||
| 1675 | Ga0373937_0000655 | |||
| 1676 | Ga0373937_0028017 | |||
| 1677 | Ga0373937_0054868 | |||
| 1678 | Ga0373925_0022231 | |||
| 1679 | Ga0373925_0118311 | |||
| 1680 | Ga0373925_0118424 | |||
| 1681 | Ga0395900_0010527 | |||
| 1682 | Ga0395898_0019086 | |||
| 1683 | Ga0436364_1125377 | |||
| 1684 | Ga0395901_0098845 | |||
| 1685 | Ga0436365_0124605 | |||
| 1686 | Ga0436365_1895534 | |||
| 1687 | Ga0436361_0430694 | |||
| 1688 | Ga0451853_3454574 | |||
| 1689 | Ga0451577_0012669 | |||
| 1690 | Ga0466963_0209296 | |||
| 1691 | Ga0466964_0018031 | |||
| 1692 | Ga0466957_0051069 | |||
| 1693 | Ga0466960_0194166 | |||
| 1694 | Ga0451576_0000822 | |||
| 1695 | Ga0466967_0002637 | |||
| 1696 | Ga0466967_0199071 | |||
| 1697 | Ga0495592_0002464 | |||
| 1698 | Ga0495603_0019055 | |||
| 1699 | Ga0495603_0090047 | |||
| 1700 | Ga0495603_0095018 | |||
| 1701 | Ga0495590_0082404 | |||
| 1702 | Ga0495591_038540 | |||
| 1703 | Ga0495629_0001465 | |||
| 1704 | Ga0495629_0053367 | |||
| 1705 | Ga0495629_0099250 | |||
| 1706 | Ga0495638_0005705 | |||
| 1707 | Ga0495641_0002445 | |||
| 1708 | Ga0495651_0002003 | |||
| 1709 | Ga0495651_0002165 | |||
| 1710 | Ga0495653_0118398 | |||
| 1711 | Ga0495653_0119132 | |||
| 1712 | Ga0495653_0356431 | |||
| 1713 | Ga0495580_0006345 | |||
| 1714 | Ga0495580_0023170 | |||
| 1715 | Ga0495580_0093435 | |||
| 1716 | Ga0495580_0157402 | |||
| 1717 | Ga0495582_0001749 | |||
| 1718 | Ga0495582_0108676 | |||
| 1719 | Ga0495582_0208146 | |||
| 1720 | Ga0495639_0014565 | |||
| 1721 | Ga0495662_0055538 | |||
| 1722 | Ga0495664_0000563 | |||
| 1723 | Ga0495664_0003135 | |||
| 1724 | Ga0495664_0017138 | |||
| 1725 | Ga0495584_0009466 | |||
| 1726 | Ga0495584_0062997 | |||
| 1727 | Ga0495594_0009159 | |||
| 1728 | Ga0495594_0017917 | |||
| 1729 | Ga0495608_0000428 | |||
| 1730 | Ga0495608_0008200 | |||
| 1731 | Ga0495616_0015414 | |||
| 1732 | Ga0495618_0006811 | |||
| 1733 | Ga0495628_0019849 | |||
| 1734 | Ga0495628_0064096 | |||
| 1735 | Ga0495628_0160000 | |||
| 1736 | Ga0495630_0012330 | |||
| 1737 | Ga0495630_0027392 | |||
| 1738 | Ga0495630_0159869 | |||
| 1739 | Ga0495630_0515885 | |||
| 1740 | Ga0495666_0000400 | |||
| 1741 | Ga0495652_0267034 | |||
| 1742 | Ga0495652_0318004 | |||
| 1743 | Ga0495640_0013977 | |||
| 1744 | Ga0495640_0019186 | |||
| 1745 | Ga0495587_0006341 | |||
| 1746 | Ga0495587_0018948 | |||
| 1747 | Ga0495598_0006601 | |||
| 1748 | Ga0495645_0100626 | |||
| 1749 | Ga0495622_0000406 | |||
| 1750 | Ga0495633_0014925 | |||
| 1751 | Ga0495633_0031919 | |||
| 1752 | Ga0495667_0004194 | |||
| 1753 | Ga0495656_0000661 | |||
| 1754 | Ga0495656_0007374 | |||
| 1755 | Ga0495668_0095410 | |||
| 1756 | Ga0495634_0036732 | |||
| 1757 | Ga0495611_0018537 | |||
| 1758 | Ga0495635_0012606 | |||
| 1759 | Ga0495635_0014382 | |||
| 1760 | Ga0495588_0000318 | |||
| 1761 | Ga0495657_0030733 | |||
| 1762 | Ga0495599_0017299 | |||
| 1763 | Ga0495599_0032734 | |||
| 1764 | Ga0495623_0001886 | |||
| 1765 | Ga0495646_0018816 | |||
| 1766 | Ga0495646_0027257 | |||
| 1767 | Ga0495647_0002144 | |||
| 1768 | Ga0495647_0007416 | |||
| 1769 | Ga0495647_0011789 | |||
| 1770 | Ga0495647_0021133 | |||
| 1771 | Ga0495658_0000237 | |||
| 1772 | Ga0495658_0006930 | |||
| 1773 | Ga0495658_0010307 | |||
| 1774 | Ga0495669_0041658 | |||
| 1775 | Ga0495669_0076310 | |||
| 1776 | Ga0495669_0120930 | |||
| 1777 | Ga0495613_0000793 | |||
| 1778 | Ga0495613_0001097 | |||
| 1779 | Ga0495613_0205306 | |||
| 1780 | Ga0495624_0003149 | |||
| 1781 | Ga0495624_0026092 | |||
| 1782 | Ga0495624_0067797 | |||
| 1783 | Ga0495670_0000558 | |||
| 1784 | Ga0495600_0000453 | |||
| 1785 | Ga0495600_0028346 | |||
| 1786 | Ga0495581_0017498 | |||
| 1787 | Ga0495581_0029185 | |||
| 1788 | Ga0495581_0081328 | |||
| 1789 | Ga0495604_0001023 | |||
| 1790 | Ga0495604_0005688 | |||
| 1791 | Ga0495604_0087533 | |||
| 1792 | Ga0495604_0216708 | |||
| 1793 | Ga0495674_0180597 | |||
| 1794 | Ga0495674_0233078 | |||
| 1795 | Ga0495674_0276738 | |||
| 1796 | Ga0495672_0078932 | |||
| 1797 | Ga0495672_0136388 | |||
| 1798 | Ga0495676_0023292 | |||
| 1799 | Ga0495676_0038413 | |||
| 1800 | Ga0495676_0047669 | |||
| 1801 | Ga0495680_0014392 | |||
| 1802 | Ga0495680_0022162 | |||
| 1803 | Ga0495680_0028274 | |||
| 1804 | Ga0495680_0094090 | |||
| 1805 | Ga0495675_0023707 | |||
| 1806 | Ga0495677_0028641 | |||
| 1807 | Ga0495679_031560 | |||
| 1808 | Ga0495684_0024943 | |||
| 1809 | Ga0495684_0135229 | |||
| 1810 | Ga0495684_0165348 | |||
| 1811 | Ga0495684_0268174 | |||
| 1812 | Ga0495686_0222256 | |||
| 1813 | Ga0495593_0001023 | |||
| 1814 | Ga0495602_0047540 | |||
| 1815 | Ga0495614_0034423 | |||
| 1816 | Ga0495626_0065940 | |||
| 1817 | Ga0496100_0003675 | |||
| 1818 | Ga0496100_0005737 | |||
| 1819 | Ga0496100_0143653 | |||
| 1820 | Ga0496101_0002231 | |||
| 1821 | Ga0496101_0006527 | |||
| 1822 | Ga0496101_0020096 | |||
| 1823 | Ga0496101_0034825 | |||
| 1824 | Ga0496101_0041132 | |||
| 1825 | Ga0496101_0071028 | |||
| 1826 | Ga0496101_0120326 | |||
| 1827 | Ga0496102_0019812 | |||
| 1828 | Ga0496102_0019821 | |||
| 1829 | Ga0496102_0020092 | |||
| 1830 | Ga0496102_0033077 | |||
| 1831 | Ga0496102_0042674 | |||
| 1832 | Ga0496102_0071073 | |||
| 1833 | Ga0496102_0240912 | |||
| 1834 | Ga0496102_0456723 | |||
| 1835 | Ga0496103_0002716 | |||
| 1836 | Ga0496103_0005324 | |||
| 1837 | Ga0496103_0006852 | |||
| 1838 | Ga0496103_0016376 | |||
| 1839 | Ga0496103_0061470 | |||
| 1840 | Ga0496104_0003499 | |||
| 1841 | Ga0496104_0008528 | |||
| 1842 | Ga0496104_0044483 | |||
| 1843 | Ga0496104_0048378 | |||
| 1844 | Ga0496104_0067135 | |||
| 1845 | Ga0496104_0131004 | |||
| 1846 | Ga0496104_0140999 | |||
| 1847 | Ga0496104_0143202 | |||
| 1848 | Ga0496105_0004200 | |||
| 1849 | Ga0496105_0025968 | |||
| 1850 | Ga0496105_0033375 | |||
| 1851 | Ga0496105_0097484 | |||
| 1852 | Ga0496105_0148348 | |||
| 1853 | Ga0496105_0155514 | |||
| 1854 | Ga0496105_0282674 | |||
| 1855 | Ga0496106_0003558 | |||
| 1856 | Ga0496106_0016339 | |||
| 1857 | Ga0496106_0019678 | |||
| 1858 | Ga0496106_0028478 | |||
| 1859 | Ga0496106_0040623 | |||
| 1860 | Ga0496106_0122055 | |||
| 1861 | Ga0496106_0281049 | |||
| 1862 | Ga0496107_0012234 | |||
| 1863 | Ga0496107_0021259 | |||
| 1864 | Ga0496107_0036978 | |||
| 1865 | Ga0496107_0041550 | |||
| 1866 | Ga0496107_0049417 | |||
| 1867 | Ga0496107_0059395 | |||
| 1868 | Ga0496107_0091946 | |||
| 1869 | Ga0496107_0157388 | |||
| 1870 | Ga0496108_0001828 | |||
| 1871 | Ga0496108_0007255 | |||
| 1872 | Ga0496108_0094003 | |||
| 1873 | Ga0496108_0135338 | |||
| 1874 | Ga0496108_0139395 | |||
| 1875 | Ga0496108_0173426 | |||
| 1876 | Ga0496108_0495282 | |||
| 1877 | Ga0496109_0007856 | |||
| 1878 | Ga0496109_0008549 | |||
| 1879 | Ga0496109_0018179 | |||
| 1880 | Ga0496109_0065176 | |||
| 1881 | Ga0496109_0066205 | |||
| 1882 | Ga0496109_0133144 | |||
| 1883 | Ga0496109_0204286 | |||
| 1884 | Ga0496109_0273572 | |||
| 1885 | Ga0496110_0027307 | |||
| 1886 | Ga0496110_0067091 | |||
| 1887 | Ga0496110_0088896 | |||
| 1888 | Ga0496110_0096561 | |||
| 1889 | Ga0496111_0002519 | |||
| 1890 | Ga0496111_0022283 | |||
| 1891 | Ga0496111_0031896 | |||
| 1892 | Ga0496111_0057641 | |||
| 1893 | Ga0496111_0082688 | |||
| 1894 | Ga0496112_0009068 | |||
| 1895 | Ga0496112_0019528 | |||
| 1896 | Ga0496112_0039463 | |||
| 1897 | Ga0496112_0059028 | |||
| 1898 | Ga0496112_0064454 | |||
| 1899 | Ga0496112_0082610 | |||
| 1900 | Ga0496112_0217225 | |||
| 1901 | Ga0496112_0365043 | |||
| 1902 | Ga0496113_0006338 | |||
| 1903 | Ga0496113_0010185 | |||
| 1904 | Ga0496113_0037480 | |||
| 1905 | Ga0496113_0041029 | |||
| 1906 | Ga0496113_0226212 | |||
| 1907 | Ga0496113_0276275 | |||
| 1908 | Ga0496113_0414995 | |||
| 1909 | Ga0496114_0014950 | |||
| 1910 | Ga0496114_0025741 | |||
| 1911 | Ga0496114_0026354 | |||
| 1912 | Ga0496114_0031259 | |||
| 1913 | Ga0496114_0085635 | |||
| 1914 | Ga0496114_0134794 | |||
| 1915 | Ga0496115_0006207 | |||
| 1916 | Ga0496115_0008489 | |||
| 1917 | Ga0496115_0046138 | |||
| 1918 | Ga0496115_0101320 | |||
| 1919 | Ga0496115_0102656 | |||
| 1920 | Ga0496115_0441876 | |||
| 1921 | Ga0501031_0050060 | |||
| 1922 | Ga0501031_0062055 | |||
| 1923 | Ga0501033_0036415 | |||
| 1924 | Ga0501033_0053143 | |||
| 1925 | Ga0501033_0068471 | |||
| 1926 | Ga0501033_0099433 | |||
| 1927 | Ga0501033_0219364 | |||
| 1928 | Ga0501034_0042753 | |||
| 1929 | Ga0501034_0074785 | |||
| 1930 | Ga0501034_0097651 | |||
| 1931 | Ga0501036_0174863 | |||
| 1932 | Ga0501037_0157408 | |||
| 1933 | Ga0501038_0089945 | |||
| 1934 | Ga0501039_0028654 | |||
| 1935 | Ga0501039_0130743 | |||
| 1936 | Ga0501041_0043008 | |||
| 1937 | Ga0501042_0037352 | |||
| 1938 | Ga0501046_0006964 | |||
| 1939 | Ga0501047_0015389 | |||
| 1940 | Ga0501047_0091710 | |||
| 1941 | Ga0501047_0171989 | |||
| 1942 | Ga0501048_0069083 | |||
| 1943 | Ga0501067_0004377 | |||
| 1944 | Ga0501068_0082284 | |||
| 1945 | Ga0501069_0032657 | |||
| 1946 | Ga0501074_0080884 | |||
| 1947 | Ga0501075_0035908 | |||
| 1948 | Ga0501079_0090925 | |||
| 1949 | Ga0501080_0115363 | |||
| 1950 | Ga0501081_0219624 | |||
| 1951 | Ga0501083_0014044 | |||
| 1952 | Ga0501035_0054484 | |||
| 1953 | Ga0501044_0000173 | |||
| 1954 | Ga0501044_0229711 | |||
| 1955 | Ga0501045_0120901 | |||
| 1956 | nmdc:mga03683_61708_c1 | |||
| 1957 | nmdc:mga00v17_83073_c1 | |||
| 1958 | nmdc:mga0yw44_170432_c1 | |||
| 1959 | nmdc:mga0yw44_6262_c1 | |||
| 1960 | nmdc:mga0k408_29747_c1 | |||
| 1961 | nmdc:mga0k408_67288_c1 | |||
| 1962 | nmdc:mga06z11_129794_c1 | |||
| 1963 | nmdc:mga05p37_157546_c1 | |||
| 1964 | nmdc:mga05p37_204703_c1 | |||
| 1965 | nmdc:mga05p37_302232_c1 | |||
| 1966 | nmdc:mga05p37_670874_c1 | |||
| 1967 | nmdc:mga05p37_69456_c1 | |||
| 1968 | nmdc:mga09592_120809_c1 | |||
| 1969 | nmdc:mga0qj67_288710_c1 | |||
| 1970 | nmdc:mga0qj67_45862_c1 | |||
| 1971 | nmdc:mga0qj67_6924_c1 | |||
| 1972 | nmdc:mga0qj67_98072_c1 | |||
| 1973 | nmdc:mga06r32_69686_c1 | |||
| 1974 | nmdc:mga08y16_160742_c1 | |||
| 1975 | nmdc:mga08y16_23656_c1 | |||
| 1976 | nmdc:mga08y16_33457_c1 | |||
| 1977 | nmdc:mga08y16_428577_c1 | |||
| 1978 | nmdc:mga08y16_53521_c1 | |||
| 1979 | nmdc:mga0n895_10980_c1 | |||
| 1980 | nmdc:mga0n895_14260_c1 | |||
| 1981 | nmdc:mga0n895_211403_c1 | |||
| 1982 | nmdc:mga0n895_63475_c1 | |||
| 1983 | nmdc:mga0n895_850525_c1 | |||
| 1984 | nmdc:mga0n895_86_c1 | |||
| 1985 | nmdc:mga0rr50_210677_c1 | |||
| 1986 | nmdc:mga0rr50_3472_c1 | |||
| 1987 | nmdc:mga0rr50_382571_c1 | |||
| 1988 | nmdc:mga0rr50_664_c1 | |||
| 1989 | nmdc:mga0rr50_740_c1 | |||
| 1990 | nmdc:mga0rr50_79065_c1 | |||
| 1991 | nmdc:mga08x19_1310_c1 | |||
| 1992 | nmdc:mga08x19_183953_c1 | |||
| 1993 | nmdc:mga08x19_32895_c1 | |||
| 1994 | nmdc:mga0a205_1448_c1 | |||
| 1995 | nmdc:mga0a205_23839_c1 | |||
| 1996 | nmdc:mga0a205_31489_c1 | |||
| 1997 | nmdc:mga0a205_55341_c1 | |||
| 1998 | nmdc:mga0a205_8069_c1 | |||
| 1999 | Ga0495601_0030200 | |||
| 2000 | Ga0495612_0002701 | |||
| 2001 | Ga0495612_0028807 | |||
| 2002 | Ga0495612_0036716 | |||
| 2003 | Ga0495655_0004315 | |||
| 2004 | Ga0495655_0022022 | |||
| 2005 | Ga0495595_0000574 | |||
| 2006 | Ga0495595_0001515 | |||
| 2007 | Ga0495595_0002744 | |||
| 2008 | Ga0495619_0000045 | |||
| 2009 | Ga0495619_0000484 | |||
| 2010 | Ga0495619_0010412 | |||
| 2011 | Ga0495619_0026207 | |||
| 2012 | Ga0495619_0032329 | |||
| 2013 | Ga0495619_0090687 | |||
| 2014 | Ga0500566_0004523 | |||
| 2015 | Ga0500641_0003963 | |||
| 2016 | Ga0500554_001737 | |||
| 2017 | Ga0500593_006659 | |||
| 2018 | Ga0500595_001694 | |||
| 2019 | Ga0500577_0054240 | |||
| 2020 | Ga0500603_006016 | |||
| 2021 | Ga0500616_0053185 | |||
| 2022 | Ga0500638_032029 | |||
| 2023 | Ga0500639_059717 | |||
| 2024 | Ga0500637_0000263 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.9597 | 27 | 319 |
| 8hkb-assembly1.cif.gz_A | tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d | 0.9568 | 31 | 323 |
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.9535 | 27 | 321 |
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.938 | 27 | 319 |
| 2f5x-assembly3.cif.gz_C | structure of periplasmic binding protein bugd | 0.9361 | 27 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9585 | 126 | 248 | 3.40.190.10 |
| 2dvzA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9511 | 126 | 244 | 3.40.190.10 |
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9499 | 126 | 243 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9437 | 126 | 248 | 3.40.190.10 |
| 2f5xC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9366 | 127 | 248 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A844TKW8-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9819 | 27 | 323 |
|
| AF-A0A1F4DZ02-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9791 | 24 | 323 |
|
| AF-A0A7J4VHT1-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.979 | 27 | 315 |
|
| AF-A0A1B2R0B6-F1-model_v4 | ABC transporter substrate-binding protein | 0.9771 | 27 | 323 |
|
| AF-A0A1F4AHA8-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9768 | 52 | 320 |
|