F488159

General Info

Members Datasets Scaffolds Average Seq Length
1012 353 1011 106

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10682833|Ga0065707_106828332
Length 110
Sequence MTDLMARVVVNVPAEAKKGEVIEIRTLAGHPMETGFRRTQLGELVPRDIIRSLVCAYNGVEVFRAELHPAIAANPLLTFTTVATESGTLEFRWTGDNGFSVTEKAVIKVV

Samples

Sample ID Description Type Environment
1 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
179 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
180 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
181 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
182 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
183 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
184 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
185 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
186 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
187 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
188 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
189 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
190 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
204 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
205 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
206 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
221 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
222 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
223 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
224 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
225 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
228 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
229 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
230 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
231 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
242 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
255 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
277 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
278 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
311 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
312 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
313 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
314 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
315 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
316 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
317 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
318 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
319 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
320 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
321 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
322 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
323 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
324 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
331 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
336 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
337 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
338 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
339 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
340 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
341 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
342 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
343 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
344 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
345 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
346 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
347 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
348 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
349 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
350 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
353 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.1
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0
Rhizoplane 1.48
Rhizosphere 96.54
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1012062 3300002070 Bacteria 1141
2 JGI25406J46586_10112665 3300003203 Bacteria 804
3 Ga0058859_10482534 3300004798 Bacteria 645
4 Ga0065707_10002472 3300005295 Bacteria 4857
5 Ga0065707_10008939 3300005295 Bacteria 2752
6 Ga0065707_10032199 3300005295 Bacteria 1093
7 Ga0065707_10142379 3300005295 Bacteria 1756
8 Ga0065707_10421713 3300005295 Bacteria 830
9 Ga0065707_10682833 3300005295 Bacteria 648
10 Ga0065707_10742311 3300005295 Bacteria 622
11 Ga0065707_10843318 3300005295 Bacteria 572
12 Ga0065707_10863893 3300005295 Unclassified 578
13 Ga0070676_10267672 3300005328 Bacteria 1146
14 Ga0070676_10289081 3300005328 Bacteria 1107
15 Ga0070676_10302924 3300005328 Bacteria 1084
16 Ga0070683_100164724 3300005329 Bacteria 2103
17 Ga0070690_100000131 3300005330 Bacteria 38893
18 Ga0070690_100009883 3300005330 Bacteria 5536
19 Ga0070690_100123222 3300005330 Bacteria 1742
20 Ga0070690_101040930 3300005330 Bacteria 647
21 Ga0068869_100000392 3300005334 Bacteria 23853
22 Ga0068869_100032305 3300005334 Bacteria 3688
23 Ga0068869_101253262 3300005334 Bacteria 653
24 Ga0070666_10295857 3300005335 Bacteria 1152
25 Ga0070680_100052279 3300005336 Bacteria 3335
26 Ga0070680_100055201 3300005336 Bacteria 3246
27 Ga0070680_100130316 3300005336 Bacteria 2104
28 Ga0070680_100168751 3300005336 Bacteria 1841
29 Ga0070680_100644785 3300005336 Bacteria 910
30 Ga0070680_100903533 3300005336 Bacteria 762
31 Ga0070680_101717628 3300005336 Bacteria 544
32 Ga0070682_100024737 3300005337 Bacteria 3577
33 Ga0068868_100000656 3300005338 Bacteria 23322
34 Ga0068868_101081600 3300005338 Bacteria 737
35 Ga0070689_100006489 3300005340 Bacteria 8103
36 Ga0070689_100098199 3300005340 Bacteria 2316
37 Ga0070689_100441349 3300005340 Bacteria 1106
38 Ga0070689_100614528 3300005340 Bacteria 942
39 Ga0070691_10000200 3300005341 Bacteria 20142
40 Ga0070691_10034787 3300005341 Bacteria 2372
41 Ga0070691_10094607 3300005341 Bacteria 1477
42 Ga0070687_100000175 3300005343 Bacteria 22196
43 Ga0070687_100127683 3300005343 Bacteria 1464
44 Ga0070687_100318442 3300005343 Bacteria 993
45 Ga0070692_10001132 3300005345 Bacteria 9346
46 Ga0070692_10018032 3300005345 Bacteria 3387
47 Ga0070692_11059412 3300005345 Unclassified 570
48 Ga0070668_100055705 3300005347 Bacteria 3053
49 Ga0070668_100226763 3300005347 Bacteria 1543
50 Ga0070668_101331689 3300005347 Unclassified 653
51 Ga0070669_100190392 3300005353 Bacteria 1609
52 Ga0070669_101272375 3300005353 Unclassified 636
53 Ga0070669_101835745 3300005353 Unclassified 529
54 Ga0070675_100050024 3300005354 Bacteria 3431
55 Ga0070675_100076173 3300005354 Bacteria 2790
56 Ga0070671_101381184 3300005355 Bacteria 622
57 Ga0070674_100069371 3300005356 Bacteria 2487
58 Ga0070674_100688142 3300005356 Bacteria 873
59 Ga0070673_100078130 3300005364 Bacteria 2676
60 Ga0070688_100216458 3300005365 Bacteria 1348
61 Ga0070688_100702707 3300005365 Bacteria 783
62 Ga0070688_100734921 3300005365 Unclassified 767
63 Ga0070688_101069554 3300005365 Bacteria 644
64 Ga0070703_10140112 3300005406 Archaea 898
65 Ga0070709_10978484 3300005434 Bacteria 672
66 Ga0070710_10193938 3300005437 Bacteria 1279
67 Ga0070701_10000676 3300005438 Bacteria 12013
68 Ga0070701_10181614 3300005438 Bacteria 1232
69 Ga0070701_10337596 3300005438 Bacteria 937
70 Ga0070701_10356053 3300005438 Bacteria 916
71 Ga0070701_10667612 3300005438 Archaea 696
72 Ga0070711_100267315 3300005439 Bacteria 1348
73 Ga0070711_100562676 3300005439 Bacteria 947
74 Ga0070705_100003918 3300005440 Bacteria 7277
75 Ga0070705_100144122 3300005440 Bacteria 1572
76 Ga0070705_100250177 3300005440 Bacteria 1244
77 Ga0070705_100719174 3300005440 Bacteria 786
78 Ga0070705_100849852 3300005440 Bacteria 730
79 Ga0070705_101056823 3300005440 Bacteria 662
80 Ga0070700_100000587 3300005441 Bacteria 18243
81 Ga0070700_100044406 3300005441 Bacteria 2737
82 Ga0070700_100530306 3300005441 Bacteria 911
83 Ga0070700_101148093 3300005441 Bacteria 646
84 Ga0070700_101215337 3300005441 Unclassified 630
85 Ga0070694_100000136 3300005444 Bacteria 36787
86 Ga0070694_100367479 3300005444 Bacteria 1119
87 Ga0070694_100474031 3300005444 Bacteria 992
88 Ga0070694_100680372 3300005444 Bacteria 835
89 Ga0070694_100740679 3300005444 Bacteria 802
90 Ga0070694_100842465 3300005444 Bacteria 754
91 Ga0070694_100890541 3300005444 Bacteria 734
92 Ga0070694_101103691 3300005444 Unclassified 662
93 Ga0070708_100045853 3300005445 Bacteria 3854
94 Ga0070708_100493268 3300005445 Bacteria 1155
95 Ga0070708_100503739 3300005445 Bacteria 1142
96 Ga0070663_100431865 3300005455 Bacteria 1082
97 Ga0070678_100988831 3300005456 Bacteria 773
98 Ga0070662_100832722 3300005457 Archaea 785
99 Ga0070662_101650347 3300005457 Bacteria 553
100 Ga0070681_10007592 3300005458 Bacteria 10603
101 Ga0068867_100001154 3300005459 Bacteria 18064
102 Ga0068867_100002412 3300005459 Bacteria 13146
103 Ga0068867_100251805 3300005459 Bacteria 1436
104 Ga0068867_100559475 3300005459 Bacteria 992
105 Ga0068867_100837729 3300005459 Bacteria 823
106 Ga0070706_100078100 3300005467 Bacteria 3065
107 Ga0070706_100119580 3300005467 Bacteria 2455
108 Ga0070707_100047466 3300005468 Bacteria 4111
109 Ga0070707_100753661 3300005468 Bacteria 937
110 Ga0070707_100808756 3300005468 Bacteria 901
111 Ga0070698_100009043 3300005471 Bacteria 10708
112 Ga0070698_100013803 3300005471 Bacteria 8546
113 Ga0070698_100094448 3300005471 Bacteria 2969
114 Ga0070698_100402494 3300005471 Bacteria 1302
115 Ga0070699_100305144 3300005518 Bacteria 1428
116 Ga0070699_100343313 3300005518 Bacteria 1344
117 Ga0070699_100352759 3300005518 Bacteria 1325
118 Ga0070699_100438873 3300005518 Bacteria 1183
119 Ga0070679_100110038 3300005530 Bacteria 2741
120 Ga0070684_100080859 3300005535 Bacteria 2875
121 Ga0070697_100028284 3300005536 Bacteria 4488
122 Ga0070697_100038912 3300005536 Bacteria 3843
123 Ga0070697_100183529 3300005536 Bacteria 1774
124 Ga0070672_100571404 3300005543 Archaea 983
125 Ga0070686_100000285 3300005544 Bacteria 34108
126 Ga0070686_100034464 3300005544 Bacteria 3120
127 Ga0070686_100382979 3300005544 Bacteria 1065
128 Ga0070686_100729425 3300005544 Bacteria 793
129 Ga0070686_101062558 3300005544 Bacteria 667
130 Ga0070686_101738496 3300005544 Unclassified 530
131 Ga0070695_100000705 3300005545 Bacteria 17853
132 Ga0070695_100494244 3300005545 Bacteria 945
133 Ga0070695_100576905 3300005545 Bacteria 880
134 Ga0070695_101335010 3300005545 Unclassified 593
135 Ga0070696_100002015 3300005546 Bacteria 13322
136 Ga0070696_100015035 3300005546 Bacteria 5195
137 Ga0070696_100025633 3300005546 Bacteria 4009
138 Ga0070696_100173263 3300005546 Bacteria 1596
139 Ga0070696_100276734 3300005546 Bacteria 1278
140 Ga0070696_100981981 3300005546 Bacteria 704
141 Ga0070693_100000278 3300005547 Bacteria 24050
142 Ga0070693_100480465 3300005547 Bacteria 878
143 Ga0070693_100931771 3300005547 Bacteria 653
144 Ga0070704_100000103 3300005549 Bacteria 29844
145 Ga0070704_100001347 3300005549 Bacteria 13021
146 Ga0070704_100102412 3300005549 Bacteria 2160
147 Ga0070704_100213775 3300005549 Bacteria 1564
148 Ga0070704_100488248 3300005549 Bacteria 1067
149 Ga0070704_101264158 3300005549 Unclassified 675
150 Ga0070704_101907159 3300005549 Unclassified 551
151 Ga0068857_100410209 3300005577 Bacteria 1262
152 Ga0068854_100001266 3300005578 Bacteria 15179
153 Ga0068856_100025824 3300005614 Bacteria 5728
154 Ga0070702_100000039 3300005615 Bacteria 35203
155 Ga0070702_100011795 3300005615 Bacteria 4358
156 Ga0070702_100263693 3300005615 Bacteria 1174
157 Ga0068852_101909030 3300005616 Bacteria 616
158 Ga0068859_100000420 3300005617 Bacteria 42401
159 Ga0068859_100181226 3300005617 Bacteria 2189
160 Ga0068859_100332394 3300005617 Bacteria 1614
161 Ga0068859_100509781 3300005617 Bacteria 1298
162 Ga0068859_100894356 3300005617 Bacteria 973
163 Ga0068866_10001352 3300005718 Bacteria 10601
164 Ga0068861_100000399 3300005719 Bacteria 25138
165 Ga0068861_100121308 3300005719 Bacteria 2109
166 Ga0068861_100452508 3300005719 Bacteria 1151
167 Ga0068861_100715111 3300005719 Bacteria 932
168 Ga0068861_101178810 3300005719 Bacteria 740
169 Ga0068870_10036599 3300005840 Bacteria 2526
170 Ga0068870_10066418 3300005840 Bacteria 1953
171 Ga0068863_102666131 3300005841 Unclassified 509
172 Ga0068858_100005769 3300005842 Bacteria 12097
173 Ga0068858_100112559 3300005842 Bacteria 2542
174 Ga0068858_100520779 3300005842 Bacteria 1150
175 Ga0068858_101170622 3300005842 Unclassified 755
176 Ga0068860_100002528 3300005843 Bacteria 19155
177 Ga0068860_100099481 3300005843 Bacteria 2774
178 Ga0068860_100533700 3300005843 Bacteria 1174
179 Ga0068860_100602500 3300005843 Bacteria 1104
180 Ga0068860_101460699 3300005843 Bacteria 705
181 Ga0068862_100005981 3300005844 Bacteria 10130
182 Ga0068862_100048027 3300005844 Bacteria 3643
183 Ga0068862_100166396 3300005844 Bacteria 1971
184 Ga0068862_100553678 3300005844 Bacteria 1098
185 Ga0068862_101458131 3300005844 Unclassified 689
186 Ga0068862_102493692 3300005844 Unclassified 529
187 Ga0081455_10003176 3300005937 Bacteria 19071
188 Ga0081455_10450024 3300005937 Bacteria 880
189 Ga0081455_10614601 3300005937 Bacteria 706
190 Ga0081538_10337381 3300005981 Unclassified 547
191 Ga0081540_1000841 3300005983 Bacteria 28015
192 Ga0081540_1023446 3300005983 Bacteria 3609
193 Ga0081539_10000468 3300005985 Bacteria 85386
194 Ga0081539_10029471 3300005985 Bacteria 3427
195 Ga0075368_10106793 3300006042 Bacteria 1152
196 Ga0075432_10105557 3300006058 Bacteria 1045
197 Ga0070716_100481606 3300006173 Bacteria 911
198 Ga0070712_100001185 3300006175 Bacteria 15747
199 Ga0097621_100000754 3300006237 Bacteria 22721
200 Ga0097621_100028703 3300006237 Bacteria 4387
201 Ga0097621_101106566 3300006237 Bacteria 744
202 Ga0068871_100003878 3300006358 Bacteria 10311
203 Ga0068871_100009731 3300006358 Bacteria 6978
204 Ga0068871_100367069 3300006358 Unclassified 1276
205 Ga0068871_101363878 3300006358 Bacteria 668
206 Ga0075428_100001502 3300006844 Bacteria 24964
207 Ga0075428_100016740 3300006844 Bacteria 8096
208 Ga0075428_100101531 3300006844 Bacteria 3136
209 Ga0075428_100169137 3300006844 Bacteria 2370
210 Ga0075428_100185437 3300006844 Bacteria 2251
211 Ga0075428_100209874 3300006844 Bacteria 2104
212 Ga0075428_100277743 3300006844 Bacteria 1802
213 Ga0075428_100370279 3300006844 Bacteria 1536
214 Ga0075428_100400711 3300006844 Bacteria 1471
215 Ga0075428_100533781 3300006844 Unclassified 1254
216 Ga0075428_100583307 3300006844 Bacteria 1194
217 Ga0075428_100846073 3300006844 Bacteria 971
218 Ga0075428_100970926 3300006844 Bacteria 900
219 Ga0075428_101384707 3300006844 Bacteria 738
220 Ga0075428_101511895 3300006844 Bacteria 703
221 Ga0075428_101908210 3300006844 Bacteria 617
222 Ga0075428_102122220 3300006844 Bacteria 581
223 Ga0075428_102475135 3300006844 Bacteria 532
224 Ga0075430_100001098 3300006846 Bacteria 21488
225 Ga0075430_100002189 3300006846 Bacteria 16184
226 Ga0075430_100004241 3300006846 Bacteria 12110
227 Ga0075430_100011150 3300006846 Bacteria 7618
228 Ga0075430_100044526 3300006846 Bacteria 3751
229 Ga0075430_100243501 3300006846 Bacteria 1490
230 Ga0075430_100251596 3300006846 Bacteria 1464
231 Ga0075430_100351842 3300006846 Bacteria 1216
232 Ga0075430_100736214 3300006846 Bacteria 813
233 Ga0075430_101346514 3300006846 Bacteria 587
234 Ga0075430_101660051 3300006846 Unclassified 524
235 Ga0075431_100012939 3300006847 Bacteria 8423
236 Ga0075431_100021216 3300006847 Bacteria 6638
237 Ga0075431_100059320 3300006847 Bacteria 3949
238 Ga0075431_100115679 3300006847 Bacteria 2769
239 Ga0075431_100145224 3300006847 Bacteria 2445
240 Ga0075431_100150292 3300006847 Bacteria 2399
241 Ga0075431_100276979 3300006847 Bacteria 1699
242 Ga0075431_100317579 3300006847 Bacteria 1571
243 Ga0075431_100355586 3300006847 Unclassified 1472
244 Ga0075431_100729205 3300006847 Bacteria 967
245 Ga0075431_101512254 3300006847 Bacteria 630
246 Ga0075431_101849872 3300006847 Unclassified 560
247 Ga0075433_10011246 3300006852 Bacteria 7205
248 Ga0075433_10033804 3300006852 Bacteria 4386
249 Ga0075433_10060852 3300006852 Bacteria 3307
250 Ga0075433_10131534 3300006852 Bacteria 2223
251 Ga0075433_10131656 3300006852 Bacteria 2222
252 Ga0075433_10154480 3300006852 Bacteria 2042
253 Ga0075433_11540808 3300006852 Bacteria 574
254 Ga0075434_100006963 3300006871 Bacteria 10421
255 Ga0075434_100043103 3300006871 Bacteria 4474
256 Ga0075434_100064939 3300006871 Bacteria 3635
257 Ga0075434_100083230 3300006871 Bacteria 3197
258 Ga0075434_100156612 3300006871 Bacteria 2297
259 Ga0075434_100379461 3300006871 Bacteria 1434
260 Ga0075434_100389302 3300006871 Bacteria 1415
261 Ga0075434_101351586 3300006871 Bacteria 723
262 Ga0075434_101359723 3300006871 Bacteria 720
263 Ga0075434_101777379 3300006871 Bacteria 623
264 Ga0075434_101787199 3300006871 Bacteria 622
265 Ga0075434_101958202 3300006871 Bacteria 591
266 Ga0075429_100000055 3300006880 Bacteria 55152
267 Ga0075429_100000432 3300006880 Bacteria 31238
268 Ga0075429_100001365 3300006880 Bacteria 19968
269 Ga0075429_100028891 3300006880 Bacteria 4816
270 Ga0075429_100044996 3300006880 Bacteria 3840
271 Ga0075429_100098316 3300006880 Bacteria 2554
272 Ga0075429_100184447 3300006880 Bacteria 1828
273 Ga0075429_100473842 3300006880 Bacteria 1097
274 Ga0075429_101677911 3300006880 Bacteria 552
275 Ga0075429_101964715 3300006880 Unclassified 507
276 Ga0068865_100001524 3300006881 Bacteria 13518
277 Ga0068865_100040545 3300006881 Bacteria 3165
278 Ga0068865_100252665 3300006881 Bacteria 1392
279 Ga0075436_100007888 3300006914 Bacteria 7286
280 Ga0075436_100114402 3300006914 Bacteria 1884
281 Ga0097620_100000420 3300006931 Bacteria 42401
282 Ga0097620_100181248 3300006931 Bacteria 2189
283 Ga0097620_100332394 3300006931 Bacteria 1614
284 Ga0097620_100509803 3300006931 Bacteria 1298
285 Ga0097620_100894455 3300006931 Bacteria 973
286 Ga0075435_100007468 3300007076 Bacteria 7793
287 Ga0075435_100024358 3300007076 Bacteria 4696
288 Ga0075435_100048103 3300007076 Bacteria 3425
289 Ga0075435_100200586 3300007076 Bacteria 1690
290 Ga0075435_100201259 3300007076 Bacteria 1688
291 Ga0075435_100351769 3300007076 Bacteria 1263
292 Ga0075435_101268334 3300007076 Bacteria 645
293 Ga0099794_10064805 3300007265 Bacteria 1781
294 Ga0099794_10295389 3300007265 Bacteria 839
295 Ga0099794_10494406 3300007265 Bacteria 643
296 Ga0099795_10335698 3300007788 Bacteria 673
297 Ga0099795_10425416 3300007788 Unclassified 607
298 Ga0105240_12017022 3300009093 Bacteria 599
299 Ga0111539_10006184 3300009094 Bacteria 15445
300 Ga0111539_10026623 3300009094 Bacteria 7069
301 Ga0111539_10088217 3300009094 Bacteria 3645
302 Ga0111539_10102104 3300009094 Bacteria 3366
303 Ga0111539_10131305 3300009094 Bacteria 2933
304 Ga0111539_10184796 3300009094 Bacteria 2434
305 Ga0111539_10237023 3300009094 Bacteria 2124
306 Ga0111539_10240452 3300009094 Bacteria 2108
307 Ga0111539_10251855 3300009094 Bacteria 2056
308 Ga0111539_10402779 3300009094 Bacteria 1594
309 Ga0111539_10782009 3300009094 Bacteria 1111
310 Ga0111539_11135043 3300009094 Bacteria 908
311 Ga0111539_11245919 3300009094 Bacteria 864
312 Ga0111539_11980314 3300009094 Bacteria 676
313 Ga0105245_10012764 3300009098 Bacteria 7317
314 Ga0114129_10002987 3300009147 Bacteria 23703
315 Ga0114129_10006327 3300009147 Bacteria 16791
316 Ga0114129_10012532 3300009147 Bacteria 12074
317 Ga0114129_10030430 3300009147 Bacteria 7639
318 Ga0114129_10060555 3300009147 Bacteria 5293
319 Ga0114129_10067680 3300009147 Bacteria 4981
320 Ga0114129_10073085 3300009147 Bacteria 4778
321 Ga0114129_10124456 3300009147 Bacteria 3546
322 Ga0114129_10224122 3300009147 Bacteria 2535
323 Ga0114129_10237706 3300009147 Bacteria 2450
324 Ga0114129_10281729 3300009147 Bacteria 2221
325 Ga0114129_10299009 3300009147 Bacteria 2146
326 Ga0114129_10301114 3300009147 Bacteria 2137
327 Ga0114129_10308584 3300009147 Bacteria 2107
328 Ga0114129_10356472 3300009147 Bacteria 1936
329 Ga0114129_10365692 3300009147 Bacteria 1908
330 Ga0114129_10768525 3300009147 Unclassified 1232
331 Ga0114129_11628529 3300009147 Unclassified 789
332 Ga0114129_12639983 3300009147 Bacteria 599
333 Ga0105243_10002912 3300009148 Bacteria 14169
334 Ga0105243_10035086 3300009148 Bacteria 3888
335 Ga0105241_10044445 3300009174 Bacteria 3366
336 Ga0105241_11425235 3300009174 Bacteria 664
337 Ga0105242_10000248 3300009176 Bacteria 42523
338 Ga0105242_10227045 3300009176 Bacteria 1671
339 Ga0105248_10631497 3300009177 Bacteria 1208
340 Ga0105248_12160258 3300009177 Unclassified 633
341 Ga0105248_12161144 3300009177 Bacteria 633
342 Ga0105237_11902219 3300009545 Archaea 603
343 Ga0105237_12111053 3300009545 Bacteria 572
344 Ga0105249_10054817 3300009553 Bacteria 3646
345 Ga0105249_10066654 3300009553 Bacteria 3315
346 Ga0105249_10287100 3300009553 Bacteria 1645
347 Ga0105249_10539275 3300009553 Bacteria 1216
348 Ga0105249_11122045 3300009553 Bacteria 857
349 Ga0105249_12037070 3300009553 Bacteria 647
350 Ga0105239_10199942 3300010375 Bacteria 2239
351 Ga0157374_11997332 3300013296 Bacteria 606
352 Ga0157378_10000387 3300013297 Bacteria 43542
353 Ga0157378_10108512 3300013297 Bacteria 2542
354 Ga0157378_10721705 3300013297 Bacteria 1017
355 Ga0157378_11255069 3300013297 Bacteria 781
356 Ga0163162_10633774 3300013306 Bacteria 1193
357 Ga0163162_11634273 3300013306 Bacteria 735
358 Ga0163162_11694773 3300013306 Bacteria 722
359 Ga0163162_11740112 3300013306 Bacteria 712
360 Ga0163162_12447749 3300013306 Bacteria 600
361 Ga0157372_11314907 3300013307 Bacteria 834
362 Ga0157375_12124567 3300013308 Unclassified 668
363 Ga0157380_10011921 3300014326 Bacteria 6289
364 Ga0157380_10025684 3300014326 Bacteria 4469
365 Ga0157380_11671134 3300014326 Bacteria 694
366 Ga0157380_13121355 3300014326 Unclassified 528
367 Ga0157377_10603151 3300014745 Unclassified 783
368 Ga0157376_10012006 3300014969 Bacteria 6410
369 Ga0157376_11450566 3300014969 Unclassified 719
370 Ga0163161_10365627 3300017792 Unclassified 1150
371 Ga0163161_11353484 3300017792 Bacteria 620
372 Ga0213875_10072124 3300021388 Bacteria 1612
373 Ga0207666_1045861 3300025271 Unclassified 688
374 Ga0207653_10004764 3300025885 Bacteria 4242
375 Ga0207682_10363490 3300025893 Unclassified 682
376 Ga0207692_10180675 3300025898 Bacteria 1229
377 Ga0207642_10005011 3300025899 Bacteria 4300
378 Ga0207642_10053835 3300025899 Bacteria 1832
379 Ga0207688_10057485 3300025901 Bacteria 2187
380 Ga0207688_10617023 3300025901 Bacteria 684
381 Ga0207680_10055662 3300025903 Bacteria 2385
382 Ga0207645_10049224 3300025907 Bacteria 2691
383 Ga0207645_10472831 3300025907 Bacteria 847
384 Ga0207645_11018987 3300025907 Unclassified 560
385 Ga0207643_10064864 3300025908 Bacteria 2091
386 Ga0207643_10077561 3300025908 Bacteria 1921
387 Ga0207684_10019497 3300025910 Bacteria 5800
388 Ga0207684_10399399 3300025910 Bacteria 1182
389 Ga0207654_10252025 3300025911 Bacteria 1184
390 Ga0207707_10011165 3300025912 Bacteria 7813
391 Ga0207663_10302475 3300025916 Bacteria 1196
392 Ga0207660_10041586 3300025917 Bacteria 3222
393 Ga0207660_10043670 3300025917 Bacteria 3150
394 Ga0207660_10067317 3300025917 Bacteria 2594
395 Ga0207660_10160542 3300025917 Bacteria 1734
396 Ga0207660_10562741 3300025917 Bacteria 928
397 Ga0207660_11075085 3300025917 Bacteria 656
398 Ga0207662_10000095 3300025918 Bacteria 41923
399 Ga0207662_10268917 3300025918 Bacteria 1124
400 Ga0207652_10026429 3300025921 Bacteria 4835
401 Ga0207646_10003246 3300025922 Bacteria 18533
402 Ga0207646_10858213 3300025922 Bacteria 807
403 Ga0207681_10194022 3300025923 Bacteria 1556
404 Ga0207681_10208421 3300025923 Bacteria 1505
405 Ga0207681_10311137 3300025923 Bacteria 1249
406 Ga0207681_11610792 3300025923 Unclassified 543
407 Ga0207659_10024348 3300025926 Bacteria 4055
408 Ga0207659_10159000 3300025926 Bacteria 1772
409 Ga0207659_11863080 3300025926 Unclassified 510
410 Ga0207687_10003242 3300025927 Bacteria 11024
411 Ga0207687_11727265 3300025927 Bacteria 536
412 Ga0207644_10408267 3300025931 Bacteria 1111
413 Ga0207644_10933887 3300025931 Bacteria 727
414 Ga0207690_10673940 3300025932 Bacteria 849
415 Ga0207706_11152731 3300025933 Bacteria 646
416 Ga0207686_10001874 3300025934 Bacteria 11669
417 Ga0207709_10001439 3300025935 Bacteria 16614
418 Ga0207709_10040568 3300025935 Bacteria 2788
419 Ga0207670_10002023 3300025936 Bacteria 10646
420 Ga0207670_10115149 3300025936 Bacteria 1944
421 Ga0207669_10016254 3300025937 Bacteria 3776
422 Ga0207704_10000623 3300025938 Bacteria 15673
423 Ga0207704_10040114 3300025938 Bacteria 2733
424 Ga0207704_10467020 3300025938 Bacteria 1010
425 Ga0207665_10129051 3300025939 Bacteria 1793
426 Ga0207665_10374736 3300025939 Bacteria 1079
427 Ga0207691_10396080 3300025940 Bacteria 1178
428 Ga0207711_11247717 3300025941 Bacteria 685
429 Ga0207689_10000977 3300025942 Bacteria 27402
430 Ga0207689_10048172 3300025942 Bacteria 3515
431 Ga0207689_10284782 3300025942 Bacteria 1368
432 Ga0207689_10986962 3300025942 Bacteria 710
433 Ga0207661_10561417 3300025944 Bacteria 1046
434 Ga0207712_10013536 3300025961 Bacteria 5231
435 Ga0207712_10108426 3300025961 Bacteria 2078
436 Ga0207712_10587580 3300025961 Bacteria 962
437 Ga0207712_10665316 3300025961 Bacteria 906
438 Ga0207712_11313584 3300025961 Bacteria 646
439 Ga0207668_10083070 3300025972 Bacteria 2330
440 Ga0207668_10163260 3300025972 Bacteria 1738
441 Ga0207640_10019295 3300025981 Bacteria 4026
442 Ga0207640_10627586 3300025981 Bacteria 913
443 Ga0207677_10017944 3300026023 Bacteria 4236
444 Ga0207677_11316375 3300026023 Bacteria 664
445 Ga0207677_11911674 3300026023 Unclassified 551
446 Ga0207703_10012439 3300026035 Bacteria 6635
447 Ga0207703_10018478 3300026035 Bacteria 5444
448 Ga0207678_10460086 3300026067 Bacteria 1106
449 Ga0207708_10000551 3300026075 Bacteria 28958
450 Ga0207708_10005521 3300026075 Bacteria 9333
451 Ga0207708_11361306 3300026075 Archaea 622
452 Ga0207702_10064024 3300026078 Bacteria 3146
453 Ga0207648_10000513 3300026089 Bacteria 43298
454 Ga0207648_10002477 3300026089 Bacteria 19838
455 Ga0207648_10076446 3300026089 Bacteria 2919
456 Ga0207648_10233922 3300026089 Bacteria 1635
457 Ga0207676_10760790 3300026095 Unclassified 943
458 Ga0207674_10810244 3300026116 Unclassified 903
459 Ga0207674_11950776 3300026116 Bacteria 553
460 Ga0207675_100001063 3300026118 Bacteria 27254
461 Ga0207675_100104513 3300026118 Bacteria 2669
462 Ga0207675_100796735 3300026118 Bacteria 958
463 Ga0207675_101912505 3300026118 Unclassified 612
464 Ga0207683_10080122 3300026121 Bacteria 2896
465 Ga0207698_10742700 3300026142 Bacteria 980
466 Ga0209969_1018790 3300027360 Bacteria 1023
467 Ga0209967_1015009 3300027364 Bacteria 1107
468 Ga0209981_1010132 3300027378 Bacteria 1291
469 Ga0210000_1015710 3300027462 Bacteria 1141
470 Ga0209968_1047314 3300027526 Bacteria 742
471 Ga0209970_1003183 3300027614 Bacteria 2774
472 Ga0209588_1027778 3300027671 Bacteria 1801
473 Ga0209971_1003253 3300027682 Bacteria 3870
474 Ga0209966_1002671 3300027695 Bacteria 2984
475 Ga0209998_10009892 3300027717 Unclassified 1977
476 Ga0209813_10243775 3300027866 Bacteria 680
477 Ga0209974_10148155 3300027876 Bacteria 846
478 Ga0207428_10000288 3300027907 Bacteria 67876
479 Ga0207428_10011126 3300027907 Bacteria 7987
480 Ga0207428_10081245 3300027907 Bacteria 2531
481 Ga0207428_10129247 3300027907 Bacteria 1934
482 Ga0207428_10212262 3300027907 Bacteria 1454
483 Ga0207428_10872034 3300027907 Bacteria 637
484 Ga0268265_10009410 3300028380 Bacteria 6598
485 Ga0268265_10043725 3300028380 Bacteria 3331
486 Ga0268265_10409679 3300028380 Bacteria 1256
487 Ga0268265_10714535 3300028380 Unclassified 969
488 Ga0268264_10005879 3300028381 Bacteria 10384
489 Ga0268264_10087084 3300028381 Bacteria 2685
490 Ga0307408_100108002 3300031548 Unclassified 2132
491 Ga0307408_101546949 3300031548 Bacteria 628
492 Ga0307408_102465983 3300031548 Unclassified 505
493 Ga0307408_102508862 3300031548 Unclassified 501
494 Ga0307405_10323688 3300031731 Bacteria 1179
495 Ga0307410_10524901 3300031852 Unclassified 978
496 Ga0307410_11031064 3300031852 Bacteria 711
497 Ga0307410_11889599 3300031852 Unclassified 531
498 Ga0307407_10112275 3300031903 Bacteria 1713
499 Ga0307407_11375041 3300031903 Bacteria 556
500 Ga0307412_10283588 3300031911 Bacteria 1302
501 Ga0307412_11074838 3300031911 Bacteria 715
502 Ga0307409_100094044 3300031995 Bacteria 2465
503 Ga0307416_100218413 3300032002 Bacteria 1826
504 Ga0307416_100480818 3300032002 Unclassified 1302
505 Ga0307416_101129270 3300032002 Bacteria 889
506 Ga0307416_101873284 3300032002 Bacteria 703
507 Ga0307416_102076379 3300032002 Unclassified 670
508 Ga0307416_102708381 3300032002 Bacteria 592
509 Ga0307416_102808169 3300032002 Unclassified 582
510 Ga0307416_103143362 3300032002 Bacteria 552
511 Ga0307416_103284057 3300032002 Bacteria 541
512 Ga0307411_10210161 3300032005 Bacteria 1502
513 Ga0307411_10318321 3300032005 Bacteria 1255
514 Ga0307411_10569643 3300032005 Bacteria 969
515 Ga0307415_101071647 3300032126 Bacteria 753
516 Ga0373930_0054789 3300034816 Bacteria 878
517 Ga0373930_0078431 3300034816 Bacteria 760
518 Ga0373948_0011845 3300034817 Bacteria 1550
519 Ga0373958_0194446 3300034819 Bacteria 528
520 Ga0373959_0026875 3300034820 Bacteria 1140
521 Ga0373938_0238554 3300034957 Unclassified 516
522 Ga0373926_0002148 3300035083 Bacteria 6207
523 Ga0373928_0005303 3300035084 Unclassified 2461
524 Ga0373928_0010322 3300035084 Bacteria 1834
525 Ga0373928_0072121 3300035084 Bacteria 856
526 Ga0373934_0100950 3300035086 Unclassified 1167
527 Ga0373940_0002387 3300035088 Bacteria 3642
528 Ga0373940_0065041 3300035088 Bacteria 1051
529 Ga0373940_0087889 3300035088 Bacteria 927
530 Ga0373944_0005437 3300035089 Bacteria 3354
531 Ga0373949_0127897 3300035090 Bacteria 719
532 Ga0373951_0026089 3300035091 Bacteria 1360
533 Ga0373951_0048705 3300035091 Bacteria 1038
534 Ga0373951_0208294 3300035091 Bacteria 572
535 Ga0373952_0004949 3300035092 Bacteria 2424
536 Ga0373952_0261350 3300035092 Bacteria 527
537 Ga0373923_0062044 3300035111 Bacteria 1590
538 Ga0373932_0002691 3300035112 Bacteria 4422
539 Ga0373932_0024935 3300035112 Bacteria 1614
540 Ga0373932_0051987 3300035112 Bacteria 1219
541 Ga0373932_0076916 3300035112 Bacteria 1047
542 Ga0373932_0224809 3300035112 Unclassified 676
543 Ga0373932_0254490 3300035112 Bacteria 642
544 Ga0373932_0340476 3300035112 Unclassified 568
545 Ga0373936_0040361 3300035113 Bacteria 1869
546 Ga0373939_0007089 3300035114 Bacteria 2714
547 Ga0373939_0044303 3300035114 Bacteria 1354
548 Ga0373939_0052296 3300035114 Bacteria 1273
549 Ga0373939_0068016 3300035114 Unclassified 1152
550 Ga0373939_0076110 3300035114 Bacteria 1104
551 Ga0373939_0110226 3300035114 Bacteria 957
552 Ga0373941_0005268 3300035115 Bacteria 3033
553 Ga0373941_0017198 3300035115 Bacteria 1977
554 Ga0373941_0019880 3300035115 Bacteria 1876
555 Ga0373941_0143279 3300035115 Bacteria 871
556 Ga0373941_0376150 3300035115 Bacteria 583
557 Ga0373945_0048244 3300035116 Bacteria 1559
558 Ga0373954_0000030 3300035118 Bacteria 55716
559 Ga0373954_0259205 3300035118 Bacteria 856
560 Ga0373957_0056107 3300035120 Bacteria 1516
561 Ga0373960_0022032 3300035121 Bacteria 1701
562 Ga0373960_0028430 3300035121 Bacteria 1543
563 Ga0373960_0037436 3300035121 Bacteria 1386
564 Ga0373943_0068348 3300035170 Bacteria 1793
565 Ga0373946_0047609 3300035171 Bacteria 1781
566 Ga0373955_0084477 3300035172 Bacteria 1800
567 Ga0373955_0353705 3300035172 Unclassified 890
568 Ga0373942_0019869 3300035207 Bacteria 1681
569 Ga0373942_0058599 3300035207 Unclassified 1098
570 Ga0373942_0063190 3300035207 Bacteria 1065
571 Ga0373942_0131809 3300035207 Bacteria 789
572 Ga0373961_0021631 3300035241 Unclassified 1713
573 Ga0373961_0038197 3300035241 Bacteria 1375
574 Ga0373961_0073549 3300035241 Bacteria 1061
575 Ga0373961_0105621 3300035241 Bacteria 917
576 Ga0373961_0448189 3300035241 Bacteria 503
577 Ga0373962_0008702 3300035242 Bacteria 2504
578 Ga0373962_0012184 3300035242 Bacteria 2164
579 Ga0373962_0013605 3300035242 Bacteria 2064
580 Ga0373962_0100443 3300035242 Bacteria 902
581 Ga0373962_0171366 3300035242 Bacteria 721
582 Ga0373962_0357490 3300035242 Unclassified 529
583 Ga0373924_0016098 3300035410 Bacteria 2852
584 Ga0373931_0001918 3300035691 Bacteria 9111
585 Ga0373931_0002342 3300035691 Bacteria 8366
586 Ga0373931_0006328 3300035691 Bacteria 5524
587 Ga0373931_0010421 3300035691 Bacteria 4467
588 Ga0373931_0025771 3300035691 Bacteria 2987
589 Ga0373931_0029473 3300035691 Bacteria 2818
590 Ga0373931_0033364 3300035691 Bacteria 2668
591 Ga0373931_0073169 3300035691 Bacteria 1875
592 Ga0373931_0213618 3300035691 Bacteria 1158
593 Ga0373931_0250445 3300035691 Unclassified 1077
594 Ga0373931_1260027 3300035691 Bacteria 508
595 Ga0373935_0125433 3300035692 Bacteria 1719
596 Ga0373927_0008733 3300035695 Bacteria 6806
597 Ga0373927_1012096 3300035695 Bacteria 548
598 Ga0373933_0022210 3300035724 Bacteria 3611
599 Ga0373947_0048561 3300035725 Bacteria 2546
600 Ga0373937_0025516 3300036401 Bacteria 5335
601 Ga0373937_0604372 3300036401 Bacteria 1041
602 Ga0373937_0622877 3300036401 Bacteria 1024
603 Ga0373925_0012851 3300037068 Bacteria 6065
604 Ga0395900_0003092 3300037418 Bacteria 18074
605 Ga0395898_0011090 3300037466 Bacteria 9384
606 Ga0395905_0252699 3300037471 Bacteria 1647
607 Ga0436364_1195800 3300037853 Bacteria 2751
608 Ga0395901_0001902 3300038443 Bacteria 21558
609 Ga0436365_1664112 3300039437 Bacteria 1359
610 Ga0436365_1801159 3300039437 Bacteria 2440
611 Ga0451807_2725195 3300041486 Bacteria 2599
612 Ga0451839_0304386 3300041496 Bacteria 757
613 Ga0439441_087449 3300042001 Unclassified 685
614 Ga0439441_185385 3300042001 Bacteria 502
615 Ga0439456_117078 3300042013 Unclassified 609
616 Ga0439435_0001468 3300042436 Bacteria 4378
617 Ga0439460_0002117 3300042461 Bacteria 4757
618 Ga0439460_0132936 3300042461 Bacteria 821
619 Ga0439460_0175014 3300042461 Bacteria 724
620 Ga0451577_0034679 3300042876 Bacteria 4547
621 Ga0451577_0063848 3300042876 Bacteria 3284
622 Ga0451577_0402867 3300042876 Unclassified 1242
623 Ga0451577_0463491 3300042876 Bacteria 1151
624 Ga0451577_0548330 3300042876 Bacteria 1050
625 Ga0451577_0849017 3300042876 Bacteria 824
626 Ga0439440_0147678 3300042993 Bacteria 671
627 Ga0466972_0418143 3300044658 Bacteria 629
628 Ga0453683_0191599 3300044673 Bacteria 1297
629 Ga0466965_0060429 3300044683 Bacteria 1893
630 Ga0466960_0450872 3300044901 Bacteria 748
631 Ga0451576_0018030 3300045051 Bacteria 7745
632 Ga0451576_0020308 3300045051 Bacteria 7235
633 Ga0451576_0023304 3300045051 Bacteria 6703
634 Ga0451576_0286661 3300045051 Bacteria 1721
635 Ga0451576_0424788 3300045051 Unclassified 1394
636 Ga0451576_0498059 3300045051 Bacteria 1280
637 Ga0451576_1243971 3300045051 Bacteria 777
638 Ga0466967_1536089 3300045976 Bacteria 663
639 Ga0495592_0001475 3300046454 Bacteria 16364
640 Ga0495603_0036255 3300046455 Bacteria 2961
641 Ga0495629_0892549 3300046459 Unclassified 583
642 Ga0495653_0012697 3300046463 Bacteria 6881
643 Ga0495580_0002475 3300046472 Bacteria 16114
644 Ga0495580_0190977 3300046472 Bacteria 1412
645 Ga0495582_0036167 3300046473 Bacteria 2716
646 Ga0495582_0129869 3300046473 Bacteria 1423
647 Ga0495639_0331543 3300046475 Bacteria 762
648 Ga0495662_0005331 3300046476 Bacteria 6441
649 Ga0495662_0038196 3300046476 Bacteria 2320
650 Ga0495584_0137983 3300046491 Bacteria 1238
651 Ga0495608_0014819 3300046511 Bacteria 5408
652 Ga0495608_0611753 3300046511 Unclassified 653
653 Ga0495618_0097543 3300046514 Bacteria 1880
654 Ga0495628_0091825 3300046516 Bacteria 2349
655 Ga0495630_0016927 3300046517 Bacteria 5334
656 Ga0495630_0066008 3300046517 Bacteria 2720
657 Ga0495630_0141363 3300046517 Bacteria 1830
658 Ga0495630_1115995 3300046517 Unclassified 598
659 Ga0495666_0013108 3300046526 Bacteria 4130
660 Ga0495666_0023766 3300046526 Bacteria 3031
661 Ga0495642_0017372 3300046528 Bacteria 2811
662 Ga0495642_0024669 3300046528 Bacteria 2380
663 Ga0495642_0102755 3300046528 Bacteria 1217
664 Ga0495652_0264328 3300046529 Bacteria 1268
665 Ga0495652_0797629 3300046529 Unclassified 629
666 Ga0495665_0062602 3300046531 Bacteria 1964
667 Ga0495665_0348724 3300046531 Unclassified 754
668 Ga0495640_0005456 3300046533 Bacteria 10118
669 Ga0495640_0030921 3300046533 Bacteria 3828
670 Ga0495586_0002272 3300046535 Bacteria 10454
671 Ga0495586_0009170 3300046535 Bacteria 5265
672 Ga0495587_0020738 3300046536 Bacteria 4054
673 Ga0495587_0238668 3300046536 Bacteria 1023
674 Ga0495598_0219483 3300046537 Bacteria 693
675 Ga0495621_0164081 3300046539 Bacteria 880
676 Ga0495621_0202782 3300046539 Bacteria 798
677 Ga0495621_0318220 3300046539 Bacteria 648
678 Ga0495645_0196269 3300046543 Bacteria 1372
679 Ga0495667_0002694 3300046559 Bacteria 11880
680 Ga0495667_0302105 3300046559 Bacteria 1014
681 Ga0495656_0026757 3300046615 Bacteria 2299
682 Ga0495656_0118188 3300046615 Bacteria 1248
683 Ga0495656_0326102 3300046615 Bacteria 792
684 Ga0495634_0003551 3300046642 Bacteria 12479
685 Ga0495635_0109075 3300046663 Bacteria 1891
686 Ga0495659_0059792 3300046664 Bacteria 1405
687 Ga0495659_0061294 3300046664 Bacteria 1390
688 Ga0495659_0095715 3300046664 Bacteria 1145
689 Ga0495661_0390800 3300046665 Bacteria 678
690 Ga0495588_0171347 3300046674 Bacteria 1147
691 Ga0495599_0002703 3300046678 Bacteria 10357
692 Ga0495599_0098574 3300046678 Bacteria 1822
693 Ga0495646_0601941 3300046680 Unclassified 558
694 Ga0495647_0001740 3300046681 Bacteria 6749
695 Ga0495647_0154543 3300046681 Bacteria 985
696 Ga0495647_0245078 3300046681 Bacteria 796
697 Ga0495658_0013614 3300046683 Bacteria 4143
698 Ga0495658_0024614 3300046683 Bacteria 3208
699 Ga0495669_0016289 3300046684 Bacteria 3182
700 Ga0495669_0050743 3300046684 Bacteria 1861
701 Ga0495669_0307721 3300046684 Bacteria 764
702 Ga0495669_0531461 3300046684 Bacteria 572
703 Ga0495613_0003446 3300046689 Bacteria 11822
704 Ga0495624_0194193 3300046690 Bacteria 1234
705 Ga0495600_0077653 3300046809 Bacteria 2168
706 Ga0495600_0136839 3300046809 Bacteria 1591
707 Ga0495581_0131514 3300047315 Bacteria 1458
708 Ga0495604_0002697 3300047317 Bacteria 14233
709 Ga0495604_0538134 3300047317 Unclassified 754
710 Ga0495636_0038176 3300047318 Bacteria 1986
711 Ga0495636_0054880 3300047318 Bacteria 1675
712 Ga0495636_0522371 3300047318 Unclassified 575
713 Ga0495636_0651902 3300047318 Unclassified 517
714 Ga0495674_0526202 3300047319 Bacteria 943
715 Ga0495674_0860094 3300047319 Unclassified 702
716 Ga0495680_0004055 3300047322 Bacteria 14117
717 Ga0495680_0696338 3300047322 Unclassified 671
718 Ga0495675_0215029 3300047444 Bacteria 1165
719 Ga0495677_0158614 3300047445 Bacteria 873
720 Ga0495684_0114616 3300047471 Bacteria 2032
721 Ga0495684_0369720 3300047471 Unclassified 1014
722 Ga0496100_0119819 3300048903 Bacteria 1839
723 Ga0496101_0173194 3300048904 Bacteria 1659
724 Ga0496102_0677997 3300048905 Bacteria 954
725 Ga0496103_0092576 3300048906 Bacteria 1908
726 Ga0496104_0047284 3300048907 Bacteria 4055
727 Ga0496105_0160233 3300048908 Bacteria 1847
728 Ga0496106_0023172 3300048909 Bacteria 4612
729 Ga0496107_0013207 3300048910 Bacteria 5771
730 Ga0496109_0003297 3300048912 Bacteria 13474
731 Ga0496110_0016127 3300048913 Bacteria 6231
732 Ga0496111_0384820 3300048914 Bacteria 1037
733 Ga0496112_0048142 3300048915 Bacteria 4180
734 Ga0496113_1003104 3300048916 Bacteria 657
735 Ga0496115_0198577 3300048918 Bacteria 1657
736 Ga0501299_101000 3300049522 Bacteria 670
737 Ga0501299_119268 3300049522 Bacteria 634
738 Ga0501031_0042679 3300049568 Bacteria 2960
739 Ga0501032_0862865 3300049569 Bacteria 571
740 Ga0501033_0006002 3300049570 Bacteria 9528
741 Ga0501033_0066352 3300049570 Bacteria 2654
742 Ga0501034_0199915 3300049571 Bacteria 1957
743 Ga0501036_0002811 3300049572 Bacteria 13791
744 Ga0501036_0186397 3300049572 Bacteria 1746
745 Ga0501036_0373424 3300049572 Bacteria 1190
746 Ga0501036_0555224 3300049572 Bacteria 954
747 Ga0501036_1027854 3300049572 Bacteria 674
748 Ga0501036_1029896 3300049572 Bacteria 673
749 Ga0501036_1244350 3300049572 Bacteria 606
750 Ga0501037_0016719 3300049573 Bacteria 5398
751 Ga0501037_0536499 3300049573 Bacteria 791
752 Ga0501037_0601433 3300049573 Unclassified 738
753 Ga0501037_1120708 3300049573 Bacteria 509
754 Ga0501038_0008069 3300049574 Bacteria 9687
755 Ga0501038_0090474 3300049574 Bacteria 2565
756 Ga0501038_0337775 3300049574 Bacteria 1175
757 Ga0501039_0014392 3300049575 Bacteria 6058
758 Ga0501039_0040879 3300049575 Bacteria 3579
759 Ga0501039_0044419 3300049575 Bacteria 3432
760 Ga0501039_0050433 3300049575 Bacteria 3220
761 Ga0501039_0137551 3300049575 Bacteria 1918
762 Ga0501039_0257536 3300049575 Unclassified 1372
763 Ga0501039_0361291 3300049575 Bacteria 1141
764 Ga0501039_1329603 3300049575 Unclassified 554
765 Ga0501040_0000376 3300049576 Bacteria 26256
766 Ga0501040_0020631 3300049576 Bacteria 4393
767 Ga0501040_0021173 3300049576 Bacteria 4338
768 Ga0501040_0055396 3300049576 Bacteria 2719
769 Ga0501040_0118826 3300049576 Bacteria 1854
770 Ga0501040_0967783 3300049576 Bacteria 617
771 Ga0501041_0000609 3300049577 Bacteria 18677
772 Ga0501041_0044711 3300049577 Bacteria 2691
773 Ga0501041_0230173 3300049577 Bacteria 1164
774 Ga0501041_0233771 3300049577 Bacteria 1154
775 Ga0501041_0253432 3300049577 Bacteria 1106
776 Ga0501041_0259263 3300049577 Bacteria 1093
777 Ga0501041_0534239 3300049577 Unclassified 747
778 Ga0501042_0000217 3300049578 Bacteria 27323
779 Ga0501042_0029750 3300049578 Bacteria 3853
780 Ga0501042_0298264 3300049578 Bacteria 1164
781 Ga0501042_0728428 3300049578 Bacteria 721
782 Ga0501042_0879999 3300049578 Bacteria 652
783 Ga0501042_1233331 3300049578 Bacteria 545
784 Ga0501043_0343407 3300049579 Unclassified 1135
785 Ga0501043_0746534 3300049579 Bacteria 712
786 Ga0501046_0003851 3300049580 Bacteria 13731
787 Ga0501046_0036615 3300049580 Bacteria 3948
788 Ga0501046_1113013 3300049580 Unclassified 545
789 Ga0501046_1223563 3300049580 Bacteria 515
790 Ga0501048_0001002 3300049582 Bacteria 21063
791 Ga0501048_0193203 3300049582 Bacteria 1442
792 Ga0501048_0217621 3300049582 Bacteria 1354
793 Ga0501048_0635887 3300049582 Bacteria 766
794 Ga0501048_0981891 3300049582 Bacteria 607
795 Ga0501048_1149143 3300049582 Bacteria 558
796 Ga0501067_0059070 3300049583 Bacteria 2123
797 Ga0501067_0120572 3300049583 Bacteria 1459
798 Ga0501067_0427476 3300049583 Unclassified 739
799 Ga0501068_0072013 3300049584 Bacteria 2110
800 Ga0501068_0414487 3300049584 Bacteria 869
801 Ga0501068_0677900 3300049584 Bacteria 674
802 Ga0501068_0816443 3300049584 Bacteria 612
803 Ga0501068_0908294 3300049584 Bacteria 579
804 Ga0501068_1208693 3300049584 Unclassified 501
805 Ga0501069_0184637 3300049585 Bacteria 1206
806 Ga0501070_0115292 3300049586 Bacteria 2219
807 Ga0501071_0011096 3300049587 Bacteria 6056
808 Ga0501071_0073797 3300049587 Bacteria 2489
809 Ga0501071_0078746 3300049587 Bacteria 2409
810 Ga0501071_0217319 3300049587 Bacteria 1438
811 Ga0501071_0432788 3300049587 Bacteria 1006
812 Ga0501071_0638314 3300049587 Bacteria 819
813 Ga0501072_0008373 3300049588 Bacteria 7852
814 Ga0501072_0023786 3300049588 Bacteria 4759
815 Ga0501072_0062249 3300049588 Bacteria 2944
816 Ga0501072_0108474 3300049588 Bacteria 2209
817 Ga0501072_0350928 3300049588 Bacteria 1171
818 Ga0501072_1101838 3300049588 Bacteria 618
819 Ga0501072_1105660 3300049588 Bacteria 617
820 Ga0501072_1240763 3300049588 Unclassified 578
821 Ga0501073_0327130 3300049589 Bacteria 1058
822 Ga0501073_0844070 3300049589 Bacteria 631
823 Ga0501074_0054650 3300049590 Bacteria 2879
824 Ga0501074_0280235 3300049590 Bacteria 1185
825 Ga0501074_1300868 3300049590 Unclassified 509
826 Ga0501075_0004474 3300049591 Bacteria 9463
827 Ga0501075_0015921 3300049591 Bacteria 5408
828 Ga0501075_0035366 3300049591 Bacteria 3725
829 Ga0501075_0053786 3300049591 Bacteria 3028
830 Ga0501075_0064978 3300049591 Bacteria 2752
831 Ga0501075_0082723 3300049591 Bacteria 2431
832 Ga0501075_0599301 3300049591 Bacteria 840
833 Ga0501075_0604425 3300049591 Bacteria 836
834 Ga0501076_0000526 3300049592 Bacteria 24329
835 Ga0501076_0000778 3300049592 Bacteria 20562
836 Ga0501076_0010510 3300049592 Bacteria 6869
837 Ga0501076_0011445 3300049592 Bacteria 6609
838 Ga0501076_0142561 3300049592 Bacteria 1947
839 Ga0501076_0163537 3300049592 Bacteria 1814
840 Ga0501076_0612339 3300049592 Bacteria 898
841 Ga0501076_1366318 3300049592 Bacteria 582
842 Ga0501077_0001082 3300049593 Bacteria 16418
843 Ga0501077_0026200 3300049593 Bacteria 3700
844 Ga0501077_0441809 3300049593 Bacteria 833
845 Ga0501199_024935 3300049650 Bacteria 712
846 Ga0501209_262894 3300049656 Bacteria 540
847 Ga0501079_0000010 3300049741 Bacteria 73916
848 Ga0501079_0017301 3300049741 Bacteria 5505
849 Ga0501079_0023005 3300049741 Bacteria 4786
850 Ga0501079_0053522 3300049741 Bacteria 3114
851 Ga0501079_0098297 3300049741 Bacteria 2269
852 Ga0501079_0176662 3300049741 Bacteria 1665
853 Ga0501079_0351802 3300049741 Unclassified 1154
854 Ga0501079_0363463 3300049741 Bacteria 1134
855 Ga0501079_0429811 3300049741 Bacteria 1037
856 Ga0501079_0474012 3300049741 Bacteria 983
857 Ga0501080_0026635 3300049742 Bacteria 5372
858 Ga0501080_0397483 3300049742 Bacteria 1240
859 Ga0501080_0507160 3300049742 Bacteria 1078
860 Ga0501080_0669886 3300049742 Bacteria 917
861 Ga0501080_0750522 3300049742 Bacteria 858
862 Ga0501081_0000811 3300049743 Bacteria 18451
863 Ga0501081_0001107 3300049743 Bacteria 16185
864 Ga0501081_0007636 3300049743 Bacteria 7015
865 Ga0501081_0038926 3300049743 Bacteria 3252
866 Ga0501081_0119593 3300049743 Bacteria 1875
867 Ga0501081_1501706 3300049743 Bacteria 512
868 Ga0501035_0041997 3300049822 Bacteria 4126
869 Ga0501035_0116958 3300049822 Bacteria 2333
870 Ga0501035_0246262 3300049822 Bacteria 1519
871 Ga0501035_0620111 3300049822 Bacteria 880
872 Ga0501044_0059444 3300049823 Bacteria 3916
873 Ga0501045_0000946 3300049824 Bacteria 18981
874 Ga0501045_0130617 3300049824 Bacteria 1867
875 Ga0501045_0579165 3300049824 Bacteria 832
876 Ga0501045_1082688 3300049824 Bacteria 586
877 nmdc:mga04h51_275502_c1 3300050495 Bacteria 680
878 nmdc:mga05p37_1169323_c1 3300050507 Bacteria 798
879 nmdc:mga05p37_129800_c1 3300050507 Bacteria 3093
880 nmdc:mga05p37_1935_c1 3300050507 Bacteria 24113
881 nmdc:mga05p37_24531_c1 3300050507 Bacteria 7331
882 nmdc:mga05p37_24611_c1 3300050507 Bacteria 7319
883 nmdc:mga05p37_290444_c1 3300050507 Bacteria 1946
884 nmdc:mga05p37_29685_c1 3300050507 Bacteria 6672
885 nmdc:mga05p37_31849_c1 3300050507 Bacteria 6445
886 nmdc:mga05p37_391130_c1 3300050507 Bacteria 1626
887 nmdc:mga05p37_413587_c1 3300050507 Bacteria 1571
888 nmdc:mga05p37_432823_c1 3300050507 Bacteria 1528
889 nmdc:mga05p37_437652_c1 3300050507 Bacteria 1517
890 nmdc:mga05p37_54085_c1 3300050507 Bacteria 4939
891 nmdc:mga05p37_66268_c1 3300050507 Bacteria 4442
892 nmdc:mga05p37_92690_c1 3300050507 Bacteria 3722
893 nmdc:mga05p37_98208_c1 3300050507 Bacteria 3607
894 nmdc:mga09592_1304195_c1 3300050508 Bacteria 597
895 nmdc:mga09592_1441079_c1 3300050508 Unclassified 562
896 nmdc:mga09592_15247_c1 3300050508 Bacteria 6279
897 nmdc:mga09592_15522_c1 3300050508 Bacteria 6226
898 nmdc:mga09592_1903_c1 3300050508 Bacteria 16783
899 nmdc:mga09592_258426_c1 3300050508 Bacteria 1510
900 nmdc:mga09592_28339_c1 3300050508 Bacteria 4652
901 nmdc:mga09592_378224_c1 3300050508 Bacteria 1225
902 nmdc:mga09592_400650_c1 3300050508 Bacteria 1186
903 nmdc:mga09592_50783_c1 3300050508 Bacteria 3498
904 nmdc:mga09592_622737_c1 3300050508 Bacteria 923
905 nmdc:mga09592_996446_c1 3300050508 Bacteria 700
906 nmdc:mga0qj67_129_c1 3300050509 Bacteria 50064
907 nmdc:mga0qj67_1355991_c1 3300050509 Bacteria 550
908 nmdc:mga0qj67_263467_c1 3300050509 Bacteria 1398
909 nmdc:mga0qj67_345846_c1 3300050509 Bacteria 1202
910 nmdc:mga0qj67_523130_c1 3300050509 Bacteria 953
911 nmdc:mga0qj67_63996_c1 3300050509 Bacteria 2925
912 nmdc:mga0qj67_733_c1 3300050509 Bacteria 22325
913 nmdc:mga0qj67_831191_c1 3300050509 Bacteria 730
914 nmdc:mga0qj67_885_c1 3300050509 Bacteria 20530
915 nmdc:mga06r32_10855_c1 3300050510 Bacteria 8202
916 nmdc:mga06r32_118889_c1 3300050510 Bacteria 2606
917 nmdc:mga06r32_1205052_c1 3300050510 Bacteria 703
918 nmdc:mga06r32_1301599_c1 3300050510 Bacteria 671
919 nmdc:mga06r32_1580981_c1 3300050510 Bacteria 595
920 nmdc:mga06r32_172098_c1 3300050510 Bacteria 2149
921 nmdc:mga06r32_182123_c1 3300050510 Bacteria 2087
922 nmdc:mga06r32_299792_c1 3300050510 Bacteria 1593
923 nmdc:mga06r32_485259_c1 3300050510 Bacteria 1214
924 nmdc:mga06r32_572428_c1 3300050510 Bacteria 1102
925 nmdc:mga06r32_57445_c1 3300050510 Bacteria 3738
926 nmdc:mga06r32_62963_c1 3300050510 Bacteria 3574
927 nmdc:mga06r32_82372_c1 3300050510 Bacteria 3134
928 nmdc:mga06r32_825828_c1 3300050510 Unclassified 886
929 nmdc:mga08y16_10187_c1 3300050511 Bacteria 9872
930 nmdc:mga08y16_112369_c1 3300050511 Bacteria 2836
931 nmdc:mga08y16_1325940_c1 3300050511 Bacteria 685
932 nmdc:mga08y16_152687_c1 3300050511 Bacteria 2400
933 nmdc:mga08y16_181142_c1 3300050511 Bacteria 2188
934 nmdc:mga08y16_2033_c1 3300050511 Bacteria 20720
935 nmdc:mga08y16_2044345_c1 3300050511 Unclassified 521
936 nmdc:mga08y16_2110138_c1 3300050511 Unclassified 511
937 nmdc:mga08y16_254680_c1 3300050511 Bacteria 1814
938 nmdc:mga08y16_279555_c1 3300050511 Bacteria 1722
939 nmdc:mga08y16_299184_c1 3300050511 Bacteria 1659
940 nmdc:mga08y16_39632_c1 3300050511 Bacteria 4942
941 nmdc:mga08y16_397400_c1 3300050511 Bacteria 1411
942 nmdc:mga08y16_44681_c2 3300050511 Bacteria 1895
943 nmdc:mga08y16_894136_c1 3300050511 Unclassified 875
944 nmdc:mga0n895_13013_c1 3300050512 Bacteria 7485
945 nmdc:mga0n895_1586586_c1 3300050512 Bacteria 619
946 nmdc:mga0n895_207855_c1 3300050512 Bacteria 1988
947 nmdc:mga0n895_244277_c1 3300050512 Bacteria 1822
948 nmdc:mga0n895_363814_c1 3300050512 Bacteria 1465
949 nmdc:mga0n895_515275_c1 3300050512 Bacteria 1204
950 nmdc:mga0n895_63738_c1 3300050512 Bacteria 3645
951 nmdc:mga0n895_67283_c1 3300050512 Bacteria 3548
952 nmdc:mga0n895_831915_c1 3300050512 Bacteria 912
953 nmdc:mga0n895_911213_c1 3300050512 Bacteria 864
954 nmdc:mga0n895_914440_c1 3300050512 Bacteria 862
955 nmdc:mga0rr50_1053066_c1 3300050513 Unclassified 692
956 nmdc:mga0rr50_32319_c1 3300050513 Bacteria 3728
957 nmdc:mga0rr50_3348_c1 3300050513 Bacteria 9209
958 nmdc:mga0rr50_35454_c1 3300050513 Bacteria 3583
959 nmdc:mga0rr50_367426_c1 3300050513 Bacteria 1212
960 nmdc:mga0rr50_373569_c1 3300050513 Bacteria 1201
961 nmdc:mga0rr50_532655_c1 3300050513 Bacteria 1000
962 nmdc:mga0rr50_659677_c1 3300050513 Bacteria 893
963 nmdc:mga0rr50_78197_c1 3300050513 Bacteria 2545
964 nmdc:mga08x19_4462_c1 3300050514 Bacteria 8292
965 nmdc:mga08x19_988589_c1 3300050514 Unclassified 598
966 nmdc:mga0a205_14700_c1 3300050515 Bacteria 7303
967 nmdc:mga0a205_155193_c1 3300050515 Bacteria 2188
968 nmdc:mga0a205_182067_c1 3300050515 Bacteria 1995
969 nmdc:mga0a205_328091_c1 3300050515 Bacteria 1400
970 nmdc:mga0a205_3699_c1 3300050515 Bacteria 13683
971 nmdc:mga0a205_48854_c1 3300050515 Bacteria 4083
972 nmdc:mga0a205_49050_c1 3300050515 Bacteria 4074
973 nmdc:mga0a205_67799_c1 3300050515 Bacteria 3446
974 Ga0495601_0057527 3300053077 Unclassified 2463
975 Ga0495601_0269669 3300053077 Bacteria 1110
976 Ga0495601_0315265 3300053077 Unclassified 1018
977 Ga0495595_0353378 3300053084 Bacteria 742
978 Ga0495619_0162293 3300053085 Bacteria 1544
979 Ga0500643_002271 3300053087 Bacteria 10082
980 Ga0500651_0031020 3300053093 Bacteria 3365
981 Ga0500651_0088309 3300053093 Bacteria 1912
982 Ga0500566_0034058 3300053094 Bacteria 2965
983 Ga0500595_000003 3300053119 Bacteria 419332
984 Ga0500642_0412553 3300053130 Bacteria 587
985 Ga0500652_005161 3300053131 Bacteria 4091
986 Ga0500577_0185485 3300053142 Bacteria 894
987 Ga0500616_0000002 3300053153 Bacteria 1611257
988 Ga0500645_000226 3300053730 Bacteria 42982
989 Ga0500645_201682 3300053730 Bacteria 536
990 Ga0501084_0001073 3300054114 Bacteria 21259
991 Ga0501084_0084857 3300054114 Bacteria 2659
992 Ga0501084_0214935 3300054114 Bacteria 1622
993 Ga0501084_0413873 3300054114 Bacteria 1139
994 Ga0501084_0427176 3300054114 Bacteria 1120
995 Ga0501084_0841933 3300054114 Bacteria 772
996 Ga0501084_0989198 3300054114 Unclassified 707
997 Ga0501082_0000809 3300060353 Bacteria 27479
998 Ga0501082_0002254 3300060353 Bacteria 16885
999 Ga0501082_0016215 3300060353 Bacteria 6414
1000 Ga0501082_0059202 3300060353 Bacteria 3301
1001 Ga0501082_0633352 3300060353 Bacteria 936
1002 Ga0501082_1007055 3300060353 Bacteria 728
1003 Ga0501082_1659796 3300060353 Bacteria 558
1004 Ga0530510_0003125 3300061734 Bacteria 11362
1005 Ga0530510_0028935 3300061734 Bacteria 3974
1006 Ga0530510_0046048 3300061734 Bacteria 3151
1007 Ga0530510_0150947 3300061734 Bacteria 1716
1008 Ga0530510_0409306 3300061734 Bacteria 1023
1009 Ga0530510_0429679 3300061734 Bacteria 997
1010 Ga0530510_0874054 3300061734 Bacteria 687
1011 Ga0530510_1223782 3300061734 Unclassified 576

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005544 Ga0070686_101062558 Ga0070686_1010625581 88
2 3300049591 Ga0501075_0064978 Ga0501075_0064978_2464_2733 89
3 3300031548 Ga0307408_102465983 Ga0307408_1024659832 99
4 3300049522 Ga0501299_119268 Ga0501299_119268_319_618 99
5 3300042461 Ga0439460_0175014 Ga0439460_0175014_41_349 102
6 3300049591 Ga0501075_0599301 Ga0501075_0599301_148_456 102
7 3300049743 Ga0501081_1501706 Ga0501081_1501706_57_365 102
8 3300049822 Ga0501035_0620111 Ga0501035_0620111_469_777 102
9 3300042876 Ga0451577_0402867 Ga0451577_0402867_131_442 103
10 3300049576 Ga0501040_0021173 Ga0501040_0021173_108_419 103
11 3300049582 Ga0501048_0193203 Ga0501048_0193203_921_1238 104
12 3300007076 Ga0075435_100048103 Ga0075435_1000481033 105
13 3300025933 Ga0207706_11152731 Ga0207706_111527312 105
14 3300050512 nmdc:mga0n895_1586586_c1 nmdc:mga0n895_1586586_c1_56_376 105
15 3300050513 nmdc:mga0rr50_32319_c1 nmdc:mga0rr50_32319_c1_1110_1427 105
16 3300050515 nmdc:mga0a205_182067_c1 nmdc:mga0a205_182067_c1_1129_1446 105
17 iso_pu_bacteria 8055225921 8055226841 105
18 3300002070 JGI24750J21931_1012062 JGI24750J21931_10120622 106
19 3300003203 JGI25406J46586_10112665 JGI25406J46586_101126652 106
20 3300004798 Ga0058859_10482534 Ga0058859_104825342 106
21 3300005295 Ga0065707_10002472 Ga0065707_100024724 106
22 3300005295 Ga0065707_10008939 Ga0065707_100089396 106
23 3300005295 Ga0065707_10032199 Ga0065707_100321993 106
24 3300005295 Ga0065707_10142379 Ga0065707_101423793 106
25 3300005295 Ga0065707_10421713 Ga0065707_104217132 106
26 3300005295 Ga0065707_10682833 Ga0065707_106828332 106
27 3300005295 Ga0065707_10742311 Ga0065707_107423111 106
28 3300005295 Ga0065707_10843318 Ga0065707_108433182 106
29 3300005295 Ga0065707_10863893 Ga0065707_108638932 106
30 3300005328 Ga0070676_10267672 Ga0070676_102676722 106
31 3300005328 Ga0070676_10289081 Ga0070676_102890812 106
32 3300005328 Ga0070676_10302924 Ga0070676_103029242 106
33 3300005329 Ga0070683_100164724 Ga0070683_1001647243 106
34 3300005330 Ga0070690_100000131 Ga0070690_10000013111 106
35 3300005330 Ga0070690_100009883 Ga0070690_1000098836 106
36 3300005330 Ga0070690_100123222 Ga0070690_1001232222 106
37 3300005330 Ga0070690_101040930 Ga0070690_1010409302 106
38 3300005334 Ga0068869_100000392 Ga0068869_10000039229 106
39 3300005334 Ga0068869_100032305 Ga0068869_1000323052 106
40 3300005334 Ga0068869_101253262 Ga0068869_1012532622 106
41 3300005335 Ga0070666_10295857 Ga0070666_102958572 106
42 3300005336 Ga0070680_100052279 Ga0070680_1000522794 106
43 3300005336 Ga0070680_100055201 Ga0070680_1000552015 106
44 3300005336 Ga0070680_100130316 Ga0070680_1001303164 106
45 3300005336 Ga0070680_100168751 Ga0070680_1001687512 106
46 3300005336 Ga0070680_100644785 Ga0070680_1006447852 106
47 3300005336 Ga0070680_100903533 Ga0070680_1009035332 106
48 3300005336 Ga0070680_101717628 Ga0070680_1017176282 106
49 3300005337 Ga0070682_100024737 Ga0070682_1000247374 106
50 3300005338 Ga0068868_100000656 Ga0068868_10000065629 106
51 3300005338 Ga0068868_101081600 Ga0068868_1010816002 106
52 3300005340 Ga0070689_100006489 Ga0070689_1000064897 106
53 3300005340 Ga0070689_100098199 Ga0070689_1000981994 106
54 3300005340 Ga0070689_100441349 Ga0070689_1004413492 106
55 3300005340 Ga0070689_100614528 Ga0070689_1006145282 106
56 3300005341 Ga0070691_10000200 Ga0070691_100002009 106
57 3300005341 Ga0070691_10034787 Ga0070691_100347874 106
58 3300005341 Ga0070691_10094607 Ga0070691_100946071 106
59 3300005343 Ga0070687_100000175 Ga0070687_1000001756 106
60 3300005343 Ga0070687_100127683 Ga0070687_1001276832 106
61 3300005343 Ga0070687_100318442 Ga0070687_1003184422 106
62 3300005345 Ga0070692_10001132 Ga0070692_100011325 106
63 3300005345 Ga0070692_10018032 Ga0070692_100180323 106
64 3300005345 Ga0070692_11059412 Ga0070692_110594121 106
65 3300005347 Ga0070668_100055705 Ga0070668_1000557052 106
66 3300005347 Ga0070668_100226763 Ga0070668_1002267634 106
67 3300005347 Ga0070668_101331689 Ga0070668_1013316892 106
68 3300005353 Ga0070669_100190392 Ga0070669_1001903924 106
69 3300005353 Ga0070669_101272375 Ga0070669_1012723752 106
70 3300005353 Ga0070669_101835745 Ga0070669_1018357452 106
71 3300005354 Ga0070675_100050024 Ga0070675_1000500242 106
72 3300005354 Ga0070675_100076173 Ga0070675_1000761735 106
73 3300005355 Ga0070671_101381184 Ga0070671_1013811841 106
74 3300005356 Ga0070674_100069371 Ga0070674_1000693714 106
75 3300005356 Ga0070674_100688142 Ga0070674_1006881422 106
76 3300005364 Ga0070673_100078130 Ga0070673_1000781303 106
77 3300005365 Ga0070688_100216458 Ga0070688_1002164582 106
78 3300005365 Ga0070688_100702707 Ga0070688_1007027071 106
79 3300005365 Ga0070688_100734921 Ga0070688_1007349212 106
80 3300005365 Ga0070688_101069554 Ga0070688_1010695541 106
81 3300005406 Ga0070703_10140112 Ga0070703_101401122 106
82 3300005434 Ga0070709_10978484 Ga0070709_109784842 106
83 3300005437 Ga0070710_10193938 Ga0070710_101939382 106
84 3300005438 Ga0070701_10000676 Ga0070701_100006764 106
85 3300005438 Ga0070701_10181614 Ga0070701_101816141 106
86 3300005438 Ga0070701_10337596 Ga0070701_103375962 106
87 3300005438 Ga0070701_10356053 Ga0070701_103560532 106
88 3300005438 Ga0070701_10667612 Ga0070701_106676122 106
89 3300005439 Ga0070711_100267315 Ga0070711_1002673152 106
90 3300005439 Ga0070711_100562676 Ga0070711_1005626762 106
91 3300005440 Ga0070705_100003918 Ga0070705_1000039186 106
92 3300005440 Ga0070705_100144122 Ga0070705_1001441222 106
93 3300005440 Ga0070705_100250177 Ga0070705_1002501772 106
94 3300005440 Ga0070705_100719174 Ga0070705_1007191741 106
95 3300005440 Ga0070705_100849852 Ga0070705_1008498522 106
96 3300005440 Ga0070705_101056823 Ga0070705_1010568232 106
97 3300005441 Ga0070700_100000587 Ga0070700_1000005873 106
98 3300005441 Ga0070700_100044406 Ga0070700_1000444063 106
99 3300005441 Ga0070700_100530306 Ga0070700_1005303062 106
100 3300005441 Ga0070700_101148093 Ga0070700_1011480932 106
101 3300005441 Ga0070700_101215337 Ga0070700_1012153372 106
102 3300005444 Ga0070694_100000136 Ga0070694_10000013634 106
103 3300005444 Ga0070694_100367479 Ga0070694_1003674793 106
104 3300005444 Ga0070694_100474031 Ga0070694_1004740312 106
105 3300005444 Ga0070694_100680372 Ga0070694_1006803722 106
106 3300005444 Ga0070694_100740679 Ga0070694_1007406792 106
107 3300005444 Ga0070694_100842465 Ga0070694_1008424652 106
108 3300005444 Ga0070694_100890541 Ga0070694_1008905411 106
109 3300005444 Ga0070694_101103691 Ga0070694_1011036912 106
110 3300005445 Ga0070708_100045853 Ga0070708_1000458533 106
111 3300005445 Ga0070708_100493268 Ga0070708_1004932681 106
112 3300005445 Ga0070708_100503739 Ga0070708_1005037392 106
113 3300005455 Ga0070663_100431865 Ga0070663_1004318652 106
114 3300005456 Ga0070678_100988831 Ga0070678_1009888311 106
115 3300005457 Ga0070662_100832722 Ga0070662_1008327221 106
116 3300005457 Ga0070662_101650347 Ga0070662_1016503472 106
117 3300005458 Ga0070681_10007592 Ga0070681_1000759211 106
118 3300005459 Ga0068867_100001154 Ga0068867_10000115422 106
119 3300005459 Ga0068867_100002412 Ga0068867_10000241212 106
120 3300005459 Ga0068867_100251805 Ga0068867_1002518052 106
121 3300005459 Ga0068867_100559475 Ga0068867_1005594752 106
122 3300005459 Ga0068867_100837729 Ga0068867_1008377292 106
123 3300005467 Ga0070706_100078100 Ga0070706_1000781004 106
124 3300005467 Ga0070706_100119580 Ga0070706_1001195803 106
125 3300005468 Ga0070707_100047466 Ga0070707_1000474661 106
126 3300005468 Ga0070707_100753661 Ga0070707_1007536612 106
127 3300005468 Ga0070707_100808756 Ga0070707_1008087562 106
128 3300005471 Ga0070698_100009043 Ga0070698_1000090433 106
129 3300005471 Ga0070698_100013803 Ga0070698_1000138035 106
130 3300005471 Ga0070698_100094448 Ga0070698_1000944482 106
131 3300005471 Ga0070698_100402494 Ga0070698_1004024943 106
132 3300005518 Ga0070699_100305144 Ga0070699_1003051443 106
133 3300005518 Ga0070699_100343313 Ga0070699_1003433132 106
134 3300005518 Ga0070699_100352759 Ga0070699_1003527592 106
135 3300005518 Ga0070699_100438873 Ga0070699_1004388732 106
136 3300005530 Ga0070679_100110038 Ga0070679_1001100382 106
137 3300005535 Ga0070684_100080859 Ga0070684_1000808592 106
138 3300005536 Ga0070697_100028284 Ga0070697_1000282842 106
139 3300005536 Ga0070697_100038912 Ga0070697_1000389123 106
140 3300005536 Ga0070697_100183529 Ga0070697_1001835292 106
141 3300005543 Ga0070672_100571404 Ga0070672_1005714042 106
142 3300005544 Ga0070686_100000285 Ga0070686_10000028539 106
143 3300005544 Ga0070686_100034464 Ga0070686_1000344642 106
144 3300005544 Ga0070686_100382979 Ga0070686_1003829792 106
145 3300005544 Ga0070686_100729425 Ga0070686_1007294252 106
146 3300005544 Ga0070686_101738496 Ga0070686_1017384961 106
147 3300005545 Ga0070695_100000705 Ga0070695_1000007054 106
148 3300005545 Ga0070695_100494244 Ga0070695_1004942442 106
149 3300005545 Ga0070695_100576905 Ga0070695_1005769052 106
150 3300005545 Ga0070695_101335010 Ga0070695_1013350101 106
151 3300005546 Ga0070696_100002015 Ga0070696_10000201514 106
152 3300005546 Ga0070696_100015035 Ga0070696_1000150355 106
153 3300005546 Ga0070696_100025633 Ga0070696_1000256333 106
154 3300005546 Ga0070696_100173263 Ga0070696_1001732633 106
155 3300005546 Ga0070696_100276734 Ga0070696_1002767343 106
156 3300005546 Ga0070696_100981981 Ga0070696_1009819812 106
157 3300005547 Ga0070693_100000278 Ga0070693_1000002785 106
158 3300005547 Ga0070693_100480465 Ga0070693_1004804652 106
159 3300005547 Ga0070693_100931771 Ga0070693_1009317712 106
160 3300005549 Ga0070704_100000103 Ga0070704_1000001034 106
161 3300005549 Ga0070704_100001347 Ga0070704_1000013478 106
162 3300005549 Ga0070704_100102412 Ga0070704_1001024124 106
163 3300005549 Ga0070704_100213775 Ga0070704_1002137754 106
164 3300005549 Ga0070704_100488248 Ga0070704_1004882482 106
165 3300005549 Ga0070704_101264158 Ga0070704_1012641582 106
166 3300005549 Ga0070704_101907159 Ga0070704_1019071591 106
167 3300005577 Ga0068857_100410209 Ga0068857_1004102092 106
168 3300005578 Ga0068854_100001266 Ga0068854_10000126617 106
169 3300005614 Ga0068856_100025824 Ga0068856_10002582411 106
170 3300005615 Ga0070702_100000039 Ga0070702_1000000394 106
171 3300005615 Ga0070702_100011795 Ga0070702_1000117955 106
172 3300005615 Ga0070702_100263693 Ga0070702_1002636931 106
173 3300005616 Ga0068852_101909030 Ga0068852_1019090302 106
174 3300005617 Ga0068859_100000420 Ga0068859_10000042045 106
175 3300005617 Ga0068859_100181226 Ga0068859_1001812262 106
176 3300005617 Ga0068859_100332394 Ga0068859_1003323943 106
177 3300005617 Ga0068859_100509781 Ga0068859_1005097813 106
178 3300005617 Ga0068859_100894356 Ga0068859_1008943562 106
179 3300005718 Ga0068866_10001352 Ga0068866_100013526 106
180 3300005719 Ga0068861_100000399 Ga0068861_10000039930 106
181 3300005719 Ga0068861_100121308 Ga0068861_1001213083 106
182 3300005719 Ga0068861_100452508 Ga0068861_1004525082 106
183 3300005719 Ga0068861_100715111 Ga0068861_1007151112 106
184 3300005719 Ga0068861_101178810 Ga0068861_1011788102 106
185 3300005840 Ga0068870_10036599 Ga0068870_100365993 106
186 3300005840 Ga0068870_10066418 Ga0068870_100664182 106
187 3300005841 Ga0068863_102666131 Ga0068863_1026661312 106
188 3300005842 Ga0068858_100005769 Ga0068858_1000057695 106
189 3300005842 Ga0068858_100112559 Ga0068858_1001125594 106
190 3300005842 Ga0068858_100520779 Ga0068858_1005207792 106
191 3300005842 Ga0068858_101170622 Ga0068858_1011706222 106
192 3300005843 Ga0068860_100002528 Ga0068860_10000252822 106
193 3300005843 Ga0068860_100099481 Ga0068860_1000994814 106
194 3300005843 Ga0068860_100533700 Ga0068860_1005337002 106
195 3300005843 Ga0068860_100602500 Ga0068860_1006025002 106
196 3300005843 Ga0068860_101460699 Ga0068860_1014606992 106
197 3300005844 Ga0068862_100005981 Ga0068862_10000598112 106
198 3300005844 Ga0068862_100048027 Ga0068862_1000480275 106
199 3300005844 Ga0068862_100166396 Ga0068862_1001663964 106
200 3300005844 Ga0068862_100553678 Ga0068862_1005536782 106
201 3300005844 Ga0068862_101458131 Ga0068862_1014581312 106
202 3300005844 Ga0068862_102493692 Ga0068862_1024936921 106
203 3300005937 Ga0081455_10003176 Ga0081455_1000317610 106
204 3300005937 Ga0081455_10450024 Ga0081455_104500242 106
205 3300005937 Ga0081455_10614601 Ga0081455_106146012 106
206 3300005981 Ga0081538_10337381 Ga0081538_103373812 106
207 3300005983 Ga0081540_1000841 Ga0081540_10008418 106
208 3300005983 Ga0081540_1023446 Ga0081540_10234463 106
209 3300005985 Ga0081539_10000468 Ga0081539_1000046868 106
210 3300005985 Ga0081539_10029471 Ga0081539_100294712 106
211 3300006042 Ga0075368_10106793 Ga0075368_101067933 106
212 3300006058 Ga0075432_10105557 Ga0075432_101055572 106
213 3300006173 Ga0070716_100481606 Ga0070716_1004816062 106
214 3300006175 Ga0070712_100001185 Ga0070712_1000011853 106
215 3300006237 Ga0097621_100000754 Ga0097621_1000007544 106
216 3300006237 Ga0097621_100028703 Ga0097621_1000287034 106
217 3300006237 Ga0097621_101106566 Ga0097621_1011065662 106
218 3300006358 Ga0068871_100003878 Ga0068871_1000038788 106
219 3300006358 Ga0068871_100009731 Ga0068871_1000097314 106
220 3300006358 Ga0068871_100367069 Ga0068871_1003670693 106
221 3300006358 Ga0068871_101363878 Ga0068871_1013638782 106
222 3300006844 Ga0075428_100001502 Ga0075428_10000150213 106
223 3300006844 Ga0075428_100016740 Ga0075428_1000167406 106
224 3300006844 Ga0075428_100101531 Ga0075428_1001015312 106
225 3300006844 Ga0075428_100169137 Ga0075428_1001691373 106
226 3300006844 Ga0075428_100185437 Ga0075428_1001854374 106
227 3300006844 Ga0075428_100209874 Ga0075428_1002098743 106
228 3300006844 Ga0075428_100277743 Ga0075428_1002777433 106
229 3300006844 Ga0075428_100370279 Ga0075428_1003702792 106
230 3300006844 Ga0075428_100400711 Ga0075428_1004007112 106
231 3300006844 Ga0075428_100533781 Ga0075428_1005337812 106
232 3300006844 Ga0075428_100583307 Ga0075428_1005833073 106
233 3300006844 Ga0075428_100846073 Ga0075428_1008460732 106
234 3300006844 Ga0075428_100970926 Ga0075428_1009709262 106
235 3300006844 Ga0075428_101384707 Ga0075428_1013847072 106
236 3300006844 Ga0075428_101511895 Ga0075428_1015118952 106
237 3300006844 Ga0075428_101908210 Ga0075428_1019082101 106
238 3300006844 Ga0075428_102122220 Ga0075428_1021222202 106
239 3300006844 Ga0075428_102475135 Ga0075428_1024751352 106
240 3300006846 Ga0075430_100001098 Ga0075430_10000109811 106
241 3300006846 Ga0075430_100002189 Ga0075430_1000021896 106
242 3300006846 Ga0075430_100004241 Ga0075430_1000042417 106
243 3300006846 Ga0075430_100011150 Ga0075430_1000111509 106
244 3300006846 Ga0075430_100044526 Ga0075430_1000445262 106
245 3300006846 Ga0075430_100243501 Ga0075430_1002435014 106
246 3300006846 Ga0075430_100251596 Ga0075430_1002515962 106
247 3300006846 Ga0075430_100351842 Ga0075430_1003518422 106
248 3300006846 Ga0075430_100736214 Ga0075430_1007362142 106
249 3300006846 Ga0075430_101346514 Ga0075430_1013465142 106
250 3300006846 Ga0075430_101660051 Ga0075430_1016600512 106
251 3300006847 Ga0075431_100012939 Ga0075431_1000129394 106
252 3300006847 Ga0075431_100021216 Ga0075431_1000212166 106
253 3300006847 Ga0075431_100059320 Ga0075431_1000593203 106
254 3300006847 Ga0075431_100115679 Ga0075431_1001156792 106
255 3300006847 Ga0075431_100145224 Ga0075431_1001452243 106
256 3300006847 Ga0075431_100150292 Ga0075431_1001502923 106
257 3300006847 Ga0075431_100276979 Ga0075431_1002769792 106
258 3300006847 Ga0075431_100317579 Ga0075431_1003175794 106
259 3300006847 Ga0075431_100355586 Ga0075431_1003555863 106
260 3300006847 Ga0075431_100729205 Ga0075431_1007292052 106
261 3300006847 Ga0075431_101512254 Ga0075431_1015122542 106
262 3300006847 Ga0075431_101849872 Ga0075431_1018498722 106
263 3300006852 Ga0075433_10011246 Ga0075433_100112467 106
264 3300006852 Ga0075433_10033804 Ga0075433_100338046 106
265 3300006852 Ga0075433_10060852 Ga0075433_100608523 106
266 3300006852 Ga0075433_10131534 Ga0075433_101315344 106
267 3300006852 Ga0075433_10131656 Ga0075433_101316563 106
268 3300006852 Ga0075433_10154480 Ga0075433_101544803 106
269 3300006852 Ga0075433_11540808 Ga0075433_115408082 106
270 3300006871 Ga0075434_100006963 Ga0075434_1000069636 106
271 3300006871 Ga0075434_100043103 Ga0075434_1000431034 106
272 3300006871 Ga0075434_100064939 Ga0075434_1000649394 106
273 3300006871 Ga0075434_100083230 Ga0075434_1000832304 106
274 3300006871 Ga0075434_100156612 Ga0075434_1001566123 106
275 3300006871 Ga0075434_100379461 Ga0075434_1003794613 106
276 3300006871 Ga0075434_100389302 Ga0075434_1003893022 106
277 3300006871 Ga0075434_101351586 Ga0075434_1013515861 106
278 3300006871 Ga0075434_101359723 Ga0075434_1013597232 106
279 3300006871 Ga0075434_101777379 Ga0075434_1017773792 106
280 3300006871 Ga0075434_101787199 Ga0075434_1017871992 106
281 3300006871 Ga0075434_101958202 Ga0075434_1019582021 106
282 3300006880 Ga0075429_100000055 Ga0075429_10000005530 106
283 3300006880 Ga0075429_100000432 Ga0075429_10000043233 106
284 3300006880 Ga0075429_100001365 Ga0075429_1000013657 106
285 3300006880 Ga0075429_100028891 Ga0075429_1000288917 106
286 3300006880 Ga0075429_100044996 Ga0075429_1000449962 106
287 3300006880 Ga0075429_100098316 Ga0075429_1000983162 106
288 3300006880 Ga0075429_100184447 Ga0075429_1001844473 106
289 3300006880 Ga0075429_100473842 Ga0075429_1004738422 106
290 3300006880 Ga0075429_101677911 Ga0075429_1016779112 106
291 3300006880 Ga0075429_101964715 Ga0075429_1019647152 106
292 3300006881 Ga0068865_100001524 Ga0068865_1000015244 106
293 3300006881 Ga0068865_100040545 Ga0068865_1000405454 106
294 3300006881 Ga0068865_100252665 Ga0068865_1002526653 106
295 3300006914 Ga0075436_100007888 Ga0075436_1000078887 106
296 3300006914 Ga0075436_100114402 Ga0075436_1001144023 106
297 3300006931 Ga0097620_100000420 Ga0097620_10000042045 106
298 3300006931 Ga0097620_100181248 Ga0097620_1001812482 106
299 3300006931 Ga0097620_100332394 Ga0097620_1003323943 106
300 3300006931 Ga0097620_100509803 Ga0097620_1005098032 106
301 3300006931 Ga0097620_100894455 Ga0097620_1008944552 106
302 3300007076 Ga0075435_100007468 Ga0075435_1000074687 106
303 3300007076 Ga0075435_100024358 Ga0075435_1000243584 106
304 3300007076 Ga0075435_100200586 Ga0075435_1002005863 106
305 3300007076 Ga0075435_100201259 Ga0075435_1002012593 106
306 3300007076 Ga0075435_100351769 Ga0075435_1003517692 106
307 3300007076 Ga0075435_101268334 Ga0075435_1012683342 106
308 3300007265 Ga0099794_10064805 Ga0099794_100648054 106
309 3300007265 Ga0099794_10295389 Ga0099794_102953892 106
310 3300007265 Ga0099794_10494406 Ga0099794_104944061 106
311 3300007788 Ga0099795_10335698 Ga0099795_103356982 106
312 3300007788 Ga0099795_10425416 Ga0099795_104254161 106
313 3300009093 Ga0105240_12017022 Ga0105240_120170222 106
314 3300009094 Ga0111539_10006184 Ga0111539_100061846 106
315 3300009094 Ga0111539_10026623 Ga0111539_1002662310 106
316 3300009094 Ga0111539_10088217 Ga0111539_100882172 106
317 3300009094 Ga0111539_10102104 Ga0111539_101021043 106
318 3300009094 Ga0111539_10131305 Ga0111539_101313053 106
319 3300009094 Ga0111539_10184796 Ga0111539_101847962 106
320 3300009094 Ga0111539_10237023 Ga0111539_102370233 106
321 3300009094 Ga0111539_10240452 Ga0111539_102404523 106
322 3300009094 Ga0111539_10251855 Ga0111539_102518554 106
323 3300009094 Ga0111539_10402779 Ga0111539_104027794 106
324 3300009094 Ga0111539_10782009 Ga0111539_107820093 106
325 3300009094 Ga0111539_11135043 Ga0111539_111350432 106
326 3300009094 Ga0111539_11245919 Ga0111539_112459192 106
327 3300009094 Ga0111539_11980314 Ga0111539_119803141 106
328 3300009098 Ga0105245_10012764 Ga0105245_100127646 106
329 3300009147 Ga0114129_10002987 Ga0114129_1000298728 106
330 3300009147 Ga0114129_10006327 Ga0114129_100063279 106
331 3300009147 Ga0114129_10012532 Ga0114129_100125328 106
332 3300009147 Ga0114129_10030430 Ga0114129_100304308 106
333 3300009147 Ga0114129_10060555 Ga0114129_100605554 106
334 3300009147 Ga0114129_10067680 Ga0114129_100676803 106
335 3300009147 Ga0114129_10073085 Ga0114129_100730856 106
336 3300009147 Ga0114129_10124456 Ga0114129_101244563 106
337 3300009147 Ga0114129_10224122 Ga0114129_102241222 106
338 3300009147 Ga0114129_10237706 Ga0114129_102377064 106
339 3300009147 Ga0114129_10281729 Ga0114129_102817293 106
340 3300009147 Ga0114129_10299009 Ga0114129_102990092 106
341 3300009147 Ga0114129_10301114 Ga0114129_103011142 106
342 3300009147 Ga0114129_10308584 Ga0114129_103085844 106
343 3300009147 Ga0114129_10356472 Ga0114129_103564722 106
344 3300009147 Ga0114129_10365692 Ga0114129_103656922 106
345 3300009147 Ga0114129_10768525 Ga0114129_107685253 106
346 3300009147 Ga0114129_11628529 Ga0114129_116285291 106
347 3300009147 Ga0114129_12639983 Ga0114129_126399831 106
348 3300009148 Ga0105243_10002912 Ga0105243_1000291217 106
349 3300009148 Ga0105243_10035086 Ga0105243_100350862 106
350 3300009174 Ga0105241_10044445 Ga0105241_100444454 106
351 3300009174 Ga0105241_11425235 Ga0105241_114252352 106
352 3300009176 Ga0105242_10000248 Ga0105242_1000024846 106
353 3300009176 Ga0105242_10227045 Ga0105242_102270454 106
354 3300009177 Ga0105248_10631497 Ga0105248_106314972 106
355 3300009177 Ga0105248_12160258 Ga0105248_121602582 106
356 3300009177 Ga0105248_12161144 Ga0105248_121611442 106
357 3300009545 Ga0105237_11902219 Ga0105237_119022191 106
358 3300009545 Ga0105237_12111053 Ga0105237_121110532 106
359 3300009553 Ga0105249_10054817 Ga0105249_100548176 106
360 3300009553 Ga0105249_10066654 Ga0105249_100666544 106
361 3300009553 Ga0105249_10287100 Ga0105249_102871002 106
362 3300009553 Ga0105249_10539275 Ga0105249_105392752 106
363 3300009553 Ga0105249_11122045 Ga0105249_111220452 106
364 3300009553 Ga0105249_12037070 Ga0105249_120370702 106
365 3300010375 Ga0105239_10199942 Ga0105239_101999425 106
366 3300013296 Ga0157374_11997332 Ga0157374_119973322 106
367 3300013297 Ga0157378_10000387 Ga0157378_1000038748 106
368 3300013297 Ga0157378_10108512 Ga0157378_101085123 106
369 3300013297 Ga0157378_10721705 Ga0157378_107217052 106
370 3300013297 Ga0157378_11255069 Ga0157378_112550692 106
371 3300013306 Ga0163162_10633774 Ga0163162_106337743 106
372 3300013306 Ga0163162_11634273 Ga0163162_116342733 106
373 3300013306 Ga0163162_11694773 Ga0163162_116947732 106
374 3300013306 Ga0163162_11740112 Ga0163162_117401121 106
375 3300013306 Ga0163162_12447749 Ga0163162_124477492 106
376 3300013307 Ga0157372_11314907 Ga0157372_113149072 106
377 3300013308 Ga0157375_12124567 Ga0157375_121245672 106
378 3300014326 Ga0157380_10011921 Ga0157380_100119214 106
379 3300014326 Ga0157380_10025684 Ga0157380_100256844 106
380 3300014326 Ga0157380_11671134 Ga0157380_116711342 106
381 3300014326 Ga0157380_13121355 Ga0157380_131213551 106
382 3300014745 Ga0157377_10603151 Ga0157377_106031512 106
383 3300014969 Ga0157376_10012006 Ga0157376_100120064 106
384 3300014969 Ga0157376_11450566 Ga0157376_114505662 106
385 3300017792 Ga0163161_10365627 Ga0163161_103656271 106
386 3300017792 Ga0163161_11353484 Ga0163161_113534842 106
387 3300021388 Ga0213875_10072124 Ga0213875_100721244 106
388 3300025271 Ga0207666_1045861 Ga0207666_10458612 106
389 3300025885 Ga0207653_10004764 Ga0207653_100047645 106
390 3300025893 Ga0207682_10363490 Ga0207682_103634901 106
391 3300025898 Ga0207692_10180675 Ga0207692_101806752 106
392 3300025899 Ga0207642_10005011 Ga0207642_100050114 106
393 3300025899 Ga0207642_10053835 Ga0207642_100538353 106
394 3300025901 Ga0207688_10057485 Ga0207688_100574854 106
395 3300025901 Ga0207688_10617023 Ga0207688_106170232 106
396 3300025903 Ga0207680_10055662 Ga0207680_100556624 106
397 3300025907 Ga0207645_10049224 Ga0207645_100492244 106
398 3300025907 Ga0207645_10472831 Ga0207645_104728312 106
399 3300025907 Ga0207645_11018987 Ga0207645_110189871 106
400 3300025908 Ga0207643_10064864 Ga0207643_100648643 106
401 3300025908 Ga0207643_10077561 Ga0207643_100775613 106
402 3300025910 Ga0207684_10019497 Ga0207684_100194974 106
403 3300025910 Ga0207684_10399399 Ga0207684_103993992 106
404 3300025911 Ga0207654_10252025 Ga0207654_102520252 106
405 3300025912 Ga0207707_10011165 Ga0207707_100111655 106
406 3300025916 Ga0207663_10302475 Ga0207663_103024752 106
407 3300025917 Ga0207660_10041586 Ga0207660_100415862 106
408 3300025917 Ga0207660_10043670 Ga0207660_100436705 106
409 3300025917 Ga0207660_10067317 Ga0207660_100673173 106
410 3300025917 Ga0207660_10160542 Ga0207660_101605424 106
411 3300025917 Ga0207660_10562741 Ga0207660_105627412 106
412 3300025917 Ga0207660_11075085 Ga0207660_110750852 106
413 3300025918 Ga0207662_10000095 Ga0207662_100000955 106
414 3300025918 Ga0207662_10268917 Ga0207662_102689173 106
415 3300025921 Ga0207652_10026429 Ga0207652_100264293 106
416 3300025922 Ga0207646_10003246 Ga0207646_1000324618 106
417 3300025922 Ga0207646_10858213 Ga0207646_108582132 106
418 3300025923 Ga0207681_10194022 Ga0207681_101940223 106
419 3300025923 Ga0207681_10208421 Ga0207681_102084213 106
420 3300025923 Ga0207681_10311137 Ga0207681_103111372 106
421 3300025923 Ga0207681_11610792 Ga0207681_116107921 106
422 3300025926 Ga0207659_10024348 Ga0207659_100243483 106
423 3300025926 Ga0207659_10159000 Ga0207659_101590004 106
424 3300025926 Ga0207659_11863080 Ga0207659_118630801 106
425 3300025927 Ga0207687_10003242 Ga0207687_100032426 106
426 3300025927 Ga0207687_11727265 Ga0207687_117272652 106
427 3300025931 Ga0207644_10408267 Ga0207644_104082672 106
428 3300025931 Ga0207644_10933887 Ga0207644_109338871 106
429 3300025932 Ga0207690_10673940 Ga0207690_106739402 106
430 3300025934 Ga0207686_10001874 Ga0207686_1000187414 106
431 3300025935 Ga0207709_10001439 Ga0207709_100014398 106
432 3300025935 Ga0207709_10040568 Ga0207709_100405683 106
433 3300025936 Ga0207670_10002023 Ga0207670_100020235 106
434 3300025936 Ga0207670_10115149 Ga0207670_101151493 106
435 3300025937 Ga0207669_10016254 Ga0207669_100162545 106
436 3300025938 Ga0207704_10000623 Ga0207704_1000062321 106
437 3300025938 Ga0207704_10040114 Ga0207704_100401142 106
438 3300025938 Ga0207704_10467020 Ga0207704_104670202 106
439 3300025939 Ga0207665_10129051 Ga0207665_101290513 106
440 3300025939 Ga0207665_10374736 Ga0207665_103747362 106
441 3300025940 Ga0207691_10396080 Ga0207691_103960802 106
442 3300025941 Ga0207711_11247717 Ga0207711_112477172 106
443 3300025942 Ga0207689_10000977 Ga0207689_1000097732 106
444 3300025942 Ga0207689_10048172 Ga0207689_100481722 106
445 3300025942 Ga0207689_10284782 Ga0207689_102847822 106
446 3300025942 Ga0207689_10986962 Ga0207689_109869622 106
447 3300025944 Ga0207661_10561417 Ga0207661_105614171 106
448 3300025961 Ga0207712_10013536 Ga0207712_100135369 106
449 3300025961 Ga0207712_10108426 Ga0207712_101084264 106
450 3300025961 Ga0207712_10587580 Ga0207712_105875802 106
451 3300025961 Ga0207712_10665316 Ga0207712_106653162 106
452 3300025961 Ga0207712_11313584 Ga0207712_113135842 106
453 3300025972 Ga0207668_10083070 Ga0207668_100830702 106
454 3300025972 Ga0207668_10163260 Ga0207668_101632604 106
455 3300025981 Ga0207640_10019295 Ga0207640_100192956 106
456 3300025981 Ga0207640_10627586 Ga0207640_106275862 106
457 3300026023 Ga0207677_10017944 Ga0207677_100179442 106
458 3300026023 Ga0207677_11316375 Ga0207677_113163752 106
459 3300026023 Ga0207677_11911674 Ga0207677_119116741 106
460 3300026035 Ga0207703_10012439 Ga0207703_100124395 106
461 3300026035 Ga0207703_10018478 Ga0207703_100184784 106
462 3300026067 Ga0207678_10460086 Ga0207678_104600862 106
463 3300026075 Ga0207708_10000551 Ga0207708_1000055132 106
464 3300026075 Ga0207708_10005521 Ga0207708_1000552111 106
465 3300026075 Ga0207708_11361306 Ga0207708_113613062 106
466 3300026078 Ga0207702_10064024 Ga0207702_100640242 106
467 3300026089 Ga0207648_10000513 Ga0207648_1000051347 106
468 3300026089 Ga0207648_10002477 Ga0207648_1000247713 106
469 3300026089 Ga0207648_10076446 Ga0207648_100764464 106
470 3300026089 Ga0207648_10233922 Ga0207648_102339222 106
471 3300026095 Ga0207676_10760790 Ga0207676_107607902 106
472 3300026116 Ga0207674_10810244 Ga0207674_108102442 106
473 3300026116 Ga0207674_11950776 Ga0207674_119507762 106
474 3300026118 Ga0207675_100001063 Ga0207675_10000106332 106
475 3300026118 Ga0207675_100104513 Ga0207675_1001045134 106
476 3300026118 Ga0207675_100796735 Ga0207675_1007967352 106
477 3300026118 Ga0207675_101912505 Ga0207675_1019125052 106
478 3300026121 Ga0207683_10080122 Ga0207683_100801223 106
479 3300026142 Ga0207698_10742700 Ga0207698_107427002 106
480 3300027360 Ga0209969_1018790 Ga0209969_10187902 106
481 3300027364 Ga0209967_1015009 Ga0209967_10150092 106
482 3300027378 Ga0209981_1010132 Ga0209981_10101323 106
483 3300027462 Ga0210000_1015710 Ga0210000_10157102 106
484 3300027526 Ga0209968_1047314 Ga0209968_10473142 106
485 3300027614 Ga0209970_1003183 Ga0209970_10031831 106
486 3300027671 Ga0209588_1027778 Ga0209588_10277782 106
487 3300027682 Ga0209971_1003253 Ga0209971_10032535 106
488 3300027695 Ga0209966_1002671 Ga0209966_10026713 106
489 3300027717 Ga0209998_10009892 Ga0209998_100098923 106
490 3300027866 Ga0209813_10243775 Ga0209813_102437751 106
491 3300027876 Ga0209974_10148155 Ga0209974_101481552 106
492 3300027907 Ga0207428_10000288 Ga0207428_100002883 106
493 3300027907 Ga0207428_10011126 Ga0207428_100111266 106
494 3300027907 Ga0207428_10081245 Ga0207428_100812452 106
495 3300027907 Ga0207428_10129247 Ga0207428_101292473 106
496 3300027907 Ga0207428_10212262 Ga0207428_102122623 106
497 3300027907 Ga0207428_10872034 Ga0207428_108720342 106
498 3300028380 Ga0268265_10009410 Ga0268265_100094105 106
499 3300028380 Ga0268265_10043725 Ga0268265_100437254 106
500 3300028380 Ga0268265_10409679 Ga0268265_104096792 106
501 3300028380 Ga0268265_10714535 Ga0268265_107145352 106
502 3300028381 Ga0268264_10005879 Ga0268264_100058796 106
503 3300028381 Ga0268264_10087084 Ga0268264_100870842 106
504 3300031548 Ga0307408_100108002 Ga0307408_1001080023 106
505 3300031548 Ga0307408_101546949 Ga0307408_1015469491 106
506 3300031548 Ga0307408_102508862 Ga0307408_1025088621 106
507 3300031731 Ga0307405_10323688 Ga0307405_103236882 106
508 3300031852 Ga0307410_10524901 Ga0307410_105249011 106
509 3300031852 Ga0307410_11031064 Ga0307410_110310642 106
510 3300031852 Ga0307410_11889599 Ga0307410_118895992 106
511 3300031903 Ga0307407_10112275 Ga0307407_101122753 106
512 3300031903 Ga0307407_11375041 Ga0307407_113750412 106
513 3300031911 Ga0307412_10283588 Ga0307412_102835883 106
514 3300031911 Ga0307412_11074838 Ga0307412_110748382 106
515 3300031995 Ga0307409_100094044 Ga0307409_1000940443 106
516 3300032002 Ga0307416_100218413 Ga0307416_1002184134 106
517 3300032002 Ga0307416_100480818 Ga0307416_1004808182 106
518 3300032002 Ga0307416_101129270 Ga0307416_1011292702 106
519 3300032002 Ga0307416_101873284 Ga0307416_1018732842 106
520 3300032002 Ga0307416_102076379 Ga0307416_1020763792 106
521 3300032002 Ga0307416_102708381 Ga0307416_1027083812 106
522 3300032002 Ga0307416_102808169 Ga0307416_1028081692 106
523 3300032002 Ga0307416_103143362 Ga0307416_1031433622 106
524 3300032002 Ga0307416_103284057 Ga0307416_1032840572 106
525 3300032005 Ga0307411_10210161 Ga0307411_102101612 106
526 3300032005 Ga0307411_10318321 Ga0307411_103183212 106
527 3300032005 Ga0307411_10569643 Ga0307411_105696432 106
528 3300032126 Ga0307415_101071647 Ga0307415_1010716471 106
529 3300034816 Ga0373930_0054789 Ga0373930_0054789_103_423 106
530 3300034816 Ga0373930_0078431 Ga0373930_0078431_324_644 106
531 3300034817 Ga0373948_0011845 Ga0373948_0011845_840_1160 106
532 3300034819 Ga0373958_0194446 Ga0373958_0194446_77_397 106
533 3300034820 Ga0373959_0026875 Ga0373959_0026875_622_942 106
534 3300034957 Ga0373938_0238554 Ga0373938_0238554_15_335 106
535 3300035083 Ga0373926_0002148 Ga0373926_0002148_2956_3276 106
536 3300035084 Ga0373928_0005303 Ga0373928_0005303_906_1226 106
537 3300035084 Ga0373928_0010322 Ga0373928_0010322_562_882 106
538 3300035084 Ga0373928_0072121 Ga0373928_0072121_470_790 106
539 3300035086 Ga0373934_0100950 Ga0373934_0100950_232_552 106
540 3300035088 Ga0373940_0002387 Ga0373940_0002387_2877_3197 106
541 3300035088 Ga0373940_0065041 Ga0373940_0065041_348_668 106
542 3300035088 Ga0373940_0087889 Ga0373940_0087889_500_820 106
543 3300035089 Ga0373944_0005437 Ga0373944_0005437_2341_2661 106
544 3300035090 Ga0373949_0127897 Ga0373949_0127897_105_425 106
545 3300035091 Ga0373951_0026089 Ga0373951_0026089_871_1191 106
546 3300035091 Ga0373951_0048705 Ga0373951_0048705_450_770 106
547 3300035091 Ga0373951_0208294 Ga0373951_0208294_201_521 106
548 3300035092 Ga0373952_0004949 Ga0373952_0004949_1827_2147 106
549 3300035092 Ga0373952_0261350 Ga0373952_0261350_21_341 106
550 3300035111 Ga0373923_0062044 Ga0373923_0062044_73_393 106
551 3300035112 Ga0373932_0002691 Ga0373932_0002691_2633_2953 106
552 3300035112 Ga0373932_0024935 Ga0373932_0024935_786_1106 106
553 3300035112 Ga0373932_0051987 Ga0373932_0051987_651_971 106
554 3300035112 Ga0373932_0076916 Ga0373932_0076916_445_777 106
555 3300035112 Ga0373932_0224809 Ga0373932_0224809_342_662 106
556 3300035112 Ga0373932_0254490 Ga0373932_0254490_86_406 106
557 3300035112 Ga0373932_0340476 Ga0373932_0340476_77_397 106
558 3300035113 Ga0373936_0040361 Ga0373936_0040361_1292_1612 106
559 3300035114 Ga0373939_0007089 Ga0373939_0007089_250_570 106
560 3300035114 Ga0373939_0044303 Ga0373939_0044303_124_444 106
561 3300035114 Ga0373939_0052296 Ga0373939_0052296_786_1106 106
562 3300035114 Ga0373939_0068016 Ga0373939_0068016_231_551 106
563 3300035114 Ga0373939_0076110 Ga0373939_0076110_390_710 106
564 3300035114 Ga0373939_0110226 Ga0373939_0110226_567_887 106
565 3300035115 Ga0373941_0005268 Ga0373941_0005268_2507_2827 106
566 3300035115 Ga0373941_0017198 Ga0373941_0017198_107_427 106
567 3300035115 Ga0373941_0019880 Ga0373941_0019880_811_1131 106
568 3300035115 Ga0373941_0143279 Ga0373941_0143279_104_424 106
569 3300035115 Ga0373941_0376150 Ga0373941_0376150_252_572 106
570 3300035116 Ga0373945_0048244 Ga0373945_0048244_480_800 106
571 3300035118 Ga0373954_0000030 Ga0373954_0000030_50591_50911 106
572 3300035118 Ga0373954_0259205 Ga0373954_0259205_276_596 106
573 3300035120 Ga0373957_0056107 Ga0373957_0056107_905_1225 106
574 3300035121 Ga0373960_0022032 Ga0373960_0022032_364_684 106
575 3300035121 Ga0373960_0028430 Ga0373960_0028430_883_1203 106
576 3300035121 Ga0373960_0037436 Ga0373960_0037436_645_965 106
577 3300035170 Ga0373943_0068348 Ga0373943_0068348_1346_1666 106
578 3300035171 Ga0373946_0047609 Ga0373946_0047609_856_1176 106
579 3300035172 Ga0373955_0084477 Ga0373955_0084477_498_818 106
580 3300035172 Ga0373955_0353705 Ga0373955_0353705_318_638 106
581 3300035207 Ga0373942_0019869 Ga0373942_0019869_906_1226 106
582 3300035207 Ga0373942_0058599 Ga0373942_0058599_271_591 106
583 3300035207 Ga0373942_0063190 Ga0373942_0063190_346_666 106
584 3300035207 Ga0373942_0131809 Ga0373942_0131809_409_729 106
585 3300035241 Ga0373961_0021631 Ga0373961_0021631_1192_1512 106
586 3300035241 Ga0373961_0038197 Ga0373961_0038197_1028_1348 106
587 3300035241 Ga0373961_0073549 Ga0373961_0073549_254_574 106
588 3300035241 Ga0373961_0105621 Ga0373961_0105621_230_550 106
589 3300035241 Ga0373961_0448189 Ga0373961_0448189_10_333 106
590 3300035242 Ga0373962_0008702 Ga0373962_0008702_310_630 106
591 3300035242 Ga0373962_0012184 Ga0373962_0012184_1711_2031 106
592 3300035242 Ga0373962_0013605 Ga0373962_0013605_36_356 106
593 3300035242 Ga0373962_0100443 Ga0373962_0100443_61_381 106
594 3300035242 Ga0373962_0171366 Ga0373962_0171366_278_610 106
595 3300035242 Ga0373962_0357490 Ga0373962_0357490_144_467 106
596 3300035410 Ga0373924_0016098 Ga0373924_0016098_1662_1982 106
597 3300035691 Ga0373931_0001918 Ga0373931_0001918_7213_7533 106
598 3300035691 Ga0373931_0002342 Ga0373931_0002342_1219_1539 106
599 3300035691 Ga0373931_0006328 Ga0373931_0006328_4059_4379 106
600 3300035691 Ga0373931_0010421 Ga0373931_0010421_2054_2374 106
601 3300035691 Ga0373931_0025771 Ga0373931_0025771_135_455 106
602 3300035691 Ga0373931_0029473 Ga0373931_0029473_1169_1489 106
603 3300035691 Ga0373931_0033364 Ga0373931_0033364_740_1060 106
604 3300035691 Ga0373931_0073169 Ga0373931_0073169_431_751 106
605 3300035691 Ga0373931_0213618 Ga0373931_0213618_65_385 106
606 3300035691 Ga0373931_0250445 Ga0373931_0250445_526_846 106
607 3300035691 Ga0373931_1260027 Ga0373931_1260027_98_418 106
608 3300035692 Ga0373935_0125433 Ga0373935_0125433_59_379 106
609 3300035695 Ga0373927_0008733 Ga0373927_0008733_2867_3187 106
610 3300035695 Ga0373927_1012096 Ga0373927_1012096_133_453 106
611 3300035724 Ga0373933_0022210 Ga0373933_0022210_279_599 106
612 3300035725 Ga0373947_0048561 Ga0373947_0048561_2188_2508 106
613 3300036401 Ga0373937_0025516 Ga0373937_0025516_178_498 106
614 3300036401 Ga0373937_0604372 Ga0373937_0604372_471_791 106
615 3300036401 Ga0373937_0622877 Ga0373937_0622877_13_333 106
616 3300037068 Ga0373925_0012851 Ga0373925_0012851_3673_3993 106
617 3300037418 Ga0395900_0003092 Ga0395900_0003092_4312_4632 106
618 3300037466 Ga0395898_0011090 Ga0395898_0011090_921_1241 106
619 3300037471 Ga0395905_0252699 Ga0395905_0252699_1306_1626 106
620 3300037853 Ga0436364_1195800 Ga0436364_1195800_1349_1669 106
621 3300038443 Ga0395901_0001902 Ga0395901_0001902_15652_15972 106
622 3300039437 Ga0436365_1664112 Ga0436365_1664112_640_960 106
623 3300039437 Ga0436365_1801159 Ga0436365_1801159_1999_2319 106
624 3300041486 Ga0451807_2725195 Ga0451807_2725195_1819_2139 106
625 3300041496 Ga0451839_0304386 Ga0451839_0304386_314_634 106
626 3300042001 Ga0439441_087449 Ga0439441_087449_44_364 106
627 3300042001 Ga0439441_185385 Ga0439441_185385_18_341 106
628 3300042013 Ga0439456_117078 Ga0439456_117078_102_422 106
629 3300042436 Ga0439435_0001468 Ga0439435_0001468_1059_1379 106
630 3300042461 Ga0439460_0002117 Ga0439460_0002117_499_819 106
631 3300042461 Ga0439460_0132936 Ga0439460_0132936_210_530 106
632 3300042876 Ga0451577_0034679 Ga0451577_0034679_577_900 106
633 3300042876 Ga0451577_0063848 Ga0451577_0063848_111_431 106
634 3300042876 Ga0451577_0463491 Ga0451577_0463491_591_911 106
635 3300042876 Ga0451577_0548330 Ga0451577_0548330_609_929 106
636 3300042876 Ga0451577_0849017 Ga0451577_0849017_76_396 106
637 3300042993 Ga0439440_0147678 Ga0439440_0147678_67_387 106
638 3300044658 Ga0466972_0418143 Ga0466972_0418143_24_344 106
639 3300044673 Ga0453683_0191599 Ga0453683_0191599_85_408 106
640 3300044683 Ga0466965_0060429 Ga0466965_0060429_220_540 106
641 3300044901 Ga0466960_0450872 Ga0466960_0450872_123_443 106
642 3300045051 Ga0451576_0018030 Ga0451576_0018030_4628_4948 106
643 3300045051 Ga0451576_0020308 Ga0451576_0020308_1662_1982 106
644 3300045051 Ga0451576_0023304 Ga0451576_0023304_232_552 106
645 3300045051 Ga0451576_0286661 Ga0451576_0286661_1369_1689 106
646 3300045051 Ga0451576_0424788 Ga0451576_0424788_1038_1358 106
647 3300045051 Ga0451576_0498059 Ga0451576_0498059_929_1252 106
648 3300045051 Ga0451576_1243971 Ga0451576_1243971_171_491 106
649 3300045976 Ga0466967_1536089 Ga0466967_1536089_269_589 106
650 3300046454 Ga0495592_0001475 Ga0495592_0001475_6458_6778 106
651 3300046455 Ga0495603_0036255 Ga0495603_0036255_824_1144 106
652 3300046459 Ga0495629_0892549 Ga0495629_0892549_23_343 106
653 3300046463 Ga0495653_0012697 Ga0495653_0012697_3562_3882 106
654 3300046472 Ga0495580_0002475 Ga0495580_0002475_8585_8905 106
655 3300046472 Ga0495580_0190977 Ga0495580_0190977_266_586 106
656 3300046473 Ga0495582_0036167 Ga0495582_0036167_1725_2045 106
657 3300046473 Ga0495582_0129869 Ga0495582_0129869_570_890 106
658 3300046475 Ga0495639_0331543 Ga0495639_0331543_257_580 106
659 3300046476 Ga0495662_0005331 Ga0495662_0005331_4362_4682 106
660 3300046476 Ga0495662_0038196 Ga0495662_0038196_921_1244 106
661 3300046491 Ga0495584_0137983 Ga0495584_0137983_613_933 106
662 3300046511 Ga0495608_0014819 Ga0495608_0014819_1351_1671 106
663 3300046511 Ga0495608_0611753 Ga0495608_0611753_152_472 106
664 3300046514 Ga0495618_0097543 Ga0495618_0097543_333_653 106
665 3300046516 Ga0495628_0091825 Ga0495628_0091825_39_359 106
666 3300046517 Ga0495630_0016927 Ga0495630_0016927_1973_2293 106
667 3300046517 Ga0495630_0066008 Ga0495630_0066008_991_1311 106
668 3300046517 Ga0495630_0141363 Ga0495630_0141363_1275_1598 106
669 3300046517 Ga0495630_1115995 Ga0495630_1115995_101_421 106
670 3300046526 Ga0495666_0013108 Ga0495666_0013108_3525_3845 106
671 3300046526 Ga0495666_0023766 Ga0495666_0023766_999_1319 106
672 3300046528 Ga0495642_0017372 Ga0495642_0017372_555_875 106
673 3300046528 Ga0495642_0024669 Ga0495642_0024669_433_753 106
674 3300046528 Ga0495642_0102755 Ga0495642_0102755_185_508 106
675 3300046529 Ga0495652_0264328 Ga0495652_0264328_568_888 106
676 3300046529 Ga0495652_0797629 Ga0495652_0797629_154_474 106
677 3300046531 Ga0495665_0062602 Ga0495665_0062602_901_1221 106
678 3300046531 Ga0495665_0348724 Ga0495665_0348724_28_351 106
679 3300046533 Ga0495640_0005456 Ga0495640_0005456_5272_5592 106
680 3300046533 Ga0495640_0030921 Ga0495640_0030921_1318_1641 106
681 3300046535 Ga0495586_0002272 Ga0495586_0002272_6531_6851 106
682 3300046535 Ga0495586_0009170 Ga0495586_0009170_2801_3121 106
683 3300046536 Ga0495587_0020738 Ga0495587_0020738_1921_2241 106
684 3300046536 Ga0495587_0238668 Ga0495587_0238668_142_462 106
685 3300046537 Ga0495598_0219483 Ga0495598_0219483_356_676 106
686 3300046539 Ga0495621_0164081 Ga0495621_0164081_57_377 106
687 3300046539 Ga0495621_0202782 Ga0495621_0202782_382_705 106
688 3300046539 Ga0495621_0318220 Ga0495621_0318220_122_445 106
689 3300046543 Ga0495645_0196269 Ga0495645_0196269_814_1134 106
690 3300046559 Ga0495667_0002694 Ga0495667_0002694_8533_8853 106
691 3300046559 Ga0495667_0302105 Ga0495667_0302105_35_355 106
692 3300046615 Ga0495656_0026757 Ga0495656_0026757_1469_1789 106
693 3300046615 Ga0495656_0118188 Ga0495656_0118188_717_1037 106
694 3300046615 Ga0495656_0326102 Ga0495656_0326102_434_754 106
695 3300046642 Ga0495634_0003551 Ga0495634_0003551_4730_5050 106
696 3300046663 Ga0495635_0109075 Ga0495635_0109075_1275_1598 106
697 3300046664 Ga0495659_0059792 Ga0495659_0059792_139_459 106
698 3300046664 Ga0495659_0061294 Ga0495659_0061294_144_464 106
699 3300046664 Ga0495659_0095715 Ga0495659_0095715_428_751 106
700 3300046665 Ga0495661_0390800 Ga0495661_0390800_309_629 106
701 3300046674 Ga0495588_0171347 Ga0495588_0171347_563_883 106
702 3300046678 Ga0495599_0002703 Ga0495599_0002703_4255_4575 106
703 3300046678 Ga0495599_0098574 Ga0495599_0098574_246_566 106
704 3300046680 Ga0495646_0601941 Ga0495646_0601941_152_472 106
705 3300046681 Ga0495647_0001740 Ga0495647_0001740_1838_2158 106
706 3300046681 Ga0495647_0154543 Ga0495647_0154543_200_523 106
707 3300046681 Ga0495647_0245078 Ga0495647_0245078_96_416 106
708 3300046683 Ga0495658_0013614 Ga0495658_0013614_1869_2189 106
709 3300046683 Ga0495658_0024614 Ga0495658_0024614_533_853 106
710 3300046684 Ga0495669_0016289 Ga0495669_0016289_464_784 106
711 3300046684 Ga0495669_0050743 Ga0495669_0050743_1261_1581 106
712 3300046684 Ga0495669_0307721 Ga0495669_0307721_387_707 106
713 3300046684 Ga0495669_0531461 Ga0495669_0531461_116_436 106
714 3300046689 Ga0495613_0003446 Ga0495613_0003446_4527_4847 106
715 3300046690 Ga0495624_0194193 Ga0495624_0194193_29_349 106
716 3300046809 Ga0495600_0077653 Ga0495600_0077653_498_818 106
717 3300046809 Ga0495600_0136839 Ga0495600_0136839_303_623 106
718 3300047315 Ga0495581_0131514 Ga0495581_0131514_874_1194 106
719 3300047317 Ga0495604_0002697 Ga0495604_0002697_3614_3934 106
720 3300047317 Ga0495604_0538134 Ga0495604_0538134_390_713 106
721 3300047318 Ga0495636_0038176 Ga0495636_0038176_1097_1423 106
722 3300047318 Ga0495636_0054880 Ga0495636_0054880_40_360 106
723 3300047318 Ga0495636_0522371 Ga0495636_0522371_75_395 106
724 3300047318 Ga0495636_0651902 Ga0495636_0651902_96_416 106
725 3300047319 Ga0495674_0526202 Ga0495674_0526202_563_883 106
726 3300047319 Ga0495674_0860094 Ga0495674_0860094_211_534 106
727 3300047322 Ga0495680_0004055 Ga0495680_0004055_7772_8092 106
728 3300047322 Ga0495680_0696338 Ga0495680_0696338_39_362 106
729 3300047444 Ga0495675_0215029 Ga0495675_0215029_359_679 106
730 3300047445 Ga0495677_0158614 Ga0495677_0158614_32_352 106
731 3300047471 Ga0495684_0114616 Ga0495684_0114616_401_721 106
732 3300047471 Ga0495684_0369720 Ga0495684_0369720_257_580 106
733 3300048903 Ga0496100_0119819 Ga0496100_0119819_271_591 106
734 3300048904 Ga0496101_0173194 Ga0496101_0173194_753_1073 106
735 3300048905 Ga0496102_0677997 Ga0496102_0677997_613_933 106
736 3300048906 Ga0496103_0092576 Ga0496103_0092576_400_720 106
737 3300048907 Ga0496104_0047284 Ga0496104_0047284_649_969 106
738 3300048908 Ga0496105_0160233 Ga0496105_0160233_428_748 106
739 3300048909 Ga0496106_0023172 Ga0496106_0023172_3082_3402 106
740 3300048910 Ga0496107_0013207 Ga0496107_0013207_4347_4667 106
741 3300048912 Ga0496109_0003297 Ga0496109_0003297_556_876 106
742 3300048913 Ga0496110_0016127 Ga0496110_0016127_1722_2042 106
743 3300048914 Ga0496111_0384820 Ga0496111_0384820_256_576 106
744 3300048915 Ga0496112_0048142 Ga0496112_0048142_3485_3805 106
745 3300048916 Ga0496113_1003104 Ga0496113_1003104_300_620 106
746 3300048918 Ga0496115_0198577 Ga0496115_0198577_661_981 106
747 3300049522 Ga0501299_101000 Ga0501299_101000_16_336 106
748 3300049568 Ga0501031_0042679 Ga0501031_0042679_1127_1450 106
749 3300049569 Ga0501032_0862865 Ga0501032_0862865_40_363 106
750 3300049570 Ga0501033_0006002 Ga0501033_0006002_4740_5063 106
751 3300049570 Ga0501033_0066352 Ga0501033_0066352_967_1287 106
752 3300049571 Ga0501034_0199915 Ga0501034_0199915_1616_1939 106
753 3300049572 Ga0501036_0002811 Ga0501036_0002811_7918_8241 106
754 3300049572 Ga0501036_0186397 Ga0501036_0186397_1199_1522 106
755 3300049572 Ga0501036_0373424 Ga0501036_0373424_860_1180 106
756 3300049572 Ga0501036_0555224 Ga0501036_0555224_453_773 106
757 3300049572 Ga0501036_1027854 Ga0501036_1027854_279_599 106
758 3300049572 Ga0501036_1029896 Ga0501036_1029896_318_638 106
759 3300049572 Ga0501036_1244350 Ga0501036_1244350_160_483 106
760 3300049573 Ga0501037_0016719 Ga0501037_0016719_3309_3632 106
761 3300049573 Ga0501037_0536499 Ga0501037_0536499_304_627 106
762 3300049573 Ga0501037_0601433 Ga0501037_0601433_238_558 106
763 3300049573 Ga0501037_1120708 Ga0501037_1120708_38_358 106
764 3300049574 Ga0501038_0008069 Ga0501038_0008069_5795_6118 106
765 3300049574 Ga0501038_0090474 Ga0501038_0090474_689_1009 106
766 3300049574 Ga0501038_0337775 Ga0501038_0337775_604_927 106
767 3300049575 Ga0501039_0014392 Ga0501039_0014392_3720_4043 106
768 3300049575 Ga0501039_0040879 Ga0501039_0040879_2546_2866 106
769 3300049575 Ga0501039_0044419 Ga0501039_0044419_32_352 106
770 3300049575 Ga0501039_0050433 Ga0501039_0050433_128_448 106
771 3300049575 Ga0501039_0137551 Ga0501039_0137551_793_1113 106
772 3300049575 Ga0501039_0257536 Ga0501039_0257536_447_767 106
773 3300049575 Ga0501039_0361291 Ga0501039_0361291_535_855 106
774 3300049575 Ga0501039_1329603 Ga0501039_1329603_76_396 106
775 3300049576 Ga0501040_0000376 Ga0501040_0000376_4622_4945 106
776 3300049576 Ga0501040_0020631 Ga0501040_0020631_1694_2017 106
777 3300049576 Ga0501040_0055396 Ga0501040_0055396_784_1104 106
778 3300049576 Ga0501040_0118826 Ga0501040_0118826_579_899 106
779 3300049576 Ga0501040_0967783 Ga0501040_0967783_138_458 106
780 3300049577 Ga0501041_0000609 Ga0501041_0000609_13548_13871 106
781 3300049577 Ga0501041_0044711 Ga0501041_0044711_1192_1512 106
782 3300049577 Ga0501041_0230173 Ga0501041_0230173_305_625 106
783 3300049577 Ga0501041_0233771 Ga0501041_0233771_269_592 106
784 3300049577 Ga0501041_0253432 Ga0501041_0253432_697_1017 106
785 3300049577 Ga0501041_0259263 Ga0501041_0259263_347_667 106
786 3300049577 Ga0501041_0534239 Ga0501041_0534239_129_449 106
787 3300049578 Ga0501042_0000217 Ga0501042_0000217_25060_25383 106
788 3300049578 Ga0501042_0029750 Ga0501042_0029750_2452_2772 106
789 3300049578 Ga0501042_0298264 Ga0501042_0298264_181_501 106
790 3300049578 Ga0501042_0728428 Ga0501042_0728428_53_373 106
791 3300049578 Ga0501042_0879999 Ga0501042_0879999_102_425 106
792 3300049578 Ga0501042_1233331 Ga0501042_1233331_129_449 106
793 3300049579 Ga0501043_0343407 Ga0501043_0343407_563_883 106
794 3300049579 Ga0501043_0746534 Ga0501043_0746534_242_565 106
795 3300049580 Ga0501046_0003851 Ga0501046_0003851_6560_6883 106
796 3300049580 Ga0501046_0036615 Ga0501046_0036615_3122_3442 106
797 3300049580 Ga0501046_1113013 Ga0501046_1113013_139_462 106
798 3300049580 Ga0501046_1223563 Ga0501046_1223563_141_461 106
799 3300049582 Ga0501048_0001002 Ga0501048_0001002_5041_5364 106
800 3300049582 Ga0501048_0217621 Ga0501048_0217621_882_1202 106
801 3300049582 Ga0501048_0635887 Ga0501048_0635887_34_354 106
802 3300049582 Ga0501048_0981891 Ga0501048_0981891_188_508 106
803 3300049582 Ga0501048_1149143 Ga0501048_1149143_209_532 106
804 3300049583 Ga0501067_0059070 Ga0501067_0059070_1224_1544 106
805 3300049583 Ga0501067_0120572 Ga0501067_0120572_870_1190 106
806 3300049583 Ga0501067_0427476 Ga0501067_0427476_374_694 106
807 3300049584 Ga0501068_0072013 Ga0501068_0072013_185_505 106
808 3300049584 Ga0501068_0414487 Ga0501068_0414487_201_521 106
809 3300049584 Ga0501068_0677900 Ga0501068_0677900_178_501 106
810 3300049584 Ga0501068_0816443 Ga0501068_0816443_143_466 106
811 3300049584 Ga0501068_0908294 Ga0501068_0908294_92_412 106
812 3300049584 Ga0501068_1208693 Ga0501068_1208693_55_378 106
813 3300049585 Ga0501069_0184637 Ga0501069_0184637_587_907 106
814 3300049586 Ga0501070_0115292 Ga0501070_0115292_1340_1663 106
815 3300049587 Ga0501071_0011096 Ga0501071_0011096_3917_4240 106
816 3300049587 Ga0501071_0073797 Ga0501071_0073797_1626_1946 106
817 3300049587 Ga0501071_0078746 Ga0501071_0078746_1841_2161 106
818 3300049587 Ga0501071_0217319 Ga0501071_0217319_403_723 106
819 3300049587 Ga0501071_0432788 Ga0501071_0432788_506_829 106
820 3300049587 Ga0501071_0638314 Ga0501071_0638314_261_581 106
821 3300049588 Ga0501072_0008373 Ga0501072_0008373_3490_3813 106
822 3300049588 Ga0501072_0023786 Ga0501072_0023786_4254_4574 106
823 3300049588 Ga0501072_0062249 Ga0501072_0062249_444_764 106
824 3300049588 Ga0501072_0108474 Ga0501072_0108474_1300_1623 106
825 3300049588 Ga0501072_0350928 Ga0501072_0350928_644_964 106
826 3300049588 Ga0501072_1101838 Ga0501072_1101838_109_432 106
827 3300049588 Ga0501072_1105660 Ga0501072_1105660_243_563 106
828 3300049588 Ga0501072_1240763 Ga0501072_1240763_149_469 106
829 3300049589 Ga0501073_0327130 Ga0501073_0327130_710_1033 106
830 3300049589 Ga0501073_0844070 Ga0501073_0844070_280_603 106
831 3300049590 Ga0501074_0054650 Ga0501074_0054650_2057_2380 106
832 3300049590 Ga0501074_0280235 Ga0501074_0280235_20_343 106
833 3300049590 Ga0501074_1300868 Ga0501074_1300868_134_457 106
834 3300049591 Ga0501075_0004474 Ga0501075_0004474_3711_4034 106
835 3300049591 Ga0501075_0015921 Ga0501075_0015921_1903_2223 106
836 3300049591 Ga0501075_0035366 Ga0501075_0035366_924_1244 106
837 3300049591 Ga0501075_0053786 Ga0501075_0053786_314_634 106
838 3300049591 Ga0501075_0082723 Ga0501075_0082723_1611_1931 106
839 3300049591 Ga0501075_0604425 Ga0501075_0604425_388_708 106
840 3300049592 Ga0501076_0000526 Ga0501076_0000526_15442_15765 106
841 3300049592 Ga0501076_0000778 Ga0501076_0000778_17697_18017 106
842 3300049592 Ga0501076_0010510 Ga0501076_0010510_4084_4404 106
843 3300049592 Ga0501076_0011445 Ga0501076_0011445_3540_3860 106
844 3300049592 Ga0501076_0142561 Ga0501076_0142561_1127_1450 106
845 3300049592 Ga0501076_0163537 Ga0501076_0163537_1163_1486 106
846 3300049592 Ga0501076_0612339 Ga0501076_0612339_128_448 106
847 3300049592 Ga0501076_1366318 Ga0501076_1366318_29_349 106
848 3300049593 Ga0501077_0001082 Ga0501077_0001082_15689_16012 106
849 3300049593 Ga0501077_0026200 Ga0501077_0026200_1626_1946 106
850 3300049593 Ga0501077_0441809 Ga0501077_0441809_336_656 106
851 3300049650 Ga0501199_024935 Ga0501199_024935_33_353 106
852 3300049656 Ga0501209_262894 Ga0501209_262894_70_390 106
853 3300049741 Ga0501079_0000010 Ga0501079_0000010_70191_70514 106
854 3300049741 Ga0501079_0017301 Ga0501079_0017301_3348_3668 106
855 3300049741 Ga0501079_0023005 Ga0501079_0023005_604_924 106
856 3300049741 Ga0501079_0053522 Ga0501079_0053522_467_787 106
857 3300049741 Ga0501079_0098297 Ga0501079_0098297_1103_1423 106
858 3300049741 Ga0501079_0176662 Ga0501079_0176662_1206_1529 106
859 3300049741 Ga0501079_0351802 Ga0501079_0351802_538_858 106
860 3300049741 Ga0501079_0363463 Ga0501079_0363463_532_852 106
861 3300049741 Ga0501079_0429811 Ga0501079_0429811_25_345 106
862 3300049741 Ga0501079_0474012 Ga0501079_0474012_162_482 106
863 3300049742 Ga0501080_0026635 Ga0501080_0026635_1328_1651 106
864 3300049742 Ga0501080_0397483 Ga0501080_0397483_116_436 106
865 3300049742 Ga0501080_0507160 Ga0501080_0507160_58_378 106
866 3300049742 Ga0501080_0669886 Ga0501080_0669886_160_480 106
867 3300049742 Ga0501080_0750522 Ga0501080_0750522_483_803 106
868 3300049743 Ga0501081_0000811 Ga0501081_0000811_6164_6484 106
869 3300049743 Ga0501081_0001107 Ga0501081_0001107_536_859 106
870 3300049743 Ga0501081_0007636 Ga0501081_0007636_2170_2490 106
871 3300049743 Ga0501081_0038926 Ga0501081_0038926_2032_2352 106
872 3300049743 Ga0501081_0119593 Ga0501081_0119593_83_403 106
873 3300049822 Ga0501035_0041997 Ga0501035_0041997_2308_2631 106
874 3300049822 Ga0501035_0116958 Ga0501035_0116958_1569_1889 106
875 3300049822 Ga0501035_0246262 Ga0501035_0246262_1035_1355 106
876 3300049823 Ga0501044_0059444 Ga0501044_0059444_2071_2394 106
877 3300049824 Ga0501045_0000946 Ga0501045_0000946_3711_4034 106
878 3300049824 Ga0501045_0130617 Ga0501045_0130617_675_995 106
879 3300049824 Ga0501045_0579165 Ga0501045_0579165_22_342 106
880 3300049824 Ga0501045_1082688 Ga0501045_1082688_61_381 106
881 3300050495 nmdc:mga04h51_275502_c1 nmdc:mga04h51_275502_c1_61_381 106
882 3300050507 nmdc:mga05p37_1169323_c1 nmdc:mga05p37_1169323_c1_143_463 106
883 3300050507 nmdc:mga05p37_129800_c1 nmdc:mga05p37_129800_c1_1290_1610 106
884 3300050507 nmdc:mga05p37_1935_c1 nmdc:mga05p37_1935_c1_19087_19407 106
885 3300050507 nmdc:mga05p37_24531_c1 nmdc:mga05p37_24531_c1_2117_2437 106
886 3300050507 nmdc:mga05p37_24611_c1 nmdc:mga05p37_24611_c1_4697_5017 106
887 3300050507 nmdc:mga05p37_290444_c1 nmdc:mga05p37_290444_c1_1548_1868 106
888 3300050507 nmdc:mga05p37_29685_c1 nmdc:mga05p37_29685_c1_2119_2439 106
889 3300050507 nmdc:mga05p37_31849_c1 nmdc:mga05p37_31849_c1_4188_4508 106
890 3300050507 nmdc:mga05p37_391130_c1 nmdc:mga05p37_391130_c1_23_343 106
891 3300050507 nmdc:mga05p37_413587_c1 nmdc:mga05p37_413587_c1_214_534 106
892 3300050507 nmdc:mga05p37_432823_c1 nmdc:mga05p37_432823_c1_377_697 106
893 3300050507 nmdc:mga05p37_437652_c1 nmdc:mga05p37_437652_c1_795_1115 106
894 3300050507 nmdc:mga05p37_54085_c1 nmdc:mga05p37_54085_c1_3138_3458 106
895 3300050507 nmdc:mga05p37_66268_c1 nmdc:mga05p37_66268_c1_3454_3774 106
896 3300050507 nmdc:mga05p37_92690_c1 nmdc:mga05p37_92690_c1_2811_3134 106
897 3300050507 nmdc:mga05p37_98208_c1 nmdc:mga05p37_98208_c1_2645_2965 106
898 3300050508 nmdc:mga09592_1304195_c1 nmdc:mga09592_1304195_c1_181_501 106
899 3300050508 nmdc:mga09592_1441079_c1 nmdc:mga09592_1441079_c1_23_343 106
900 3300050508 nmdc:mga09592_15247_c1 nmdc:mga09592_15247_c1_3604_3924 106
901 3300050508 nmdc:mga09592_15522_c1 nmdc:mga09592_15522_c1_230_550 106
902 3300050508 nmdc:mga09592_1903_c1 nmdc:mga09592_1903_c1_15572_15892 106
903 3300050508 nmdc:mga09592_258426_c1 nmdc:mga09592_258426_c1_786_1106 106
904 3300050508 nmdc:mga09592_28339_c1 nmdc:mga09592_28339_c1_3556_3876 106
905 3300050508 nmdc:mga09592_378224_c1 nmdc:mga09592_378224_c1_69_389 106
906 3300050508 nmdc:mga09592_400650_c1 nmdc:mga09592_400650_c1_653_973 106
907 3300050508 nmdc:mga09592_50783_c1 nmdc:mga09592_50783_c1_2202_2522 106
908 3300050508 nmdc:mga09592_622737_c1 nmdc:mga09592_622737_c1_432_752 106
909 3300050508 nmdc:mga09592_996446_c1 nmdc:mga09592_996446_c1_192_512 106
910 3300050509 nmdc:mga0qj67_129_c1 nmdc:mga0qj67_129_c1_5473_5796 106
911 3300050509 nmdc:mga0qj67_1355991_c1 nmdc:mga0qj67_1355991_c1_116_436 106
912 3300050509 nmdc:mga0qj67_263467_c1 nmdc:mga0qj67_263467_c1_613_933 106
913 3300050509 nmdc:mga0qj67_345846_c1 nmdc:mga0qj67_345846_c1_103_423 106
914 3300050509 nmdc:mga0qj67_523130_c1 nmdc:mga0qj67_523130_c1_465_785 106
915 3300050509 nmdc:mga0qj67_63996_c1 nmdc:mga0qj67_63996_c1_994_1314 106
916 3300050509 nmdc:mga0qj67_733_c1 nmdc:mga0qj67_733_c1_12122_12442 106
917 3300050509 nmdc:mga0qj67_831191_c1 nmdc:mga0qj67_831191_c1_216_536 106
918 3300050509 nmdc:mga0qj67_885_c1 nmdc:mga0qj67_885_c1_422_742 106
919 3300050510 nmdc:mga06r32_10855_c1 nmdc:mga06r32_10855_c1_5549_5869 106
920 3300050510 nmdc:mga06r32_118889_c1 nmdc:mga06r32_118889_c1_1523_1843 106
921 3300050510 nmdc:mga06r32_1205052_c1 nmdc:mga06r32_1205052_c1_45_365 106
922 3300050510 nmdc:mga06r32_1301599_c1 nmdc:mga06r32_1301599_c1_27_347 106
923 3300050510 nmdc:mga06r32_1580981_c1 nmdc:mga06r32_1580981_c1_160_480 106
924 3300050510 nmdc:mga06r32_172098_c1 nmdc:mga06r32_172098_c1_99_422 106
925 3300050510 nmdc:mga06r32_182123_c1 nmdc:mga06r32_182123_c1_69_389 106
926 3300050510 nmdc:mga06r32_299792_c1 nmdc:mga06r32_299792_c1_182_502 106
927 3300050510 nmdc:mga06r32_485259_c1 nmdc:mga06r32_485259_c1_628_948 106
928 3300050510 nmdc:mga06r32_572428_c1 nmdc:mga06r32_572428_c1_397_717 106
929 3300050510 nmdc:mga06r32_57445_c1 nmdc:mga06r32_57445_c1_2932_3252 106
930 3300050510 nmdc:mga06r32_62963_c1 nmdc:mga06r32_62963_c1_1811_2131 106
931 3300050510 nmdc:mga06r32_82372_c1 nmdc:mga06r32_82372_c1_192_512 106
932 3300050510 nmdc:mga06r32_825828_c1 nmdc:mga06r32_825828_c1_244_564 106
933 3300050511 nmdc:mga08y16_10187_c1 nmdc:mga08y16_10187_c1_5151_5471 106
934 3300050511 nmdc:mga08y16_112369_c1 nmdc:mga08y16_112369_c1_16_336 106
935 3300050511 nmdc:mga08y16_1325940_c1 nmdc:mga08y16_1325940_c1_189_509 106
936 3300050511 nmdc:mga08y16_152687_c1 nmdc:mga08y16_152687_c1_148_468 106
937 3300050511 nmdc:mga08y16_181142_c1 nmdc:mga08y16_181142_c1_780_1112 106
938 3300050511 nmdc:mga08y16_2033_c1 nmdc:mga08y16_2033_c1_285_605 106
939 3300050511 nmdc:mga08y16_2044345_c1 nmdc:mga08y16_2044345_c1_41_364 106
940 3300050511 nmdc:mga08y16_2110138_c1 nmdc:mga08y16_2110138_c1_141_461 106
941 3300050511 nmdc:mga08y16_254680_c1 nmdc:mga08y16_254680_c1_678_998 106
942 3300050511 nmdc:mga08y16_279555_c1 nmdc:mga08y16_279555_c1_1107_1430 106
943 3300050511 nmdc:mga08y16_299184_c1 nmdc:mga08y16_299184_c1_63_383 106
944 3300050511 nmdc:mga08y16_39632_c1 nmdc:mga08y16_39632_c1_168_488 106
945 3300050511 nmdc:mga08y16_397400_c1 nmdc:mga08y16_397400_c1_553_873 106
946 3300050511 nmdc:mga08y16_44681_c2 nmdc:mga08y16_44681_c2_1555_1875 106
947 3300050511 nmdc:mga08y16_894136_c1 nmdc:mga08y16_894136_c1_410_730 106
948 3300050512 nmdc:mga0n895_13013_c1 nmdc:mga0n895_13013_c1_4294_4614 106
949 3300050512 nmdc:mga0n895_207855_c1 nmdc:mga0n895_207855_c1_371_691 106
950 3300050512 nmdc:mga0n895_244277_c1 nmdc:mga0n895_244277_c1_292_612 106
951 3300050512 nmdc:mga0n895_363814_c1 nmdc:mga0n895_363814_c1_714_1034 106
952 3300050512 nmdc:mga0n895_515275_c1 nmdc:mga0n895_515275_c1_272_592 106
953 3300050512 nmdc:mga0n895_63738_c1 nmdc:mga0n895_63738_c1_2380_2703 106
954 3300050512 nmdc:mga0n895_67283_c1 nmdc:mga0n895_67283_c1_663_983 106
955 3300050512 nmdc:mga0n895_831915_c1 nmdc:mga0n895_831915_c1_336_656 106
956 3300050512 nmdc:mga0n895_911213_c1 nmdc:mga0n895_911213_c1_511_831 106
957 3300050512 nmdc:mga0n895_914440_c1 nmdc:mga0n895_914440_c1_34_357 106
958 3300050513 nmdc:mga0rr50_1053066_c1 nmdc:mga0rr50_1053066_c1_306_629 106
959 3300050513 nmdc:mga0rr50_3348_c1 nmdc:mga0rr50_3348_c1_4234_4554 106
960 3300050513 nmdc:mga0rr50_35454_c1 nmdc:mga0rr50_35454_c1_3205_3525 106
961 3300050513 nmdc:mga0rr50_367426_c1 nmdc:mga0rr50_367426_c1_464_784 106
962 3300050513 nmdc:mga0rr50_373569_c1 nmdc:mga0rr50_373569_c1_144_464 106
963 3300050513 nmdc:mga0rr50_532655_c1 nmdc:mga0rr50_532655_c1_523_843 106
964 3300050513 nmdc:mga0rr50_659677_c1 nmdc:mga0rr50_659677_c1_353_673 106
965 3300050513 nmdc:mga0rr50_78197_c1 nmdc:mga0rr50_78197_c1_845_1165 106
966 3300050514 nmdc:mga08x19_4462_c1 nmdc:mga08x19_4462_c1_4166_4486 106
967 3300050514 nmdc:mga08x19_988589_c1 nmdc:mga08x19_988589_c1_174_497 106
968 3300050515 nmdc:mga0a205_14700_c1 nmdc:mga0a205_14700_c1_2469_2789 106
969 3300050515 nmdc:mga0a205_155193_c1 nmdc:mga0a205_155193_c1_76_396 106
970 3300050515 nmdc:mga0a205_328091_c1 nmdc:mga0a205_328091_c1_1004_1324 106
971 3300050515 nmdc:mga0a205_3699_c1 nmdc:mga0a205_3699_c1_963_1283 106
972 3300050515 nmdc:mga0a205_48854_c1 nmdc:mga0a205_48854_c1_1556_1876 106
973 3300050515 nmdc:mga0a205_49050_c1 nmdc:mga0a205_49050_c1_946_1266 106
974 3300050515 nmdc:mga0a205_67799_c1 nmdc:mga0a205_67799_c1_1502_1822 106
975 3300053077 Ga0495601_0057527 Ga0495601_0057527_635_955 106
976 3300053077 Ga0495601_0269669 Ga0495601_0269669_738_1061 106
977 3300053077 Ga0495601_0315265 Ga0495601_0315265_391_711 106
978 3300053084 Ga0495595_0353378 Ga0495595_0353378_102_422 106
979 3300053085 Ga0495619_0162293 Ga0495619_0162293_32_352 106
980 3300053087 Ga0500643_002271 Ga0500643_002271_9650_9970 106
981 3300053093 Ga0500651_0031020 Ga0500651_0031020_2647_2967 106
982 3300053093 Ga0500651_0088309 Ga0500651_0088309_1320_1640 106
983 3300053094 Ga0500566_0034058 Ga0500566_0034058_1645_1965 106
984 3300053119 Ga0500595_000003 Ga0500595_000003_413786_414106 106
985 3300053130 Ga0500642_0412553 Ga0500642_0412553_170_490 106
986 3300053131 Ga0500652_005161 Ga0500652_005161_721_1041 106
987 3300053142 Ga0500577_0185485 Ga0500577_0185485_346_666 106
988 3300053153 Ga0500616_0000002 Ga0500616_0000002_1600423_1600743 106
989 3300053730 Ga0500645_000226 Ga0500645_000226_11706_12026 106
990 3300053730 Ga0500645_201682 Ga0500645_201682_22_342 106
991 3300054114 Ga0501084_0001073 Ga0501084_0001073_15769_16092 106
992 3300054114 Ga0501084_0084857 Ga0501084_0084857_1876_2196 106
993 3300054114 Ga0501084_0214935 Ga0501084_0214935_657_977 106
994 3300054114 Ga0501084_0413873 Ga0501084_0413873_247_567 106
995 3300054114 Ga0501084_0427176 Ga0501084_0427176_652_975 106
996 3300054114 Ga0501084_0841933 Ga0501084_0841933_69_389 106
997 3300054114 Ga0501084_0989198 Ga0501084_0989198_345_665 106
998 3300060353 Ga0501082_0000809 Ga0501082_0000809_7054_7377 106
999 3300060353 Ga0501082_0002254 Ga0501082_0002254_5353_5673 106
1000 3300060353 Ga0501082_0016215 Ga0501082_0016215_5172_5492 106
1001 3300060353 Ga0501082_0059202 Ga0501082_0059202_1305_1625 106
1002 3300060353 Ga0501082_0633352 Ga0501082_0633352_541_864 106
1003 3300060353 Ga0501082_1007055 Ga0501082_1007055_90_410 106
1004 3300060353 Ga0501082_1659796 Ga0501082_1659796_70_390 106
1005 3300061734 Ga0530510_0003125 Ga0530510_0003125_4606_4929 106
1006 3300061734 Ga0530510_0028935 Ga0530510_0028935_3250_3570 106
1007 3300061734 Ga0530510_0046048 Ga0530510_0046048_343_663 106
1008 3300061734 Ga0530510_0150947 Ga0530510_0150947_488_808 106
1009 3300061734 Ga0530510_0409306 Ga0530510_0409306_288_608 106
1010 3300061734 Ga0530510_0429679 Ga0530510_0429679_303_623 106
1011 3300061734 Ga0530510_0874054 Ga0530510_0874054_212_532 106
1012 3300061734 Ga0530510_1223782 Ga0530510_1223782_103_423 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08770

SoxZ

Sulphur oxidation protein SoxZ

10

106

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8958 2 106
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8935 1 106
2oxg-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8905 2 105
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8851 1 106
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8632 2 106
ID Description Score Start End Superfamily
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8935 1 106 2.60.40.10
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8851 1 106 2.60.40.10
1v8hB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8155 1 104 2.60.40.10
af_Q58151_5_116_2.60.40.730 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.8103 5 106 2.60.40.730
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8083 4 106 2.60.40.2470
ID Description Score Start End GO Terms
AF-W7QMR9-F1-model_v4 Sulphur oxidation protein SoxZ domain-containing protein 0.924 45 103
AF-A0A6P1B118-F1-model_v4 deleted 0.9217 41 106
AF-A0A6P1B118-F1-model_v4 deleted 0.8961 41 106
AF-A0A3D9ZF85-F1-model_v4 Uncharacterized protein 0.8838 5 106
AF-A0A651FJ43-F1-model_v4 Sulfur oxidation protein 0.8837 1 106

Feature Viewer

pLDDT pTM Quality
93.43 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map