F488159
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1012 | 353 | 1011 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300005295|Ga0065707_10682833|Ga0065707_106828332 |
| Length | 110 |
| Sequence | MTDLMARVVVNVPAEAKKGEVIEIRTLAGHPMETGFRRTQLGELVPRDIIRSLVCAYNGVEVFRAELHPAIAANPLLTFTTVATESGTLEFRWTGDNGFSVTEKAVIKVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 107 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 170 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 173 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 177 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 178 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 179 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 180 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 181 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 182 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 183 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 184 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 185 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 191 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 195 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 199 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 206 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 210 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 211 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 212 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 220 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 222 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 223 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 224 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 225 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 226 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 227 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 228 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 229 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 230 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 231 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 232 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 233 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 234 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 290 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 291 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 292 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 293 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 294 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 295 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 321 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 322 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 329 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 342 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 343 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 344 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 345 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 346 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 347 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 348 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 349 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 350 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 353 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0.1 |
| Isolates | 0.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.38 |
| Nodule | 0 |
| Rhizoplane | 1.48 |
| Rhizosphere | 96.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1012062 | 3300002070 | Bacteria | 1141 |
| 2 | JGI25406J46586_10112665 | 3300003203 | Bacteria | 804 |
| 3 | Ga0058859_10482534 | 3300004798 | Bacteria | 645 |
| 4 | Ga0065707_10002472 | 3300005295 | Bacteria | 4857 |
| 5 | Ga0065707_10008939 | 3300005295 | Bacteria | 2752 |
| 6 | Ga0065707_10032199 | 3300005295 | Bacteria | 1093 |
| 7 | Ga0065707_10142379 | 3300005295 | Bacteria | 1756 |
| 8 | Ga0065707_10421713 | 3300005295 | Bacteria | 830 |
| 9 | Ga0065707_10682833 | 3300005295 | Bacteria | 648 |
| 10 | Ga0065707_10742311 | 3300005295 | Bacteria | 622 |
| 11 | Ga0065707_10843318 | 3300005295 | Bacteria | 572 |
| 12 | Ga0065707_10863893 | 3300005295 | Unclassified | 578 |
| 13 | Ga0070676_10267672 | 3300005328 | Bacteria | 1146 |
| 14 | Ga0070676_10289081 | 3300005328 | Bacteria | 1107 |
| 15 | Ga0070676_10302924 | 3300005328 | Bacteria | 1084 |
| 16 | Ga0070683_100164724 | 3300005329 | Bacteria | 2103 |
| 17 | Ga0070690_100000131 | 3300005330 | Bacteria | 38893 |
| 18 | Ga0070690_100009883 | 3300005330 | Bacteria | 5536 |
| 19 | Ga0070690_100123222 | 3300005330 | Bacteria | 1742 |
| 20 | Ga0070690_101040930 | 3300005330 | Bacteria | 647 |
| 21 | Ga0068869_100000392 | 3300005334 | Bacteria | 23853 |
| 22 | Ga0068869_100032305 | 3300005334 | Bacteria | 3688 |
| 23 | Ga0068869_101253262 | 3300005334 | Bacteria | 653 |
| 24 | Ga0070666_10295857 | 3300005335 | Bacteria | 1152 |
| 25 | Ga0070680_100052279 | 3300005336 | Bacteria | 3335 |
| 26 | Ga0070680_100055201 | 3300005336 | Bacteria | 3246 |
| 27 | Ga0070680_100130316 | 3300005336 | Bacteria | 2104 |
| 28 | Ga0070680_100168751 | 3300005336 | Bacteria | 1841 |
| 29 | Ga0070680_100644785 | 3300005336 | Bacteria | 910 |
| 30 | Ga0070680_100903533 | 3300005336 | Bacteria | 762 |
| 31 | Ga0070680_101717628 | 3300005336 | Bacteria | 544 |
| 32 | Ga0070682_100024737 | 3300005337 | Bacteria | 3577 |
| 33 | Ga0068868_100000656 | 3300005338 | Bacteria | 23322 |
| 34 | Ga0068868_101081600 | 3300005338 | Bacteria | 737 |
| 35 | Ga0070689_100006489 | 3300005340 | Bacteria | 8103 |
| 36 | Ga0070689_100098199 | 3300005340 | Bacteria | 2316 |
| 37 | Ga0070689_100441349 | 3300005340 | Bacteria | 1106 |
| 38 | Ga0070689_100614528 | 3300005340 | Bacteria | 942 |
| 39 | Ga0070691_10000200 | 3300005341 | Bacteria | 20142 |
| 40 | Ga0070691_10034787 | 3300005341 | Bacteria | 2372 |
| 41 | Ga0070691_10094607 | 3300005341 | Bacteria | 1477 |
| 42 | Ga0070687_100000175 | 3300005343 | Bacteria | 22196 |
| 43 | Ga0070687_100127683 | 3300005343 | Bacteria | 1464 |
| 44 | Ga0070687_100318442 | 3300005343 | Bacteria | 993 |
| 45 | Ga0070692_10001132 | 3300005345 | Bacteria | 9346 |
| 46 | Ga0070692_10018032 | 3300005345 | Bacteria | 3387 |
| 47 | Ga0070692_11059412 | 3300005345 | Unclassified | 570 |
| 48 | Ga0070668_100055705 | 3300005347 | Bacteria | 3053 |
| 49 | Ga0070668_100226763 | 3300005347 | Bacteria | 1543 |
| 50 | Ga0070668_101331689 | 3300005347 | Unclassified | 653 |
| 51 | Ga0070669_100190392 | 3300005353 | Bacteria | 1609 |
| 52 | Ga0070669_101272375 | 3300005353 | Unclassified | 636 |
| 53 | Ga0070669_101835745 | 3300005353 | Unclassified | 529 |
| 54 | Ga0070675_100050024 | 3300005354 | Bacteria | 3431 |
| 55 | Ga0070675_100076173 | 3300005354 | Bacteria | 2790 |
| 56 | Ga0070671_101381184 | 3300005355 | Bacteria | 622 |
| 57 | Ga0070674_100069371 | 3300005356 | Bacteria | 2487 |
| 58 | Ga0070674_100688142 | 3300005356 | Bacteria | 873 |
| 59 | Ga0070673_100078130 | 3300005364 | Bacteria | 2676 |
| 60 | Ga0070688_100216458 | 3300005365 | Bacteria | 1348 |
| 61 | Ga0070688_100702707 | 3300005365 | Bacteria | 783 |
| 62 | Ga0070688_100734921 | 3300005365 | Unclassified | 767 |
| 63 | Ga0070688_101069554 | 3300005365 | Bacteria | 644 |
| 64 | Ga0070703_10140112 | 3300005406 | Archaea | 898 |
| 65 | Ga0070709_10978484 | 3300005434 | Bacteria | 672 |
| 66 | Ga0070710_10193938 | 3300005437 | Bacteria | 1279 |
| 67 | Ga0070701_10000676 | 3300005438 | Bacteria | 12013 |
| 68 | Ga0070701_10181614 | 3300005438 | Bacteria | 1232 |
| 69 | Ga0070701_10337596 | 3300005438 | Bacteria | 937 |
| 70 | Ga0070701_10356053 | 3300005438 | Bacteria | 916 |
| 71 | Ga0070701_10667612 | 3300005438 | Archaea | 696 |
| 72 | Ga0070711_100267315 | 3300005439 | Bacteria | 1348 |
| 73 | Ga0070711_100562676 | 3300005439 | Bacteria | 947 |
| 74 | Ga0070705_100003918 | 3300005440 | Bacteria | 7277 |
| 75 | Ga0070705_100144122 | 3300005440 | Bacteria | 1572 |
| 76 | Ga0070705_100250177 | 3300005440 | Bacteria | 1244 |
| 77 | Ga0070705_100719174 | 3300005440 | Bacteria | 786 |
| 78 | Ga0070705_100849852 | 3300005440 | Bacteria | 730 |
| 79 | Ga0070705_101056823 | 3300005440 | Bacteria | 662 |
| 80 | Ga0070700_100000587 | 3300005441 | Bacteria | 18243 |
| 81 | Ga0070700_100044406 | 3300005441 | Bacteria | 2737 |
| 82 | Ga0070700_100530306 | 3300005441 | Bacteria | 911 |
| 83 | Ga0070700_101148093 | 3300005441 | Bacteria | 646 |
| 84 | Ga0070700_101215337 | 3300005441 | Unclassified | 630 |
| 85 | Ga0070694_100000136 | 3300005444 | Bacteria | 36787 |
| 86 | Ga0070694_100367479 | 3300005444 | Bacteria | 1119 |
| 87 | Ga0070694_100474031 | 3300005444 | Bacteria | 992 |
| 88 | Ga0070694_100680372 | 3300005444 | Bacteria | 835 |
| 89 | Ga0070694_100740679 | 3300005444 | Bacteria | 802 |
| 90 | Ga0070694_100842465 | 3300005444 | Bacteria | 754 |
| 91 | Ga0070694_100890541 | 3300005444 | Bacteria | 734 |
| 92 | Ga0070694_101103691 | 3300005444 | Unclassified | 662 |
| 93 | Ga0070708_100045853 | 3300005445 | Bacteria | 3854 |
| 94 | Ga0070708_100493268 | 3300005445 | Bacteria | 1155 |
| 95 | Ga0070708_100503739 | 3300005445 | Bacteria | 1142 |
| 96 | Ga0070663_100431865 | 3300005455 | Bacteria | 1082 |
| 97 | Ga0070678_100988831 | 3300005456 | Bacteria | 773 |
| 98 | Ga0070662_100832722 | 3300005457 | Archaea | 785 |
| 99 | Ga0070662_101650347 | 3300005457 | Bacteria | 553 |
| 100 | Ga0070681_10007592 | 3300005458 | Bacteria | 10603 |
| 101 | Ga0068867_100001154 | 3300005459 | Bacteria | 18064 |
| 102 | Ga0068867_100002412 | 3300005459 | Bacteria | 13146 |
| 103 | Ga0068867_100251805 | 3300005459 | Bacteria | 1436 |
| 104 | Ga0068867_100559475 | 3300005459 | Bacteria | 992 |
| 105 | Ga0068867_100837729 | 3300005459 | Bacteria | 823 |
| 106 | Ga0070706_100078100 | 3300005467 | Bacteria | 3065 |
| 107 | Ga0070706_100119580 | 3300005467 | Bacteria | 2455 |
| 108 | Ga0070707_100047466 | 3300005468 | Bacteria | 4111 |
| 109 | Ga0070707_100753661 | 3300005468 | Bacteria | 937 |
| 110 | Ga0070707_100808756 | 3300005468 | Bacteria | 901 |
| 111 | Ga0070698_100009043 | 3300005471 | Bacteria | 10708 |
| 112 | Ga0070698_100013803 | 3300005471 | Bacteria | 8546 |
| 113 | Ga0070698_100094448 | 3300005471 | Bacteria | 2969 |
| 114 | Ga0070698_100402494 | 3300005471 | Bacteria | 1302 |
| 115 | Ga0070699_100305144 | 3300005518 | Bacteria | 1428 |
| 116 | Ga0070699_100343313 | 3300005518 | Bacteria | 1344 |
| 117 | Ga0070699_100352759 | 3300005518 | Bacteria | 1325 |
| 118 | Ga0070699_100438873 | 3300005518 | Bacteria | 1183 |
| 119 | Ga0070679_100110038 | 3300005530 | Bacteria | 2741 |
| 120 | Ga0070684_100080859 | 3300005535 | Bacteria | 2875 |
| 121 | Ga0070697_100028284 | 3300005536 | Bacteria | 4488 |
| 122 | Ga0070697_100038912 | 3300005536 | Bacteria | 3843 |
| 123 | Ga0070697_100183529 | 3300005536 | Bacteria | 1774 |
| 124 | Ga0070672_100571404 | 3300005543 | Archaea | 983 |
| 125 | Ga0070686_100000285 | 3300005544 | Bacteria | 34108 |
| 126 | Ga0070686_100034464 | 3300005544 | Bacteria | 3120 |
| 127 | Ga0070686_100382979 | 3300005544 | Bacteria | 1065 |
| 128 | Ga0070686_100729425 | 3300005544 | Bacteria | 793 |
| 129 | Ga0070686_101062558 | 3300005544 | Bacteria | 667 |
| 130 | Ga0070686_101738496 | 3300005544 | Unclassified | 530 |
| 131 | Ga0070695_100000705 | 3300005545 | Bacteria | 17853 |
| 132 | Ga0070695_100494244 | 3300005545 | Bacteria | 945 |
| 133 | Ga0070695_100576905 | 3300005545 | Bacteria | 880 |
| 134 | Ga0070695_101335010 | 3300005545 | Unclassified | 593 |
| 135 | Ga0070696_100002015 | 3300005546 | Bacteria | 13322 |
| 136 | Ga0070696_100015035 | 3300005546 | Bacteria | 5195 |
| 137 | Ga0070696_100025633 | 3300005546 | Bacteria | 4009 |
| 138 | Ga0070696_100173263 | 3300005546 | Bacteria | 1596 |
| 139 | Ga0070696_100276734 | 3300005546 | Bacteria | 1278 |
| 140 | Ga0070696_100981981 | 3300005546 | Bacteria | 704 |
| 141 | Ga0070693_100000278 | 3300005547 | Bacteria | 24050 |
| 142 | Ga0070693_100480465 | 3300005547 | Bacteria | 878 |
| 143 | Ga0070693_100931771 | 3300005547 | Bacteria | 653 |
| 144 | Ga0070704_100000103 | 3300005549 | Bacteria | 29844 |
| 145 | Ga0070704_100001347 | 3300005549 | Bacteria | 13021 |
| 146 | Ga0070704_100102412 | 3300005549 | Bacteria | 2160 |
| 147 | Ga0070704_100213775 | 3300005549 | Bacteria | 1564 |
| 148 | Ga0070704_100488248 | 3300005549 | Bacteria | 1067 |
| 149 | Ga0070704_101264158 | 3300005549 | Unclassified | 675 |
| 150 | Ga0070704_101907159 | 3300005549 | Unclassified | 551 |
| 151 | Ga0068857_100410209 | 3300005577 | Bacteria | 1262 |
| 152 | Ga0068854_100001266 | 3300005578 | Bacteria | 15179 |
| 153 | Ga0068856_100025824 | 3300005614 | Bacteria | 5728 |
| 154 | Ga0070702_100000039 | 3300005615 | Bacteria | 35203 |
| 155 | Ga0070702_100011795 | 3300005615 | Bacteria | 4358 |
| 156 | Ga0070702_100263693 | 3300005615 | Bacteria | 1174 |
| 157 | Ga0068852_101909030 | 3300005616 | Bacteria | 616 |
| 158 | Ga0068859_100000420 | 3300005617 | Bacteria | 42401 |
| 159 | Ga0068859_100181226 | 3300005617 | Bacteria | 2189 |
| 160 | Ga0068859_100332394 | 3300005617 | Bacteria | 1614 |
| 161 | Ga0068859_100509781 | 3300005617 | Bacteria | 1298 |
| 162 | Ga0068859_100894356 | 3300005617 | Bacteria | 973 |
| 163 | Ga0068866_10001352 | 3300005718 | Bacteria | 10601 |
| 164 | Ga0068861_100000399 | 3300005719 | Bacteria | 25138 |
| 165 | Ga0068861_100121308 | 3300005719 | Bacteria | 2109 |
| 166 | Ga0068861_100452508 | 3300005719 | Bacteria | 1151 |
| 167 | Ga0068861_100715111 | 3300005719 | Bacteria | 932 |
| 168 | Ga0068861_101178810 | 3300005719 | Bacteria | 740 |
| 169 | Ga0068870_10036599 | 3300005840 | Bacteria | 2526 |
| 170 | Ga0068870_10066418 | 3300005840 | Bacteria | 1953 |
| 171 | Ga0068863_102666131 | 3300005841 | Unclassified | 509 |
| 172 | Ga0068858_100005769 | 3300005842 | Bacteria | 12097 |
| 173 | Ga0068858_100112559 | 3300005842 | Bacteria | 2542 |
| 174 | Ga0068858_100520779 | 3300005842 | Bacteria | 1150 |
| 175 | Ga0068858_101170622 | 3300005842 | Unclassified | 755 |
| 176 | Ga0068860_100002528 | 3300005843 | Bacteria | 19155 |
| 177 | Ga0068860_100099481 | 3300005843 | Bacteria | 2774 |
| 178 | Ga0068860_100533700 | 3300005843 | Bacteria | 1174 |
| 179 | Ga0068860_100602500 | 3300005843 | Bacteria | 1104 |
| 180 | Ga0068860_101460699 | 3300005843 | Bacteria | 705 |
| 181 | Ga0068862_100005981 | 3300005844 | Bacteria | 10130 |
| 182 | Ga0068862_100048027 | 3300005844 | Bacteria | 3643 |
| 183 | Ga0068862_100166396 | 3300005844 | Bacteria | 1971 |
| 184 | Ga0068862_100553678 | 3300005844 | Bacteria | 1098 |
| 185 | Ga0068862_101458131 | 3300005844 | Unclassified | 689 |
| 186 | Ga0068862_102493692 | 3300005844 | Unclassified | 529 |
| 187 | Ga0081455_10003176 | 3300005937 | Bacteria | 19071 |
| 188 | Ga0081455_10450024 | 3300005937 | Bacteria | 880 |
| 189 | Ga0081455_10614601 | 3300005937 | Bacteria | 706 |
| 190 | Ga0081538_10337381 | 3300005981 | Unclassified | 547 |
| 191 | Ga0081540_1000841 | 3300005983 | Bacteria | 28015 |
| 192 | Ga0081540_1023446 | 3300005983 | Bacteria | 3609 |
| 193 | Ga0081539_10000468 | 3300005985 | Bacteria | 85386 |
| 194 | Ga0081539_10029471 | 3300005985 | Bacteria | 3427 |
| 195 | Ga0075368_10106793 | 3300006042 | Bacteria | 1152 |
| 196 | Ga0075432_10105557 | 3300006058 | Bacteria | 1045 |
| 197 | Ga0070716_100481606 | 3300006173 | Bacteria | 911 |
| 198 | Ga0070712_100001185 | 3300006175 | Bacteria | 15747 |
| 199 | Ga0097621_100000754 | 3300006237 | Bacteria | 22721 |
| 200 | Ga0097621_100028703 | 3300006237 | Bacteria | 4387 |
| 201 | Ga0097621_101106566 | 3300006237 | Bacteria | 744 |
| 202 | Ga0068871_100003878 | 3300006358 | Bacteria | 10311 |
| 203 | Ga0068871_100009731 | 3300006358 | Bacteria | 6978 |
| 204 | Ga0068871_100367069 | 3300006358 | Unclassified | 1276 |
| 205 | Ga0068871_101363878 | 3300006358 | Bacteria | 668 |
| 206 | Ga0075428_100001502 | 3300006844 | Bacteria | 24964 |
| 207 | Ga0075428_100016740 | 3300006844 | Bacteria | 8096 |
| 208 | Ga0075428_100101531 | 3300006844 | Bacteria | 3136 |
| 209 | Ga0075428_100169137 | 3300006844 | Bacteria | 2370 |
| 210 | Ga0075428_100185437 | 3300006844 | Bacteria | 2251 |
| 211 | Ga0075428_100209874 | 3300006844 | Bacteria | 2104 |
| 212 | Ga0075428_100277743 | 3300006844 | Bacteria | 1802 |
| 213 | Ga0075428_100370279 | 3300006844 | Bacteria | 1536 |
| 214 | Ga0075428_100400711 | 3300006844 | Bacteria | 1471 |
| 215 | Ga0075428_100533781 | 3300006844 | Unclassified | 1254 |
| 216 | Ga0075428_100583307 | 3300006844 | Bacteria | 1194 |
| 217 | Ga0075428_100846073 | 3300006844 | Bacteria | 971 |
| 218 | Ga0075428_100970926 | 3300006844 | Bacteria | 900 |
| 219 | Ga0075428_101384707 | 3300006844 | Bacteria | 738 |
| 220 | Ga0075428_101511895 | 3300006844 | Bacteria | 703 |
| 221 | Ga0075428_101908210 | 3300006844 | Bacteria | 617 |
| 222 | Ga0075428_102122220 | 3300006844 | Bacteria | 581 |
| 223 | Ga0075428_102475135 | 3300006844 | Bacteria | 532 |
| 224 | Ga0075430_100001098 | 3300006846 | Bacteria | 21488 |
| 225 | Ga0075430_100002189 | 3300006846 | Bacteria | 16184 |
| 226 | Ga0075430_100004241 | 3300006846 | Bacteria | 12110 |
| 227 | Ga0075430_100011150 | 3300006846 | Bacteria | 7618 |
| 228 | Ga0075430_100044526 | 3300006846 | Bacteria | 3751 |
| 229 | Ga0075430_100243501 | 3300006846 | Bacteria | 1490 |
| 230 | Ga0075430_100251596 | 3300006846 | Bacteria | 1464 |
| 231 | Ga0075430_100351842 | 3300006846 | Bacteria | 1216 |
| 232 | Ga0075430_100736214 | 3300006846 | Bacteria | 813 |
| 233 | Ga0075430_101346514 | 3300006846 | Bacteria | 587 |
| 234 | Ga0075430_101660051 | 3300006846 | Unclassified | 524 |
| 235 | Ga0075431_100012939 | 3300006847 | Bacteria | 8423 |
| 236 | Ga0075431_100021216 | 3300006847 | Bacteria | 6638 |
| 237 | Ga0075431_100059320 | 3300006847 | Bacteria | 3949 |
| 238 | Ga0075431_100115679 | 3300006847 | Bacteria | 2769 |
| 239 | Ga0075431_100145224 | 3300006847 | Bacteria | 2445 |
| 240 | Ga0075431_100150292 | 3300006847 | Bacteria | 2399 |
| 241 | Ga0075431_100276979 | 3300006847 | Bacteria | 1699 |
| 242 | Ga0075431_100317579 | 3300006847 | Bacteria | 1571 |
| 243 | Ga0075431_100355586 | 3300006847 | Unclassified | 1472 |
| 244 | Ga0075431_100729205 | 3300006847 | Bacteria | 967 |
| 245 | Ga0075431_101512254 | 3300006847 | Bacteria | 630 |
| 246 | Ga0075431_101849872 | 3300006847 | Unclassified | 560 |
| 247 | Ga0075433_10011246 | 3300006852 | Bacteria | 7205 |
| 248 | Ga0075433_10033804 | 3300006852 | Bacteria | 4386 |
| 249 | Ga0075433_10060852 | 3300006852 | Bacteria | 3307 |
| 250 | Ga0075433_10131534 | 3300006852 | Bacteria | 2223 |
| 251 | Ga0075433_10131656 | 3300006852 | Bacteria | 2222 |
| 252 | Ga0075433_10154480 | 3300006852 | Bacteria | 2042 |
| 253 | Ga0075433_11540808 | 3300006852 | Bacteria | 574 |
| 254 | Ga0075434_100006963 | 3300006871 | Bacteria | 10421 |
| 255 | Ga0075434_100043103 | 3300006871 | Bacteria | 4474 |
| 256 | Ga0075434_100064939 | 3300006871 | Bacteria | 3635 |
| 257 | Ga0075434_100083230 | 3300006871 | Bacteria | 3197 |
| 258 | Ga0075434_100156612 | 3300006871 | Bacteria | 2297 |
| 259 | Ga0075434_100379461 | 3300006871 | Bacteria | 1434 |
| 260 | Ga0075434_100389302 | 3300006871 | Bacteria | 1415 |
| 261 | Ga0075434_101351586 | 3300006871 | Bacteria | 723 |
| 262 | Ga0075434_101359723 | 3300006871 | Bacteria | 720 |
| 263 | Ga0075434_101777379 | 3300006871 | Bacteria | 623 |
| 264 | Ga0075434_101787199 | 3300006871 | Bacteria | 622 |
| 265 | Ga0075434_101958202 | 3300006871 | Bacteria | 591 |
| 266 | Ga0075429_100000055 | 3300006880 | Bacteria | 55152 |
| 267 | Ga0075429_100000432 | 3300006880 | Bacteria | 31238 |
| 268 | Ga0075429_100001365 | 3300006880 | Bacteria | 19968 |
| 269 | Ga0075429_100028891 | 3300006880 | Bacteria | 4816 |
| 270 | Ga0075429_100044996 | 3300006880 | Bacteria | 3840 |
| 271 | Ga0075429_100098316 | 3300006880 | Bacteria | 2554 |
| 272 | Ga0075429_100184447 | 3300006880 | Bacteria | 1828 |
| 273 | Ga0075429_100473842 | 3300006880 | Bacteria | 1097 |
| 274 | Ga0075429_101677911 | 3300006880 | Bacteria | 552 |
| 275 | Ga0075429_101964715 | 3300006880 | Unclassified | 507 |
| 276 | Ga0068865_100001524 | 3300006881 | Bacteria | 13518 |
| 277 | Ga0068865_100040545 | 3300006881 | Bacteria | 3165 |
| 278 | Ga0068865_100252665 | 3300006881 | Bacteria | 1392 |
| 279 | Ga0075436_100007888 | 3300006914 | Bacteria | 7286 |
| 280 | Ga0075436_100114402 | 3300006914 | Bacteria | 1884 |
| 281 | Ga0097620_100000420 | 3300006931 | Bacteria | 42401 |
| 282 | Ga0097620_100181248 | 3300006931 | Bacteria | 2189 |
| 283 | Ga0097620_100332394 | 3300006931 | Bacteria | 1614 |
| 284 | Ga0097620_100509803 | 3300006931 | Bacteria | 1298 |
| 285 | Ga0097620_100894455 | 3300006931 | Bacteria | 973 |
| 286 | Ga0075435_100007468 | 3300007076 | Bacteria | 7793 |
| 287 | Ga0075435_100024358 | 3300007076 | Bacteria | 4696 |
| 288 | Ga0075435_100048103 | 3300007076 | Bacteria | 3425 |
| 289 | Ga0075435_100200586 | 3300007076 | Bacteria | 1690 |
| 290 | Ga0075435_100201259 | 3300007076 | Bacteria | 1688 |
| 291 | Ga0075435_100351769 | 3300007076 | Bacteria | 1263 |
| 292 | Ga0075435_101268334 | 3300007076 | Bacteria | 645 |
| 293 | Ga0099794_10064805 | 3300007265 | Bacteria | 1781 |
| 294 | Ga0099794_10295389 | 3300007265 | Bacteria | 839 |
| 295 | Ga0099794_10494406 | 3300007265 | Bacteria | 643 |
| 296 | Ga0099795_10335698 | 3300007788 | Bacteria | 673 |
| 297 | Ga0099795_10425416 | 3300007788 | Unclassified | 607 |
| 298 | Ga0105240_12017022 | 3300009093 | Bacteria | 599 |
| 299 | Ga0111539_10006184 | 3300009094 | Bacteria | 15445 |
| 300 | Ga0111539_10026623 | 3300009094 | Bacteria | 7069 |
| 301 | Ga0111539_10088217 | 3300009094 | Bacteria | 3645 |
| 302 | Ga0111539_10102104 | 3300009094 | Bacteria | 3366 |
| 303 | Ga0111539_10131305 | 3300009094 | Bacteria | 2933 |
| 304 | Ga0111539_10184796 | 3300009094 | Bacteria | 2434 |
| 305 | Ga0111539_10237023 | 3300009094 | Bacteria | 2124 |
| 306 | Ga0111539_10240452 | 3300009094 | Bacteria | 2108 |
| 307 | Ga0111539_10251855 | 3300009094 | Bacteria | 2056 |
| 308 | Ga0111539_10402779 | 3300009094 | Bacteria | 1594 |
| 309 | Ga0111539_10782009 | 3300009094 | Bacteria | 1111 |
| 310 | Ga0111539_11135043 | 3300009094 | Bacteria | 908 |
| 311 | Ga0111539_11245919 | 3300009094 | Bacteria | 864 |
| 312 | Ga0111539_11980314 | 3300009094 | Bacteria | 676 |
| 313 | Ga0105245_10012764 | 3300009098 | Bacteria | 7317 |
| 314 | Ga0114129_10002987 | 3300009147 | Bacteria | 23703 |
| 315 | Ga0114129_10006327 | 3300009147 | Bacteria | 16791 |
| 316 | Ga0114129_10012532 | 3300009147 | Bacteria | 12074 |
| 317 | Ga0114129_10030430 | 3300009147 | Bacteria | 7639 |
| 318 | Ga0114129_10060555 | 3300009147 | Bacteria | 5293 |
| 319 | Ga0114129_10067680 | 3300009147 | Bacteria | 4981 |
| 320 | Ga0114129_10073085 | 3300009147 | Bacteria | 4778 |
| 321 | Ga0114129_10124456 | 3300009147 | Bacteria | 3546 |
| 322 | Ga0114129_10224122 | 3300009147 | Bacteria | 2535 |
| 323 | Ga0114129_10237706 | 3300009147 | Bacteria | 2450 |
| 324 | Ga0114129_10281729 | 3300009147 | Bacteria | 2221 |
| 325 | Ga0114129_10299009 | 3300009147 | Bacteria | 2146 |
| 326 | Ga0114129_10301114 | 3300009147 | Bacteria | 2137 |
| 327 | Ga0114129_10308584 | 3300009147 | Bacteria | 2107 |
| 328 | Ga0114129_10356472 | 3300009147 | Bacteria | 1936 |
| 329 | Ga0114129_10365692 | 3300009147 | Bacteria | 1908 |
| 330 | Ga0114129_10768525 | 3300009147 | Unclassified | 1232 |
| 331 | Ga0114129_11628529 | 3300009147 | Unclassified | 789 |
| 332 | Ga0114129_12639983 | 3300009147 | Bacteria | 599 |
| 333 | Ga0105243_10002912 | 3300009148 | Bacteria | 14169 |
| 334 | Ga0105243_10035086 | 3300009148 | Bacteria | 3888 |
| 335 | Ga0105241_10044445 | 3300009174 | Bacteria | 3366 |
| 336 | Ga0105241_11425235 | 3300009174 | Bacteria | 664 |
| 337 | Ga0105242_10000248 | 3300009176 | Bacteria | 42523 |
| 338 | Ga0105242_10227045 | 3300009176 | Bacteria | 1671 |
| 339 | Ga0105248_10631497 | 3300009177 | Bacteria | 1208 |
| 340 | Ga0105248_12160258 | 3300009177 | Unclassified | 633 |
| 341 | Ga0105248_12161144 | 3300009177 | Bacteria | 633 |
| 342 | Ga0105237_11902219 | 3300009545 | Archaea | 603 |
| 343 | Ga0105237_12111053 | 3300009545 | Bacteria | 572 |
| 344 | Ga0105249_10054817 | 3300009553 | Bacteria | 3646 |
| 345 | Ga0105249_10066654 | 3300009553 | Bacteria | 3315 |
| 346 | Ga0105249_10287100 | 3300009553 | Bacteria | 1645 |
| 347 | Ga0105249_10539275 | 3300009553 | Bacteria | 1216 |
| 348 | Ga0105249_11122045 | 3300009553 | Bacteria | 857 |
| 349 | Ga0105249_12037070 | 3300009553 | Bacteria | 647 |
| 350 | Ga0105239_10199942 | 3300010375 | Bacteria | 2239 |
| 351 | Ga0157374_11997332 | 3300013296 | Bacteria | 606 |
| 352 | Ga0157378_10000387 | 3300013297 | Bacteria | 43542 |
| 353 | Ga0157378_10108512 | 3300013297 | Bacteria | 2542 |
| 354 | Ga0157378_10721705 | 3300013297 | Bacteria | 1017 |
| 355 | Ga0157378_11255069 | 3300013297 | Bacteria | 781 |
| 356 | Ga0163162_10633774 | 3300013306 | Bacteria | 1193 |
| 357 | Ga0163162_11634273 | 3300013306 | Bacteria | 735 |
| 358 | Ga0163162_11694773 | 3300013306 | Bacteria | 722 |
| 359 | Ga0163162_11740112 | 3300013306 | Bacteria | 712 |
| 360 | Ga0163162_12447749 | 3300013306 | Bacteria | 600 |
| 361 | Ga0157372_11314907 | 3300013307 | Bacteria | 834 |
| 362 | Ga0157375_12124567 | 3300013308 | Unclassified | 668 |
| 363 | Ga0157380_10011921 | 3300014326 | Bacteria | 6289 |
| 364 | Ga0157380_10025684 | 3300014326 | Bacteria | 4469 |
| 365 | Ga0157380_11671134 | 3300014326 | Bacteria | 694 |
| 366 | Ga0157380_13121355 | 3300014326 | Unclassified | 528 |
| 367 | Ga0157377_10603151 | 3300014745 | Unclassified | 783 |
| 368 | Ga0157376_10012006 | 3300014969 | Bacteria | 6410 |
| 369 | Ga0157376_11450566 | 3300014969 | Unclassified | 719 |
| 370 | Ga0163161_10365627 | 3300017792 | Unclassified | 1150 |
| 371 | Ga0163161_11353484 | 3300017792 | Bacteria | 620 |
| 372 | Ga0213875_10072124 | 3300021388 | Bacteria | 1612 |
| 373 | Ga0207666_1045861 | 3300025271 | Unclassified | 688 |
| 374 | Ga0207653_10004764 | 3300025885 | Bacteria | 4242 |
| 375 | Ga0207682_10363490 | 3300025893 | Unclassified | 682 |
| 376 | Ga0207692_10180675 | 3300025898 | Bacteria | 1229 |
| 377 | Ga0207642_10005011 | 3300025899 | Bacteria | 4300 |
| 378 | Ga0207642_10053835 | 3300025899 | Bacteria | 1832 |
| 379 | Ga0207688_10057485 | 3300025901 | Bacteria | 2187 |
| 380 | Ga0207688_10617023 | 3300025901 | Bacteria | 684 |
| 381 | Ga0207680_10055662 | 3300025903 | Bacteria | 2385 |
| 382 | Ga0207645_10049224 | 3300025907 | Bacteria | 2691 |
| 383 | Ga0207645_10472831 | 3300025907 | Bacteria | 847 |
| 384 | Ga0207645_11018987 | 3300025907 | Unclassified | 560 |
| 385 | Ga0207643_10064864 | 3300025908 | Bacteria | 2091 |
| 386 | Ga0207643_10077561 | 3300025908 | Bacteria | 1921 |
| 387 | Ga0207684_10019497 | 3300025910 | Bacteria | 5800 |
| 388 | Ga0207684_10399399 | 3300025910 | Bacteria | 1182 |
| 389 | Ga0207654_10252025 | 3300025911 | Bacteria | 1184 |
| 390 | Ga0207707_10011165 | 3300025912 | Bacteria | 7813 |
| 391 | Ga0207663_10302475 | 3300025916 | Bacteria | 1196 |
| 392 | Ga0207660_10041586 | 3300025917 | Bacteria | 3222 |
| 393 | Ga0207660_10043670 | 3300025917 | Bacteria | 3150 |
| 394 | Ga0207660_10067317 | 3300025917 | Bacteria | 2594 |
| 395 | Ga0207660_10160542 | 3300025917 | Bacteria | 1734 |
| 396 | Ga0207660_10562741 | 3300025917 | Bacteria | 928 |
| 397 | Ga0207660_11075085 | 3300025917 | Bacteria | 656 |
| 398 | Ga0207662_10000095 | 3300025918 | Bacteria | 41923 |
| 399 | Ga0207662_10268917 | 3300025918 | Bacteria | 1124 |
| 400 | Ga0207652_10026429 | 3300025921 | Bacteria | 4835 |
| 401 | Ga0207646_10003246 | 3300025922 | Bacteria | 18533 |
| 402 | Ga0207646_10858213 | 3300025922 | Bacteria | 807 |
| 403 | Ga0207681_10194022 | 3300025923 | Bacteria | 1556 |
| 404 | Ga0207681_10208421 | 3300025923 | Bacteria | 1505 |
| 405 | Ga0207681_10311137 | 3300025923 | Bacteria | 1249 |
| 406 | Ga0207681_11610792 | 3300025923 | Unclassified | 543 |
| 407 | Ga0207659_10024348 | 3300025926 | Bacteria | 4055 |
| 408 | Ga0207659_10159000 | 3300025926 | Bacteria | 1772 |
| 409 | Ga0207659_11863080 | 3300025926 | Unclassified | 510 |
| 410 | Ga0207687_10003242 | 3300025927 | Bacteria | 11024 |
| 411 | Ga0207687_11727265 | 3300025927 | Bacteria | 536 |
| 412 | Ga0207644_10408267 | 3300025931 | Bacteria | 1111 |
| 413 | Ga0207644_10933887 | 3300025931 | Bacteria | 727 |
| 414 | Ga0207690_10673940 | 3300025932 | Bacteria | 849 |
| 415 | Ga0207706_11152731 | 3300025933 | Bacteria | 646 |
| 416 | Ga0207686_10001874 | 3300025934 | Bacteria | 11669 |
| 417 | Ga0207709_10001439 | 3300025935 | Bacteria | 16614 |
| 418 | Ga0207709_10040568 | 3300025935 | Bacteria | 2788 |
| 419 | Ga0207670_10002023 | 3300025936 | Bacteria | 10646 |
| 420 | Ga0207670_10115149 | 3300025936 | Bacteria | 1944 |
| 421 | Ga0207669_10016254 | 3300025937 | Bacteria | 3776 |
| 422 | Ga0207704_10000623 | 3300025938 | Bacteria | 15673 |
| 423 | Ga0207704_10040114 | 3300025938 | Bacteria | 2733 |
| 424 | Ga0207704_10467020 | 3300025938 | Bacteria | 1010 |
| 425 | Ga0207665_10129051 | 3300025939 | Bacteria | 1793 |
| 426 | Ga0207665_10374736 | 3300025939 | Bacteria | 1079 |
| 427 | Ga0207691_10396080 | 3300025940 | Bacteria | 1178 |
| 428 | Ga0207711_11247717 | 3300025941 | Bacteria | 685 |
| 429 | Ga0207689_10000977 | 3300025942 | Bacteria | 27402 |
| 430 | Ga0207689_10048172 | 3300025942 | Bacteria | 3515 |
| 431 | Ga0207689_10284782 | 3300025942 | Bacteria | 1368 |
| 432 | Ga0207689_10986962 | 3300025942 | Bacteria | 710 |
| 433 | Ga0207661_10561417 | 3300025944 | Bacteria | 1046 |
| 434 | Ga0207712_10013536 | 3300025961 | Bacteria | 5231 |
| 435 | Ga0207712_10108426 | 3300025961 | Bacteria | 2078 |
| 436 | Ga0207712_10587580 | 3300025961 | Bacteria | 962 |
| 437 | Ga0207712_10665316 | 3300025961 | Bacteria | 906 |
| 438 | Ga0207712_11313584 | 3300025961 | Bacteria | 646 |
| 439 | Ga0207668_10083070 | 3300025972 | Bacteria | 2330 |
| 440 | Ga0207668_10163260 | 3300025972 | Bacteria | 1738 |
| 441 | Ga0207640_10019295 | 3300025981 | Bacteria | 4026 |
| 442 | Ga0207640_10627586 | 3300025981 | Bacteria | 913 |
| 443 | Ga0207677_10017944 | 3300026023 | Bacteria | 4236 |
| 444 | Ga0207677_11316375 | 3300026023 | Bacteria | 664 |
| 445 | Ga0207677_11911674 | 3300026023 | Unclassified | 551 |
| 446 | Ga0207703_10012439 | 3300026035 | Bacteria | 6635 |
| 447 | Ga0207703_10018478 | 3300026035 | Bacteria | 5444 |
| 448 | Ga0207678_10460086 | 3300026067 | Bacteria | 1106 |
| 449 | Ga0207708_10000551 | 3300026075 | Bacteria | 28958 |
| 450 | Ga0207708_10005521 | 3300026075 | Bacteria | 9333 |
| 451 | Ga0207708_11361306 | 3300026075 | Archaea | 622 |
| 452 | Ga0207702_10064024 | 3300026078 | Bacteria | 3146 |
| 453 | Ga0207648_10000513 | 3300026089 | Bacteria | 43298 |
| 454 | Ga0207648_10002477 | 3300026089 | Bacteria | 19838 |
| 455 | Ga0207648_10076446 | 3300026089 | Bacteria | 2919 |
| 456 | Ga0207648_10233922 | 3300026089 | Bacteria | 1635 |
| 457 | Ga0207676_10760790 | 3300026095 | Unclassified | 943 |
| 458 | Ga0207674_10810244 | 3300026116 | Unclassified | 903 |
| 459 | Ga0207674_11950776 | 3300026116 | Bacteria | 553 |
| 460 | Ga0207675_100001063 | 3300026118 | Bacteria | 27254 |
| 461 | Ga0207675_100104513 | 3300026118 | Bacteria | 2669 |
| 462 | Ga0207675_100796735 | 3300026118 | Bacteria | 958 |
| 463 | Ga0207675_101912505 | 3300026118 | Unclassified | 612 |
| 464 | Ga0207683_10080122 | 3300026121 | Bacteria | 2896 |
| 465 | Ga0207698_10742700 | 3300026142 | Bacteria | 980 |
| 466 | Ga0209969_1018790 | 3300027360 | Bacteria | 1023 |
| 467 | Ga0209967_1015009 | 3300027364 | Bacteria | 1107 |
| 468 | Ga0209981_1010132 | 3300027378 | Bacteria | 1291 |
| 469 | Ga0210000_1015710 | 3300027462 | Bacteria | 1141 |
| 470 | Ga0209968_1047314 | 3300027526 | Bacteria | 742 |
| 471 | Ga0209970_1003183 | 3300027614 | Bacteria | 2774 |
| 472 | Ga0209588_1027778 | 3300027671 | Bacteria | 1801 |
| 473 | Ga0209971_1003253 | 3300027682 | Bacteria | 3870 |
| 474 | Ga0209966_1002671 | 3300027695 | Bacteria | 2984 |
| 475 | Ga0209998_10009892 | 3300027717 | Unclassified | 1977 |
| 476 | Ga0209813_10243775 | 3300027866 | Bacteria | 680 |
| 477 | Ga0209974_10148155 | 3300027876 | Bacteria | 846 |
| 478 | Ga0207428_10000288 | 3300027907 | Bacteria | 67876 |
| 479 | Ga0207428_10011126 | 3300027907 | Bacteria | 7987 |
| 480 | Ga0207428_10081245 | 3300027907 | Bacteria | 2531 |
| 481 | Ga0207428_10129247 | 3300027907 | Bacteria | 1934 |
| 482 | Ga0207428_10212262 | 3300027907 | Bacteria | 1454 |
| 483 | Ga0207428_10872034 | 3300027907 | Bacteria | 637 |
| 484 | Ga0268265_10009410 | 3300028380 | Bacteria | 6598 |
| 485 | Ga0268265_10043725 | 3300028380 | Bacteria | 3331 |
| 486 | Ga0268265_10409679 | 3300028380 | Bacteria | 1256 |
| 487 | Ga0268265_10714535 | 3300028380 | Unclassified | 969 |
| 488 | Ga0268264_10005879 | 3300028381 | Bacteria | 10384 |
| 489 | Ga0268264_10087084 | 3300028381 | Bacteria | 2685 |
| 490 | Ga0307408_100108002 | 3300031548 | Unclassified | 2132 |
| 491 | Ga0307408_101546949 | 3300031548 | Bacteria | 628 |
| 492 | Ga0307408_102465983 | 3300031548 | Unclassified | 505 |
| 493 | Ga0307408_102508862 | 3300031548 | Unclassified | 501 |
| 494 | Ga0307405_10323688 | 3300031731 | Bacteria | 1179 |
| 495 | Ga0307410_10524901 | 3300031852 | Unclassified | 978 |
| 496 | Ga0307410_11031064 | 3300031852 | Bacteria | 711 |
| 497 | Ga0307410_11889599 | 3300031852 | Unclassified | 531 |
| 498 | Ga0307407_10112275 | 3300031903 | Bacteria | 1713 |
| 499 | Ga0307407_11375041 | 3300031903 | Bacteria | 556 |
| 500 | Ga0307412_10283588 | 3300031911 | Bacteria | 1302 |
| 501 | Ga0307412_11074838 | 3300031911 | Bacteria | 715 |
| 502 | Ga0307409_100094044 | 3300031995 | Bacteria | 2465 |
| 503 | Ga0307416_100218413 | 3300032002 | Bacteria | 1826 |
| 504 | Ga0307416_100480818 | 3300032002 | Unclassified | 1302 |
| 505 | Ga0307416_101129270 | 3300032002 | Bacteria | 889 |
| 506 | Ga0307416_101873284 | 3300032002 | Bacteria | 703 |
| 507 | Ga0307416_102076379 | 3300032002 | Unclassified | 670 |
| 508 | Ga0307416_102708381 | 3300032002 | Bacteria | 592 |
| 509 | Ga0307416_102808169 | 3300032002 | Unclassified | 582 |
| 510 | Ga0307416_103143362 | 3300032002 | Bacteria | 552 |
| 511 | Ga0307416_103284057 | 3300032002 | Bacteria | 541 |
| 512 | Ga0307411_10210161 | 3300032005 | Bacteria | 1502 |
| 513 | Ga0307411_10318321 | 3300032005 | Bacteria | 1255 |
| 514 | Ga0307411_10569643 | 3300032005 | Bacteria | 969 |
| 515 | Ga0307415_101071647 | 3300032126 | Bacteria | 753 |
| 516 | Ga0373930_0054789 | 3300034816 | Bacteria | 878 |
| 517 | Ga0373930_0078431 | 3300034816 | Bacteria | 760 |
| 518 | Ga0373948_0011845 | 3300034817 | Bacteria | 1550 |
| 519 | Ga0373958_0194446 | 3300034819 | Bacteria | 528 |
| 520 | Ga0373959_0026875 | 3300034820 | Bacteria | 1140 |
| 521 | Ga0373938_0238554 | 3300034957 | Unclassified | 516 |
| 522 | Ga0373926_0002148 | 3300035083 | Bacteria | 6207 |
| 523 | Ga0373928_0005303 | 3300035084 | Unclassified | 2461 |
| 524 | Ga0373928_0010322 | 3300035084 | Bacteria | 1834 |
| 525 | Ga0373928_0072121 | 3300035084 | Bacteria | 856 |
| 526 | Ga0373934_0100950 | 3300035086 | Unclassified | 1167 |
| 527 | Ga0373940_0002387 | 3300035088 | Bacteria | 3642 |
| 528 | Ga0373940_0065041 | 3300035088 | Bacteria | 1051 |
| 529 | Ga0373940_0087889 | 3300035088 | Bacteria | 927 |
| 530 | Ga0373944_0005437 | 3300035089 | Bacteria | 3354 |
| 531 | Ga0373949_0127897 | 3300035090 | Bacteria | 719 |
| 532 | Ga0373951_0026089 | 3300035091 | Bacteria | 1360 |
| 533 | Ga0373951_0048705 | 3300035091 | Bacteria | 1038 |
| 534 | Ga0373951_0208294 | 3300035091 | Bacteria | 572 |
| 535 | Ga0373952_0004949 | 3300035092 | Bacteria | 2424 |
| 536 | Ga0373952_0261350 | 3300035092 | Bacteria | 527 |
| 537 | Ga0373923_0062044 | 3300035111 | Bacteria | 1590 |
| 538 | Ga0373932_0002691 | 3300035112 | Bacteria | 4422 |
| 539 | Ga0373932_0024935 | 3300035112 | Bacteria | 1614 |
| 540 | Ga0373932_0051987 | 3300035112 | Bacteria | 1219 |
| 541 | Ga0373932_0076916 | 3300035112 | Bacteria | 1047 |
| 542 | Ga0373932_0224809 | 3300035112 | Unclassified | 676 |
| 543 | Ga0373932_0254490 | 3300035112 | Bacteria | 642 |
| 544 | Ga0373932_0340476 | 3300035112 | Unclassified | 568 |
| 545 | Ga0373936_0040361 | 3300035113 | Bacteria | 1869 |
| 546 | Ga0373939_0007089 | 3300035114 | Bacteria | 2714 |
| 547 | Ga0373939_0044303 | 3300035114 | Bacteria | 1354 |
| 548 | Ga0373939_0052296 | 3300035114 | Bacteria | 1273 |
| 549 | Ga0373939_0068016 | 3300035114 | Unclassified | 1152 |
| 550 | Ga0373939_0076110 | 3300035114 | Bacteria | 1104 |
| 551 | Ga0373939_0110226 | 3300035114 | Bacteria | 957 |
| 552 | Ga0373941_0005268 | 3300035115 | Bacteria | 3033 |
| 553 | Ga0373941_0017198 | 3300035115 | Bacteria | 1977 |
| 554 | Ga0373941_0019880 | 3300035115 | Bacteria | 1876 |
| 555 | Ga0373941_0143279 | 3300035115 | Bacteria | 871 |
| 556 | Ga0373941_0376150 | 3300035115 | Bacteria | 583 |
| 557 | Ga0373945_0048244 | 3300035116 | Bacteria | 1559 |
| 558 | Ga0373954_0000030 | 3300035118 | Bacteria | 55716 |
| 559 | Ga0373954_0259205 | 3300035118 | Bacteria | 856 |
| 560 | Ga0373957_0056107 | 3300035120 | Bacteria | 1516 |
| 561 | Ga0373960_0022032 | 3300035121 | Bacteria | 1701 |
| 562 | Ga0373960_0028430 | 3300035121 | Bacteria | 1543 |
| 563 | Ga0373960_0037436 | 3300035121 | Bacteria | 1386 |
| 564 | Ga0373943_0068348 | 3300035170 | Bacteria | 1793 |
| 565 | Ga0373946_0047609 | 3300035171 | Bacteria | 1781 |
| 566 | Ga0373955_0084477 | 3300035172 | Bacteria | 1800 |
| 567 | Ga0373955_0353705 | 3300035172 | Unclassified | 890 |
| 568 | Ga0373942_0019869 | 3300035207 | Bacteria | 1681 |
| 569 | Ga0373942_0058599 | 3300035207 | Unclassified | 1098 |
| 570 | Ga0373942_0063190 | 3300035207 | Bacteria | 1065 |
| 571 | Ga0373942_0131809 | 3300035207 | Bacteria | 789 |
| 572 | Ga0373961_0021631 | 3300035241 | Unclassified | 1713 |
| 573 | Ga0373961_0038197 | 3300035241 | Bacteria | 1375 |
| 574 | Ga0373961_0073549 | 3300035241 | Bacteria | 1061 |
| 575 | Ga0373961_0105621 | 3300035241 | Bacteria | 917 |
| 576 | Ga0373961_0448189 | 3300035241 | Bacteria | 503 |
| 577 | Ga0373962_0008702 | 3300035242 | Bacteria | 2504 |
| 578 | Ga0373962_0012184 | 3300035242 | Bacteria | 2164 |
| 579 | Ga0373962_0013605 | 3300035242 | Bacteria | 2064 |
| 580 | Ga0373962_0100443 | 3300035242 | Bacteria | 902 |
| 581 | Ga0373962_0171366 | 3300035242 | Bacteria | 721 |
| 582 | Ga0373962_0357490 | 3300035242 | Unclassified | 529 |
| 583 | Ga0373924_0016098 | 3300035410 | Bacteria | 2852 |
| 584 | Ga0373931_0001918 | 3300035691 | Bacteria | 9111 |
| 585 | Ga0373931_0002342 | 3300035691 | Bacteria | 8366 |
| 586 | Ga0373931_0006328 | 3300035691 | Bacteria | 5524 |
| 587 | Ga0373931_0010421 | 3300035691 | Bacteria | 4467 |
| 588 | Ga0373931_0025771 | 3300035691 | Bacteria | 2987 |
| 589 | Ga0373931_0029473 | 3300035691 | Bacteria | 2818 |
| 590 | Ga0373931_0033364 | 3300035691 | Bacteria | 2668 |
| 591 | Ga0373931_0073169 | 3300035691 | Bacteria | 1875 |
| 592 | Ga0373931_0213618 | 3300035691 | Bacteria | 1158 |
| 593 | Ga0373931_0250445 | 3300035691 | Unclassified | 1077 |
| 594 | Ga0373931_1260027 | 3300035691 | Bacteria | 508 |
| 595 | Ga0373935_0125433 | 3300035692 | Bacteria | 1719 |
| 596 | Ga0373927_0008733 | 3300035695 | Bacteria | 6806 |
| 597 | Ga0373927_1012096 | 3300035695 | Bacteria | 548 |
| 598 | Ga0373933_0022210 | 3300035724 | Bacteria | 3611 |
| 599 | Ga0373947_0048561 | 3300035725 | Bacteria | 2546 |
| 600 | Ga0373937_0025516 | 3300036401 | Bacteria | 5335 |
| 601 | Ga0373937_0604372 | 3300036401 | Bacteria | 1041 |
| 602 | Ga0373937_0622877 | 3300036401 | Bacteria | 1024 |
| 603 | Ga0373925_0012851 | 3300037068 | Bacteria | 6065 |
| 604 | Ga0395900_0003092 | 3300037418 | Bacteria | 18074 |
| 605 | Ga0395898_0011090 | 3300037466 | Bacteria | 9384 |
| 606 | Ga0395905_0252699 | 3300037471 | Bacteria | 1647 |
| 607 | Ga0436364_1195800 | 3300037853 | Bacteria | 2751 |
| 608 | Ga0395901_0001902 | 3300038443 | Bacteria | 21558 |
| 609 | Ga0436365_1664112 | 3300039437 | Bacteria | 1359 |
| 610 | Ga0436365_1801159 | 3300039437 | Bacteria | 2440 |
| 611 | Ga0451807_2725195 | 3300041486 | Bacteria | 2599 |
| 612 | Ga0451839_0304386 | 3300041496 | Bacteria | 757 |
| 613 | Ga0439441_087449 | 3300042001 | Unclassified | 685 |
| 614 | Ga0439441_185385 | 3300042001 | Bacteria | 502 |
| 615 | Ga0439456_117078 | 3300042013 | Unclassified | 609 |
| 616 | Ga0439435_0001468 | 3300042436 | Bacteria | 4378 |
| 617 | Ga0439460_0002117 | 3300042461 | Bacteria | 4757 |
| 618 | Ga0439460_0132936 | 3300042461 | Bacteria | 821 |
| 619 | Ga0439460_0175014 | 3300042461 | Bacteria | 724 |
| 620 | Ga0451577_0034679 | 3300042876 | Bacteria | 4547 |
| 621 | Ga0451577_0063848 | 3300042876 | Bacteria | 3284 |
| 622 | Ga0451577_0402867 | 3300042876 | Unclassified | 1242 |
| 623 | Ga0451577_0463491 | 3300042876 | Bacteria | 1151 |
| 624 | Ga0451577_0548330 | 3300042876 | Bacteria | 1050 |
| 625 | Ga0451577_0849017 | 3300042876 | Bacteria | 824 |
| 626 | Ga0439440_0147678 | 3300042993 | Bacteria | 671 |
| 627 | Ga0466972_0418143 | 3300044658 | Bacteria | 629 |
| 628 | Ga0453683_0191599 | 3300044673 | Bacteria | 1297 |
| 629 | Ga0466965_0060429 | 3300044683 | Bacteria | 1893 |
| 630 | Ga0466960_0450872 | 3300044901 | Bacteria | 748 |
| 631 | Ga0451576_0018030 | 3300045051 | Bacteria | 7745 |
| 632 | Ga0451576_0020308 | 3300045051 | Bacteria | 7235 |
| 633 | Ga0451576_0023304 | 3300045051 | Bacteria | 6703 |
| 634 | Ga0451576_0286661 | 3300045051 | Bacteria | 1721 |
| 635 | Ga0451576_0424788 | 3300045051 | Unclassified | 1394 |
| 636 | Ga0451576_0498059 | 3300045051 | Bacteria | 1280 |
| 637 | Ga0451576_1243971 | 3300045051 | Bacteria | 777 |
| 638 | Ga0466967_1536089 | 3300045976 | Bacteria | 663 |
| 639 | Ga0495592_0001475 | 3300046454 | Bacteria | 16364 |
| 640 | Ga0495603_0036255 | 3300046455 | Bacteria | 2961 |
| 641 | Ga0495629_0892549 | 3300046459 | Unclassified | 583 |
| 642 | Ga0495653_0012697 | 3300046463 | Bacteria | 6881 |
| 643 | Ga0495580_0002475 | 3300046472 | Bacteria | 16114 |
| 644 | Ga0495580_0190977 | 3300046472 | Bacteria | 1412 |
| 645 | Ga0495582_0036167 | 3300046473 | Bacteria | 2716 |
| 646 | Ga0495582_0129869 | 3300046473 | Bacteria | 1423 |
| 647 | Ga0495639_0331543 | 3300046475 | Bacteria | 762 |
| 648 | Ga0495662_0005331 | 3300046476 | Bacteria | 6441 |
| 649 | Ga0495662_0038196 | 3300046476 | Bacteria | 2320 |
| 650 | Ga0495584_0137983 | 3300046491 | Bacteria | 1238 |
| 651 | Ga0495608_0014819 | 3300046511 | Bacteria | 5408 |
| 652 | Ga0495608_0611753 | 3300046511 | Unclassified | 653 |
| 653 | Ga0495618_0097543 | 3300046514 | Bacteria | 1880 |
| 654 | Ga0495628_0091825 | 3300046516 | Bacteria | 2349 |
| 655 | Ga0495630_0016927 | 3300046517 | Bacteria | 5334 |
| 656 | Ga0495630_0066008 | 3300046517 | Bacteria | 2720 |
| 657 | Ga0495630_0141363 | 3300046517 | Bacteria | 1830 |
| 658 | Ga0495630_1115995 | 3300046517 | Unclassified | 598 |
| 659 | Ga0495666_0013108 | 3300046526 | Bacteria | 4130 |
| 660 | Ga0495666_0023766 | 3300046526 | Bacteria | 3031 |
| 661 | Ga0495642_0017372 | 3300046528 | Bacteria | 2811 |
| 662 | Ga0495642_0024669 | 3300046528 | Bacteria | 2380 |
| 663 | Ga0495642_0102755 | 3300046528 | Bacteria | 1217 |
| 664 | Ga0495652_0264328 | 3300046529 | Bacteria | 1268 |
| 665 | Ga0495652_0797629 | 3300046529 | Unclassified | 629 |
| 666 | Ga0495665_0062602 | 3300046531 | Bacteria | 1964 |
| 667 | Ga0495665_0348724 | 3300046531 | Unclassified | 754 |
| 668 | Ga0495640_0005456 | 3300046533 | Bacteria | 10118 |
| 669 | Ga0495640_0030921 | 3300046533 | Bacteria | 3828 |
| 670 | Ga0495586_0002272 | 3300046535 | Bacteria | 10454 |
| 671 | Ga0495586_0009170 | 3300046535 | Bacteria | 5265 |
| 672 | Ga0495587_0020738 | 3300046536 | Bacteria | 4054 |
| 673 | Ga0495587_0238668 | 3300046536 | Bacteria | 1023 |
| 674 | Ga0495598_0219483 | 3300046537 | Bacteria | 693 |
| 675 | Ga0495621_0164081 | 3300046539 | Bacteria | 880 |
| 676 | Ga0495621_0202782 | 3300046539 | Bacteria | 798 |
| 677 | Ga0495621_0318220 | 3300046539 | Bacteria | 648 |
| 678 | Ga0495645_0196269 | 3300046543 | Bacteria | 1372 |
| 679 | Ga0495667_0002694 | 3300046559 | Bacteria | 11880 |
| 680 | Ga0495667_0302105 | 3300046559 | Bacteria | 1014 |
| 681 | Ga0495656_0026757 | 3300046615 | Bacteria | 2299 |
| 682 | Ga0495656_0118188 | 3300046615 | Bacteria | 1248 |
| 683 | Ga0495656_0326102 | 3300046615 | Bacteria | 792 |
| 684 | Ga0495634_0003551 | 3300046642 | Bacteria | 12479 |
| 685 | Ga0495635_0109075 | 3300046663 | Bacteria | 1891 |
| 686 | Ga0495659_0059792 | 3300046664 | Bacteria | 1405 |
| 687 | Ga0495659_0061294 | 3300046664 | Bacteria | 1390 |
| 688 | Ga0495659_0095715 | 3300046664 | Bacteria | 1145 |
| 689 | Ga0495661_0390800 | 3300046665 | Bacteria | 678 |
| 690 | Ga0495588_0171347 | 3300046674 | Bacteria | 1147 |
| 691 | Ga0495599_0002703 | 3300046678 | Bacteria | 10357 |
| 692 | Ga0495599_0098574 | 3300046678 | Bacteria | 1822 |
| 693 | Ga0495646_0601941 | 3300046680 | Unclassified | 558 |
| 694 | Ga0495647_0001740 | 3300046681 | Bacteria | 6749 |
| 695 | Ga0495647_0154543 | 3300046681 | Bacteria | 985 |
| 696 | Ga0495647_0245078 | 3300046681 | Bacteria | 796 |
| 697 | Ga0495658_0013614 | 3300046683 | Bacteria | 4143 |
| 698 | Ga0495658_0024614 | 3300046683 | Bacteria | 3208 |
| 699 | Ga0495669_0016289 | 3300046684 | Bacteria | 3182 |
| 700 | Ga0495669_0050743 | 3300046684 | Bacteria | 1861 |
| 701 | Ga0495669_0307721 | 3300046684 | Bacteria | 764 |
| 702 | Ga0495669_0531461 | 3300046684 | Bacteria | 572 |
| 703 | Ga0495613_0003446 | 3300046689 | Bacteria | 11822 |
| 704 | Ga0495624_0194193 | 3300046690 | Bacteria | 1234 |
| 705 | Ga0495600_0077653 | 3300046809 | Bacteria | 2168 |
| 706 | Ga0495600_0136839 | 3300046809 | Bacteria | 1591 |
| 707 | Ga0495581_0131514 | 3300047315 | Bacteria | 1458 |
| 708 | Ga0495604_0002697 | 3300047317 | Bacteria | 14233 |
| 709 | Ga0495604_0538134 | 3300047317 | Unclassified | 754 |
| 710 | Ga0495636_0038176 | 3300047318 | Bacteria | 1986 |
| 711 | Ga0495636_0054880 | 3300047318 | Bacteria | 1675 |
| 712 | Ga0495636_0522371 | 3300047318 | Unclassified | 575 |
| 713 | Ga0495636_0651902 | 3300047318 | Unclassified | 517 |
| 714 | Ga0495674_0526202 | 3300047319 | Bacteria | 943 |
| 715 | Ga0495674_0860094 | 3300047319 | Unclassified | 702 |
| 716 | Ga0495680_0004055 | 3300047322 | Bacteria | 14117 |
| 717 | Ga0495680_0696338 | 3300047322 | Unclassified | 671 |
| 718 | Ga0495675_0215029 | 3300047444 | Bacteria | 1165 |
| 719 | Ga0495677_0158614 | 3300047445 | Bacteria | 873 |
| 720 | Ga0495684_0114616 | 3300047471 | Bacteria | 2032 |
| 721 | Ga0495684_0369720 | 3300047471 | Unclassified | 1014 |
| 722 | Ga0496100_0119819 | 3300048903 | Bacteria | 1839 |
| 723 | Ga0496101_0173194 | 3300048904 | Bacteria | 1659 |
| 724 | Ga0496102_0677997 | 3300048905 | Bacteria | 954 |
| 725 | Ga0496103_0092576 | 3300048906 | Bacteria | 1908 |
| 726 | Ga0496104_0047284 | 3300048907 | Bacteria | 4055 |
| 727 | Ga0496105_0160233 | 3300048908 | Bacteria | 1847 |
| 728 | Ga0496106_0023172 | 3300048909 | Bacteria | 4612 |
| 729 | Ga0496107_0013207 | 3300048910 | Bacteria | 5771 |
| 730 | Ga0496109_0003297 | 3300048912 | Bacteria | 13474 |
| 731 | Ga0496110_0016127 | 3300048913 | Bacteria | 6231 |
| 732 | Ga0496111_0384820 | 3300048914 | Bacteria | 1037 |
| 733 | Ga0496112_0048142 | 3300048915 | Bacteria | 4180 |
| 734 | Ga0496113_1003104 | 3300048916 | Bacteria | 657 |
| 735 | Ga0496115_0198577 | 3300048918 | Bacteria | 1657 |
| 736 | Ga0501299_101000 | 3300049522 | Bacteria | 670 |
| 737 | Ga0501299_119268 | 3300049522 | Bacteria | 634 |
| 738 | Ga0501031_0042679 | 3300049568 | Bacteria | 2960 |
| 739 | Ga0501032_0862865 | 3300049569 | Bacteria | 571 |
| 740 | Ga0501033_0006002 | 3300049570 | Bacteria | 9528 |
| 741 | Ga0501033_0066352 | 3300049570 | Bacteria | 2654 |
| 742 | Ga0501034_0199915 | 3300049571 | Bacteria | 1957 |
| 743 | Ga0501036_0002811 | 3300049572 | Bacteria | 13791 |
| 744 | Ga0501036_0186397 | 3300049572 | Bacteria | 1746 |
| 745 | Ga0501036_0373424 | 3300049572 | Bacteria | 1190 |
| 746 | Ga0501036_0555224 | 3300049572 | Bacteria | 954 |
| 747 | Ga0501036_1027854 | 3300049572 | Bacteria | 674 |
| 748 | Ga0501036_1029896 | 3300049572 | Bacteria | 673 |
| 749 | Ga0501036_1244350 | 3300049572 | Bacteria | 606 |
| 750 | Ga0501037_0016719 | 3300049573 | Bacteria | 5398 |
| 751 | Ga0501037_0536499 | 3300049573 | Bacteria | 791 |
| 752 | Ga0501037_0601433 | 3300049573 | Unclassified | 738 |
| 753 | Ga0501037_1120708 | 3300049573 | Bacteria | 509 |
| 754 | Ga0501038_0008069 | 3300049574 | Bacteria | 9687 |
| 755 | Ga0501038_0090474 | 3300049574 | Bacteria | 2565 |
| 756 | Ga0501038_0337775 | 3300049574 | Bacteria | 1175 |
| 757 | Ga0501039_0014392 | 3300049575 | Bacteria | 6058 |
| 758 | Ga0501039_0040879 | 3300049575 | Bacteria | 3579 |
| 759 | Ga0501039_0044419 | 3300049575 | Bacteria | 3432 |
| 760 | Ga0501039_0050433 | 3300049575 | Bacteria | 3220 |
| 761 | Ga0501039_0137551 | 3300049575 | Bacteria | 1918 |
| 762 | Ga0501039_0257536 | 3300049575 | Unclassified | 1372 |
| 763 | Ga0501039_0361291 | 3300049575 | Bacteria | 1141 |
| 764 | Ga0501039_1329603 | 3300049575 | Unclassified | 554 |
| 765 | Ga0501040_0000376 | 3300049576 | Bacteria | 26256 |
| 766 | Ga0501040_0020631 | 3300049576 | Bacteria | 4393 |
| 767 | Ga0501040_0021173 | 3300049576 | Bacteria | 4338 |
| 768 | Ga0501040_0055396 | 3300049576 | Bacteria | 2719 |
| 769 | Ga0501040_0118826 | 3300049576 | Bacteria | 1854 |
| 770 | Ga0501040_0967783 | 3300049576 | Bacteria | 617 |
| 771 | Ga0501041_0000609 | 3300049577 | Bacteria | 18677 |
| 772 | Ga0501041_0044711 | 3300049577 | Bacteria | 2691 |
| 773 | Ga0501041_0230173 | 3300049577 | Bacteria | 1164 |
| 774 | Ga0501041_0233771 | 3300049577 | Bacteria | 1154 |
| 775 | Ga0501041_0253432 | 3300049577 | Bacteria | 1106 |
| 776 | Ga0501041_0259263 | 3300049577 | Bacteria | 1093 |
| 777 | Ga0501041_0534239 | 3300049577 | Unclassified | 747 |
| 778 | Ga0501042_0000217 | 3300049578 | Bacteria | 27323 |
| 779 | Ga0501042_0029750 | 3300049578 | Bacteria | 3853 |
| 780 | Ga0501042_0298264 | 3300049578 | Bacteria | 1164 |
| 781 | Ga0501042_0728428 | 3300049578 | Bacteria | 721 |
| 782 | Ga0501042_0879999 | 3300049578 | Bacteria | 652 |
| 783 | Ga0501042_1233331 | 3300049578 | Bacteria | 545 |
| 784 | Ga0501043_0343407 | 3300049579 | Unclassified | 1135 |
| 785 | Ga0501043_0746534 | 3300049579 | Bacteria | 712 |
| 786 | Ga0501046_0003851 | 3300049580 | Bacteria | 13731 |
| 787 | Ga0501046_0036615 | 3300049580 | Bacteria | 3948 |
| 788 | Ga0501046_1113013 | 3300049580 | Unclassified | 545 |
| 789 | Ga0501046_1223563 | 3300049580 | Bacteria | 515 |
| 790 | Ga0501048_0001002 | 3300049582 | Bacteria | 21063 |
| 791 | Ga0501048_0193203 | 3300049582 | Bacteria | 1442 |
| 792 | Ga0501048_0217621 | 3300049582 | Bacteria | 1354 |
| 793 | Ga0501048_0635887 | 3300049582 | Bacteria | 766 |
| 794 | Ga0501048_0981891 | 3300049582 | Bacteria | 607 |
| 795 | Ga0501048_1149143 | 3300049582 | Bacteria | 558 |
| 796 | Ga0501067_0059070 | 3300049583 | Bacteria | 2123 |
| 797 | Ga0501067_0120572 | 3300049583 | Bacteria | 1459 |
| 798 | Ga0501067_0427476 | 3300049583 | Unclassified | 739 |
| 799 | Ga0501068_0072013 | 3300049584 | Bacteria | 2110 |
| 800 | Ga0501068_0414487 | 3300049584 | Bacteria | 869 |
| 801 | Ga0501068_0677900 | 3300049584 | Bacteria | 674 |
| 802 | Ga0501068_0816443 | 3300049584 | Bacteria | 612 |
| 803 | Ga0501068_0908294 | 3300049584 | Bacteria | 579 |
| 804 | Ga0501068_1208693 | 3300049584 | Unclassified | 501 |
| 805 | Ga0501069_0184637 | 3300049585 | Bacteria | 1206 |
| 806 | Ga0501070_0115292 | 3300049586 | Bacteria | 2219 |
| 807 | Ga0501071_0011096 | 3300049587 | Bacteria | 6056 |
| 808 | Ga0501071_0073797 | 3300049587 | Bacteria | 2489 |
| 809 | Ga0501071_0078746 | 3300049587 | Bacteria | 2409 |
| 810 | Ga0501071_0217319 | 3300049587 | Bacteria | 1438 |
| 811 | Ga0501071_0432788 | 3300049587 | Bacteria | 1006 |
| 812 | Ga0501071_0638314 | 3300049587 | Bacteria | 819 |
| 813 | Ga0501072_0008373 | 3300049588 | Bacteria | 7852 |
| 814 | Ga0501072_0023786 | 3300049588 | Bacteria | 4759 |
| 815 | Ga0501072_0062249 | 3300049588 | Bacteria | 2944 |
| 816 | Ga0501072_0108474 | 3300049588 | Bacteria | 2209 |
| 817 | Ga0501072_0350928 | 3300049588 | Bacteria | 1171 |
| 818 | Ga0501072_1101838 | 3300049588 | Bacteria | 618 |
| 819 | Ga0501072_1105660 | 3300049588 | Bacteria | 617 |
| 820 | Ga0501072_1240763 | 3300049588 | Unclassified | 578 |
| 821 | Ga0501073_0327130 | 3300049589 | Bacteria | 1058 |
| 822 | Ga0501073_0844070 | 3300049589 | Bacteria | 631 |
| 823 | Ga0501074_0054650 | 3300049590 | Bacteria | 2879 |
| 824 | Ga0501074_0280235 | 3300049590 | Bacteria | 1185 |
| 825 | Ga0501074_1300868 | 3300049590 | Unclassified | 509 |
| 826 | Ga0501075_0004474 | 3300049591 | Bacteria | 9463 |
| 827 | Ga0501075_0015921 | 3300049591 | Bacteria | 5408 |
| 828 | Ga0501075_0035366 | 3300049591 | Bacteria | 3725 |
| 829 | Ga0501075_0053786 | 3300049591 | Bacteria | 3028 |
| 830 | Ga0501075_0064978 | 3300049591 | Bacteria | 2752 |
| 831 | Ga0501075_0082723 | 3300049591 | Bacteria | 2431 |
| 832 | Ga0501075_0599301 | 3300049591 | Bacteria | 840 |
| 833 | Ga0501075_0604425 | 3300049591 | Bacteria | 836 |
| 834 | Ga0501076_0000526 | 3300049592 | Bacteria | 24329 |
| 835 | Ga0501076_0000778 | 3300049592 | Bacteria | 20562 |
| 836 | Ga0501076_0010510 | 3300049592 | Bacteria | 6869 |
| 837 | Ga0501076_0011445 | 3300049592 | Bacteria | 6609 |
| 838 | Ga0501076_0142561 | 3300049592 | Bacteria | 1947 |
| 839 | Ga0501076_0163537 | 3300049592 | Bacteria | 1814 |
| 840 | Ga0501076_0612339 | 3300049592 | Bacteria | 898 |
| 841 | Ga0501076_1366318 | 3300049592 | Bacteria | 582 |
| 842 | Ga0501077_0001082 | 3300049593 | Bacteria | 16418 |
| 843 | Ga0501077_0026200 | 3300049593 | Bacteria | 3700 |
| 844 | Ga0501077_0441809 | 3300049593 | Bacteria | 833 |
| 845 | Ga0501199_024935 | 3300049650 | Bacteria | 712 |
| 846 | Ga0501209_262894 | 3300049656 | Bacteria | 540 |
| 847 | Ga0501079_0000010 | 3300049741 | Bacteria | 73916 |
| 848 | Ga0501079_0017301 | 3300049741 | Bacteria | 5505 |
| 849 | Ga0501079_0023005 | 3300049741 | Bacteria | 4786 |
| 850 | Ga0501079_0053522 | 3300049741 | Bacteria | 3114 |
| 851 | Ga0501079_0098297 | 3300049741 | Bacteria | 2269 |
| 852 | Ga0501079_0176662 | 3300049741 | Bacteria | 1665 |
| 853 | Ga0501079_0351802 | 3300049741 | Unclassified | 1154 |
| 854 | Ga0501079_0363463 | 3300049741 | Bacteria | 1134 |
| 855 | Ga0501079_0429811 | 3300049741 | Bacteria | 1037 |
| 856 | Ga0501079_0474012 | 3300049741 | Bacteria | 983 |
| 857 | Ga0501080_0026635 | 3300049742 | Bacteria | 5372 |
| 858 | Ga0501080_0397483 | 3300049742 | Bacteria | 1240 |
| 859 | Ga0501080_0507160 | 3300049742 | Bacteria | 1078 |
| 860 | Ga0501080_0669886 | 3300049742 | Bacteria | 917 |
| 861 | Ga0501080_0750522 | 3300049742 | Bacteria | 858 |
| 862 | Ga0501081_0000811 | 3300049743 | Bacteria | 18451 |
| 863 | Ga0501081_0001107 | 3300049743 | Bacteria | 16185 |
| 864 | Ga0501081_0007636 | 3300049743 | Bacteria | 7015 |
| 865 | Ga0501081_0038926 | 3300049743 | Bacteria | 3252 |
| 866 | Ga0501081_0119593 | 3300049743 | Bacteria | 1875 |
| 867 | Ga0501081_1501706 | 3300049743 | Bacteria | 512 |
| 868 | Ga0501035_0041997 | 3300049822 | Bacteria | 4126 |
| 869 | Ga0501035_0116958 | 3300049822 | Bacteria | 2333 |
| 870 | Ga0501035_0246262 | 3300049822 | Bacteria | 1519 |
| 871 | Ga0501035_0620111 | 3300049822 | Bacteria | 880 |
| 872 | Ga0501044_0059444 | 3300049823 | Bacteria | 3916 |
| 873 | Ga0501045_0000946 | 3300049824 | Bacteria | 18981 |
| 874 | Ga0501045_0130617 | 3300049824 | Bacteria | 1867 |
| 875 | Ga0501045_0579165 | 3300049824 | Bacteria | 832 |
| 876 | Ga0501045_1082688 | 3300049824 | Bacteria | 586 |
| 877 | nmdc:mga04h51_275502_c1 | 3300050495 | Bacteria | 680 |
| 878 | nmdc:mga05p37_1169323_c1 | 3300050507 | Bacteria | 798 |
| 879 | nmdc:mga05p37_129800_c1 | 3300050507 | Bacteria | 3093 |
| 880 | nmdc:mga05p37_1935_c1 | 3300050507 | Bacteria | 24113 |
| 881 | nmdc:mga05p37_24531_c1 | 3300050507 | Bacteria | 7331 |
| 882 | nmdc:mga05p37_24611_c1 | 3300050507 | Bacteria | 7319 |
| 883 | nmdc:mga05p37_290444_c1 | 3300050507 | Bacteria | 1946 |
| 884 | nmdc:mga05p37_29685_c1 | 3300050507 | Bacteria | 6672 |
| 885 | nmdc:mga05p37_31849_c1 | 3300050507 | Bacteria | 6445 |
| 886 | nmdc:mga05p37_391130_c1 | 3300050507 | Bacteria | 1626 |
| 887 | nmdc:mga05p37_413587_c1 | 3300050507 | Bacteria | 1571 |
| 888 | nmdc:mga05p37_432823_c1 | 3300050507 | Bacteria | 1528 |
| 889 | nmdc:mga05p37_437652_c1 | 3300050507 | Bacteria | 1517 |
| 890 | nmdc:mga05p37_54085_c1 | 3300050507 | Bacteria | 4939 |
| 891 | nmdc:mga05p37_66268_c1 | 3300050507 | Bacteria | 4442 |
| 892 | nmdc:mga05p37_92690_c1 | 3300050507 | Bacteria | 3722 |
| 893 | nmdc:mga05p37_98208_c1 | 3300050507 | Bacteria | 3607 |
| 894 | nmdc:mga09592_1304195_c1 | 3300050508 | Bacteria | 597 |
| 895 | nmdc:mga09592_1441079_c1 | 3300050508 | Unclassified | 562 |
| 896 | nmdc:mga09592_15247_c1 | 3300050508 | Bacteria | 6279 |
| 897 | nmdc:mga09592_15522_c1 | 3300050508 | Bacteria | 6226 |
| 898 | nmdc:mga09592_1903_c1 | 3300050508 | Bacteria | 16783 |
| 899 | nmdc:mga09592_258426_c1 | 3300050508 | Bacteria | 1510 |
| 900 | nmdc:mga09592_28339_c1 | 3300050508 | Bacteria | 4652 |
| 901 | nmdc:mga09592_378224_c1 | 3300050508 | Bacteria | 1225 |
| 902 | nmdc:mga09592_400650_c1 | 3300050508 | Bacteria | 1186 |
| 903 | nmdc:mga09592_50783_c1 | 3300050508 | Bacteria | 3498 |
| 904 | nmdc:mga09592_622737_c1 | 3300050508 | Bacteria | 923 |
| 905 | nmdc:mga09592_996446_c1 | 3300050508 | Bacteria | 700 |
| 906 | nmdc:mga0qj67_129_c1 | 3300050509 | Bacteria | 50064 |
| 907 | nmdc:mga0qj67_1355991_c1 | 3300050509 | Bacteria | 550 |
| 908 | nmdc:mga0qj67_263467_c1 | 3300050509 | Bacteria | 1398 |
| 909 | nmdc:mga0qj67_345846_c1 | 3300050509 | Bacteria | 1202 |
| 910 | nmdc:mga0qj67_523130_c1 | 3300050509 | Bacteria | 953 |
| 911 | nmdc:mga0qj67_63996_c1 | 3300050509 | Bacteria | 2925 |
| 912 | nmdc:mga0qj67_733_c1 | 3300050509 | Bacteria | 22325 |
| 913 | nmdc:mga0qj67_831191_c1 | 3300050509 | Bacteria | 730 |
| 914 | nmdc:mga0qj67_885_c1 | 3300050509 | Bacteria | 20530 |
| 915 | nmdc:mga06r32_10855_c1 | 3300050510 | Bacteria | 8202 |
| 916 | nmdc:mga06r32_118889_c1 | 3300050510 | Bacteria | 2606 |
| 917 | nmdc:mga06r32_1205052_c1 | 3300050510 | Bacteria | 703 |
| 918 | nmdc:mga06r32_1301599_c1 | 3300050510 | Bacteria | 671 |
| 919 | nmdc:mga06r32_1580981_c1 | 3300050510 | Bacteria | 595 |
| 920 | nmdc:mga06r32_172098_c1 | 3300050510 | Bacteria | 2149 |
| 921 | nmdc:mga06r32_182123_c1 | 3300050510 | Bacteria | 2087 |
| 922 | nmdc:mga06r32_299792_c1 | 3300050510 | Bacteria | 1593 |
| 923 | nmdc:mga06r32_485259_c1 | 3300050510 | Bacteria | 1214 |
| 924 | nmdc:mga06r32_572428_c1 | 3300050510 | Bacteria | 1102 |
| 925 | nmdc:mga06r32_57445_c1 | 3300050510 | Bacteria | 3738 |
| 926 | nmdc:mga06r32_62963_c1 | 3300050510 | Bacteria | 3574 |
| 927 | nmdc:mga06r32_82372_c1 | 3300050510 | Bacteria | 3134 |
| 928 | nmdc:mga06r32_825828_c1 | 3300050510 | Unclassified | 886 |
| 929 | nmdc:mga08y16_10187_c1 | 3300050511 | Bacteria | 9872 |
| 930 | nmdc:mga08y16_112369_c1 | 3300050511 | Bacteria | 2836 |
| 931 | nmdc:mga08y16_1325940_c1 | 3300050511 | Bacteria | 685 |
| 932 | nmdc:mga08y16_152687_c1 | 3300050511 | Bacteria | 2400 |
| 933 | nmdc:mga08y16_181142_c1 | 3300050511 | Bacteria | 2188 |
| 934 | nmdc:mga08y16_2033_c1 | 3300050511 | Bacteria | 20720 |
| 935 | nmdc:mga08y16_2044345_c1 | 3300050511 | Unclassified | 521 |
| 936 | nmdc:mga08y16_2110138_c1 | 3300050511 | Unclassified | 511 |
| 937 | nmdc:mga08y16_254680_c1 | 3300050511 | Bacteria | 1814 |
| 938 | nmdc:mga08y16_279555_c1 | 3300050511 | Bacteria | 1722 |
| 939 | nmdc:mga08y16_299184_c1 | 3300050511 | Bacteria | 1659 |
| 940 | nmdc:mga08y16_39632_c1 | 3300050511 | Bacteria | 4942 |
| 941 | nmdc:mga08y16_397400_c1 | 3300050511 | Bacteria | 1411 |
| 942 | nmdc:mga08y16_44681_c2 | 3300050511 | Bacteria | 1895 |
| 943 | nmdc:mga08y16_894136_c1 | 3300050511 | Unclassified | 875 |
| 944 | nmdc:mga0n895_13013_c1 | 3300050512 | Bacteria | 7485 |
| 945 | nmdc:mga0n895_1586586_c1 | 3300050512 | Bacteria | 619 |
| 946 | nmdc:mga0n895_207855_c1 | 3300050512 | Bacteria | 1988 |
| 947 | nmdc:mga0n895_244277_c1 | 3300050512 | Bacteria | 1822 |
| 948 | nmdc:mga0n895_363814_c1 | 3300050512 | Bacteria | 1465 |
| 949 | nmdc:mga0n895_515275_c1 | 3300050512 | Bacteria | 1204 |
| 950 | nmdc:mga0n895_63738_c1 | 3300050512 | Bacteria | 3645 |
| 951 | nmdc:mga0n895_67283_c1 | 3300050512 | Bacteria | 3548 |
| 952 | nmdc:mga0n895_831915_c1 | 3300050512 | Bacteria | 912 |
| 953 | nmdc:mga0n895_911213_c1 | 3300050512 | Bacteria | 864 |
| 954 | nmdc:mga0n895_914440_c1 | 3300050512 | Bacteria | 862 |
| 955 | nmdc:mga0rr50_1053066_c1 | 3300050513 | Unclassified | 692 |
| 956 | nmdc:mga0rr50_32319_c1 | 3300050513 | Bacteria | 3728 |
| 957 | nmdc:mga0rr50_3348_c1 | 3300050513 | Bacteria | 9209 |
| 958 | nmdc:mga0rr50_35454_c1 | 3300050513 | Bacteria | 3583 |
| 959 | nmdc:mga0rr50_367426_c1 | 3300050513 | Bacteria | 1212 |
| 960 | nmdc:mga0rr50_373569_c1 | 3300050513 | Bacteria | 1201 |
| 961 | nmdc:mga0rr50_532655_c1 | 3300050513 | Bacteria | 1000 |
| 962 | nmdc:mga0rr50_659677_c1 | 3300050513 | Bacteria | 893 |
| 963 | nmdc:mga0rr50_78197_c1 | 3300050513 | Bacteria | 2545 |
| 964 | nmdc:mga08x19_4462_c1 | 3300050514 | Bacteria | 8292 |
| 965 | nmdc:mga08x19_988589_c1 | 3300050514 | Unclassified | 598 |
| 966 | nmdc:mga0a205_14700_c1 | 3300050515 | Bacteria | 7303 |
| 967 | nmdc:mga0a205_155193_c1 | 3300050515 | Bacteria | 2188 |
| 968 | nmdc:mga0a205_182067_c1 | 3300050515 | Bacteria | 1995 |
| 969 | nmdc:mga0a205_328091_c1 | 3300050515 | Bacteria | 1400 |
| 970 | nmdc:mga0a205_3699_c1 | 3300050515 | Bacteria | 13683 |
| 971 | nmdc:mga0a205_48854_c1 | 3300050515 | Bacteria | 4083 |
| 972 | nmdc:mga0a205_49050_c1 | 3300050515 | Bacteria | 4074 |
| 973 | nmdc:mga0a205_67799_c1 | 3300050515 | Bacteria | 3446 |
| 974 | Ga0495601_0057527 | 3300053077 | Unclassified | 2463 |
| 975 | Ga0495601_0269669 | 3300053077 | Bacteria | 1110 |
| 976 | Ga0495601_0315265 | 3300053077 | Unclassified | 1018 |
| 977 | Ga0495595_0353378 | 3300053084 | Bacteria | 742 |
| 978 | Ga0495619_0162293 | 3300053085 | Bacteria | 1544 |
| 979 | Ga0500643_002271 | 3300053087 | Bacteria | 10082 |
| 980 | Ga0500651_0031020 | 3300053093 | Bacteria | 3365 |
| 981 | Ga0500651_0088309 | 3300053093 | Bacteria | 1912 |
| 982 | Ga0500566_0034058 | 3300053094 | Bacteria | 2965 |
| 983 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 984 | Ga0500642_0412553 | 3300053130 | Bacteria | 587 |
| 985 | Ga0500652_005161 | 3300053131 | Bacteria | 4091 |
| 986 | Ga0500577_0185485 | 3300053142 | Bacteria | 894 |
| 987 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 988 | Ga0500645_000226 | 3300053730 | Bacteria | 42982 |
| 989 | Ga0500645_201682 | 3300053730 | Bacteria | 536 |
| 990 | Ga0501084_0001073 | 3300054114 | Bacteria | 21259 |
| 991 | Ga0501084_0084857 | 3300054114 | Bacteria | 2659 |
| 992 | Ga0501084_0214935 | 3300054114 | Bacteria | 1622 |
| 993 | Ga0501084_0413873 | 3300054114 | Bacteria | 1139 |
| 994 | Ga0501084_0427176 | 3300054114 | Bacteria | 1120 |
| 995 | Ga0501084_0841933 | 3300054114 | Bacteria | 772 |
| 996 | Ga0501084_0989198 | 3300054114 | Unclassified | 707 |
| 997 | Ga0501082_0000809 | 3300060353 | Bacteria | 27479 |
| 998 | Ga0501082_0002254 | 3300060353 | Bacteria | 16885 |
| 999 | Ga0501082_0016215 | 3300060353 | Bacteria | 6414 |
| 1000 | Ga0501082_0059202 | 3300060353 | Bacteria | 3301 |
| 1001 | Ga0501082_0633352 | 3300060353 | Bacteria | 936 |
| 1002 | Ga0501082_1007055 | 3300060353 | Bacteria | 728 |
| 1003 | Ga0501082_1659796 | 3300060353 | Bacteria | 558 |
| 1004 | Ga0530510_0003125 | 3300061734 | Bacteria | 11362 |
| 1005 | Ga0530510_0028935 | 3300061734 | Bacteria | 3974 |
| 1006 | Ga0530510_0046048 | 3300061734 | Bacteria | 3151 |
| 1007 | Ga0530510_0150947 | 3300061734 | Bacteria | 1716 |
| 1008 | Ga0530510_0409306 | 3300061734 | Bacteria | 1023 |
| 1009 | Ga0530510_0429679 | 3300061734 | Bacteria | 997 |
| 1010 | Ga0530510_0874054 | 3300061734 | Bacteria | 687 |
| 1011 | Ga0530510_1223782 | 3300061734 | Unclassified | 576 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005544 | Ga0070686_101062558 | Ga0070686_1010625581 | 88 |
| 2 | 3300049591 | Ga0501075_0064978 | Ga0501075_0064978_2464_2733 | 89 |
| 3 | 3300031548 | Ga0307408_102465983 | Ga0307408_1024659832 | 99 |
| 4 | 3300049522 | Ga0501299_119268 | Ga0501299_119268_319_618 | 99 |
| 5 | 3300042461 | Ga0439460_0175014 | Ga0439460_0175014_41_349 | 102 |
| 6 | 3300049591 | Ga0501075_0599301 | Ga0501075_0599301_148_456 | 102 |
| 7 | 3300049743 | Ga0501081_1501706 | Ga0501081_1501706_57_365 | 102 |
| 8 | 3300049822 | Ga0501035_0620111 | Ga0501035_0620111_469_777 | 102 |
| 9 | 3300042876 | Ga0451577_0402867 | Ga0451577_0402867_131_442 | 103 |
| 10 | 3300049576 | Ga0501040_0021173 | Ga0501040_0021173_108_419 | 103 |
| 11 | 3300049582 | Ga0501048_0193203 | Ga0501048_0193203_921_1238 | 104 |
| 12 | 3300007076 | Ga0075435_100048103 | Ga0075435_1000481033 | 105 |
| 13 | 3300025933 | Ga0207706_11152731 | Ga0207706_111527312 | 105 |
| 14 | 3300050512 | nmdc:mga0n895_1586586_c1 | nmdc:mga0n895_1586586_c1_56_376 | 105 |
| 15 | 3300050513 | nmdc:mga0rr50_32319_c1 | nmdc:mga0rr50_32319_c1_1110_1427 | 105 |
| 16 | 3300050515 | nmdc:mga0a205_182067_c1 | nmdc:mga0a205_182067_c1_1129_1446 | 105 |
| 17 | iso_pu_bacteria | 8055225921 | 8055226841 | 105 |
| 18 | 3300002070 | JGI24750J21931_1012062 | JGI24750J21931_10120622 | 106 |
| 19 | 3300003203 | JGI25406J46586_10112665 | JGI25406J46586_101126652 | 106 |
| 20 | 3300004798 | Ga0058859_10482534 | Ga0058859_104825342 | 106 |
| 21 | 3300005295 | Ga0065707_10002472 | Ga0065707_100024724 | 106 |
| 22 | 3300005295 | Ga0065707_10008939 | Ga0065707_100089396 | 106 |
| 23 | 3300005295 | Ga0065707_10032199 | Ga0065707_100321993 | 106 |
| 24 | 3300005295 | Ga0065707_10142379 | Ga0065707_101423793 | 106 |
| 25 | 3300005295 | Ga0065707_10421713 | Ga0065707_104217132 | 106 |
| 26 | 3300005295 | Ga0065707_10682833 | Ga0065707_106828332 | 106 |
| 27 | 3300005295 | Ga0065707_10742311 | Ga0065707_107423111 | 106 |
| 28 | 3300005295 | Ga0065707_10843318 | Ga0065707_108433182 | 106 |
| 29 | 3300005295 | Ga0065707_10863893 | Ga0065707_108638932 | 106 |
| 30 | 3300005328 | Ga0070676_10267672 | Ga0070676_102676722 | 106 |
| 31 | 3300005328 | Ga0070676_10289081 | Ga0070676_102890812 | 106 |
| 32 | 3300005328 | Ga0070676_10302924 | Ga0070676_103029242 | 106 |
| 33 | 3300005329 | Ga0070683_100164724 | Ga0070683_1001647243 | 106 |
| 34 | 3300005330 | Ga0070690_100000131 | Ga0070690_10000013111 | 106 |
| 35 | 3300005330 | Ga0070690_100009883 | Ga0070690_1000098836 | 106 |
| 36 | 3300005330 | Ga0070690_100123222 | Ga0070690_1001232222 | 106 |
| 37 | 3300005330 | Ga0070690_101040930 | Ga0070690_1010409302 | 106 |
| 38 | 3300005334 | Ga0068869_100000392 | Ga0068869_10000039229 | 106 |
| 39 | 3300005334 | Ga0068869_100032305 | Ga0068869_1000323052 | 106 |
| 40 | 3300005334 | Ga0068869_101253262 | Ga0068869_1012532622 | 106 |
| 41 | 3300005335 | Ga0070666_10295857 | Ga0070666_102958572 | 106 |
| 42 | 3300005336 | Ga0070680_100052279 | Ga0070680_1000522794 | 106 |
| 43 | 3300005336 | Ga0070680_100055201 | Ga0070680_1000552015 | 106 |
| 44 | 3300005336 | Ga0070680_100130316 | Ga0070680_1001303164 | 106 |
| 45 | 3300005336 | Ga0070680_100168751 | Ga0070680_1001687512 | 106 |
| 46 | 3300005336 | Ga0070680_100644785 | Ga0070680_1006447852 | 106 |
| 47 | 3300005336 | Ga0070680_100903533 | Ga0070680_1009035332 | 106 |
| 48 | 3300005336 | Ga0070680_101717628 | Ga0070680_1017176282 | 106 |
| 49 | 3300005337 | Ga0070682_100024737 | Ga0070682_1000247374 | 106 |
| 50 | 3300005338 | Ga0068868_100000656 | Ga0068868_10000065629 | 106 |
| 51 | 3300005338 | Ga0068868_101081600 | Ga0068868_1010816002 | 106 |
| 52 | 3300005340 | Ga0070689_100006489 | Ga0070689_1000064897 | 106 |
| 53 | 3300005340 | Ga0070689_100098199 | Ga0070689_1000981994 | 106 |
| 54 | 3300005340 | Ga0070689_100441349 | Ga0070689_1004413492 | 106 |
| 55 | 3300005340 | Ga0070689_100614528 | Ga0070689_1006145282 | 106 |
| 56 | 3300005341 | Ga0070691_10000200 | Ga0070691_100002009 | 106 |
| 57 | 3300005341 | Ga0070691_10034787 | Ga0070691_100347874 | 106 |
| 58 | 3300005341 | Ga0070691_10094607 | Ga0070691_100946071 | 106 |
| 59 | 3300005343 | Ga0070687_100000175 | Ga0070687_1000001756 | 106 |
| 60 | 3300005343 | Ga0070687_100127683 | Ga0070687_1001276832 | 106 |
| 61 | 3300005343 | Ga0070687_100318442 | Ga0070687_1003184422 | 106 |
| 62 | 3300005345 | Ga0070692_10001132 | Ga0070692_100011325 | 106 |
| 63 | 3300005345 | Ga0070692_10018032 | Ga0070692_100180323 | 106 |
| 64 | 3300005345 | Ga0070692_11059412 | Ga0070692_110594121 | 106 |
| 65 | 3300005347 | Ga0070668_100055705 | Ga0070668_1000557052 | 106 |
| 66 | 3300005347 | Ga0070668_100226763 | Ga0070668_1002267634 | 106 |
| 67 | 3300005347 | Ga0070668_101331689 | Ga0070668_1013316892 | 106 |
| 68 | 3300005353 | Ga0070669_100190392 | Ga0070669_1001903924 | 106 |
| 69 | 3300005353 | Ga0070669_101272375 | Ga0070669_1012723752 | 106 |
| 70 | 3300005353 | Ga0070669_101835745 | Ga0070669_1018357452 | 106 |
| 71 | 3300005354 | Ga0070675_100050024 | Ga0070675_1000500242 | 106 |
| 72 | 3300005354 | Ga0070675_100076173 | Ga0070675_1000761735 | 106 |
| 73 | 3300005355 | Ga0070671_101381184 | Ga0070671_1013811841 | 106 |
| 74 | 3300005356 | Ga0070674_100069371 | Ga0070674_1000693714 | 106 |
| 75 | 3300005356 | Ga0070674_100688142 | Ga0070674_1006881422 | 106 |
| 76 | 3300005364 | Ga0070673_100078130 | Ga0070673_1000781303 | 106 |
| 77 | 3300005365 | Ga0070688_100216458 | Ga0070688_1002164582 | 106 |
| 78 | 3300005365 | Ga0070688_100702707 | Ga0070688_1007027071 | 106 |
| 79 | 3300005365 | Ga0070688_100734921 | Ga0070688_1007349212 | 106 |
| 80 | 3300005365 | Ga0070688_101069554 | Ga0070688_1010695541 | 106 |
| 81 | 3300005406 | Ga0070703_10140112 | Ga0070703_101401122 | 106 |
| 82 | 3300005434 | Ga0070709_10978484 | Ga0070709_109784842 | 106 |
| 83 | 3300005437 | Ga0070710_10193938 | Ga0070710_101939382 | 106 |
| 84 | 3300005438 | Ga0070701_10000676 | Ga0070701_100006764 | 106 |
| 85 | 3300005438 | Ga0070701_10181614 | Ga0070701_101816141 | 106 |
| 86 | 3300005438 | Ga0070701_10337596 | Ga0070701_103375962 | 106 |
| 87 | 3300005438 | Ga0070701_10356053 | Ga0070701_103560532 | 106 |
| 88 | 3300005438 | Ga0070701_10667612 | Ga0070701_106676122 | 106 |
| 89 | 3300005439 | Ga0070711_100267315 | Ga0070711_1002673152 | 106 |
| 90 | 3300005439 | Ga0070711_100562676 | Ga0070711_1005626762 | 106 |
| 91 | 3300005440 | Ga0070705_100003918 | Ga0070705_1000039186 | 106 |
| 92 | 3300005440 | Ga0070705_100144122 | Ga0070705_1001441222 | 106 |
| 93 | 3300005440 | Ga0070705_100250177 | Ga0070705_1002501772 | 106 |
| 94 | 3300005440 | Ga0070705_100719174 | Ga0070705_1007191741 | 106 |
| 95 | 3300005440 | Ga0070705_100849852 | Ga0070705_1008498522 | 106 |
| 96 | 3300005440 | Ga0070705_101056823 | Ga0070705_1010568232 | 106 |
| 97 | 3300005441 | Ga0070700_100000587 | Ga0070700_1000005873 | 106 |
| 98 | 3300005441 | Ga0070700_100044406 | Ga0070700_1000444063 | 106 |
| 99 | 3300005441 | Ga0070700_100530306 | Ga0070700_1005303062 | 106 |
| 100 | 3300005441 | Ga0070700_101148093 | Ga0070700_1011480932 | 106 |
| 101 | 3300005441 | Ga0070700_101215337 | Ga0070700_1012153372 | 106 |
| 102 | 3300005444 | Ga0070694_100000136 | Ga0070694_10000013634 | 106 |
| 103 | 3300005444 | Ga0070694_100367479 | Ga0070694_1003674793 | 106 |
| 104 | 3300005444 | Ga0070694_100474031 | Ga0070694_1004740312 | 106 |
| 105 | 3300005444 | Ga0070694_100680372 | Ga0070694_1006803722 | 106 |
| 106 | 3300005444 | Ga0070694_100740679 | Ga0070694_1007406792 | 106 |
| 107 | 3300005444 | Ga0070694_100842465 | Ga0070694_1008424652 | 106 |
| 108 | 3300005444 | Ga0070694_100890541 | Ga0070694_1008905411 | 106 |
| 109 | 3300005444 | Ga0070694_101103691 | Ga0070694_1011036912 | 106 |
| 110 | 3300005445 | Ga0070708_100045853 | Ga0070708_1000458533 | 106 |
| 111 | 3300005445 | Ga0070708_100493268 | Ga0070708_1004932681 | 106 |
| 112 | 3300005445 | Ga0070708_100503739 | Ga0070708_1005037392 | 106 |
| 113 | 3300005455 | Ga0070663_100431865 | Ga0070663_1004318652 | 106 |
| 114 | 3300005456 | Ga0070678_100988831 | Ga0070678_1009888311 | 106 |
| 115 | 3300005457 | Ga0070662_100832722 | Ga0070662_1008327221 | 106 |
| 116 | 3300005457 | Ga0070662_101650347 | Ga0070662_1016503472 | 106 |
| 117 | 3300005458 | Ga0070681_10007592 | Ga0070681_1000759211 | 106 |
| 118 | 3300005459 | Ga0068867_100001154 | Ga0068867_10000115422 | 106 |
| 119 | 3300005459 | Ga0068867_100002412 | Ga0068867_10000241212 | 106 |
| 120 | 3300005459 | Ga0068867_100251805 | Ga0068867_1002518052 | 106 |
| 121 | 3300005459 | Ga0068867_100559475 | Ga0068867_1005594752 | 106 |
| 122 | 3300005459 | Ga0068867_100837729 | Ga0068867_1008377292 | 106 |
| 123 | 3300005467 | Ga0070706_100078100 | Ga0070706_1000781004 | 106 |
| 124 | 3300005467 | Ga0070706_100119580 | Ga0070706_1001195803 | 106 |
| 125 | 3300005468 | Ga0070707_100047466 | Ga0070707_1000474661 | 106 |
| 126 | 3300005468 | Ga0070707_100753661 | Ga0070707_1007536612 | 106 |
| 127 | 3300005468 | Ga0070707_100808756 | Ga0070707_1008087562 | 106 |
| 128 | 3300005471 | Ga0070698_100009043 | Ga0070698_1000090433 | 106 |
| 129 | 3300005471 | Ga0070698_100013803 | Ga0070698_1000138035 | 106 |
| 130 | 3300005471 | Ga0070698_100094448 | Ga0070698_1000944482 | 106 |
| 131 | 3300005471 | Ga0070698_100402494 | Ga0070698_1004024943 | 106 |
| 132 | 3300005518 | Ga0070699_100305144 | Ga0070699_1003051443 | 106 |
| 133 | 3300005518 | Ga0070699_100343313 | Ga0070699_1003433132 | 106 |
| 134 | 3300005518 | Ga0070699_100352759 | Ga0070699_1003527592 | 106 |
| 135 | 3300005518 | Ga0070699_100438873 | Ga0070699_1004388732 | 106 |
| 136 | 3300005530 | Ga0070679_100110038 | Ga0070679_1001100382 | 106 |
| 137 | 3300005535 | Ga0070684_100080859 | Ga0070684_1000808592 | 106 |
| 138 | 3300005536 | Ga0070697_100028284 | Ga0070697_1000282842 | 106 |
| 139 | 3300005536 | Ga0070697_100038912 | Ga0070697_1000389123 | 106 |
| 140 | 3300005536 | Ga0070697_100183529 | Ga0070697_1001835292 | 106 |
| 141 | 3300005543 | Ga0070672_100571404 | Ga0070672_1005714042 | 106 |
| 142 | 3300005544 | Ga0070686_100000285 | Ga0070686_10000028539 | 106 |
| 143 | 3300005544 | Ga0070686_100034464 | Ga0070686_1000344642 | 106 |
| 144 | 3300005544 | Ga0070686_100382979 | Ga0070686_1003829792 | 106 |
| 145 | 3300005544 | Ga0070686_100729425 | Ga0070686_1007294252 | 106 |
| 146 | 3300005544 | Ga0070686_101738496 | Ga0070686_1017384961 | 106 |
| 147 | 3300005545 | Ga0070695_100000705 | Ga0070695_1000007054 | 106 |
| 148 | 3300005545 | Ga0070695_100494244 | Ga0070695_1004942442 | 106 |
| 149 | 3300005545 | Ga0070695_100576905 | Ga0070695_1005769052 | 106 |
| 150 | 3300005545 | Ga0070695_101335010 | Ga0070695_1013350101 | 106 |
| 151 | 3300005546 | Ga0070696_100002015 | Ga0070696_10000201514 | 106 |
| 152 | 3300005546 | Ga0070696_100015035 | Ga0070696_1000150355 | 106 |
| 153 | 3300005546 | Ga0070696_100025633 | Ga0070696_1000256333 | 106 |
| 154 | 3300005546 | Ga0070696_100173263 | Ga0070696_1001732633 | 106 |
| 155 | 3300005546 | Ga0070696_100276734 | Ga0070696_1002767343 | 106 |
| 156 | 3300005546 | Ga0070696_100981981 | Ga0070696_1009819812 | 106 |
| 157 | 3300005547 | Ga0070693_100000278 | Ga0070693_1000002785 | 106 |
| 158 | 3300005547 | Ga0070693_100480465 | Ga0070693_1004804652 | 106 |
| 159 | 3300005547 | Ga0070693_100931771 | Ga0070693_1009317712 | 106 |
| 160 | 3300005549 | Ga0070704_100000103 | Ga0070704_1000001034 | 106 |
| 161 | 3300005549 | Ga0070704_100001347 | Ga0070704_1000013478 | 106 |
| 162 | 3300005549 | Ga0070704_100102412 | Ga0070704_1001024124 | 106 |
| 163 | 3300005549 | Ga0070704_100213775 | Ga0070704_1002137754 | 106 |
| 164 | 3300005549 | Ga0070704_100488248 | Ga0070704_1004882482 | 106 |
| 165 | 3300005549 | Ga0070704_101264158 | Ga0070704_1012641582 | 106 |
| 166 | 3300005549 | Ga0070704_101907159 | Ga0070704_1019071591 | 106 |
| 167 | 3300005577 | Ga0068857_100410209 | Ga0068857_1004102092 | 106 |
| 168 | 3300005578 | Ga0068854_100001266 | Ga0068854_10000126617 | 106 |
| 169 | 3300005614 | Ga0068856_100025824 | Ga0068856_10002582411 | 106 |
| 170 | 3300005615 | Ga0070702_100000039 | Ga0070702_1000000394 | 106 |
| 171 | 3300005615 | Ga0070702_100011795 | Ga0070702_1000117955 | 106 |
| 172 | 3300005615 | Ga0070702_100263693 | Ga0070702_1002636931 | 106 |
| 173 | 3300005616 | Ga0068852_101909030 | Ga0068852_1019090302 | 106 |
| 174 | 3300005617 | Ga0068859_100000420 | Ga0068859_10000042045 | 106 |
| 175 | 3300005617 | Ga0068859_100181226 | Ga0068859_1001812262 | 106 |
| 176 | 3300005617 | Ga0068859_100332394 | Ga0068859_1003323943 | 106 |
| 177 | 3300005617 | Ga0068859_100509781 | Ga0068859_1005097813 | 106 |
| 178 | 3300005617 | Ga0068859_100894356 | Ga0068859_1008943562 | 106 |
| 179 | 3300005718 | Ga0068866_10001352 | Ga0068866_100013526 | 106 |
| 180 | 3300005719 | Ga0068861_100000399 | Ga0068861_10000039930 | 106 |
| 181 | 3300005719 | Ga0068861_100121308 | Ga0068861_1001213083 | 106 |
| 182 | 3300005719 | Ga0068861_100452508 | Ga0068861_1004525082 | 106 |
| 183 | 3300005719 | Ga0068861_100715111 | Ga0068861_1007151112 | 106 |
| 184 | 3300005719 | Ga0068861_101178810 | Ga0068861_1011788102 | 106 |
| 185 | 3300005840 | Ga0068870_10036599 | Ga0068870_100365993 | 106 |
| 186 | 3300005840 | Ga0068870_10066418 | Ga0068870_100664182 | 106 |
| 187 | 3300005841 | Ga0068863_102666131 | Ga0068863_1026661312 | 106 |
| 188 | 3300005842 | Ga0068858_100005769 | Ga0068858_1000057695 | 106 |
| 189 | 3300005842 | Ga0068858_100112559 | Ga0068858_1001125594 | 106 |
| 190 | 3300005842 | Ga0068858_100520779 | Ga0068858_1005207792 | 106 |
| 191 | 3300005842 | Ga0068858_101170622 | Ga0068858_1011706222 | 106 |
| 192 | 3300005843 | Ga0068860_100002528 | Ga0068860_10000252822 | 106 |
| 193 | 3300005843 | Ga0068860_100099481 | Ga0068860_1000994814 | 106 |
| 194 | 3300005843 | Ga0068860_100533700 | Ga0068860_1005337002 | 106 |
| 195 | 3300005843 | Ga0068860_100602500 | Ga0068860_1006025002 | 106 |
| 196 | 3300005843 | Ga0068860_101460699 | Ga0068860_1014606992 | 106 |
| 197 | 3300005844 | Ga0068862_100005981 | Ga0068862_10000598112 | 106 |
| 198 | 3300005844 | Ga0068862_100048027 | Ga0068862_1000480275 | 106 |
| 199 | 3300005844 | Ga0068862_100166396 | Ga0068862_1001663964 | 106 |
| 200 | 3300005844 | Ga0068862_100553678 | Ga0068862_1005536782 | 106 |
| 201 | 3300005844 | Ga0068862_101458131 | Ga0068862_1014581312 | 106 |
| 202 | 3300005844 | Ga0068862_102493692 | Ga0068862_1024936921 | 106 |
| 203 | 3300005937 | Ga0081455_10003176 | Ga0081455_1000317610 | 106 |
| 204 | 3300005937 | Ga0081455_10450024 | Ga0081455_104500242 | 106 |
| 205 | 3300005937 | Ga0081455_10614601 | Ga0081455_106146012 | 106 |
| 206 | 3300005981 | Ga0081538_10337381 | Ga0081538_103373812 | 106 |
| 207 | 3300005983 | Ga0081540_1000841 | Ga0081540_10008418 | 106 |
| 208 | 3300005983 | Ga0081540_1023446 | Ga0081540_10234463 | 106 |
| 209 | 3300005985 | Ga0081539_10000468 | Ga0081539_1000046868 | 106 |
| 210 | 3300005985 | Ga0081539_10029471 | Ga0081539_100294712 | 106 |
| 211 | 3300006042 | Ga0075368_10106793 | Ga0075368_101067933 | 106 |
| 212 | 3300006058 | Ga0075432_10105557 | Ga0075432_101055572 | 106 |
| 213 | 3300006173 | Ga0070716_100481606 | Ga0070716_1004816062 | 106 |
| 214 | 3300006175 | Ga0070712_100001185 | Ga0070712_1000011853 | 106 |
| 215 | 3300006237 | Ga0097621_100000754 | Ga0097621_1000007544 | 106 |
| 216 | 3300006237 | Ga0097621_100028703 | Ga0097621_1000287034 | 106 |
| 217 | 3300006237 | Ga0097621_101106566 | Ga0097621_1011065662 | 106 |
| 218 | 3300006358 | Ga0068871_100003878 | Ga0068871_1000038788 | 106 |
| 219 | 3300006358 | Ga0068871_100009731 | Ga0068871_1000097314 | 106 |
| 220 | 3300006358 | Ga0068871_100367069 | Ga0068871_1003670693 | 106 |
| 221 | 3300006358 | Ga0068871_101363878 | Ga0068871_1013638782 | 106 |
| 222 | 3300006844 | Ga0075428_100001502 | Ga0075428_10000150213 | 106 |
| 223 | 3300006844 | Ga0075428_100016740 | Ga0075428_1000167406 | 106 |
| 224 | 3300006844 | Ga0075428_100101531 | Ga0075428_1001015312 | 106 |
| 225 | 3300006844 | Ga0075428_100169137 | Ga0075428_1001691373 | 106 |
| 226 | 3300006844 | Ga0075428_100185437 | Ga0075428_1001854374 | 106 |
| 227 | 3300006844 | Ga0075428_100209874 | Ga0075428_1002098743 | 106 |
| 228 | 3300006844 | Ga0075428_100277743 | Ga0075428_1002777433 | 106 |
| 229 | 3300006844 | Ga0075428_100370279 | Ga0075428_1003702792 | 106 |
| 230 | 3300006844 | Ga0075428_100400711 | Ga0075428_1004007112 | 106 |
| 231 | 3300006844 | Ga0075428_100533781 | Ga0075428_1005337812 | 106 |
| 232 | 3300006844 | Ga0075428_100583307 | Ga0075428_1005833073 | 106 |
| 233 | 3300006844 | Ga0075428_100846073 | Ga0075428_1008460732 | 106 |
| 234 | 3300006844 | Ga0075428_100970926 | Ga0075428_1009709262 | 106 |
| 235 | 3300006844 | Ga0075428_101384707 | Ga0075428_1013847072 | 106 |
| 236 | 3300006844 | Ga0075428_101511895 | Ga0075428_1015118952 | 106 |
| 237 | 3300006844 | Ga0075428_101908210 | Ga0075428_1019082101 | 106 |
| 238 | 3300006844 | Ga0075428_102122220 | Ga0075428_1021222202 | 106 |
| 239 | 3300006844 | Ga0075428_102475135 | Ga0075428_1024751352 | 106 |
| 240 | 3300006846 | Ga0075430_100001098 | Ga0075430_10000109811 | 106 |
| 241 | 3300006846 | Ga0075430_100002189 | Ga0075430_1000021896 | 106 |
| 242 | 3300006846 | Ga0075430_100004241 | Ga0075430_1000042417 | 106 |
| 243 | 3300006846 | Ga0075430_100011150 | Ga0075430_1000111509 | 106 |
| 244 | 3300006846 | Ga0075430_100044526 | Ga0075430_1000445262 | 106 |
| 245 | 3300006846 | Ga0075430_100243501 | Ga0075430_1002435014 | 106 |
| 246 | 3300006846 | Ga0075430_100251596 | Ga0075430_1002515962 | 106 |
| 247 | 3300006846 | Ga0075430_100351842 | Ga0075430_1003518422 | 106 |
| 248 | 3300006846 | Ga0075430_100736214 | Ga0075430_1007362142 | 106 |
| 249 | 3300006846 | Ga0075430_101346514 | Ga0075430_1013465142 | 106 |
| 250 | 3300006846 | Ga0075430_101660051 | Ga0075430_1016600512 | 106 |
| 251 | 3300006847 | Ga0075431_100012939 | Ga0075431_1000129394 | 106 |
| 252 | 3300006847 | Ga0075431_100021216 | Ga0075431_1000212166 | 106 |
| 253 | 3300006847 | Ga0075431_100059320 | Ga0075431_1000593203 | 106 |
| 254 | 3300006847 | Ga0075431_100115679 | Ga0075431_1001156792 | 106 |
| 255 | 3300006847 | Ga0075431_100145224 | Ga0075431_1001452243 | 106 |
| 256 | 3300006847 | Ga0075431_100150292 | Ga0075431_1001502923 | 106 |
| 257 | 3300006847 | Ga0075431_100276979 | Ga0075431_1002769792 | 106 |
| 258 | 3300006847 | Ga0075431_100317579 | Ga0075431_1003175794 | 106 |
| 259 | 3300006847 | Ga0075431_100355586 | Ga0075431_1003555863 | 106 |
| 260 | 3300006847 | Ga0075431_100729205 | Ga0075431_1007292052 | 106 |
| 261 | 3300006847 | Ga0075431_101512254 | Ga0075431_1015122542 | 106 |
| 262 | 3300006847 | Ga0075431_101849872 | Ga0075431_1018498722 | 106 |
| 263 | 3300006852 | Ga0075433_10011246 | Ga0075433_100112467 | 106 |
| 264 | 3300006852 | Ga0075433_10033804 | Ga0075433_100338046 | 106 |
| 265 | 3300006852 | Ga0075433_10060852 | Ga0075433_100608523 | 106 |
| 266 | 3300006852 | Ga0075433_10131534 | Ga0075433_101315344 | 106 |
| 267 | 3300006852 | Ga0075433_10131656 | Ga0075433_101316563 | 106 |
| 268 | 3300006852 | Ga0075433_10154480 | Ga0075433_101544803 | 106 |
| 269 | 3300006852 | Ga0075433_11540808 | Ga0075433_115408082 | 106 |
| 270 | 3300006871 | Ga0075434_100006963 | Ga0075434_1000069636 | 106 |
| 271 | 3300006871 | Ga0075434_100043103 | Ga0075434_1000431034 | 106 |
| 272 | 3300006871 | Ga0075434_100064939 | Ga0075434_1000649394 | 106 |
| 273 | 3300006871 | Ga0075434_100083230 | Ga0075434_1000832304 | 106 |
| 274 | 3300006871 | Ga0075434_100156612 | Ga0075434_1001566123 | 106 |
| 275 | 3300006871 | Ga0075434_100379461 | Ga0075434_1003794613 | 106 |
| 276 | 3300006871 | Ga0075434_100389302 | Ga0075434_1003893022 | 106 |
| 277 | 3300006871 | Ga0075434_101351586 | Ga0075434_1013515861 | 106 |
| 278 | 3300006871 | Ga0075434_101359723 | Ga0075434_1013597232 | 106 |
| 279 | 3300006871 | Ga0075434_101777379 | Ga0075434_1017773792 | 106 |
| 280 | 3300006871 | Ga0075434_101787199 | Ga0075434_1017871992 | 106 |
| 281 | 3300006871 | Ga0075434_101958202 | Ga0075434_1019582021 | 106 |
| 282 | 3300006880 | Ga0075429_100000055 | Ga0075429_10000005530 | 106 |
| 283 | 3300006880 | Ga0075429_100000432 | Ga0075429_10000043233 | 106 |
| 284 | 3300006880 | Ga0075429_100001365 | Ga0075429_1000013657 | 106 |
| 285 | 3300006880 | Ga0075429_100028891 | Ga0075429_1000288917 | 106 |
| 286 | 3300006880 | Ga0075429_100044996 | Ga0075429_1000449962 | 106 |
| 287 | 3300006880 | Ga0075429_100098316 | Ga0075429_1000983162 | 106 |
| 288 | 3300006880 | Ga0075429_100184447 | Ga0075429_1001844473 | 106 |
| 289 | 3300006880 | Ga0075429_100473842 | Ga0075429_1004738422 | 106 |
| 290 | 3300006880 | Ga0075429_101677911 | Ga0075429_1016779112 | 106 |
| 291 | 3300006880 | Ga0075429_101964715 | Ga0075429_1019647152 | 106 |
| 292 | 3300006881 | Ga0068865_100001524 | Ga0068865_1000015244 | 106 |
| 293 | 3300006881 | Ga0068865_100040545 | Ga0068865_1000405454 | 106 |
| 294 | 3300006881 | Ga0068865_100252665 | Ga0068865_1002526653 | 106 |
| 295 | 3300006914 | Ga0075436_100007888 | Ga0075436_1000078887 | 106 |
| 296 | 3300006914 | Ga0075436_100114402 | Ga0075436_1001144023 | 106 |
| 297 | 3300006931 | Ga0097620_100000420 | Ga0097620_10000042045 | 106 |
| 298 | 3300006931 | Ga0097620_100181248 | Ga0097620_1001812482 | 106 |
| 299 | 3300006931 | Ga0097620_100332394 | Ga0097620_1003323943 | 106 |
| 300 | 3300006931 | Ga0097620_100509803 | Ga0097620_1005098032 | 106 |
| 301 | 3300006931 | Ga0097620_100894455 | Ga0097620_1008944552 | 106 |
| 302 | 3300007076 | Ga0075435_100007468 | Ga0075435_1000074687 | 106 |
| 303 | 3300007076 | Ga0075435_100024358 | Ga0075435_1000243584 | 106 |
| 304 | 3300007076 | Ga0075435_100200586 | Ga0075435_1002005863 | 106 |
| 305 | 3300007076 | Ga0075435_100201259 | Ga0075435_1002012593 | 106 |
| 306 | 3300007076 | Ga0075435_100351769 | Ga0075435_1003517692 | 106 |
| 307 | 3300007076 | Ga0075435_101268334 | Ga0075435_1012683342 | 106 |
| 308 | 3300007265 | Ga0099794_10064805 | Ga0099794_100648054 | 106 |
| 309 | 3300007265 | Ga0099794_10295389 | Ga0099794_102953892 | 106 |
| 310 | 3300007265 | Ga0099794_10494406 | Ga0099794_104944061 | 106 |
| 311 | 3300007788 | Ga0099795_10335698 | Ga0099795_103356982 | 106 |
| 312 | 3300007788 | Ga0099795_10425416 | Ga0099795_104254161 | 106 |
| 313 | 3300009093 | Ga0105240_12017022 | Ga0105240_120170222 | 106 |
| 314 | 3300009094 | Ga0111539_10006184 | Ga0111539_100061846 | 106 |
| 315 | 3300009094 | Ga0111539_10026623 | Ga0111539_1002662310 | 106 |
| 316 | 3300009094 | Ga0111539_10088217 | Ga0111539_100882172 | 106 |
| 317 | 3300009094 | Ga0111539_10102104 | Ga0111539_101021043 | 106 |
| 318 | 3300009094 | Ga0111539_10131305 | Ga0111539_101313053 | 106 |
| 319 | 3300009094 | Ga0111539_10184796 | Ga0111539_101847962 | 106 |
| 320 | 3300009094 | Ga0111539_10237023 | Ga0111539_102370233 | 106 |
| 321 | 3300009094 | Ga0111539_10240452 | Ga0111539_102404523 | 106 |
| 322 | 3300009094 | Ga0111539_10251855 | Ga0111539_102518554 | 106 |
| 323 | 3300009094 | Ga0111539_10402779 | Ga0111539_104027794 | 106 |
| 324 | 3300009094 | Ga0111539_10782009 | Ga0111539_107820093 | 106 |
| 325 | 3300009094 | Ga0111539_11135043 | Ga0111539_111350432 | 106 |
| 326 | 3300009094 | Ga0111539_11245919 | Ga0111539_112459192 | 106 |
| 327 | 3300009094 | Ga0111539_11980314 | Ga0111539_119803141 | 106 |
| 328 | 3300009098 | Ga0105245_10012764 | Ga0105245_100127646 | 106 |
| 329 | 3300009147 | Ga0114129_10002987 | Ga0114129_1000298728 | 106 |
| 330 | 3300009147 | Ga0114129_10006327 | Ga0114129_100063279 | 106 |
| 331 | 3300009147 | Ga0114129_10012532 | Ga0114129_100125328 | 106 |
| 332 | 3300009147 | Ga0114129_10030430 | Ga0114129_100304308 | 106 |
| 333 | 3300009147 | Ga0114129_10060555 | Ga0114129_100605554 | 106 |
| 334 | 3300009147 | Ga0114129_10067680 | Ga0114129_100676803 | 106 |
| 335 | 3300009147 | Ga0114129_10073085 | Ga0114129_100730856 | 106 |
| 336 | 3300009147 | Ga0114129_10124456 | Ga0114129_101244563 | 106 |
| 337 | 3300009147 | Ga0114129_10224122 | Ga0114129_102241222 | 106 |
| 338 | 3300009147 | Ga0114129_10237706 | Ga0114129_102377064 | 106 |
| 339 | 3300009147 | Ga0114129_10281729 | Ga0114129_102817293 | 106 |
| 340 | 3300009147 | Ga0114129_10299009 | Ga0114129_102990092 | 106 |
| 341 | 3300009147 | Ga0114129_10301114 | Ga0114129_103011142 | 106 |
| 342 | 3300009147 | Ga0114129_10308584 | Ga0114129_103085844 | 106 |
| 343 | 3300009147 | Ga0114129_10356472 | Ga0114129_103564722 | 106 |
| 344 | 3300009147 | Ga0114129_10365692 | Ga0114129_103656922 | 106 |
| 345 | 3300009147 | Ga0114129_10768525 | Ga0114129_107685253 | 106 |
| 346 | 3300009147 | Ga0114129_11628529 | Ga0114129_116285291 | 106 |
| 347 | 3300009147 | Ga0114129_12639983 | Ga0114129_126399831 | 106 |
| 348 | 3300009148 | Ga0105243_10002912 | Ga0105243_1000291217 | 106 |
| 349 | 3300009148 | Ga0105243_10035086 | Ga0105243_100350862 | 106 |
| 350 | 3300009174 | Ga0105241_10044445 | Ga0105241_100444454 | 106 |
| 351 | 3300009174 | Ga0105241_11425235 | Ga0105241_114252352 | 106 |
| 352 | 3300009176 | Ga0105242_10000248 | Ga0105242_1000024846 | 106 |
| 353 | 3300009176 | Ga0105242_10227045 | Ga0105242_102270454 | 106 |
| 354 | 3300009177 | Ga0105248_10631497 | Ga0105248_106314972 | 106 |
| 355 | 3300009177 | Ga0105248_12160258 | Ga0105248_121602582 | 106 |
| 356 | 3300009177 | Ga0105248_12161144 | Ga0105248_121611442 | 106 |
| 357 | 3300009545 | Ga0105237_11902219 | Ga0105237_119022191 | 106 |
| 358 | 3300009545 | Ga0105237_12111053 | Ga0105237_121110532 | 106 |
| 359 | 3300009553 | Ga0105249_10054817 | Ga0105249_100548176 | 106 |
| 360 | 3300009553 | Ga0105249_10066654 | Ga0105249_100666544 | 106 |
| 361 | 3300009553 | Ga0105249_10287100 | Ga0105249_102871002 | 106 |
| 362 | 3300009553 | Ga0105249_10539275 | Ga0105249_105392752 | 106 |
| 363 | 3300009553 | Ga0105249_11122045 | Ga0105249_111220452 | 106 |
| 364 | 3300009553 | Ga0105249_12037070 | Ga0105249_120370702 | 106 |
| 365 | 3300010375 | Ga0105239_10199942 | Ga0105239_101999425 | 106 |
| 366 | 3300013296 | Ga0157374_11997332 | Ga0157374_119973322 | 106 |
| 367 | 3300013297 | Ga0157378_10000387 | Ga0157378_1000038748 | 106 |
| 368 | 3300013297 | Ga0157378_10108512 | Ga0157378_101085123 | 106 |
| 369 | 3300013297 | Ga0157378_10721705 | Ga0157378_107217052 | 106 |
| 370 | 3300013297 | Ga0157378_11255069 | Ga0157378_112550692 | 106 |
| 371 | 3300013306 | Ga0163162_10633774 | Ga0163162_106337743 | 106 |
| 372 | 3300013306 | Ga0163162_11634273 | Ga0163162_116342733 | 106 |
| 373 | 3300013306 | Ga0163162_11694773 | Ga0163162_116947732 | 106 |
| 374 | 3300013306 | Ga0163162_11740112 | Ga0163162_117401121 | 106 |
| 375 | 3300013306 | Ga0163162_12447749 | Ga0163162_124477492 | 106 |
| 376 | 3300013307 | Ga0157372_11314907 | Ga0157372_113149072 | 106 |
| 377 | 3300013308 | Ga0157375_12124567 | Ga0157375_121245672 | 106 |
| 378 | 3300014326 | Ga0157380_10011921 | Ga0157380_100119214 | 106 |
| 379 | 3300014326 | Ga0157380_10025684 | Ga0157380_100256844 | 106 |
| 380 | 3300014326 | Ga0157380_11671134 | Ga0157380_116711342 | 106 |
| 381 | 3300014326 | Ga0157380_13121355 | Ga0157380_131213551 | 106 |
| 382 | 3300014745 | Ga0157377_10603151 | Ga0157377_106031512 | 106 |
| 383 | 3300014969 | Ga0157376_10012006 | Ga0157376_100120064 | 106 |
| 384 | 3300014969 | Ga0157376_11450566 | Ga0157376_114505662 | 106 |
| 385 | 3300017792 | Ga0163161_10365627 | Ga0163161_103656271 | 106 |
| 386 | 3300017792 | Ga0163161_11353484 | Ga0163161_113534842 | 106 |
| 387 | 3300021388 | Ga0213875_10072124 | Ga0213875_100721244 | 106 |
| 388 | 3300025271 | Ga0207666_1045861 | Ga0207666_10458612 | 106 |
| 389 | 3300025885 | Ga0207653_10004764 | Ga0207653_100047645 | 106 |
| 390 | 3300025893 | Ga0207682_10363490 | Ga0207682_103634901 | 106 |
| 391 | 3300025898 | Ga0207692_10180675 | Ga0207692_101806752 | 106 |
| 392 | 3300025899 | Ga0207642_10005011 | Ga0207642_100050114 | 106 |
| 393 | 3300025899 | Ga0207642_10053835 | Ga0207642_100538353 | 106 |
| 394 | 3300025901 | Ga0207688_10057485 | Ga0207688_100574854 | 106 |
| 395 | 3300025901 | Ga0207688_10617023 | Ga0207688_106170232 | 106 |
| 396 | 3300025903 | Ga0207680_10055662 | Ga0207680_100556624 | 106 |
| 397 | 3300025907 | Ga0207645_10049224 | Ga0207645_100492244 | 106 |
| 398 | 3300025907 | Ga0207645_10472831 | Ga0207645_104728312 | 106 |
| 399 | 3300025907 | Ga0207645_11018987 | Ga0207645_110189871 | 106 |
| 400 | 3300025908 | Ga0207643_10064864 | Ga0207643_100648643 | 106 |
| 401 | 3300025908 | Ga0207643_10077561 | Ga0207643_100775613 | 106 |
| 402 | 3300025910 | Ga0207684_10019497 | Ga0207684_100194974 | 106 |
| 403 | 3300025910 | Ga0207684_10399399 | Ga0207684_103993992 | 106 |
| 404 | 3300025911 | Ga0207654_10252025 | Ga0207654_102520252 | 106 |
| 405 | 3300025912 | Ga0207707_10011165 | Ga0207707_100111655 | 106 |
| 406 | 3300025916 | Ga0207663_10302475 | Ga0207663_103024752 | 106 |
| 407 | 3300025917 | Ga0207660_10041586 | Ga0207660_100415862 | 106 |
| 408 | 3300025917 | Ga0207660_10043670 | Ga0207660_100436705 | 106 |
| 409 | 3300025917 | Ga0207660_10067317 | Ga0207660_100673173 | 106 |
| 410 | 3300025917 | Ga0207660_10160542 | Ga0207660_101605424 | 106 |
| 411 | 3300025917 | Ga0207660_10562741 | Ga0207660_105627412 | 106 |
| 412 | 3300025917 | Ga0207660_11075085 | Ga0207660_110750852 | 106 |
| 413 | 3300025918 | Ga0207662_10000095 | Ga0207662_100000955 | 106 |
| 414 | 3300025918 | Ga0207662_10268917 | Ga0207662_102689173 | 106 |
| 415 | 3300025921 | Ga0207652_10026429 | Ga0207652_100264293 | 106 |
| 416 | 3300025922 | Ga0207646_10003246 | Ga0207646_1000324618 | 106 |
| 417 | 3300025922 | Ga0207646_10858213 | Ga0207646_108582132 | 106 |
| 418 | 3300025923 | Ga0207681_10194022 | Ga0207681_101940223 | 106 |
| 419 | 3300025923 | Ga0207681_10208421 | Ga0207681_102084213 | 106 |
| 420 | 3300025923 | Ga0207681_10311137 | Ga0207681_103111372 | 106 |
| 421 | 3300025923 | Ga0207681_11610792 | Ga0207681_116107921 | 106 |
| 422 | 3300025926 | Ga0207659_10024348 | Ga0207659_100243483 | 106 |
| 423 | 3300025926 | Ga0207659_10159000 | Ga0207659_101590004 | 106 |
| 424 | 3300025926 | Ga0207659_11863080 | Ga0207659_118630801 | 106 |
| 425 | 3300025927 | Ga0207687_10003242 | Ga0207687_100032426 | 106 |
| 426 | 3300025927 | Ga0207687_11727265 | Ga0207687_117272652 | 106 |
| 427 | 3300025931 | Ga0207644_10408267 | Ga0207644_104082672 | 106 |
| 428 | 3300025931 | Ga0207644_10933887 | Ga0207644_109338871 | 106 |
| 429 | 3300025932 | Ga0207690_10673940 | Ga0207690_106739402 | 106 |
| 430 | 3300025934 | Ga0207686_10001874 | Ga0207686_1000187414 | 106 |
| 431 | 3300025935 | Ga0207709_10001439 | Ga0207709_100014398 | 106 |
| 432 | 3300025935 | Ga0207709_10040568 | Ga0207709_100405683 | 106 |
| 433 | 3300025936 | Ga0207670_10002023 | Ga0207670_100020235 | 106 |
| 434 | 3300025936 | Ga0207670_10115149 | Ga0207670_101151493 | 106 |
| 435 | 3300025937 | Ga0207669_10016254 | Ga0207669_100162545 | 106 |
| 436 | 3300025938 | Ga0207704_10000623 | Ga0207704_1000062321 | 106 |
| 437 | 3300025938 | Ga0207704_10040114 | Ga0207704_100401142 | 106 |
| 438 | 3300025938 | Ga0207704_10467020 | Ga0207704_104670202 | 106 |
| 439 | 3300025939 | Ga0207665_10129051 | Ga0207665_101290513 | 106 |
| 440 | 3300025939 | Ga0207665_10374736 | Ga0207665_103747362 | 106 |
| 441 | 3300025940 | Ga0207691_10396080 | Ga0207691_103960802 | 106 |
| 442 | 3300025941 | Ga0207711_11247717 | Ga0207711_112477172 | 106 |
| 443 | 3300025942 | Ga0207689_10000977 | Ga0207689_1000097732 | 106 |
| 444 | 3300025942 | Ga0207689_10048172 | Ga0207689_100481722 | 106 |
| 445 | 3300025942 | Ga0207689_10284782 | Ga0207689_102847822 | 106 |
| 446 | 3300025942 | Ga0207689_10986962 | Ga0207689_109869622 | 106 |
| 447 | 3300025944 | Ga0207661_10561417 | Ga0207661_105614171 | 106 |
| 448 | 3300025961 | Ga0207712_10013536 | Ga0207712_100135369 | 106 |
| 449 | 3300025961 | Ga0207712_10108426 | Ga0207712_101084264 | 106 |
| 450 | 3300025961 | Ga0207712_10587580 | Ga0207712_105875802 | 106 |
| 451 | 3300025961 | Ga0207712_10665316 | Ga0207712_106653162 | 106 |
| 452 | 3300025961 | Ga0207712_11313584 | Ga0207712_113135842 | 106 |
| 453 | 3300025972 | Ga0207668_10083070 | Ga0207668_100830702 | 106 |
| 454 | 3300025972 | Ga0207668_10163260 | Ga0207668_101632604 | 106 |
| 455 | 3300025981 | Ga0207640_10019295 | Ga0207640_100192956 | 106 |
| 456 | 3300025981 | Ga0207640_10627586 | Ga0207640_106275862 | 106 |
| 457 | 3300026023 | Ga0207677_10017944 | Ga0207677_100179442 | 106 |
| 458 | 3300026023 | Ga0207677_11316375 | Ga0207677_113163752 | 106 |
| 459 | 3300026023 | Ga0207677_11911674 | Ga0207677_119116741 | 106 |
| 460 | 3300026035 | Ga0207703_10012439 | Ga0207703_100124395 | 106 |
| 461 | 3300026035 | Ga0207703_10018478 | Ga0207703_100184784 | 106 |
| 462 | 3300026067 | Ga0207678_10460086 | Ga0207678_104600862 | 106 |
| 463 | 3300026075 | Ga0207708_10000551 | Ga0207708_1000055132 | 106 |
| 464 | 3300026075 | Ga0207708_10005521 | Ga0207708_1000552111 | 106 |
| 465 | 3300026075 | Ga0207708_11361306 | Ga0207708_113613062 | 106 |
| 466 | 3300026078 | Ga0207702_10064024 | Ga0207702_100640242 | 106 |
| 467 | 3300026089 | Ga0207648_10000513 | Ga0207648_1000051347 | 106 |
| 468 | 3300026089 | Ga0207648_10002477 | Ga0207648_1000247713 | 106 |
| 469 | 3300026089 | Ga0207648_10076446 | Ga0207648_100764464 | 106 |
| 470 | 3300026089 | Ga0207648_10233922 | Ga0207648_102339222 | 106 |
| 471 | 3300026095 | Ga0207676_10760790 | Ga0207676_107607902 | 106 |
| 472 | 3300026116 | Ga0207674_10810244 | Ga0207674_108102442 | 106 |
| 473 | 3300026116 | Ga0207674_11950776 | Ga0207674_119507762 | 106 |
| 474 | 3300026118 | Ga0207675_100001063 | Ga0207675_10000106332 | 106 |
| 475 | 3300026118 | Ga0207675_100104513 | Ga0207675_1001045134 | 106 |
| 476 | 3300026118 | Ga0207675_100796735 | Ga0207675_1007967352 | 106 |
| 477 | 3300026118 | Ga0207675_101912505 | Ga0207675_1019125052 | 106 |
| 478 | 3300026121 | Ga0207683_10080122 | Ga0207683_100801223 | 106 |
| 479 | 3300026142 | Ga0207698_10742700 | Ga0207698_107427002 | 106 |
| 480 | 3300027360 | Ga0209969_1018790 | Ga0209969_10187902 | 106 |
| 481 | 3300027364 | Ga0209967_1015009 | Ga0209967_10150092 | 106 |
| 482 | 3300027378 | Ga0209981_1010132 | Ga0209981_10101323 | 106 |
| 483 | 3300027462 | Ga0210000_1015710 | Ga0210000_10157102 | 106 |
| 484 | 3300027526 | Ga0209968_1047314 | Ga0209968_10473142 | 106 |
| 485 | 3300027614 | Ga0209970_1003183 | Ga0209970_10031831 | 106 |
| 486 | 3300027671 | Ga0209588_1027778 | Ga0209588_10277782 | 106 |
| 487 | 3300027682 | Ga0209971_1003253 | Ga0209971_10032535 | 106 |
| 488 | 3300027695 | Ga0209966_1002671 | Ga0209966_10026713 | 106 |
| 489 | 3300027717 | Ga0209998_10009892 | Ga0209998_100098923 | 106 |
| 490 | 3300027866 | Ga0209813_10243775 | Ga0209813_102437751 | 106 |
| 491 | 3300027876 | Ga0209974_10148155 | Ga0209974_101481552 | 106 |
| 492 | 3300027907 | Ga0207428_10000288 | Ga0207428_100002883 | 106 |
| 493 | 3300027907 | Ga0207428_10011126 | Ga0207428_100111266 | 106 |
| 494 | 3300027907 | Ga0207428_10081245 | Ga0207428_100812452 | 106 |
| 495 | 3300027907 | Ga0207428_10129247 | Ga0207428_101292473 | 106 |
| 496 | 3300027907 | Ga0207428_10212262 | Ga0207428_102122623 | 106 |
| 497 | 3300027907 | Ga0207428_10872034 | Ga0207428_108720342 | 106 |
| 498 | 3300028380 | Ga0268265_10009410 | Ga0268265_100094105 | 106 |
| 499 | 3300028380 | Ga0268265_10043725 | Ga0268265_100437254 | 106 |
| 500 | 3300028380 | Ga0268265_10409679 | Ga0268265_104096792 | 106 |
| 501 | 3300028380 | Ga0268265_10714535 | Ga0268265_107145352 | 106 |
| 502 | 3300028381 | Ga0268264_10005879 | Ga0268264_100058796 | 106 |
| 503 | 3300028381 | Ga0268264_10087084 | Ga0268264_100870842 | 106 |
| 504 | 3300031548 | Ga0307408_100108002 | Ga0307408_1001080023 | 106 |
| 505 | 3300031548 | Ga0307408_101546949 | Ga0307408_1015469491 | 106 |
| 506 | 3300031548 | Ga0307408_102508862 | Ga0307408_1025088621 | 106 |
| 507 | 3300031731 | Ga0307405_10323688 | Ga0307405_103236882 | 106 |
| 508 | 3300031852 | Ga0307410_10524901 | Ga0307410_105249011 | 106 |
| 509 | 3300031852 | Ga0307410_11031064 | Ga0307410_110310642 | 106 |
| 510 | 3300031852 | Ga0307410_11889599 | Ga0307410_118895992 | 106 |
| 511 | 3300031903 | Ga0307407_10112275 | Ga0307407_101122753 | 106 |
| 512 | 3300031903 | Ga0307407_11375041 | Ga0307407_113750412 | 106 |
| 513 | 3300031911 | Ga0307412_10283588 | Ga0307412_102835883 | 106 |
| 514 | 3300031911 | Ga0307412_11074838 | Ga0307412_110748382 | 106 |
| 515 | 3300031995 | Ga0307409_100094044 | Ga0307409_1000940443 | 106 |
| 516 | 3300032002 | Ga0307416_100218413 | Ga0307416_1002184134 | 106 |
| 517 | 3300032002 | Ga0307416_100480818 | Ga0307416_1004808182 | 106 |
| 518 | 3300032002 | Ga0307416_101129270 | Ga0307416_1011292702 | 106 |
| 519 | 3300032002 | Ga0307416_101873284 | Ga0307416_1018732842 | 106 |
| 520 | 3300032002 | Ga0307416_102076379 | Ga0307416_1020763792 | 106 |
| 521 | 3300032002 | Ga0307416_102708381 | Ga0307416_1027083812 | 106 |
| 522 | 3300032002 | Ga0307416_102808169 | Ga0307416_1028081692 | 106 |
| 523 | 3300032002 | Ga0307416_103143362 | Ga0307416_1031433622 | 106 |
| 524 | 3300032002 | Ga0307416_103284057 | Ga0307416_1032840572 | 106 |
| 525 | 3300032005 | Ga0307411_10210161 | Ga0307411_102101612 | 106 |
| 526 | 3300032005 | Ga0307411_10318321 | Ga0307411_103183212 | 106 |
| 527 | 3300032005 | Ga0307411_10569643 | Ga0307411_105696432 | 106 |
| 528 | 3300032126 | Ga0307415_101071647 | Ga0307415_1010716471 | 106 |
| 529 | 3300034816 | Ga0373930_0054789 | Ga0373930_0054789_103_423 | 106 |
| 530 | 3300034816 | Ga0373930_0078431 | Ga0373930_0078431_324_644 | 106 |
| 531 | 3300034817 | Ga0373948_0011845 | Ga0373948_0011845_840_1160 | 106 |
| 532 | 3300034819 | Ga0373958_0194446 | Ga0373958_0194446_77_397 | 106 |
| 533 | 3300034820 | Ga0373959_0026875 | Ga0373959_0026875_622_942 | 106 |
| 534 | 3300034957 | Ga0373938_0238554 | Ga0373938_0238554_15_335 | 106 |
| 535 | 3300035083 | Ga0373926_0002148 | Ga0373926_0002148_2956_3276 | 106 |
| 536 | 3300035084 | Ga0373928_0005303 | Ga0373928_0005303_906_1226 | 106 |
| 537 | 3300035084 | Ga0373928_0010322 | Ga0373928_0010322_562_882 | 106 |
| 538 | 3300035084 | Ga0373928_0072121 | Ga0373928_0072121_470_790 | 106 |
| 539 | 3300035086 | Ga0373934_0100950 | Ga0373934_0100950_232_552 | 106 |
| 540 | 3300035088 | Ga0373940_0002387 | Ga0373940_0002387_2877_3197 | 106 |
| 541 | 3300035088 | Ga0373940_0065041 | Ga0373940_0065041_348_668 | 106 |
| 542 | 3300035088 | Ga0373940_0087889 | Ga0373940_0087889_500_820 | 106 |
| 543 | 3300035089 | Ga0373944_0005437 | Ga0373944_0005437_2341_2661 | 106 |
| 544 | 3300035090 | Ga0373949_0127897 | Ga0373949_0127897_105_425 | 106 |
| 545 | 3300035091 | Ga0373951_0026089 | Ga0373951_0026089_871_1191 | 106 |
| 546 | 3300035091 | Ga0373951_0048705 | Ga0373951_0048705_450_770 | 106 |
| 547 | 3300035091 | Ga0373951_0208294 | Ga0373951_0208294_201_521 | 106 |
| 548 | 3300035092 | Ga0373952_0004949 | Ga0373952_0004949_1827_2147 | 106 |
| 549 | 3300035092 | Ga0373952_0261350 | Ga0373952_0261350_21_341 | 106 |
| 550 | 3300035111 | Ga0373923_0062044 | Ga0373923_0062044_73_393 | 106 |
| 551 | 3300035112 | Ga0373932_0002691 | Ga0373932_0002691_2633_2953 | 106 |
| 552 | 3300035112 | Ga0373932_0024935 | Ga0373932_0024935_786_1106 | 106 |
| 553 | 3300035112 | Ga0373932_0051987 | Ga0373932_0051987_651_971 | 106 |
| 554 | 3300035112 | Ga0373932_0076916 | Ga0373932_0076916_445_777 | 106 |
| 555 | 3300035112 | Ga0373932_0224809 | Ga0373932_0224809_342_662 | 106 |
| 556 | 3300035112 | Ga0373932_0254490 | Ga0373932_0254490_86_406 | 106 |
| 557 | 3300035112 | Ga0373932_0340476 | Ga0373932_0340476_77_397 | 106 |
| 558 | 3300035113 | Ga0373936_0040361 | Ga0373936_0040361_1292_1612 | 106 |
| 559 | 3300035114 | Ga0373939_0007089 | Ga0373939_0007089_250_570 | 106 |
| 560 | 3300035114 | Ga0373939_0044303 | Ga0373939_0044303_124_444 | 106 |
| 561 | 3300035114 | Ga0373939_0052296 | Ga0373939_0052296_786_1106 | 106 |
| 562 | 3300035114 | Ga0373939_0068016 | Ga0373939_0068016_231_551 | 106 |
| 563 | 3300035114 | Ga0373939_0076110 | Ga0373939_0076110_390_710 | 106 |
| 564 | 3300035114 | Ga0373939_0110226 | Ga0373939_0110226_567_887 | 106 |
| 565 | 3300035115 | Ga0373941_0005268 | Ga0373941_0005268_2507_2827 | 106 |
| 566 | 3300035115 | Ga0373941_0017198 | Ga0373941_0017198_107_427 | 106 |
| 567 | 3300035115 | Ga0373941_0019880 | Ga0373941_0019880_811_1131 | 106 |
| 568 | 3300035115 | Ga0373941_0143279 | Ga0373941_0143279_104_424 | 106 |
| 569 | 3300035115 | Ga0373941_0376150 | Ga0373941_0376150_252_572 | 106 |
| 570 | 3300035116 | Ga0373945_0048244 | Ga0373945_0048244_480_800 | 106 |
| 571 | 3300035118 | Ga0373954_0000030 | Ga0373954_0000030_50591_50911 | 106 |
| 572 | 3300035118 | Ga0373954_0259205 | Ga0373954_0259205_276_596 | 106 |
| 573 | 3300035120 | Ga0373957_0056107 | Ga0373957_0056107_905_1225 | 106 |
| 574 | 3300035121 | Ga0373960_0022032 | Ga0373960_0022032_364_684 | 106 |
| 575 | 3300035121 | Ga0373960_0028430 | Ga0373960_0028430_883_1203 | 106 |
| 576 | 3300035121 | Ga0373960_0037436 | Ga0373960_0037436_645_965 | 106 |
| 577 | 3300035170 | Ga0373943_0068348 | Ga0373943_0068348_1346_1666 | 106 |
| 578 | 3300035171 | Ga0373946_0047609 | Ga0373946_0047609_856_1176 | 106 |
| 579 | 3300035172 | Ga0373955_0084477 | Ga0373955_0084477_498_818 | 106 |
| 580 | 3300035172 | Ga0373955_0353705 | Ga0373955_0353705_318_638 | 106 |
| 581 | 3300035207 | Ga0373942_0019869 | Ga0373942_0019869_906_1226 | 106 |
| 582 | 3300035207 | Ga0373942_0058599 | Ga0373942_0058599_271_591 | 106 |
| 583 | 3300035207 | Ga0373942_0063190 | Ga0373942_0063190_346_666 | 106 |
| 584 | 3300035207 | Ga0373942_0131809 | Ga0373942_0131809_409_729 | 106 |
| 585 | 3300035241 | Ga0373961_0021631 | Ga0373961_0021631_1192_1512 | 106 |
| 586 | 3300035241 | Ga0373961_0038197 | Ga0373961_0038197_1028_1348 | 106 |
| 587 | 3300035241 | Ga0373961_0073549 | Ga0373961_0073549_254_574 | 106 |
| 588 | 3300035241 | Ga0373961_0105621 | Ga0373961_0105621_230_550 | 106 |
| 589 | 3300035241 | Ga0373961_0448189 | Ga0373961_0448189_10_333 | 106 |
| 590 | 3300035242 | Ga0373962_0008702 | Ga0373962_0008702_310_630 | 106 |
| 591 | 3300035242 | Ga0373962_0012184 | Ga0373962_0012184_1711_2031 | 106 |
| 592 | 3300035242 | Ga0373962_0013605 | Ga0373962_0013605_36_356 | 106 |
| 593 | 3300035242 | Ga0373962_0100443 | Ga0373962_0100443_61_381 | 106 |
| 594 | 3300035242 | Ga0373962_0171366 | Ga0373962_0171366_278_610 | 106 |
| 595 | 3300035242 | Ga0373962_0357490 | Ga0373962_0357490_144_467 | 106 |
| 596 | 3300035410 | Ga0373924_0016098 | Ga0373924_0016098_1662_1982 | 106 |
| 597 | 3300035691 | Ga0373931_0001918 | Ga0373931_0001918_7213_7533 | 106 |
| 598 | 3300035691 | Ga0373931_0002342 | Ga0373931_0002342_1219_1539 | 106 |
| 599 | 3300035691 | Ga0373931_0006328 | Ga0373931_0006328_4059_4379 | 106 |
| 600 | 3300035691 | Ga0373931_0010421 | Ga0373931_0010421_2054_2374 | 106 |
| 601 | 3300035691 | Ga0373931_0025771 | Ga0373931_0025771_135_455 | 106 |
| 602 | 3300035691 | Ga0373931_0029473 | Ga0373931_0029473_1169_1489 | 106 |
| 603 | 3300035691 | Ga0373931_0033364 | Ga0373931_0033364_740_1060 | 106 |
| 604 | 3300035691 | Ga0373931_0073169 | Ga0373931_0073169_431_751 | 106 |
| 605 | 3300035691 | Ga0373931_0213618 | Ga0373931_0213618_65_385 | 106 |
| 606 | 3300035691 | Ga0373931_0250445 | Ga0373931_0250445_526_846 | 106 |
| 607 | 3300035691 | Ga0373931_1260027 | Ga0373931_1260027_98_418 | 106 |
| 608 | 3300035692 | Ga0373935_0125433 | Ga0373935_0125433_59_379 | 106 |
| 609 | 3300035695 | Ga0373927_0008733 | Ga0373927_0008733_2867_3187 | 106 |
| 610 | 3300035695 | Ga0373927_1012096 | Ga0373927_1012096_133_453 | 106 |
| 611 | 3300035724 | Ga0373933_0022210 | Ga0373933_0022210_279_599 | 106 |
| 612 | 3300035725 | Ga0373947_0048561 | Ga0373947_0048561_2188_2508 | 106 |
| 613 | 3300036401 | Ga0373937_0025516 | Ga0373937_0025516_178_498 | 106 |
| 614 | 3300036401 | Ga0373937_0604372 | Ga0373937_0604372_471_791 | 106 |
| 615 | 3300036401 | Ga0373937_0622877 | Ga0373937_0622877_13_333 | 106 |
| 616 | 3300037068 | Ga0373925_0012851 | Ga0373925_0012851_3673_3993 | 106 |
| 617 | 3300037418 | Ga0395900_0003092 | Ga0395900_0003092_4312_4632 | 106 |
| 618 | 3300037466 | Ga0395898_0011090 | Ga0395898_0011090_921_1241 | 106 |
| 619 | 3300037471 | Ga0395905_0252699 | Ga0395905_0252699_1306_1626 | 106 |
| 620 | 3300037853 | Ga0436364_1195800 | Ga0436364_1195800_1349_1669 | 106 |
| 621 | 3300038443 | Ga0395901_0001902 | Ga0395901_0001902_15652_15972 | 106 |
| 622 | 3300039437 | Ga0436365_1664112 | Ga0436365_1664112_640_960 | 106 |
| 623 | 3300039437 | Ga0436365_1801159 | Ga0436365_1801159_1999_2319 | 106 |
| 624 | 3300041486 | Ga0451807_2725195 | Ga0451807_2725195_1819_2139 | 106 |
| 625 | 3300041496 | Ga0451839_0304386 | Ga0451839_0304386_314_634 | 106 |
| 626 | 3300042001 | Ga0439441_087449 | Ga0439441_087449_44_364 | 106 |
| 627 | 3300042001 | Ga0439441_185385 | Ga0439441_185385_18_341 | 106 |
| 628 | 3300042013 | Ga0439456_117078 | Ga0439456_117078_102_422 | 106 |
| 629 | 3300042436 | Ga0439435_0001468 | Ga0439435_0001468_1059_1379 | 106 |
| 630 | 3300042461 | Ga0439460_0002117 | Ga0439460_0002117_499_819 | 106 |
| 631 | 3300042461 | Ga0439460_0132936 | Ga0439460_0132936_210_530 | 106 |
| 632 | 3300042876 | Ga0451577_0034679 | Ga0451577_0034679_577_900 | 106 |
| 633 | 3300042876 | Ga0451577_0063848 | Ga0451577_0063848_111_431 | 106 |
| 634 | 3300042876 | Ga0451577_0463491 | Ga0451577_0463491_591_911 | 106 |
| 635 | 3300042876 | Ga0451577_0548330 | Ga0451577_0548330_609_929 | 106 |
| 636 | 3300042876 | Ga0451577_0849017 | Ga0451577_0849017_76_396 | 106 |
| 637 | 3300042993 | Ga0439440_0147678 | Ga0439440_0147678_67_387 | 106 |
| 638 | 3300044658 | Ga0466972_0418143 | Ga0466972_0418143_24_344 | 106 |
| 639 | 3300044673 | Ga0453683_0191599 | Ga0453683_0191599_85_408 | 106 |
| 640 | 3300044683 | Ga0466965_0060429 | Ga0466965_0060429_220_540 | 106 |
| 641 | 3300044901 | Ga0466960_0450872 | Ga0466960_0450872_123_443 | 106 |
| 642 | 3300045051 | Ga0451576_0018030 | Ga0451576_0018030_4628_4948 | 106 |
| 643 | 3300045051 | Ga0451576_0020308 | Ga0451576_0020308_1662_1982 | 106 |
| 644 | 3300045051 | Ga0451576_0023304 | Ga0451576_0023304_232_552 | 106 |
| 645 | 3300045051 | Ga0451576_0286661 | Ga0451576_0286661_1369_1689 | 106 |
| 646 | 3300045051 | Ga0451576_0424788 | Ga0451576_0424788_1038_1358 | 106 |
| 647 | 3300045051 | Ga0451576_0498059 | Ga0451576_0498059_929_1252 | 106 |
| 648 | 3300045051 | Ga0451576_1243971 | Ga0451576_1243971_171_491 | 106 |
| 649 | 3300045976 | Ga0466967_1536089 | Ga0466967_1536089_269_589 | 106 |
| 650 | 3300046454 | Ga0495592_0001475 | Ga0495592_0001475_6458_6778 | 106 |
| 651 | 3300046455 | Ga0495603_0036255 | Ga0495603_0036255_824_1144 | 106 |
| 652 | 3300046459 | Ga0495629_0892549 | Ga0495629_0892549_23_343 | 106 |
| 653 | 3300046463 | Ga0495653_0012697 | Ga0495653_0012697_3562_3882 | 106 |
| 654 | 3300046472 | Ga0495580_0002475 | Ga0495580_0002475_8585_8905 | 106 |
| 655 | 3300046472 | Ga0495580_0190977 | Ga0495580_0190977_266_586 | 106 |
| 656 | 3300046473 | Ga0495582_0036167 | Ga0495582_0036167_1725_2045 | 106 |
| 657 | 3300046473 | Ga0495582_0129869 | Ga0495582_0129869_570_890 | 106 |
| 658 | 3300046475 | Ga0495639_0331543 | Ga0495639_0331543_257_580 | 106 |
| 659 | 3300046476 | Ga0495662_0005331 | Ga0495662_0005331_4362_4682 | 106 |
| 660 | 3300046476 | Ga0495662_0038196 | Ga0495662_0038196_921_1244 | 106 |
| 661 | 3300046491 | Ga0495584_0137983 | Ga0495584_0137983_613_933 | 106 |
| 662 | 3300046511 | Ga0495608_0014819 | Ga0495608_0014819_1351_1671 | 106 |
| 663 | 3300046511 | Ga0495608_0611753 | Ga0495608_0611753_152_472 | 106 |
| 664 | 3300046514 | Ga0495618_0097543 | Ga0495618_0097543_333_653 | 106 |
| 665 | 3300046516 | Ga0495628_0091825 | Ga0495628_0091825_39_359 | 106 |
| 666 | 3300046517 | Ga0495630_0016927 | Ga0495630_0016927_1973_2293 | 106 |
| 667 | 3300046517 | Ga0495630_0066008 | Ga0495630_0066008_991_1311 | 106 |
| 668 | 3300046517 | Ga0495630_0141363 | Ga0495630_0141363_1275_1598 | 106 |
| 669 | 3300046517 | Ga0495630_1115995 | Ga0495630_1115995_101_421 | 106 |
| 670 | 3300046526 | Ga0495666_0013108 | Ga0495666_0013108_3525_3845 | 106 |
| 671 | 3300046526 | Ga0495666_0023766 | Ga0495666_0023766_999_1319 | 106 |
| 672 | 3300046528 | Ga0495642_0017372 | Ga0495642_0017372_555_875 | 106 |
| 673 | 3300046528 | Ga0495642_0024669 | Ga0495642_0024669_433_753 | 106 |
| 674 | 3300046528 | Ga0495642_0102755 | Ga0495642_0102755_185_508 | 106 |
| 675 | 3300046529 | Ga0495652_0264328 | Ga0495652_0264328_568_888 | 106 |
| 676 | 3300046529 | Ga0495652_0797629 | Ga0495652_0797629_154_474 | 106 |
| 677 | 3300046531 | Ga0495665_0062602 | Ga0495665_0062602_901_1221 | 106 |
| 678 | 3300046531 | Ga0495665_0348724 | Ga0495665_0348724_28_351 | 106 |
| 679 | 3300046533 | Ga0495640_0005456 | Ga0495640_0005456_5272_5592 | 106 |
| 680 | 3300046533 | Ga0495640_0030921 | Ga0495640_0030921_1318_1641 | 106 |
| 681 | 3300046535 | Ga0495586_0002272 | Ga0495586_0002272_6531_6851 | 106 |
| 682 | 3300046535 | Ga0495586_0009170 | Ga0495586_0009170_2801_3121 | 106 |
| 683 | 3300046536 | Ga0495587_0020738 | Ga0495587_0020738_1921_2241 | 106 |
| 684 | 3300046536 | Ga0495587_0238668 | Ga0495587_0238668_142_462 | 106 |
| 685 | 3300046537 | Ga0495598_0219483 | Ga0495598_0219483_356_676 | 106 |
| 686 | 3300046539 | Ga0495621_0164081 | Ga0495621_0164081_57_377 | 106 |
| 687 | 3300046539 | Ga0495621_0202782 | Ga0495621_0202782_382_705 | 106 |
| 688 | 3300046539 | Ga0495621_0318220 | Ga0495621_0318220_122_445 | 106 |
| 689 | 3300046543 | Ga0495645_0196269 | Ga0495645_0196269_814_1134 | 106 |
| 690 | 3300046559 | Ga0495667_0002694 | Ga0495667_0002694_8533_8853 | 106 |
| 691 | 3300046559 | Ga0495667_0302105 | Ga0495667_0302105_35_355 | 106 |
| 692 | 3300046615 | Ga0495656_0026757 | Ga0495656_0026757_1469_1789 | 106 |
| 693 | 3300046615 | Ga0495656_0118188 | Ga0495656_0118188_717_1037 | 106 |
| 694 | 3300046615 | Ga0495656_0326102 | Ga0495656_0326102_434_754 | 106 |
| 695 | 3300046642 | Ga0495634_0003551 | Ga0495634_0003551_4730_5050 | 106 |
| 696 | 3300046663 | Ga0495635_0109075 | Ga0495635_0109075_1275_1598 | 106 |
| 697 | 3300046664 | Ga0495659_0059792 | Ga0495659_0059792_139_459 | 106 |
| 698 | 3300046664 | Ga0495659_0061294 | Ga0495659_0061294_144_464 | 106 |
| 699 | 3300046664 | Ga0495659_0095715 | Ga0495659_0095715_428_751 | 106 |
| 700 | 3300046665 | Ga0495661_0390800 | Ga0495661_0390800_309_629 | 106 |
| 701 | 3300046674 | Ga0495588_0171347 | Ga0495588_0171347_563_883 | 106 |
| 702 | 3300046678 | Ga0495599_0002703 | Ga0495599_0002703_4255_4575 | 106 |
| 703 | 3300046678 | Ga0495599_0098574 | Ga0495599_0098574_246_566 | 106 |
| 704 | 3300046680 | Ga0495646_0601941 | Ga0495646_0601941_152_472 | 106 |
| 705 | 3300046681 | Ga0495647_0001740 | Ga0495647_0001740_1838_2158 | 106 |
| 706 | 3300046681 | Ga0495647_0154543 | Ga0495647_0154543_200_523 | 106 |
| 707 | 3300046681 | Ga0495647_0245078 | Ga0495647_0245078_96_416 | 106 |
| 708 | 3300046683 | Ga0495658_0013614 | Ga0495658_0013614_1869_2189 | 106 |
| 709 | 3300046683 | Ga0495658_0024614 | Ga0495658_0024614_533_853 | 106 |
| 710 | 3300046684 | Ga0495669_0016289 | Ga0495669_0016289_464_784 | 106 |
| 711 | 3300046684 | Ga0495669_0050743 | Ga0495669_0050743_1261_1581 | 106 |
| 712 | 3300046684 | Ga0495669_0307721 | Ga0495669_0307721_387_707 | 106 |
| 713 | 3300046684 | Ga0495669_0531461 | Ga0495669_0531461_116_436 | 106 |
| 714 | 3300046689 | Ga0495613_0003446 | Ga0495613_0003446_4527_4847 | 106 |
| 715 | 3300046690 | Ga0495624_0194193 | Ga0495624_0194193_29_349 | 106 |
| 716 | 3300046809 | Ga0495600_0077653 | Ga0495600_0077653_498_818 | 106 |
| 717 | 3300046809 | Ga0495600_0136839 | Ga0495600_0136839_303_623 | 106 |
| 718 | 3300047315 | Ga0495581_0131514 | Ga0495581_0131514_874_1194 | 106 |
| 719 | 3300047317 | Ga0495604_0002697 | Ga0495604_0002697_3614_3934 | 106 |
| 720 | 3300047317 | Ga0495604_0538134 | Ga0495604_0538134_390_713 | 106 |
| 721 | 3300047318 | Ga0495636_0038176 | Ga0495636_0038176_1097_1423 | 106 |
| 722 | 3300047318 | Ga0495636_0054880 | Ga0495636_0054880_40_360 | 106 |
| 723 | 3300047318 | Ga0495636_0522371 | Ga0495636_0522371_75_395 | 106 |
| 724 | 3300047318 | Ga0495636_0651902 | Ga0495636_0651902_96_416 | 106 |
| 725 | 3300047319 | Ga0495674_0526202 | Ga0495674_0526202_563_883 | 106 |
| 726 | 3300047319 | Ga0495674_0860094 | Ga0495674_0860094_211_534 | 106 |
| 727 | 3300047322 | Ga0495680_0004055 | Ga0495680_0004055_7772_8092 | 106 |
| 728 | 3300047322 | Ga0495680_0696338 | Ga0495680_0696338_39_362 | 106 |
| 729 | 3300047444 | Ga0495675_0215029 | Ga0495675_0215029_359_679 | 106 |
| 730 | 3300047445 | Ga0495677_0158614 | Ga0495677_0158614_32_352 | 106 |
| 731 | 3300047471 | Ga0495684_0114616 | Ga0495684_0114616_401_721 | 106 |
| 732 | 3300047471 | Ga0495684_0369720 | Ga0495684_0369720_257_580 | 106 |
| 733 | 3300048903 | Ga0496100_0119819 | Ga0496100_0119819_271_591 | 106 |
| 734 | 3300048904 | Ga0496101_0173194 | Ga0496101_0173194_753_1073 | 106 |
| 735 | 3300048905 | Ga0496102_0677997 | Ga0496102_0677997_613_933 | 106 |
| 736 | 3300048906 | Ga0496103_0092576 | Ga0496103_0092576_400_720 | 106 |
| 737 | 3300048907 | Ga0496104_0047284 | Ga0496104_0047284_649_969 | 106 |
| 738 | 3300048908 | Ga0496105_0160233 | Ga0496105_0160233_428_748 | 106 |
| 739 | 3300048909 | Ga0496106_0023172 | Ga0496106_0023172_3082_3402 | 106 |
| 740 | 3300048910 | Ga0496107_0013207 | Ga0496107_0013207_4347_4667 | 106 |
| 741 | 3300048912 | Ga0496109_0003297 | Ga0496109_0003297_556_876 | 106 |
| 742 | 3300048913 | Ga0496110_0016127 | Ga0496110_0016127_1722_2042 | 106 |
| 743 | 3300048914 | Ga0496111_0384820 | Ga0496111_0384820_256_576 | 106 |
| 744 | 3300048915 | Ga0496112_0048142 | Ga0496112_0048142_3485_3805 | 106 |
| 745 | 3300048916 | Ga0496113_1003104 | Ga0496113_1003104_300_620 | 106 |
| 746 | 3300048918 | Ga0496115_0198577 | Ga0496115_0198577_661_981 | 106 |
| 747 | 3300049522 | Ga0501299_101000 | Ga0501299_101000_16_336 | 106 |
| 748 | 3300049568 | Ga0501031_0042679 | Ga0501031_0042679_1127_1450 | 106 |
| 749 | 3300049569 | Ga0501032_0862865 | Ga0501032_0862865_40_363 | 106 |
| 750 | 3300049570 | Ga0501033_0006002 | Ga0501033_0006002_4740_5063 | 106 |
| 751 | 3300049570 | Ga0501033_0066352 | Ga0501033_0066352_967_1287 | 106 |
| 752 | 3300049571 | Ga0501034_0199915 | Ga0501034_0199915_1616_1939 | 106 |
| 753 | 3300049572 | Ga0501036_0002811 | Ga0501036_0002811_7918_8241 | 106 |
| 754 | 3300049572 | Ga0501036_0186397 | Ga0501036_0186397_1199_1522 | 106 |
| 755 | 3300049572 | Ga0501036_0373424 | Ga0501036_0373424_860_1180 | 106 |
| 756 | 3300049572 | Ga0501036_0555224 | Ga0501036_0555224_453_773 | 106 |
| 757 | 3300049572 | Ga0501036_1027854 | Ga0501036_1027854_279_599 | 106 |
| 758 | 3300049572 | Ga0501036_1029896 | Ga0501036_1029896_318_638 | 106 |
| 759 | 3300049572 | Ga0501036_1244350 | Ga0501036_1244350_160_483 | 106 |
| 760 | 3300049573 | Ga0501037_0016719 | Ga0501037_0016719_3309_3632 | 106 |
| 761 | 3300049573 | Ga0501037_0536499 | Ga0501037_0536499_304_627 | 106 |
| 762 | 3300049573 | Ga0501037_0601433 | Ga0501037_0601433_238_558 | 106 |
| 763 | 3300049573 | Ga0501037_1120708 | Ga0501037_1120708_38_358 | 106 |
| 764 | 3300049574 | Ga0501038_0008069 | Ga0501038_0008069_5795_6118 | 106 |
| 765 | 3300049574 | Ga0501038_0090474 | Ga0501038_0090474_689_1009 | 106 |
| 766 | 3300049574 | Ga0501038_0337775 | Ga0501038_0337775_604_927 | 106 |
| 767 | 3300049575 | Ga0501039_0014392 | Ga0501039_0014392_3720_4043 | 106 |
| 768 | 3300049575 | Ga0501039_0040879 | Ga0501039_0040879_2546_2866 | 106 |
| 769 | 3300049575 | Ga0501039_0044419 | Ga0501039_0044419_32_352 | 106 |
| 770 | 3300049575 | Ga0501039_0050433 | Ga0501039_0050433_128_448 | 106 |
| 771 | 3300049575 | Ga0501039_0137551 | Ga0501039_0137551_793_1113 | 106 |
| 772 | 3300049575 | Ga0501039_0257536 | Ga0501039_0257536_447_767 | 106 |
| 773 | 3300049575 | Ga0501039_0361291 | Ga0501039_0361291_535_855 | 106 |
| 774 | 3300049575 | Ga0501039_1329603 | Ga0501039_1329603_76_396 | 106 |
| 775 | 3300049576 | Ga0501040_0000376 | Ga0501040_0000376_4622_4945 | 106 |
| 776 | 3300049576 | Ga0501040_0020631 | Ga0501040_0020631_1694_2017 | 106 |
| 777 | 3300049576 | Ga0501040_0055396 | Ga0501040_0055396_784_1104 | 106 |
| 778 | 3300049576 | Ga0501040_0118826 | Ga0501040_0118826_579_899 | 106 |
| 779 | 3300049576 | Ga0501040_0967783 | Ga0501040_0967783_138_458 | 106 |
| 780 | 3300049577 | Ga0501041_0000609 | Ga0501041_0000609_13548_13871 | 106 |
| 781 | 3300049577 | Ga0501041_0044711 | Ga0501041_0044711_1192_1512 | 106 |
| 782 | 3300049577 | Ga0501041_0230173 | Ga0501041_0230173_305_625 | 106 |
| 783 | 3300049577 | Ga0501041_0233771 | Ga0501041_0233771_269_592 | 106 |
| 784 | 3300049577 | Ga0501041_0253432 | Ga0501041_0253432_697_1017 | 106 |
| 785 | 3300049577 | Ga0501041_0259263 | Ga0501041_0259263_347_667 | 106 |
| 786 | 3300049577 | Ga0501041_0534239 | Ga0501041_0534239_129_449 | 106 |
| 787 | 3300049578 | Ga0501042_0000217 | Ga0501042_0000217_25060_25383 | 106 |
| 788 | 3300049578 | Ga0501042_0029750 | Ga0501042_0029750_2452_2772 | 106 |
| 789 | 3300049578 | Ga0501042_0298264 | Ga0501042_0298264_181_501 | 106 |
| 790 | 3300049578 | Ga0501042_0728428 | Ga0501042_0728428_53_373 | 106 |
| 791 | 3300049578 | Ga0501042_0879999 | Ga0501042_0879999_102_425 | 106 |
| 792 | 3300049578 | Ga0501042_1233331 | Ga0501042_1233331_129_449 | 106 |
| 793 | 3300049579 | Ga0501043_0343407 | Ga0501043_0343407_563_883 | 106 |
| 794 | 3300049579 | Ga0501043_0746534 | Ga0501043_0746534_242_565 | 106 |
| 795 | 3300049580 | Ga0501046_0003851 | Ga0501046_0003851_6560_6883 | 106 |
| 796 | 3300049580 | Ga0501046_0036615 | Ga0501046_0036615_3122_3442 | 106 |
| 797 | 3300049580 | Ga0501046_1113013 | Ga0501046_1113013_139_462 | 106 |
| 798 | 3300049580 | Ga0501046_1223563 | Ga0501046_1223563_141_461 | 106 |
| 799 | 3300049582 | Ga0501048_0001002 | Ga0501048_0001002_5041_5364 | 106 |
| 800 | 3300049582 | Ga0501048_0217621 | Ga0501048_0217621_882_1202 | 106 |
| 801 | 3300049582 | Ga0501048_0635887 | Ga0501048_0635887_34_354 | 106 |
| 802 | 3300049582 | Ga0501048_0981891 | Ga0501048_0981891_188_508 | 106 |
| 803 | 3300049582 | Ga0501048_1149143 | Ga0501048_1149143_209_532 | 106 |
| 804 | 3300049583 | Ga0501067_0059070 | Ga0501067_0059070_1224_1544 | 106 |
| 805 | 3300049583 | Ga0501067_0120572 | Ga0501067_0120572_870_1190 | 106 |
| 806 | 3300049583 | Ga0501067_0427476 | Ga0501067_0427476_374_694 | 106 |
| 807 | 3300049584 | Ga0501068_0072013 | Ga0501068_0072013_185_505 | 106 |
| 808 | 3300049584 | Ga0501068_0414487 | Ga0501068_0414487_201_521 | 106 |
| 809 | 3300049584 | Ga0501068_0677900 | Ga0501068_0677900_178_501 | 106 |
| 810 | 3300049584 | Ga0501068_0816443 | Ga0501068_0816443_143_466 | 106 |
| 811 | 3300049584 | Ga0501068_0908294 | Ga0501068_0908294_92_412 | 106 |
| 812 | 3300049584 | Ga0501068_1208693 | Ga0501068_1208693_55_378 | 106 |
| 813 | 3300049585 | Ga0501069_0184637 | Ga0501069_0184637_587_907 | 106 |
| 814 | 3300049586 | Ga0501070_0115292 | Ga0501070_0115292_1340_1663 | 106 |
| 815 | 3300049587 | Ga0501071_0011096 | Ga0501071_0011096_3917_4240 | 106 |
| 816 | 3300049587 | Ga0501071_0073797 | Ga0501071_0073797_1626_1946 | 106 |
| 817 | 3300049587 | Ga0501071_0078746 | Ga0501071_0078746_1841_2161 | 106 |
| 818 | 3300049587 | Ga0501071_0217319 | Ga0501071_0217319_403_723 | 106 |
| 819 | 3300049587 | Ga0501071_0432788 | Ga0501071_0432788_506_829 | 106 |
| 820 | 3300049587 | Ga0501071_0638314 | Ga0501071_0638314_261_581 | 106 |
| 821 | 3300049588 | Ga0501072_0008373 | Ga0501072_0008373_3490_3813 | 106 |
| 822 | 3300049588 | Ga0501072_0023786 | Ga0501072_0023786_4254_4574 | 106 |
| 823 | 3300049588 | Ga0501072_0062249 | Ga0501072_0062249_444_764 | 106 |
| 824 | 3300049588 | Ga0501072_0108474 | Ga0501072_0108474_1300_1623 | 106 |
| 825 | 3300049588 | Ga0501072_0350928 | Ga0501072_0350928_644_964 | 106 |
| 826 | 3300049588 | Ga0501072_1101838 | Ga0501072_1101838_109_432 | 106 |
| 827 | 3300049588 | Ga0501072_1105660 | Ga0501072_1105660_243_563 | 106 |
| 828 | 3300049588 | Ga0501072_1240763 | Ga0501072_1240763_149_469 | 106 |
| 829 | 3300049589 | Ga0501073_0327130 | Ga0501073_0327130_710_1033 | 106 |
| 830 | 3300049589 | Ga0501073_0844070 | Ga0501073_0844070_280_603 | 106 |
| 831 | 3300049590 | Ga0501074_0054650 | Ga0501074_0054650_2057_2380 | 106 |
| 832 | 3300049590 | Ga0501074_0280235 | Ga0501074_0280235_20_343 | 106 |
| 833 | 3300049590 | Ga0501074_1300868 | Ga0501074_1300868_134_457 | 106 |
| 834 | 3300049591 | Ga0501075_0004474 | Ga0501075_0004474_3711_4034 | 106 |
| 835 | 3300049591 | Ga0501075_0015921 | Ga0501075_0015921_1903_2223 | 106 |
| 836 | 3300049591 | Ga0501075_0035366 | Ga0501075_0035366_924_1244 | 106 |
| 837 | 3300049591 | Ga0501075_0053786 | Ga0501075_0053786_314_634 | 106 |
| 838 | 3300049591 | Ga0501075_0082723 | Ga0501075_0082723_1611_1931 | 106 |
| 839 | 3300049591 | Ga0501075_0604425 | Ga0501075_0604425_388_708 | 106 |
| 840 | 3300049592 | Ga0501076_0000526 | Ga0501076_0000526_15442_15765 | 106 |
| 841 | 3300049592 | Ga0501076_0000778 | Ga0501076_0000778_17697_18017 | 106 |
| 842 | 3300049592 | Ga0501076_0010510 | Ga0501076_0010510_4084_4404 | 106 |
| 843 | 3300049592 | Ga0501076_0011445 | Ga0501076_0011445_3540_3860 | 106 |
| 844 | 3300049592 | Ga0501076_0142561 | Ga0501076_0142561_1127_1450 | 106 |
| 845 | 3300049592 | Ga0501076_0163537 | Ga0501076_0163537_1163_1486 | 106 |
| 846 | 3300049592 | Ga0501076_0612339 | Ga0501076_0612339_128_448 | 106 |
| 847 | 3300049592 | Ga0501076_1366318 | Ga0501076_1366318_29_349 | 106 |
| 848 | 3300049593 | Ga0501077_0001082 | Ga0501077_0001082_15689_16012 | 106 |
| 849 | 3300049593 | Ga0501077_0026200 | Ga0501077_0026200_1626_1946 | 106 |
| 850 | 3300049593 | Ga0501077_0441809 | Ga0501077_0441809_336_656 | 106 |
| 851 | 3300049650 | Ga0501199_024935 | Ga0501199_024935_33_353 | 106 |
| 852 | 3300049656 | Ga0501209_262894 | Ga0501209_262894_70_390 | 106 |
| 853 | 3300049741 | Ga0501079_0000010 | Ga0501079_0000010_70191_70514 | 106 |
| 854 | 3300049741 | Ga0501079_0017301 | Ga0501079_0017301_3348_3668 | 106 |
| 855 | 3300049741 | Ga0501079_0023005 | Ga0501079_0023005_604_924 | 106 |
| 856 | 3300049741 | Ga0501079_0053522 | Ga0501079_0053522_467_787 | 106 |
| 857 | 3300049741 | Ga0501079_0098297 | Ga0501079_0098297_1103_1423 | 106 |
| 858 | 3300049741 | Ga0501079_0176662 | Ga0501079_0176662_1206_1529 | 106 |
| 859 | 3300049741 | Ga0501079_0351802 | Ga0501079_0351802_538_858 | 106 |
| 860 | 3300049741 | Ga0501079_0363463 | Ga0501079_0363463_532_852 | 106 |
| 861 | 3300049741 | Ga0501079_0429811 | Ga0501079_0429811_25_345 | 106 |
| 862 | 3300049741 | Ga0501079_0474012 | Ga0501079_0474012_162_482 | 106 |
| 863 | 3300049742 | Ga0501080_0026635 | Ga0501080_0026635_1328_1651 | 106 |
| 864 | 3300049742 | Ga0501080_0397483 | Ga0501080_0397483_116_436 | 106 |
| 865 | 3300049742 | Ga0501080_0507160 | Ga0501080_0507160_58_378 | 106 |
| 866 | 3300049742 | Ga0501080_0669886 | Ga0501080_0669886_160_480 | 106 |
| 867 | 3300049742 | Ga0501080_0750522 | Ga0501080_0750522_483_803 | 106 |
| 868 | 3300049743 | Ga0501081_0000811 | Ga0501081_0000811_6164_6484 | 106 |
| 869 | 3300049743 | Ga0501081_0001107 | Ga0501081_0001107_536_859 | 106 |
| 870 | 3300049743 | Ga0501081_0007636 | Ga0501081_0007636_2170_2490 | 106 |
| 871 | 3300049743 | Ga0501081_0038926 | Ga0501081_0038926_2032_2352 | 106 |
| 872 | 3300049743 | Ga0501081_0119593 | Ga0501081_0119593_83_403 | 106 |
| 873 | 3300049822 | Ga0501035_0041997 | Ga0501035_0041997_2308_2631 | 106 |
| 874 | 3300049822 | Ga0501035_0116958 | Ga0501035_0116958_1569_1889 | 106 |
| 875 | 3300049822 | Ga0501035_0246262 | Ga0501035_0246262_1035_1355 | 106 |
| 876 | 3300049823 | Ga0501044_0059444 | Ga0501044_0059444_2071_2394 | 106 |
| 877 | 3300049824 | Ga0501045_0000946 | Ga0501045_0000946_3711_4034 | 106 |
| 878 | 3300049824 | Ga0501045_0130617 | Ga0501045_0130617_675_995 | 106 |
| 879 | 3300049824 | Ga0501045_0579165 | Ga0501045_0579165_22_342 | 106 |
| 880 | 3300049824 | Ga0501045_1082688 | Ga0501045_1082688_61_381 | 106 |
| 881 | 3300050495 | nmdc:mga04h51_275502_c1 | nmdc:mga04h51_275502_c1_61_381 | 106 |
| 882 | 3300050507 | nmdc:mga05p37_1169323_c1 | nmdc:mga05p37_1169323_c1_143_463 | 106 |
| 883 | 3300050507 | nmdc:mga05p37_129800_c1 | nmdc:mga05p37_129800_c1_1290_1610 | 106 |
| 884 | 3300050507 | nmdc:mga05p37_1935_c1 | nmdc:mga05p37_1935_c1_19087_19407 | 106 |
| 885 | 3300050507 | nmdc:mga05p37_24531_c1 | nmdc:mga05p37_24531_c1_2117_2437 | 106 |
| 886 | 3300050507 | nmdc:mga05p37_24611_c1 | nmdc:mga05p37_24611_c1_4697_5017 | 106 |
| 887 | 3300050507 | nmdc:mga05p37_290444_c1 | nmdc:mga05p37_290444_c1_1548_1868 | 106 |
| 888 | 3300050507 | nmdc:mga05p37_29685_c1 | nmdc:mga05p37_29685_c1_2119_2439 | 106 |
| 889 | 3300050507 | nmdc:mga05p37_31849_c1 | nmdc:mga05p37_31849_c1_4188_4508 | 106 |
| 890 | 3300050507 | nmdc:mga05p37_391130_c1 | nmdc:mga05p37_391130_c1_23_343 | 106 |
| 891 | 3300050507 | nmdc:mga05p37_413587_c1 | nmdc:mga05p37_413587_c1_214_534 | 106 |
| 892 | 3300050507 | nmdc:mga05p37_432823_c1 | nmdc:mga05p37_432823_c1_377_697 | 106 |
| 893 | 3300050507 | nmdc:mga05p37_437652_c1 | nmdc:mga05p37_437652_c1_795_1115 | 106 |
| 894 | 3300050507 | nmdc:mga05p37_54085_c1 | nmdc:mga05p37_54085_c1_3138_3458 | 106 |
| 895 | 3300050507 | nmdc:mga05p37_66268_c1 | nmdc:mga05p37_66268_c1_3454_3774 | 106 |
| 896 | 3300050507 | nmdc:mga05p37_92690_c1 | nmdc:mga05p37_92690_c1_2811_3134 | 106 |
| 897 | 3300050507 | nmdc:mga05p37_98208_c1 | nmdc:mga05p37_98208_c1_2645_2965 | 106 |
| 898 | 3300050508 | nmdc:mga09592_1304195_c1 | nmdc:mga09592_1304195_c1_181_501 | 106 |
| 899 | 3300050508 | nmdc:mga09592_1441079_c1 | nmdc:mga09592_1441079_c1_23_343 | 106 |
| 900 | 3300050508 | nmdc:mga09592_15247_c1 | nmdc:mga09592_15247_c1_3604_3924 | 106 |
| 901 | 3300050508 | nmdc:mga09592_15522_c1 | nmdc:mga09592_15522_c1_230_550 | 106 |
| 902 | 3300050508 | nmdc:mga09592_1903_c1 | nmdc:mga09592_1903_c1_15572_15892 | 106 |
| 903 | 3300050508 | nmdc:mga09592_258426_c1 | nmdc:mga09592_258426_c1_786_1106 | 106 |
| 904 | 3300050508 | nmdc:mga09592_28339_c1 | nmdc:mga09592_28339_c1_3556_3876 | 106 |
| 905 | 3300050508 | nmdc:mga09592_378224_c1 | nmdc:mga09592_378224_c1_69_389 | 106 |
| 906 | 3300050508 | nmdc:mga09592_400650_c1 | nmdc:mga09592_400650_c1_653_973 | 106 |
| 907 | 3300050508 | nmdc:mga09592_50783_c1 | nmdc:mga09592_50783_c1_2202_2522 | 106 |
| 908 | 3300050508 | nmdc:mga09592_622737_c1 | nmdc:mga09592_622737_c1_432_752 | 106 |
| 909 | 3300050508 | nmdc:mga09592_996446_c1 | nmdc:mga09592_996446_c1_192_512 | 106 |
| 910 | 3300050509 | nmdc:mga0qj67_129_c1 | nmdc:mga0qj67_129_c1_5473_5796 | 106 |
| 911 | 3300050509 | nmdc:mga0qj67_1355991_c1 | nmdc:mga0qj67_1355991_c1_116_436 | 106 |
| 912 | 3300050509 | nmdc:mga0qj67_263467_c1 | nmdc:mga0qj67_263467_c1_613_933 | 106 |
| 913 | 3300050509 | nmdc:mga0qj67_345846_c1 | nmdc:mga0qj67_345846_c1_103_423 | 106 |
| 914 | 3300050509 | nmdc:mga0qj67_523130_c1 | nmdc:mga0qj67_523130_c1_465_785 | 106 |
| 915 | 3300050509 | nmdc:mga0qj67_63996_c1 | nmdc:mga0qj67_63996_c1_994_1314 | 106 |
| 916 | 3300050509 | nmdc:mga0qj67_733_c1 | nmdc:mga0qj67_733_c1_12122_12442 | 106 |
| 917 | 3300050509 | nmdc:mga0qj67_831191_c1 | nmdc:mga0qj67_831191_c1_216_536 | 106 |
| 918 | 3300050509 | nmdc:mga0qj67_885_c1 | nmdc:mga0qj67_885_c1_422_742 | 106 |
| 919 | 3300050510 | nmdc:mga06r32_10855_c1 | nmdc:mga06r32_10855_c1_5549_5869 | 106 |
| 920 | 3300050510 | nmdc:mga06r32_118889_c1 | nmdc:mga06r32_118889_c1_1523_1843 | 106 |
| 921 | 3300050510 | nmdc:mga06r32_1205052_c1 | nmdc:mga06r32_1205052_c1_45_365 | 106 |
| 922 | 3300050510 | nmdc:mga06r32_1301599_c1 | nmdc:mga06r32_1301599_c1_27_347 | 106 |
| 923 | 3300050510 | nmdc:mga06r32_1580981_c1 | nmdc:mga06r32_1580981_c1_160_480 | 106 |
| 924 | 3300050510 | nmdc:mga06r32_172098_c1 | nmdc:mga06r32_172098_c1_99_422 | 106 |
| 925 | 3300050510 | nmdc:mga06r32_182123_c1 | nmdc:mga06r32_182123_c1_69_389 | 106 |
| 926 | 3300050510 | nmdc:mga06r32_299792_c1 | nmdc:mga06r32_299792_c1_182_502 | 106 |
| 927 | 3300050510 | nmdc:mga06r32_485259_c1 | nmdc:mga06r32_485259_c1_628_948 | 106 |
| 928 | 3300050510 | nmdc:mga06r32_572428_c1 | nmdc:mga06r32_572428_c1_397_717 | 106 |
| 929 | 3300050510 | nmdc:mga06r32_57445_c1 | nmdc:mga06r32_57445_c1_2932_3252 | 106 |
| 930 | 3300050510 | nmdc:mga06r32_62963_c1 | nmdc:mga06r32_62963_c1_1811_2131 | 106 |
| 931 | 3300050510 | nmdc:mga06r32_82372_c1 | nmdc:mga06r32_82372_c1_192_512 | 106 |
| 932 | 3300050510 | nmdc:mga06r32_825828_c1 | nmdc:mga06r32_825828_c1_244_564 | 106 |
| 933 | 3300050511 | nmdc:mga08y16_10187_c1 | nmdc:mga08y16_10187_c1_5151_5471 | 106 |
| 934 | 3300050511 | nmdc:mga08y16_112369_c1 | nmdc:mga08y16_112369_c1_16_336 | 106 |
| 935 | 3300050511 | nmdc:mga08y16_1325940_c1 | nmdc:mga08y16_1325940_c1_189_509 | 106 |
| 936 | 3300050511 | nmdc:mga08y16_152687_c1 | nmdc:mga08y16_152687_c1_148_468 | 106 |
| 937 | 3300050511 | nmdc:mga08y16_181142_c1 | nmdc:mga08y16_181142_c1_780_1112 | 106 |
| 938 | 3300050511 | nmdc:mga08y16_2033_c1 | nmdc:mga08y16_2033_c1_285_605 | 106 |
| 939 | 3300050511 | nmdc:mga08y16_2044345_c1 | nmdc:mga08y16_2044345_c1_41_364 | 106 |
| 940 | 3300050511 | nmdc:mga08y16_2110138_c1 | nmdc:mga08y16_2110138_c1_141_461 | 106 |
| 941 | 3300050511 | nmdc:mga08y16_254680_c1 | nmdc:mga08y16_254680_c1_678_998 | 106 |
| 942 | 3300050511 | nmdc:mga08y16_279555_c1 | nmdc:mga08y16_279555_c1_1107_1430 | 106 |
| 943 | 3300050511 | nmdc:mga08y16_299184_c1 | nmdc:mga08y16_299184_c1_63_383 | 106 |
| 944 | 3300050511 | nmdc:mga08y16_39632_c1 | nmdc:mga08y16_39632_c1_168_488 | 106 |
| 945 | 3300050511 | nmdc:mga08y16_397400_c1 | nmdc:mga08y16_397400_c1_553_873 | 106 |
| 946 | 3300050511 | nmdc:mga08y16_44681_c2 | nmdc:mga08y16_44681_c2_1555_1875 | 106 |
| 947 | 3300050511 | nmdc:mga08y16_894136_c1 | nmdc:mga08y16_894136_c1_410_730 | 106 |
| 948 | 3300050512 | nmdc:mga0n895_13013_c1 | nmdc:mga0n895_13013_c1_4294_4614 | 106 |
| 949 | 3300050512 | nmdc:mga0n895_207855_c1 | nmdc:mga0n895_207855_c1_371_691 | 106 |
| 950 | 3300050512 | nmdc:mga0n895_244277_c1 | nmdc:mga0n895_244277_c1_292_612 | 106 |
| 951 | 3300050512 | nmdc:mga0n895_363814_c1 | nmdc:mga0n895_363814_c1_714_1034 | 106 |
| 952 | 3300050512 | nmdc:mga0n895_515275_c1 | nmdc:mga0n895_515275_c1_272_592 | 106 |
| 953 | 3300050512 | nmdc:mga0n895_63738_c1 | nmdc:mga0n895_63738_c1_2380_2703 | 106 |
| 954 | 3300050512 | nmdc:mga0n895_67283_c1 | nmdc:mga0n895_67283_c1_663_983 | 106 |
| 955 | 3300050512 | nmdc:mga0n895_831915_c1 | nmdc:mga0n895_831915_c1_336_656 | 106 |
| 956 | 3300050512 | nmdc:mga0n895_911213_c1 | nmdc:mga0n895_911213_c1_511_831 | 106 |
| 957 | 3300050512 | nmdc:mga0n895_914440_c1 | nmdc:mga0n895_914440_c1_34_357 | 106 |
| 958 | 3300050513 | nmdc:mga0rr50_1053066_c1 | nmdc:mga0rr50_1053066_c1_306_629 | 106 |
| 959 | 3300050513 | nmdc:mga0rr50_3348_c1 | nmdc:mga0rr50_3348_c1_4234_4554 | 106 |
| 960 | 3300050513 | nmdc:mga0rr50_35454_c1 | nmdc:mga0rr50_35454_c1_3205_3525 | 106 |
| 961 | 3300050513 | nmdc:mga0rr50_367426_c1 | nmdc:mga0rr50_367426_c1_464_784 | 106 |
| 962 | 3300050513 | nmdc:mga0rr50_373569_c1 | nmdc:mga0rr50_373569_c1_144_464 | 106 |
| 963 | 3300050513 | nmdc:mga0rr50_532655_c1 | nmdc:mga0rr50_532655_c1_523_843 | 106 |
| 964 | 3300050513 | nmdc:mga0rr50_659677_c1 | nmdc:mga0rr50_659677_c1_353_673 | 106 |
| 965 | 3300050513 | nmdc:mga0rr50_78197_c1 | nmdc:mga0rr50_78197_c1_845_1165 | 106 |
| 966 | 3300050514 | nmdc:mga08x19_4462_c1 | nmdc:mga08x19_4462_c1_4166_4486 | 106 |
| 967 | 3300050514 | nmdc:mga08x19_988589_c1 | nmdc:mga08x19_988589_c1_174_497 | 106 |
| 968 | 3300050515 | nmdc:mga0a205_14700_c1 | nmdc:mga0a205_14700_c1_2469_2789 | 106 |
| 969 | 3300050515 | nmdc:mga0a205_155193_c1 | nmdc:mga0a205_155193_c1_76_396 | 106 |
| 970 | 3300050515 | nmdc:mga0a205_328091_c1 | nmdc:mga0a205_328091_c1_1004_1324 | 106 |
| 971 | 3300050515 | nmdc:mga0a205_3699_c1 | nmdc:mga0a205_3699_c1_963_1283 | 106 |
| 972 | 3300050515 | nmdc:mga0a205_48854_c1 | nmdc:mga0a205_48854_c1_1556_1876 | 106 |
| 973 | 3300050515 | nmdc:mga0a205_49050_c1 | nmdc:mga0a205_49050_c1_946_1266 | 106 |
| 974 | 3300050515 | nmdc:mga0a205_67799_c1 | nmdc:mga0a205_67799_c1_1502_1822 | 106 |
| 975 | 3300053077 | Ga0495601_0057527 | Ga0495601_0057527_635_955 | 106 |
| 976 | 3300053077 | Ga0495601_0269669 | Ga0495601_0269669_738_1061 | 106 |
| 977 | 3300053077 | Ga0495601_0315265 | Ga0495601_0315265_391_711 | 106 |
| 978 | 3300053084 | Ga0495595_0353378 | Ga0495595_0353378_102_422 | 106 |
| 979 | 3300053085 | Ga0495619_0162293 | Ga0495619_0162293_32_352 | 106 |
| 980 | 3300053087 | Ga0500643_002271 | Ga0500643_002271_9650_9970 | 106 |
| 981 | 3300053093 | Ga0500651_0031020 | Ga0500651_0031020_2647_2967 | 106 |
| 982 | 3300053093 | Ga0500651_0088309 | Ga0500651_0088309_1320_1640 | 106 |
| 983 | 3300053094 | Ga0500566_0034058 | Ga0500566_0034058_1645_1965 | 106 |
| 984 | 3300053119 | Ga0500595_000003 | Ga0500595_000003_413786_414106 | 106 |
| 985 | 3300053130 | Ga0500642_0412553 | Ga0500642_0412553_170_490 | 106 |
| 986 | 3300053131 | Ga0500652_005161 | Ga0500652_005161_721_1041 | 106 |
| 987 | 3300053142 | Ga0500577_0185485 | Ga0500577_0185485_346_666 | 106 |
| 988 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1600423_1600743 | 106 |
| 989 | 3300053730 | Ga0500645_000226 | Ga0500645_000226_11706_12026 | 106 |
| 990 | 3300053730 | Ga0500645_201682 | Ga0500645_201682_22_342 | 106 |
| 991 | 3300054114 | Ga0501084_0001073 | Ga0501084_0001073_15769_16092 | 106 |
| 992 | 3300054114 | Ga0501084_0084857 | Ga0501084_0084857_1876_2196 | 106 |
| 993 | 3300054114 | Ga0501084_0214935 | Ga0501084_0214935_657_977 | 106 |
| 994 | 3300054114 | Ga0501084_0413873 | Ga0501084_0413873_247_567 | 106 |
| 995 | 3300054114 | Ga0501084_0427176 | Ga0501084_0427176_652_975 | 106 |
| 996 | 3300054114 | Ga0501084_0841933 | Ga0501084_0841933_69_389 | 106 |
| 997 | 3300054114 | Ga0501084_0989198 | Ga0501084_0989198_345_665 | 106 |
| 998 | 3300060353 | Ga0501082_0000809 | Ga0501082_0000809_7054_7377 | 106 |
| 999 | 3300060353 | Ga0501082_0002254 | Ga0501082_0002254_5353_5673 | 106 |
| 1000 | 3300060353 | Ga0501082_0016215 | Ga0501082_0016215_5172_5492 | 106 |
| 1001 | 3300060353 | Ga0501082_0059202 | Ga0501082_0059202_1305_1625 | 106 |
| 1002 | 3300060353 | Ga0501082_0633352 | Ga0501082_0633352_541_864 | 106 |
| 1003 | 3300060353 | Ga0501082_1007055 | Ga0501082_1007055_90_410 | 106 |
| 1004 | 3300060353 | Ga0501082_1659796 | Ga0501082_1659796_70_390 | 106 |
| 1005 | 3300061734 | Ga0530510_0003125 | Ga0530510_0003125_4606_4929 | 106 |
| 1006 | 3300061734 | Ga0530510_0028935 | Ga0530510_0028935_3250_3570 | 106 |
| 1007 | 3300061734 | Ga0530510_0046048 | Ga0530510_0046048_343_663 | 106 |
| 1008 | 3300061734 | Ga0530510_0150947 | Ga0530510_0150947_488_808 | 106 |
| 1009 | 3300061734 | Ga0530510_0409306 | Ga0530510_0409306_288_608 | 106 |
| 1010 | 3300061734 | Ga0530510_0429679 | Ga0530510_0429679_303_623 | 106 |
| 1011 | 3300061734 | Ga0530510_0874054 | Ga0530510_0874054_212_532 | 106 |
| 1012 | 3300061734 | Ga0530510_1223782 | Ga0530510_1223782_103_423 | 106 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ox5-assembly3.cif.gz_C | the soxyz complex of paracoccus pantotrophus | 0.8958 | 2 | 106 |
| 2oxg-assembly4.cif.gz_E | the soxyz complex of paracoccus pantotrophus | 0.8935 | 1 | 106 |
| 2oxg-assembly3.cif.gz_C | the soxyz complex of paracoccus pantotrophus | 0.8905 | 2 | 105 |
| 2oxg-assembly4.cif.gz_E | the soxyz complex of paracoccus pantotrophus | 0.8851 | 1 | 106 |
| 2ox5-assembly3.cif.gz_C | the soxyz complex of paracoccus pantotrophus | 0.8632 | 2 | 106 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2oxgE00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8935 | 1 | 106 | 2.60.40.10 |
| 2oxgE00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8851 | 1 | 106 | 2.60.40.10 |
| 1v8hB00 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8155 | 1 | 104 | 2.60.40.10 |
| af_Q58151_5_116_2.60.40.730 | Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain | 0.8103 | 5 | 106 | 2.60.40.730 |
| 2nncA00 | Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain | 0.8083 | 4 | 106 | 2.60.40.2470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W7QMR9-F1-model_v4 | Sulphur oxidation protein SoxZ domain-containing protein | 0.924 | 45 | 103 |
|
| AF-A0A6P1B118-F1-model_v4 | deleted | 0.9217 | 41 | 106 |
|
| AF-A0A6P1B118-F1-model_v4 | deleted | 0.8961 | 41 | 106 |
|
| AF-A0A3D9ZF85-F1-model_v4 | Uncharacterized protein | 0.8838 | 5 | 106 |
|
| AF-A0A651FJ43-F1-model_v4 | Sulfur oxidation protein | 0.8837 | 1 | 106 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar