F488135

General Info

Members Datasets Scaffolds Average Seq Length
1011 441 2022 153

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100227100|Ga0070714_1002271001
Length 186
Sequence MLSPGRGYRSARLRRRRMLPNYPHNIEVLDATGACVMEPVKFVALDRDDLEVVSTHLQDALVKVCDVIWRPQDKRVVVALSRFDWLSAEGEKPELRRCRSALRFERVSCCKCRNVDPAGKAAVLNLLAVEFSETDAPGGVVNLIFSGGGMLRLEVECLEAELADLGPSWPAAARPVHADGTPDLRG

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
10 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
11 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
12 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
21 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
86 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
100 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
101 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
102 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
103 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
104 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
105 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
106 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
107 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
108 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
109 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
122 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
124 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
125 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
141 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
142 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
143 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
144 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
145 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
148 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
149 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
150 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
151 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
152 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
153 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
163 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
165 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
234 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
238 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
239 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
240 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
241 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
242 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
243 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
244 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
245 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
246 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
247 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
248 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
249 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
250 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
251 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
252 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
253 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
254 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
255 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
256 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
257 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
259 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
260 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
261 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
262 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
263 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
264 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
265 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
266 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
267 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
268 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
269 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
270 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
271 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
272 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
273 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
274 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
275 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
276 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
277 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
278 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
279 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
280 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
281 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
282 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
283 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
284 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
285 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
286 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
287 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
288 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
289 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
290 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
291 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
292 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
293 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
294 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
295 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
296 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
297 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
298 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
299 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
300 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
301 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
302 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
303 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
304 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
305 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
306 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
307 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
308 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
309 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
310 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
311 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
312 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
313 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
314 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
315 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
316 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
317 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
318 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
319 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
320 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
321 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
322 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
323 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
324 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
325 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
326 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
327 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
328 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
329 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
330 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
331 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
332 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
333 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
334 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
335 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
336 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
337 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
338 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
339 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
340 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
341 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
342 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
343 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
344 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
345 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
346 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
347 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
348 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
349 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
350 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
351 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
352 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
353 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
354 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
355 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
356 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
357 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
358 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
359 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
360 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
361 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
362 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
363 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
364 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
365 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
366 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
367 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
368 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
369 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
370 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
371 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
372 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
373 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
374 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
375 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
376 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
377 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
378 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
379 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
380 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
381 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
382 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
383 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
384 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
395 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
396 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
397 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
398 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
399 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
400 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
401 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
402 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
403 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
404 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
405 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
406 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
407 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
408 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
409 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
411 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
412 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
413 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
414 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
415 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
416 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
417 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
418 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
419 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
420 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
421 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
422 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
423 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
424 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
425 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
426 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
427 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
428 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
429 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
430 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
431 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
432 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
433 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
434 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
435 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
436 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
437 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
438 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
439 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
440 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
441 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.77
Nodule 0
Rhizoplane 8.7
Rhizosphere 87.93
Stem 0
Stem Tuber 0
Unclassified 11.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100227100 3300005435 Bacteria 1718
2 2214773003 2209111006 Bacteria 2639
3 ARcpr5oldR_c000063 3300000041 Bacteria 19343
4 ARSoilYngRDRAFT_c00158 3300000042 Bacteria 11627
5 ARcpr5yngRDRAFT_c000065 3300000043 Bacteria 17113
6 ARSoilOldRDRAFT_c000068 3300000044 Bacteria 20059
7 ARCol0oldRDRAFT_c02928 3300000045 Unclassified 692
8 ARCol0yngRDRAFT_1000177 3300000652 Bacteria 10787
9 JGI24032J14994_101865 3300001430 Bacteria 800
10 JGI24741J21665_1006926 3300001915 Bacteria 2235
11 JGI24752J21851_1008192 3300001976 Bacteria 1360
12 JGI24746J21847_1012275 3300001977 Unclassified 1253
13 JGI24739J22299_10023557 3300001989 Bacteria 2175
14 JGI24743J22301_10044263 3300001991 Bacteria 898
15 JGI24750J21931_1001335 3300002070 Bacteria 3096
16 JGI24745J21846_1008340 3300002073 Bacteria 1167
17 JGI24738J21930_10008401 3300002075 Bacteria 2350
18 JGI24749J21850_1001566 3300002076 Bacteria 3237
19 JGI24744J21845_10024551 3300002077 Bacteria 1178
20 JGI24035J26624_1000242 3300002126 Bacteria 5026
21 JGI24033J26618_1009855 3300002155 Unclassified 1118
22 rootH2_10150727 3300003320 Bacteria 2507
23 JGI25405J52794_10080227 3300003911 Unclassified 718
24 Ga0058861_11407041 3300004800 Unclassified 616
25 Ga0065716_1002145 3300005277 Bacteria 2182
26 Ga0065704_10040669 3300005289 Unclassified 1021
27 Ga0065712_10008684 3300005290 Bacteria 2646
28 Ga0065712_10072748 3300005290 Bacteria 4630
29 Ga0065715_10539460 3300005293 Unclassified 749
30 Ga0065707_10188752 3300005295 Unclassified 1373
31 Ga0070658_10052638 3300005327 Bacteria 3302
32 Ga0070676_10025727 3300005328 Bacteria 3328
33 Ga0070676_10120093 3300005328 Bacteria 1649
34 Ga0070683_100065036 3300005329 Bacteria 3395
35 Ga0070683_100120682 3300005329 Bacteria 2476
36 Ga0070683_100144139 3300005329 Bacteria 2257
37 Ga0070690_100005956 3300005330 Bacteria 6884
38 Ga0070690_100026003 3300005330 Bacteria 3607
39 Ga0070690_100027267 3300005330 Bacteria 3530
40 Ga0070690_100135954 3300005330 Bacteria 1665
41 Ga0070670_100351697 3300005331 Bacteria 1294
42 Ga0070670_101162845 3300005331 Unclassified 704
43 Ga0070677_10001154 3300005333 Bacteria 8507
44 Ga0068869_100056191 3300005334 Bacteria 2870
45 Ga0068869_100733959 3300005334 Bacteria 844
46 Ga0070666_10055647 3300005335 Bacteria 2671
47 Ga0070666_11172271 3300005335 Bacteria 572
48 Ga0070680_100045501 3300005336 Bacteria 3568
49 Ga0070680_100068956 3300005336 Bacteria 2903
50 Ga0070680_100207057 3300005336 Bacteria 1654
51 Ga0070680_100440621 3300005336 Bacteria 1112
52 Ga0068868_100079304 3300005338 Bacteria 2630
53 Ga0068868_100091549 3300005338 Bacteria 2450
54 Ga0070660_100054597 3300005339 Bacteria 3085
55 Ga0070660_100067452 3300005339 Bacteria 2787
56 Ga0070660_100089589 3300005339 Bacteria 2424
57 Ga0070660_100090122 3300005339 Bacteria 2417
58 Ga0070660_100430079 3300005339 Bacteria 1094
59 Ga0070689_100029104 3300005340 Bacteria 4178
60 Ga0070689_100067424 3300005340 Bacteria 2789
61 Ga0070691_10013699 3300005341 Bacteria 3718
62 Ga0070691_10555226 3300005341 Bacteria 671
63 Ga0070687_100000184 3300005343 Bacteria 21654
64 Ga0070687_100104368 3300005343 Bacteria 1593
65 Ga0070661_100033600 3300005344 Bacteria 3716
66 Ga0070661_100272644 3300005344 Bacteria 1311
67 Ga0070661_100454387 3300005344 Bacteria 1019
68 Ga0070692_10005813 3300005345 Bacteria 5303
69 Ga0070692_10108281 3300005345 Unclassified 1533
70 Ga0070692_10295085 3300005345 Bacteria 988
71 Ga0070668_100085761 3300005347 Bacteria 2475
72 Ga0070668_100150854 3300005347 Bacteria 1879
73 Ga0070668_100424228 3300005347 Bacteria 1139
74 Ga0070668_100489906 3300005347 Bacteria 1063
75 Ga0070669_100029760 3300005353 Bacteria 3939
76 Ga0070669_100667695 3300005353 Unclassified 875
77 Ga0070675_100032769 3300005354 Bacteria 4206
78 Ga0070675_100109180 3300005354 Bacteria 2338
79 Ga0070675_100317222 3300005354 Bacteria 1376
80 Ga0070675_101705011 3300005354 Unclassified 581
81 Ga0070671_100000348 3300005355 Bacteria 31750
82 Ga0070671_100279666 3300005355 Bacteria 1419
83 Ga0070671_100718040 3300005355 Bacteria 867
84 Ga0070674_100031708 3300005356 Bacteria 3504
85 Ga0070674_100037559 3300005356 Bacteria 3258
86 Ga0070673_100021426 3300005364 Bacteria 4685
87 Ga0070673_100204139 3300005364 Bacteria 1703
88 Ga0070673_100533368 3300005364 Bacteria 1065
89 Ga0070688_100027408 3300005365 Bacteria 3394
90 Ga0070688_100120349 3300005365 Bacteria 1757
91 Ga0070688_100144847 3300005365 Bacteria 1618
92 Ga0070688_100235709 3300005365 Bacteria 1296
93 Ga0070659_100011784 3300005366 Bacteria 6471
94 Ga0070659_100050448 3300005366 Bacteria 3271
95 Ga0070667_100163192 3300005367 Bacteria 1964
96 Ga0070667_100193949 3300005367 Bacteria 1800
97 Ga0070667_100445413 3300005367 Bacteria 1183
98 Ga0070709_10136123 3300005434 Bacteria 1682
99 Ga0070709_10674694 3300005434 Bacteria 802
100 Ga0070709_11091676 3300005434 Unclassified 638
101 Ga0070714_100126476 3300005435 Bacteria 2279
102 Ga0070713_100046433 3300005436 Bacteria 3563
103 Ga0070713_100546314 3300005436 Bacteria 1097
104 Ga0070710_10224431 3300005437 Unclassified 1197
105 Ga0070701_10011484 3300005438 Bacteria 3961
106 Ga0070705_100015256 3300005440 Bacteria 3967
107 Ga0070705_100086715 3300005440 Bacteria 1939
108 Ga0070705_100152486 3300005440 Bacteria 1535
109 Ga0070700_100019204 3300005441 Bacteria 3942
110 Ga0070700_100112893 3300005441 Bacteria 1810
111 Ga0070700_100226267 3300005441 Unclassified 1328
112 Ga0070694_100052473 3300005444 Bacteria 2756
113 Ga0070694_100963752 3300005444 Bacteria 707
114 Ga0070708_100037273 3300005445 Bacteria 4241
115 Ga0070708_100145950 3300005445 Bacteria 2198
116 Ga0070663_100039185 3300005455 Bacteria 3310
117 Ga0070663_100210991 3300005455 Bacteria 1520
118 Ga0070663_100331053 3300005455 Bacteria 1227
119 Ga0070663_100499892 3300005455 Bacteria 1009
120 Ga0070678_100018719 3300005456 Bacteria 4495
121 Ga0070678_100067960 3300005456 Bacteria 2655
122 Ga0070678_100327215 3300005456 Bacteria 1310
123 Ga0070678_100481924 3300005456 Bacteria 1091
124 Ga0070662_100076990 3300005457 Bacteria 2474
125 Ga0070662_100506440 3300005457 Unclassified 1007
126 Ga0070662_101317916 3300005457 Unclassified 621
127 Ga0070681_10088074 3300005458 Bacteria 3057
128 Ga0070681_10093013 3300005458 Bacteria 2964
129 Ga0068867_100062994 3300005459 Bacteria 2756
130 Ga0068867_100119169 3300005459 Bacteria 2037
131 Ga0068867_100656679 3300005459 Unclassified 921
132 Ga0070685_10181102 3300005466 Bacteria 1356
133 Ga0070685_10541427 3300005466 Bacteria 830
134 Ga0070698_101946166 3300005471 Bacteria 541
135 Ga0074259_11362925 3300005507 Bacteria 1555
136 Ga0070699_100005897 3300005518 Bacteria 10705
137 Ga0070699_100194686 3300005518 Bacteria 1801
138 Ga0070679_100038088 3300005530 Bacteria 4780
139 Ga0070679_100061631 3300005530 Bacteria 3739
140 Ga0070679_100154158 3300005530 Bacteria 2273
141 Ga0070679_100233854 3300005530 Bacteria 1797
142 Ga0070679_100583448 3300005530 Bacteria 1061
143 Ga0070679_100690147 3300005530 Bacteria 964
144 Ga0070679_100992027 3300005530 Bacteria 784
145 Ga0070684_100012243 3300005535 Bacteria 6867
146 Ga0070684_100328229 3300005535 Bacteria 1406
147 Ga0070684_100523459 3300005535 Bacteria 1099
148 Ga0070697_100384820 3300005536 Bacteria 1215
149 Ga0068853_100164993 3300005539 Bacteria 2001
150 Ga0068853_100456273 3300005539 Unclassified 1202
151 Ga0070672_100054936 3300005543 Bacteria 3119
152 Ga0070686_100043359 3300005544 Bacteria 2822
153 Ga0070686_100095576 3300005544 Bacteria 1996
154 Ga0070686_100126201 3300005544 Bacteria 1763
155 Ga0070686_100174243 3300005544 Bacteria 1524
156 Ga0070686_100903650 3300005544 Unclassified 718
157 Ga0070696_100043061 3300005546 Bacteria 3122
158 Ga0070696_100121552 3300005546 Bacteria 1890
159 Ga0070696_100270960 3300005546 Bacteria 1291
160 Ga0070696_100373695 3300005546 Bacteria 1109
161 Ga0070693_100017020 3300005547 Bacteria 3772
162 Ga0070693_100143428 3300005547 Bacteria 1506
163 Ga0070693_100249994 3300005547 Bacteria 1175
164 Ga0070693_101033196 3300005547 Bacteria 623
165 Ga0070665_100113262 3300005548 Bacteria 2715
166 Ga0070665_100659912 3300005548 Unclassified 1059
167 Ga0070704_100066695 3300005549 Bacteria 2596
168 Ga0070704_100161732 3300005549 Bacteria 1771
169 Ga0068855_100037153 3300005563 Bacteria 5794
170 Ga0068855_100176114 3300005563 Bacteria 2420
171 Ga0068855_100235539 3300005563 Bacteria 2047
172 Ga0070664_100057358 3300005564 Bacteria 3310
173 Ga0070664_100085873 3300005564 Bacteria 2718
174 Ga0070664_100166446 3300005564 Bacteria 1953
175 Ga0070664_100292869 3300005564 Unclassified 1470
176 Ga0068857_100013840 3300005577 Bacteria 7025
177 Ga0068857_100126512 3300005577 Bacteria 2303
178 Ga0068857_101796424 3300005577 Bacteria 600
179 Ga0068854_100087832 3300005578 Bacteria 2307
180 Ga0068854_100097564 3300005578 Bacteria 2197
181 Ga0068854_100158345 3300005578 Bacteria 1752
182 Ga0068854_100907716 3300005578 Unclassified 775
183 Ga0068856_100088266 3300005614 Bacteria 3083
184 Ga0068856_100274858 3300005614 Bacteria 1701
185 Ga0068856_100363144 3300005614 Bacteria 1466
186 Ga0070702_100054242 3300005615 Bacteria 2305
187 Ga0070702_100596093 3300005615 Bacteria 827
188 Ga0068852_100015188 3300005616 Bacteria 5960
189 Ga0068852_100349374 3300005616 Bacteria 1443
190 Ga0068852_100453742 3300005616 Archaea 1269
191 Ga0068852_100646690 3300005616 Bacteria 1064
192 Ga0068859_100005469 3300005617 Bacteria 12924
193 Ga0068859_100113228 3300005617 Bacteria 2777
194 Ga0068859_100483555 3300005617 Bacteria 1334
195 Ga0068859_100553165 3300005617 Bacteria 1245
196 Ga0068864_100009632 3300005618 Bacteria 7970
197 Ga0068864_100045253 3300005618 Bacteria 3775
198 Ga0068864_100376630 3300005618 Bacteria 1344
199 Ga0068866_10051280 3300005718 Bacteria 2100
200 Ga0068861_100045116 3300005719 Bacteria 3317
201 Ga0068861_100457870 3300005719 Bacteria 1144
202 Ga0068851_11091743 3300005834 Unclassified 506
203 Ga0068870_10001851 3300005840 Bacteria 8702
204 Ga0068870_10016871 3300005840 Bacteria 3500
205 Ga0068863_100013874 3300005841 Bacteria 7768
206 Ga0068858_100031941 3300005842 Bacteria 4891
207 Ga0068858_100141055 3300005842 Bacteria 2262
208 Ga0068858_100380510 3300005842 Unclassified 1354
209 Ga0068858_100937989 3300005842 Unclassified 847
210 Ga0068860_100042871 3300005843 Bacteria 4318
211 Ga0068860_100130436 3300005843 Bacteria 2412
212 Ga0068860_100308868 3300005843 Bacteria 1550
213 Ga0068862_100027421 3300005844 Bacteria 4794
214 Ga0068862_100056632 3300005844 Bacteria 3359
215 Ga0068862_100871572 3300005844 Unclassified 883
216 Ga0081455_10000404 3300005937 Bacteria 56788
217 Ga0081455_10018650 3300005937 Bacteria 6594
218 Ga0081455_10039290 3300005937 Bacteria 4184
219 Ga0081455_10107538 3300005937 Bacteria 2223
220 Ga0081455_10115838 3300005937 Bacteria 2121
221 Ga0081455_10128263 3300005937 Bacteria 1987
222 Ga0081538_10040213 3300005981 Bacteria 2986
223 Ga0081538_10102975 3300005981 Bacteria 1430
224 Ga0081540_1074288 3300005983 Bacteria 1558
225 Ga0081540_1088610 3300005983 Bacteria 1368
226 Ga0081540_1208341 3300005983 Unclassified 705
227 Ga0081539_10031957 3300005985 Bacteria 3232
228 Ga0070717_10011726 3300006028 Bacteria 6669
229 Ga0070717_11046349 3300006028 Unclassified 743
230 Ga0075365_10097082 3300006038 Bacteria 2014
231 Ga0075365_10161758 3300006038 Bacteria 1560
232 Ga0075365_10312417 3300006038 Bacteria 1106
233 Ga0075365_10383521 3300006038 Bacteria 991
234 Ga0075432_10002316 3300006058 Bacteria 6338
235 Ga0075432_10125745 3300006058 Bacteria 967
236 Ga0070715_10025105 3300006163 Bacteria 2356
237 Ga0070715_10039045 3300006163 Bacteria 1975
238 Ga0070716_100045408 3300006173 Bacteria 2466
239 Ga0070716_100736086 3300006173 Unclassified 757
240 Ga0070712_100016939 3300006175 Bacteria 4712
241 Ga0070712_100063746 3300006175 Bacteria 2611
242 Ga0070712_100123074 3300006175 Bacteria 1955
243 Ga0075362_10291952 3300006177 Bacteria 808
244 Ga0075362_10347715 3300006177 Bacteria 742
245 Ga0075367_10278376 3300006178 Bacteria 1051
246 Ga0075367_10506592 3300006178 Unclassified 766
247 Ga0075367_10636358 3300006178 Unclassified 678
248 Ga0075369_10287970 3300006186 Bacteria 766
249 Ga0097621_100107279 3300006237 Bacteria 2356
250 Ga0097621_100184118 3300006237 Bacteria 1806
251 Ga0075370_10023759 3300006353 Bacteria 3380
252 Ga0075428_100014827 3300006844 Bacteria 8662
253 Ga0075428_100124917 3300006844 Bacteria 2800
254 Ga0075428_100253736 3300006844 Bacteria 1895
255 Ga0075430_100013770 3300006846 Bacteria 6890
256 Ga0075430_100054076 3300006846 Bacteria 3378
257 Ga0075431_100008339 3300006847 Bacteria 10365
258 Ga0075431_100028947 3300006847 Bacteria 5696
259 Ga0075431_100084770 3300006847 Bacteria 3271
260 Ga0075431_100151984 3300006847 Bacteria 2383
261 Ga0075431_101144190 3300006847 Bacteria 742
262 Ga0075431_101642466 3300006847 Unclassified 600
263 Ga0075433_10006454 3300006852 Bacteria 9276
264 Ga0075433_10067581 3300006852 Bacteria 3137
265 Ga0075434_100006422 3300006871 Bacteria 10772
266 Ga0075434_100045654 3300006871 Bacteria 4346
267 Ga0075434_100087664 3300006871 Bacteria 3113
268 Ga0075434_100191392 3300006871 Bacteria 2066
269 Ga0075434_100237005 3300006871 Bacteria 1844
270 Ga0075434_100894648 3300006871 Bacteria 903
271 Ga0075434_102025052 3300006871 Bacteria 581
272 Ga0075429_100020613 3300006880 Bacteria 5721
273 Ga0075429_100140361 3300006880 Bacteria 2115
274 Ga0075429_100309528 3300006880 Bacteria 1383
275 Ga0075429_100335747 3300006880 Bacteria 1323
276 Ga0075429_100471954 3300006880 Unclassified 1099
277 Ga0068865_100038002 3300006881 Bacteria 3255
278 Ga0068865_100218954 3300006881 Bacteria 1487
279 Ga0068865_100455315 3300006881 Bacteria 1059
280 Ga0075436_100103436 3300006914 Bacteria 1985
281 Ga0075436_100224943 3300006914 Bacteria 1332
282 Ga0075436_100279100 3300006914 Unclassified 1194
283 Ga0097620_100005469 3300006931 Bacteria 12924
284 Ga0097620_100113222 3300006931 Bacteria 2777
285 Ga0097620_100483568 3300006931 Bacteria 1334
286 Ga0097620_100553163 3300006931 Bacteria 1245
287 Ga0075435_100005128 3300007076 Bacteria 9105
288 Ga0075435_100084633 3300007076 Bacteria 2610
289 Ga0075435_100120750 3300007076 Bacteria 2187
290 Ga0075435_100214658 3300007076 Bacteria 1633
291 Ga0075435_101133901 3300007076 Bacteria 684
292 Ga0099794_10028981 3300007265 Bacteria 2577
293 Ga0105251_10051680 3300009011 Bacteria 1959
294 Ga0105251_10245641 3300009011 Bacteria 806
295 Ga0105240_10151222 3300009093 Bacteria 2764
296 Ga0111539_10001349 3300009094 Bacteria 32670
297 Ga0111539_10018218 3300009094 Bacteria 8697
298 Ga0111539_10159265 3300009094 Bacteria 2641
299 Ga0111539_10255867 3300009094 Bacteria 2039
300 Ga0111539_10883233 3300009094 Bacteria 1040
301 Ga0111539_11877561 3300009094 Unclassified 695
302 Ga0111539_12138184 3300009094 Unclassified 649
303 Ga0105245_10036366 3300009098 Bacteria 4374
304 Ga0105245_10066484 3300009098 Bacteria 3263
305 Ga0105247_10011736 3300009101 Bacteria 5269
306 Ga0105247_10026758 3300009101 Bacteria 3486
307 Ga0114129_10023892 3300009147 Bacteria 8662
308 Ga0114129_10026898 3300009147 Bacteria 8144
309 Ga0114129_10156190 3300009147 Bacteria 3119
310 Ga0114129_10231119 3300009147 Bacteria 2491
311 Ga0114129_10785724 3300009147 Unclassified 1216
312 Ga0114129_11252749 3300009147 Unclassified 921
313 Ga0105243_10076814 3300009148 Bacteria 2715
314 Ga0105243_10226906 3300009148 Bacteria 1654
315 Ga0105243_10318838 3300009148 Bacteria 1415
316 Ga0105241_10875270 3300009174 Bacteria 832
317 Ga0105242_10049159 3300009176 Bacteria 3431
318 Ga0105248_10020176 3300009177 Bacteria 7383
319 Ga0105248_10026619 3300009177 Bacteria 6432
320 Ga0105248_10030985 3300009177 Bacteria 5976
321 Ga0105248_13042612 3300009177 Unclassified 534
322 Ga0105237_10011839 3300009545 Bacteria 9226
323 Ga0105237_10601647 3300009545 Bacteria 1107
324 Ga0105238_10139710 3300009551 Bacteria 2399
325 Ga0105238_10702427 3300009551 Bacteria 1023
326 Ga0105249_10007332 3300009553 Bacteria 9614
327 Ga0105249_10186540 3300009553 Bacteria 2021
328 Ga0105249_10923002 3300009553 Unclassified 940
329 Ga0105239_10035238 3300010375 Bacteria 5497
330 Ga0105239_10263644 3300010375 Bacteria 1937
331 Ga0105239_11401061 3300010375 Bacteria 807
332 Ga0105246_10005348 3300011119 Bacteria 7815
333 Ga0105246_10127169 3300011119 Bacteria 1898
334 Ga0105246_10169954 3300011119 Bacteria 1669
335 Ga0105246_10912417 3300011119 Unclassified 789
336 Ga0157320_1000205 3300012481 Bacteria 2017
337 Ga0157325_1001937 3300012485 Bacteria 1006
338 Ga0157339_1013360 3300012505 Unclassified 784
339 Ga0157338_1001673 3300012515 Unclassified 1628
340 Ga0157371_10023549 3300013102 Bacteria 4503
341 Ga0157371_10066573 3300013102 Bacteria 2551
342 Ga0157371_10105040 3300013102 Bacteria 2004
343 Ga0157371_11469291 3300013102 Bacteria 531
344 Ga0157370_10024394 3300013104 Bacteria 5990
345 Ga0157370_10783655 3300013104 Bacteria 868
346 Ga0157369_10086450 3300013105 Bacteria 3349
347 Ga0157369_11468335 3300013105 Unclassified 694
348 Ga0157374_10191223 3300013296 Bacteria 2002
349 Ga0157374_10999710 3300013296 Bacteria 855
350 Ga0157378_10338162 3300013297 Bacteria 1467
351 Ga0163162_10945357 3300013306 Bacteria 973
352 Ga0163162_11193537 3300013306 Bacteria 863
353 Ga0157372_10344753 3300013307 Bacteria 1735
354 Ga0157372_12049658 3300013307 Unclassified 657
355 Ga0157375_10052064 3300013308 Bacteria 4023
356 Ga0157375_10365309 3300013308 Bacteria 1609
357 Ga0163163_10000318 3300014325 Bacteria 46911
358 Ga0163163_10108737 3300014325 Bacteria 2800
359 Ga0163163_10111084 3300014325 Bacteria 2770
360 Ga0163163_10196161 3300014325 Bacteria 2067
361 Ga0163163_10585805 3300014325 Bacteria 1178
362 Ga0157380_10216890 3300014326 Bacteria 1709
363 Ga0157380_10395488 3300014326 Bacteria 1309
364 Ga0157380_10974207 3300014326 Bacteria 880
365 Ga0157380_11771925 3300014326 Unclassified 676
366 Ga0182008_10199091 3300014497 Bacteria 1019
367 Ga0157377_10078754 3300014745 Bacteria 1921
368 Ga0157377_10147848 3300014745 Bacteria 1450
369 Ga0157377_10588104 3300014745 Bacteria 792
370 Ga0157379_10044911 3300014968 Bacteria 3944
371 Ga0157379_10297320 3300014968 Bacteria 1471
372 Ga0157379_10366131 3300014968 Bacteria 1321
373 Ga0157379_10823343 3300014968 Bacteria 877
374 Ga0157379_10920823 3300014968 Unclassified 830
375 Ga0157376_10113291 3300014969 Bacteria 2391
376 Ga0157376_10617936 3300014969 Bacteria 1080
377 Ga0157376_11650168 3300014969 Bacteria 676
378 Ga0163161_10034359 3300017792 Bacteria 3627
379 Ga0163161_10192247 3300017792 Bacteria 1570
380 Ga0197907_10268439 3300020069 Bacteria 538
381 Ga0206356_11092613 3300020070 Bacteria 789
382 Ga0206353_10292301 3300020082 Unclassified 844
383 Ga0206353_10486689 3300020082 Bacteria 2288
384 Ga0206353_11607177 3300020082 Bacteria 885
385 Ga0213876_10036889 3300021384 Bacteria 2579
386 Ga0224712_10584784 3300022467 Unclassified 544
387 Ga0207673_1000103 3300025290 Bacteria 7639
388 Ga0207697_10030709 3300025315 Bacteria 2198
389 Ga0207653_10004967 3300025885 Bacteria 4154
390 Ga0207653_10070795 3300025885 Unclassified 1192
391 Ga0207682_10054890 3300025893 Bacteria 1656
392 Ga0207692_10047479 3300025898 Bacteria 2156
393 Ga0207692_10183562 3300025898 Bacteria 1220
394 Ga0207642_10021833 3300025899 Bacteria 2527
395 Ga0207642_10805281 3300025899 Unclassified 598
396 Ga0207710_10065426 3300025900 Bacteria 1657
397 Ga0207710_10164362 3300025900 Bacteria 1083
398 Ga0207688_10001502 3300025901 Bacteria 12242
399 Ga0207680_10226533 3300025903 Bacteria 1283
400 Ga0207680_10362134 3300025903 Bacteria 1020
401 Ga0207647_10002513 3300025904 Bacteria 13884
402 Ga0207647_10161487 3300025904 Bacteria 1307
403 Ga0207685_10405426 3300025905 Unclassified 700
404 Ga0207643_10089901 3300025908 Bacteria 1789
405 Ga0207705_10031451 3300025909 Bacteria 3789
406 Ga0207705_10379119 3300025909 Bacteria 1092
407 Ga0207654_10015859 3300025911 Bacteria 3917
408 Ga0207707_10036443 3300025912 Bacteria 4300
409 Ga0207707_10049562 3300025912 Bacteria 3659
410 Ga0207707_10091347 3300025912 Bacteria 2661
411 Ga0207707_10204578 3300025912 Bacteria 1721
412 Ga0207707_10297255 3300025912 Unclassified 1397
413 Ga0207695_10116458 3300025913 Bacteria 2646
414 Ga0207671_10104015 3300025914 Bacteria 2154
415 Ga0207671_10350846 3300025914 Bacteria 1170
416 Ga0207693_10011489 3300025915 Bacteria 7162
417 Ga0207693_10036204 3300025915 Bacteria 3890
418 Ga0207693_10036211 3300025915 Bacteria 3889
419 Ga0207693_10120732 3300025915 Bacteria 2058
420 Ga0207660_10034851 3300025917 Bacteria 3491
421 Ga0207660_10053310 3300025917 Bacteria 2882
422 Ga0207660_10073540 3300025917 Bacteria 2492
423 Ga0207660_10145273 3300025917 Bacteria 1817
424 Ga0207660_10348405 3300025917 Bacteria 1187
425 Ga0207660_10424775 3300025917 Unclassified 1072
426 Ga0207662_10009038 3300025918 Bacteria 5473
427 Ga0207657_10006553 3300025919 Bacteria 12055
428 Ga0207657_10047597 3300025919 Bacteria 3747
429 Ga0207657_10057406 3300025919 Bacteria 3354
430 Ga0207657_10364350 3300025919 Bacteria 1139
431 Ga0207649_10001009 3300025920 Bacteria 17378
432 Ga0207652_10041370 3300025921 Bacteria 3917
433 Ga0207652_10190922 3300025921 Bacteria 1842
434 Ga0207652_10239087 3300025921 Bacteria 1637
435 Ga0207652_10278245 3300025921 Bacteria 1510
436 Ga0207652_10369717 3300025921 Bacteria 1294
437 Ga0207652_10601686 3300025921 Bacteria 986
438 Ga0207646_10216621 3300025922 Bacteria 1729
439 Ga0207681_10018419 3300025923 Bacteria 4399
440 Ga0207681_10096010 3300025923 Bacteria 2127
441 Ga0207681_10503672 3300025923 Bacteria 992
442 Ga0207681_10545815 3300025923 Unclassified 953
443 Ga0207694_10083753 3300025924 Bacteria 2508
444 Ga0207694_10916501 3300025924 Unclassified 741
445 Ga0207650_10036047 3300025925 Bacteria 3597
446 Ga0207650_10141495 3300025925 Bacteria 1892
447 Ga0207659_10115184 3300025926 Bacteria 2050
448 Ga0207659_10136727 3300025926 Bacteria 1898
449 Ga0207687_10006543 3300025927 Bacteria 7694
450 Ga0207700_10066229 3300025928 Bacteria 2760
451 Ga0207664_10076178 3300025929 Bacteria 2714
452 Ga0207664_10270524 3300025929 Bacteria 1488
453 Ga0207644_10434868 3300025931 Unclassified 1076
454 Ga0207644_11649637 3300025931 Bacteria 537
455 Ga0207690_10015532 3300025932 Bacteria 4615
456 Ga0207690_10042069 3300025932 Bacteria 2998
457 Ga0207690_10874433 3300025932 Unclassified 745
458 Ga0207709_10012890 3300025935 Bacteria 4610
459 Ga0207670_10005976 3300025936 Bacteria 6723
460 Ga0207670_10286623 3300025936 Bacteria 1285
461 Ga0207669_10013484 3300025937 Bacteria 4060
462 Ga0207669_10111644 3300025937 Bacteria 1833
463 Ga0207669_10265018 3300025937 Bacteria 1287
464 Ga0207704_10052785 3300025938 Bacteria 2466
465 Ga0207665_10045359 3300025939 Bacteria 2944
466 Ga0207665_10691971 3300025939 Bacteria 801
467 Ga0207691_10126738 3300025940 Bacteria 2258
468 Ga0207711_10038522 3300025941 Bacteria 4066
469 Ga0207711_10049627 3300025941 Bacteria 3593
470 Ga0207661_10000500 3300025944 Bacteria 25254
471 Ga0207661_10038404 3300025944 Bacteria 3753
472 Ga0207679_10000073 3300025945 Bacteria 89687
473 Ga0207679_10121415 3300025945 Bacteria 2081
474 Ga0207679_10164034 3300025945 Bacteria 1822
475 Ga0207679_11255513 3300025945 Unclassified 680
476 Ga0207667_10156921 3300025949 Bacteria 2341
477 Ga0207667_10293159 3300025949 Bacteria 1662
478 Ga0207651_10004037 3300025960 Bacteria 7306
479 Ga0207712_10099138 3300025961 Bacteria 2163
480 Ga0207712_10188502 3300025961 Bacteria 1626
481 Ga0207668_10051474 3300025972 Bacteria 2844
482 Ga0207668_10102250 3300025972 Bacteria 2132
483 Ga0207668_10224167 3300025972 Bacteria 1511
484 Ga0207668_10589823 3300025972 Bacteria 967
485 Ga0207668_11706853 3300025972 Unclassified 568
486 Ga0207640_10002641 3300025981 Bacteria 9600
487 Ga0207640_10034940 3300025981 Bacteria 3141
488 Ga0207658_10035001 3300025986 Bacteria 3594
489 Ga0207658_10312512 3300025986 Unclassified 1358
490 Ga0207677_10014893 3300026023 Bacteria 4556
491 Ga0207703_10013981 3300026035 Bacteria 6257
492 Ga0207703_10055498 3300026035 Bacteria 3223
493 Ga0207703_10734487 3300026035 Bacteria 940
494 Ga0207639_10035494 3300026041 Bacteria 3690
495 Ga0207639_10909355 3300026041 Bacteria 823
496 Ga0207678_10056143 3300026067 Bacteria 3391
497 Ga0207708_10266496 3300026075 Unclassified 1384
498 Ga0207702_10006076 3300026078 Bacteria 10472
499 Ga0207702_10183852 3300026078 Bacteria 1927
500 Ga0207702_10273031 3300026078 Bacteria 1595
501 Ga0207641_10184795 3300026088 Bacteria 1911
502 Ga0207641_10199366 3300026088 Bacteria 1844
503 Ga0207648_10173078 3300026089 Bacteria 1909
504 Ga0207676_10006437 3300026095 Bacteria 8295
505 Ga0207676_10241413 3300026095 Bacteria 1621
506 Ga0207674_10033677 3300026116 Bacteria 5362
507 Ga0207674_10134742 3300026116 Bacteria 2432
508 Ga0207675_100207746 3300026118 Bacteria 1882
509 Ga0207675_100436048 3300026118 Unclassified 1296
510 Ga0207683_10106902 3300026121 Bacteria 2503
511 Ga0207698_10055877 3300026142 Bacteria 3045
512 Ga0207698_10258164 3300026142 Bacteria 1599
513 Ga0207698_11642420 3300026142 Unclassified 658
514 Ga0209996_1021857 3300027395 Bacteria 903
515 Ga0209984_1052135 3300027424 Unclassified 599
516 Ga0209970_1045951 3300027614 Unclassified 783
517 Ga0210002_1004812 3300027617 Bacteria 2015
518 Ga0209971_1115263 3300027682 Bacteria 660
519 Ga0209966_1001929 3300027695 Bacteria 3483
520 Ga0209998_10002879 3300027717 Bacteria 3860
521 Ga0209998_10006315 3300027717 Bacteria 2463
522 Ga0209974_10002818 3300027876 Bacteria 6310
523 Ga0207428_10001432 3300027907 Bacteria 25078
524 Ga0207428_10005007 3300027907 Bacteria 12458
525 Ga0207428_10034138 3300027907 Bacteria 4172
526 Ga0207428_10953096 3300027907 Unclassified 604
527 Ga0268266_10444699 3300028379 Bacteria 1231
528 Ga0268265_10073775 3300028380 Bacteria 2666
529 Ga0268265_10357073 3300028380 Bacteria 1336
530 Ga0268264_10027537 3300028381 Bacteria 4645
531 Ga0265338_10051458 3300028800 Bacteria 3708
532 Ga0265332_10159996 3300031238 Bacteria 941
533 Ga0265325_10000004 3300031241 Bacteria 347347
534 Ga0265339_10072487 3300031249 Bacteria 1833
535 Ga0265313_10093881 3300031595 Bacteria 1342
536 Ga0265313_10105339 3300031595 Unclassified 1246
537 Ga0265313_10136649 3300031595 Bacteria 1057
538 Ga0265313_10275746 3300031595 Bacteria 680
539 Ga0316575_10037644 3300031665 Unclassified 1906
540 Ga0316575_10095740 3300031665 Bacteria 1205
541 Ga0316579_10065763 3300031691 Bacteria 1711
542 Ga0316583_10025555 3300032133 Bacteria 2109
543 Ga0373930_0003251 3300034816 Bacteria 2569
544 Ga0373948_0011244 3300034817 Bacteria 1578
545 Ga0373958_0001455 3300034819 Bacteria 3188
546 Ga0373959_0005113 3300034820 Bacteria 2145
547 Ga0373959_0036516 3300034820 Unclassified 1014
548 Ga0373938_0002185 3300034957 Bacteria 3140
549 Ga0373938_0007073 3300034957 Bacteria 1963
550 Ga0373926_0065812 3300035083 Bacteria 1326
551 Ga0373928_0007812 3300035084 Bacteria 2069
552 Ga0373929_0000248 3300035085 Bacteria 9932
553 Ga0373940_0000098 3300035088 Bacteria 10456
554 Ga0373940_0010425 3300035088 Bacteria 2184
555 Ga0373944_0002451 3300035089 Bacteria 4716
556 Ga0373944_0002775 3300035089 Bacteria 4480
557 Ga0373944_0028419 3300035089 Bacteria 1664
558 Ga0373949_0286354 3300035090 Unclassified 519
559 Ga0373951_0004830 3300035091 Bacteria 3172
560 Ga0373923_0004618 3300035111 Bacteria 4586
561 Ga0373923_0194504 3300035111 Bacteria 936
562 Ga0373932_0000586 3300035112 Bacteria 11105
563 Ga0373936_0032686 3300035113 Bacteria 2059
564 Ga0373939_0000650 3300035114 Bacteria 8639
565 Ga0373939_0013752 3300035114 Bacteria 2088
566 Ga0373941_0000197 3300035115 Bacteria 11482
567 Ga0373945_0001528 3300035116 Bacteria 7075
568 Ga0373945_0061049 3300035116 Unclassified 1407
569 Ga0373953_0222150 3300035117 Bacteria 818
570 Ga0373954_0007450 3300035118 Bacteria 4789
571 Ga0373954_0034662 3300035118 Bacteria 2339
572 Ga0373954_0316513 3300035118 Bacteria 770
573 Ga0373956_0008167 3300035119 Bacteria 4235
574 Ga0373956_0008980 3300035119 Bacteria 4054
575 Ga0373956_0119895 3300035119 Bacteria 1228
576 Ga0373957_0004466 3300035120 Bacteria 4257
577 Ga0373957_0014018 3300035120 Bacteria 2733
578 Ga0373960_0005113 3300035121 Bacteria 3024
579 Ga0373960_0024905 3300035121 Bacteria 1622
580 Ga0373943_0007905 3300035170 Bacteria 4773
581 Ga0373943_0026367 3300035170 Bacteria 2722
582 Ga0373946_0019720 3300035171 Bacteria 2600
583 Ga0373946_0044630 3300035171 Bacteria 1830
584 Ga0373946_0623215 3300035171 Unclassified 560
585 Ga0373955_0004448 3300035172 Bacteria 6210
586 Ga0373955_0022485 3300035172 Bacteria 3199
587 Ga0373955_0026739 3300035172 Bacteria 2976
588 Ga0373942_0001180 3300035207 Bacteria 6905
589 Ga0373961_0012280 3300035241 Bacteria 2141
590 Ga0373961_0014929 3300035241 Bacteria 1978
591 Ga0373961_0144846 3300035241 Bacteria 805
592 Ga0373962_0055096 3300035242 Unclassified 1154
593 Ga0373924_0054336 3300035410 Bacteria 1665
594 Ga0373924_0233936 3300035410 Unclassified 812
595 Ga0373924_0358272 3300035410 Bacteria 650
596 Ga0373931_0034901 3300035691 Bacteria 2613
597 Ga0373931_0443486 3300035691 Bacteria 829
598 Ga0373935_0005520 3300035692 Bacteria 7449
599 Ga0373935_0010567 3300035692 Bacteria 5539
600 Ga0373935_0097129 3300035692 Bacteria 1937
601 Ga0373935_0221126 3300035692 Bacteria 1315
602 Ga0373935_0816457 3300035692 Unclassified 689
603 Ga0373927_0013207 3300035695 Bacteria 5492
604 Ga0373927_0022447 3300035695 Bacteria 4134
605 Ga0373927_0069057 3300035695 Bacteria 2287
606 Ga0373933_0003227 3300035724 Bacteria 9105
607 Ga0373933_0036360 3300035724 Bacteria 2882
608 Ga0373933_0176811 3300035724 Bacteria 1360
609 Ga0373933_0263155 3300035724 Bacteria 1112
610 Ga0373947_0010385 3300035725 Bacteria 5342
611 Ga0373947_0085165 3300035725 Bacteria 1963
612 Ga0373947_0111766 3300035725 Bacteria 1727
613 Ga0373937_0005224 3300036401 Bacteria 11093
614 Ga0373937_0011749 3300036401 Bacteria 7681
615 Ga0373937_0029334 3300036401 Bacteria 4982
616 Ga0373937_0136429 3300036401 Bacteria 2294
617 Ga0373937_0591569 3300036401 Unclassified 1053
618 Ga0316582_0163815 3300036647 Bacteria 1507
619 Ga0373925_0026613 3300037068 Bacteria 4232
620 Ga0373925_0033142 3300037068 Bacteria 3807
621 Ga0373925_1466591 3300037068 Unclassified 558
622 Ga0395899_0007490 3300037312 Bacteria 8431
623 Ga0395899_0174593 3300037312 Bacteria 1512
624 Ga0395899_0561818 3300037312 Unclassified 732
625 Ga0395900_0005278 3300037418 Bacteria 13545
626 Ga0395900_0008706 3300037418 Bacteria 10423
627 Ga0395898_0061586 3300037466 Bacteria 3645
628 Ga0395898_0129749 3300037466 Bacteria 2415
629 Ga0395901_0065832 3300038443 Bacteria 3774
630 Ga0395901_0109688 3300038443 Bacteria 2897
631 Ga0395901_0190092 3300038443 Bacteria 2153
632 Ga0395901_0298607 3300038443 Bacteria 1670
633 Ga0242420_025770 3300038996 Unclassified 1070
634 Ga0436365_1542655 3300039437 Bacteria 11188
635 Ga0436365_1905880 3300039437 Bacteria 1282
636 Ga0436361_0854854 3300039447 Bacteria 5402
637 Ga0436363_1259660 3300039450 Bacteria 6844
638 Ga0436363_1294438 3300039450 Bacteria 1507
639 Ga0436362_1300628 3300039453 Bacteria 2829
640 Ga0439448_0033718 3300042005 Bacteria 1634
641 Ga0439444_0049838 3300042437 Bacteria 848
642 Ga0439464_0036523 3300042439 Bacteria 1390
643 Ga0439460_0055594 3300042461 Bacteria 1197
644 Ga0466966_0388143 3300044684 Unclassified 839
645 Ga0466963_0084657 3300044694 Bacteria 2152
646 Ga0466959_0305954 3300045049 Bacteria 1088
647 Ga0466959_0322961 3300045049 Bacteria 1055
648 Ga0451576_1161169 3300045051 Unclassified 807
649 Ga0495617_128741 3300046452 Unclassified 813
650 Ga0495592_0012029 3300046454 Bacteria 6559
651 Ga0495592_0022220 3300046454 Bacteria 4825
652 Ga0495592_0137094 3300046454 Bacteria 1706
653 Ga0495592_0204865 3300046454 Bacteria 1329
654 Ga0495603_0011832 3300046455 Bacteria 5280
655 Ga0495603_0135806 3300046455 Unclassified 1431
656 Ga0495629_0058047 3300046459 Bacteria 2705
657 Ga0495629_0155402 3300046459 Bacteria 1589
658 Ga0495629_0164864 3300046459 Bacteria 1539
659 Ga0495638_0226854 3300046460 Bacteria 1041
660 Ga0495641_0036496 3300046461 Bacteria 2309
661 Ga0495651_0010613 3300046462 Bacteria 7086
662 Ga0495651_0028420 3300046462 Bacteria 4358
663 Ga0495651_0228233 3300046462 Bacteria 1284
664 Ga0495651_0245222 3300046462 Bacteria 1226
665 Ga0495653_0062913 3300046463 Bacteria 2802
666 Ga0495653_0694436 3300046463 Bacteria 618
667 Ga0495580_0011461 3300046472 Bacteria 6860
668 Ga0495582_0016975 3300046473 Bacteria 3986
669 Ga0495605_0075518 3300046474 Bacteria 1585
670 Ga0495639_0012458 3300046475 Bacteria 3667
671 Ga0495664_0015661 3300046477 Bacteria 4313
672 Ga0495584_0010562 3300046491 Bacteria 4742
673 Ga0495584_0316540 3300046491 Unclassified 792
674 Ga0495584_0394950 3300046491 Bacteria 703
675 Ga0495585_0007439 3300046492 Bacteria 6704
676 Ga0495585_0124792 3300046492 Bacteria 1359
677 Ga0495594_0116665 3300046499 Bacteria 1508
678 Ga0495594_0241084 3300046499 Bacteria 1030
679 Ga0495607_0012941 3300046501 Bacteria 5487
680 Ga0495607_0124268 3300046501 Bacteria 1351
681 Ga0495608_0020087 3300046511 Bacteria 4593
682 Ga0495608_0035555 3300046511 Bacteria 3359
683 Ga0495608_0050275 3300046511 Bacteria 2766
684 Ga0495608_0523120 3300046511 Unclassified 717
685 Ga0495616_0287700 3300046513 Unclassified 697
686 Ga0495618_0066077 3300046514 Bacteria 2299
687 Ga0495618_0307704 3300046514 Unclassified 983
688 Ga0495628_0002929 3300046516 Bacteria 15303
689 Ga0495628_0011523 3300046516 Bacteria 7475
690 Ga0495630_0004487 3300046517 Bacteria 9784
691 Ga0495631_0033974 3300046518 Bacteria 2288
692 Ga0495637_0093757 3300046520 Unclassified 1181
693 Ga0495644_0002214 3300046523 Bacteria 7782
694 Ga0495644_0025698 3300046523 Bacteria 2235
695 Ga0495666_0005918 3300046526 Bacteria 6162
696 Ga0495666_0086892 3300046526 Bacteria 1477
697 Ga0495652_0010152 3300046529 Bacteria 8537
698 Ga0495652_0020838 3300046529 Bacteria 5825
699 Ga0495665_0097155 3300046531 Bacteria 1546
700 Ga0495640_0689052 3300046533 Unclassified 613
701 Ga0495586_0075579 3300046535 Bacteria 1844
702 Ga0495587_0022988 3300046536 Bacteria 3834
703 Ga0495587_0026523 3300046536 Bacteria 3533
704 Ga0495587_0100129 3300046536 Bacteria 1670
705 Ga0495598_0010145 3300046537 Bacteria 2249
706 Ga0495621_0122268 3300046539 Bacteria 1007
707 Ga0495645_0000359 3300046543 Bacteria 31690
708 Ga0495645_0116148 3300046543 Bacteria 1889
709 Ga0495622_0164000 3300046557 Unclassified 1001
710 Ga0495633_0009681 3300046558 Bacteria 5300
711 Ga0495633_0027510 3300046558 Bacteria 2780
712 Ga0495667_0015835 3300046559 Bacteria 5098
713 Ga0495667_0025456 3300046559 Bacteria 3987
714 Ga0495667_0045221 3300046559 Bacteria 2916
715 Ga0495667_0289541 3300046559 Bacteria 1039
716 Ga0495656_0001258 3300046615 Bacteria 8239
717 Ga0495656_0126059 3300046615 Bacteria 1214
718 Ga0495634_0061443 3300046642 Bacteria 2497
719 Ga0495634_0215277 3300046642 Bacteria 1188
720 Ga0495611_0005786 3300046648 Bacteria 5275
721 Ga0495635_0009700 3300046663 Bacteria 6732
722 Ga0495635_0018411 3300046663 Bacteria 4874
723 Ga0495635_0052344 3300046663 Bacteria 2813
724 Ga0495659_0009054 3300046664 Bacteria 3174
725 Ga0495659_0012038 3300046664 Bacteria 2795
726 Ga0495659_0023126 3300046664 Bacteria 2109
727 Ga0495661_0048221 3300046665 Bacteria 2589
728 Ga0495588_0003980 3300046674 Bacteria 6489
729 Ga0495588_0025993 3300046674 Bacteria 2920
730 Ga0495657_0012702 3300046675 Bacteria 6244
731 Ga0495657_0090623 3300046675 Bacteria 1962
732 Ga0495599_0004676 3300046678 Bacteria 8119
733 Ga0495623_0034824 3300046679 Bacteria 3229
734 Ga0495623_0074392 3300046679 Bacteria 2111
735 Ga0495646_0008212 3300046680 Bacteria 6636
736 Ga0495646_0357386 3300046680 Bacteria 764
737 Ga0495647_0027087 3300046681 Bacteria 2104
738 Ga0495647_0221236 3300046681 Unclassified 836
739 Ga0495658_0037142 3300046683 Bacteria 2691
740 Ga0495658_0105952 3300046683 Bacteria 1684
741 Ga0495669_0231753 3300046684 Unclassified 886
742 Ga0495613_0019139 3300046689 Bacteria 5103
743 Ga0495613_0132268 3300046689 Bacteria 1786
744 Ga0495613_0151706 3300046689 Bacteria 1652
745 Ga0495624_0084584 3300046690 Bacteria 1960
746 Ga0495624_0093357 3300046690 Bacteria 1855
747 Ga0495624_0219007 3300046690 Bacteria 1154
748 Ga0495670_0022571 3300046691 Bacteria 3108
749 Ga0495670_0040967 3300046691 Bacteria 2310
750 Ga0495600_0002996 3300046809 Bacteria 9863
751 Ga0495600_0170206 3300046809 Bacteria 1406
752 Ga0495660_0173662 3300046810 Unclassified 1048
753 Ga0495581_0010023 3300047315 Bacteria 5480
754 Ga0495581_0153505 3300047315 Bacteria 1345
755 Ga0495604_0003521 3300047317 Bacteria 12475
756 Ga0495604_0090669 3300047317 Bacteria 2269
757 Ga0495604_0092089 3300047317 Bacteria 2246
758 Ga0495674_0032385 3300047319 Bacteria 4741
759 Ga0495674_0394326 3300047319 Unclassified 1118
760 Ga0495674_0710247 3300047319 Unclassified 788
761 Ga0495672_0228242 3300047320 Unclassified 915
762 Ga0495676_0036868 3300047321 Bacteria 4077
763 Ga0495676_0043929 3300047321 Bacteria 3652
764 Ga0495676_0904047 3300047321 Unclassified 565
765 Ga0495680_0045470 3300047322 Bacteria 3466
766 Ga0495680_0048021 3300047322 Bacteria 3354
767 Ga0495680_0143795 3300047322 Bacteria 1743
768 Ga0495680_0258848 3300047322 Bacteria 1231
769 Ga0495675_0006898 3300047444 Bacteria 6975
770 Ga0495675_0028460 3300047444 Bacteria 3561
771 Ga0495679_013725 3300047446 Bacteria 3027
772 Ga0495684_0018065 3300047471 Bacteria 5434
773 Ga0495684_0045027 3300047471 Bacteria 3377
774 Ga0495593_0143845 3300047673 Bacteria 1207
775 Ga0495593_0160860 3300047673 Bacteria 1133
776 Ga0495602_0007055 3300048088 Bacteria 11792
777 Ga0495602_0010621 3300048088 Bacteria 9553
778 Ga0495602_0243592 3300048088 Bacteria 1344
779 Ga0495614_0014879 3300048089 Bacteria 3399
780 Ga0496100_0004113 3300048903 Bacteria 7669
781 Ga0496100_0038624 3300048903 Bacteria 3026
782 Ga0496100_0094102 3300048903 Bacteria 2051
783 Ga0496100_0377599 3300048903 Bacteria 1076
784 Ga0496100_0404384 3300048903 Unclassified 1040
785 Ga0496100_0953005 3300048903 Bacteria 675
786 Ga0496101_0003062 3300048904 Bacteria 10323
787 Ga0496101_0012909 3300048904 Bacteria 5587
788 Ga0496101_0193507 3300048904 Bacteria 1570
789 Ga0496101_0268773 3300048904 Bacteria 1331
790 Ga0496101_0844753 3300048904 Bacteria 721
791 Ga0496101_0875641 3300048904 Bacteria 707
792 Ga0496102_0027680 3300048905 Bacteria 5062
793 Ga0496102_0066831 3300048905 Bacteria 3296
794 Ga0496102_0081266 3300048905 Bacteria 2987
795 Ga0496102_0184381 3300048905 Bacteria 1967
796 Ga0496103_0013991 3300048906 Bacteria 4763
797 Ga0496103_0056455 3300048906 Bacteria 2437
798 Ga0496103_0070840 3300048906 Bacteria 2181
799 Ga0496104_0000086 3300048907 Bacteria 89916
800 Ga0496104_0005366 3300048907 Bacteria 11220
801 Ga0496104_0005870 3300048907 Bacteria 10759
802 Ga0496104_0038562 3300048907 Bacteria 4471
803 Ga0496104_0040710 3300048907 Bacteria 4356
804 Ga0496104_0066485 3300048907 Bacteria 3423
805 Ga0496105_0000126 3300048908 Bacteria 51169
806 Ga0496105_0010885 3300048908 Bacteria 7163
807 Ga0496105_0015451 3300048908 Bacteria 6084
808 Ga0496105_0025219 3300048908 Bacteria 4837
809 Ga0496105_0070526 3300048908 Bacteria 2889
810 Ga0496105_0115462 3300048908 Bacteria 2214
811 Ga0496105_0431877 3300048908 Unclassified 1042
812 Ga0496106_0011535 3300048909 Bacteria 6534
813 Ga0496106_0049736 3300048909 Bacteria 3158
814 Ga0496106_0123262 3300048909 Bacteria 2027
815 Ga0496106_0228877 3300048909 Bacteria 1484
816 Ga0496106_0921995 3300048909 Unclassified 689
817 Ga0496107_0011217 3300048910 Bacteria 6237
818 Ga0496107_0023524 3300048910 Bacteria 4356
819 Ga0496107_0037172 3300048910 Bacteria 3493
820 Ga0496107_0059189 3300048910 Bacteria 2772
821 Ga0496107_0091939 3300048910 Bacteria 2218
822 Ga0496107_0117453 3300048910 Bacteria 1958
823 Ga0496107_0434428 3300048910 Bacteria 976
824 Ga0496108_0002764 3300048911 Bacteria 14047
825 Ga0496108_0003252 3300048911 Bacteria 13057
826 Ga0496108_0004600 3300048911 Bacteria 11109
827 Ga0496108_0008108 3300048911 Bacteria 8516
828 Ga0496108_0318887 3300048911 Bacteria 1355
829 Ga0496108_0624051 3300048911 Unclassified 938
830 Ga0496108_0857157 3300048911 Bacteria 781
831 Ga0496109_0000755 3300048912 Bacteria 26947
832 Ga0496109_0003246 3300048912 Bacteria 13551
833 Ga0496109_0018955 3300048912 Bacteria 6058
834 Ga0496109_0117218 3300048912 Bacteria 2478
835 Ga0496109_0268161 3300048912 Bacteria 1608
836 Ga0496109_0343334 3300048912 Bacteria 1410
837 Ga0496110_0023920 3300048913 Bacteria 5201
838 Ga0496110_0067593 3300048913 Bacteria 3162
839 Ga0496110_0074197 3300048913 Bacteria 3020
840 Ga0496110_0097043 3300048913 Bacteria 2641
841 Ga0496110_0112886 3300048913 Bacteria 2443
842 Ga0496110_0294840 3300048913 Bacteria 1477
843 Ga0496111_0007148 3300048914 Bacteria 7294
844 Ga0496111_0018697 3300048914 Bacteria 4803
845 Ga0496111_0033929 3300048914 Bacteria 3641
846 Ga0496111_0283666 3300048914 Bacteria 1228
847 Ga0496111_0423994 3300048914 Bacteria 983
848 Ga0496111_0618913 3300048914 Unclassified 792
849 Ga0496111_1120883 3300048914 Unclassified 560
850 Ga0496112_0000689 3300048915 Bacteria 23554
851 Ga0496112_0010308 3300048915 Bacteria 8475
852 Ga0496112_0010565 3300048915 Bacteria 8384
853 Ga0496112_0019853 3300048915 Bacteria 6358
854 Ga0496112_0386632 3300048915 Bacteria 1340
855 Ga0496113_0005397 3300048916 Bacteria 7966
856 Ga0496113_0020536 3300048916 Bacteria 4645
857 Ga0496113_0032325 3300048916 Bacteria 3803
858 Ga0496113_0076416 3300048916 Bacteria 2558
859 Ga0496113_0606868 3300048916 Bacteria 876
860 Ga0496114_0054394 3300048917 Bacteria 3337
861 Ga0496114_0479993 3300048917 Bacteria 1100
862 Ga0496114_0593155 3300048917 Bacteria 977
863 Ga0496114_0617693 3300048917 Unclassified 955
864 Ga0496114_1008081 3300048917 Unclassified 716
865 Ga0496115_0025986 3300048918 Bacteria 4565
866 Ga0496115_0256334 3300048918 Bacteria 1439
867 Ga0496115_0698577 3300048918 Bacteria 798
868 Ga0501032_0058546 3300049569 Bacteria 2587
869 Ga0501032_0316705 3300049569 Bacteria 1007
870 Ga0501032_0549132 3300049569 Bacteria 737
871 Ga0501033_0021420 3300049570 Bacteria 4877
872 Ga0501034_0065274 3300049571 Bacteria 3652
873 Ga0501034_0174750 3300049571 Bacteria 2114
874 Ga0501034_0302965 3300049571 Unclassified 1534
875 Ga0501036_0390737 3300049572 Bacteria 1161
876 Ga0501037_0378029 3300049573 Bacteria 974
877 Ga0501039_0133751 3300049575 Bacteria 1947
878 Ga0501039_0274600 3300049575 Bacteria 1325
879 Ga0501039_0324983 3300049575 Bacteria 1209
880 Ga0501040_0139398 3300049576 Bacteria 1708
881 Ga0501040_0192169 3300049576 Bacteria 1449
882 Ga0501046_0359554 3300049580 Bacteria 1056
883 Ga0501047_0054406 3300049581 Bacteria 3871
884 Ga0501048_0670811 3300049582 Bacteria 744
885 Ga0501048_0747835 3300049582 Bacteria 702
886 Ga0501048_0865626 3300049582 Bacteria 650
887 Ga0501067_0013821 3300049583 Bacteria 4471
888 Ga0501068_0024447 3300049584 Bacteria 3548
889 Ga0501069_0046952 3300049585 Bacteria 2396
890 Ga0501069_0584373 3300049585 Unclassified 670
891 Ga0501070_0036276 3300049586 Bacteria 4117
892 Ga0501070_0046100 3300049586 Bacteria 3625
893 Ga0501070_0071426 3300049586 Bacteria 2874
894 Ga0501070_0896149 3300049586 Bacteria 692
895 Ga0501071_0216148 3300049587 Bacteria 1442
896 Ga0501071_0256851 3300049587 Unclassified 1319
897 Ga0501071_0411620 3300049587 Unclassified 1033
898 Ga0501071_1153313 3300049587 Unclassified 599
899 Ga0501072_0043250 3300049588 Bacteria 3540
900 Ga0501073_0028486 3300049589 Bacteria 3991
901 Ga0501073_0108241 3300049589 Bacteria 1929
902 Ga0501074_0043558 3300049590 Bacteria 3248
903 Ga0501074_0494873 3300049590 Bacteria 866
904 Ga0501075_0323424 3300049591 Bacteria 1175
905 Ga0501075_0862386 3300049591 Unclassified 689
906 Ga0501075_0904562 3300049591 Bacteria 671
907 Ga0501076_0734915 3300049592 Bacteria 815
908 Ga0501077_0056211 3300049593 Bacteria 2498
909 Ga0501077_0068387 3300049593 Bacteria 2251
910 Ga0501077_0108982 3300049593 Bacteria 1755
911 Ga0501077_0487153 3300049593 Unclassified 790
912 Ga0501077_1091473 3300049593 Bacteria 514
913 Ga0501079_0439037 3300049741 Bacteria 1025
914 Ga0501079_0832930 3300049741 Unclassified 726
915 Ga0501080_0169119 3300049742 Bacteria 2016
916 Ga0501080_0207613 3300049742 Bacteria 1796
917 Ga0501080_0484077 3300049742 Bacteria 1107
918 Ga0501080_0591509 3300049742 Bacteria 986
919 Ga0501081_0118605 3300049743 Bacteria 1883
920 Ga0501081_0775581 3300049743 Bacteria 721
921 Ga0501083_0026749 3300049744 Bacteria 3986
922 Ga0501083_0834301 3300049744 Unclassified 600
923 Ga0501035_0002877 3300049822 Bacteria 16600
924 Ga0501035_0563485 3300049822 Bacteria 932
925 Ga0501035_0596948 3300049822 Bacteria 900
926 Ga0501035_0728030 3300049822 Bacteria 798
927 Ga0501044_0032820 3300049823 Bacteria 5458
928 Ga0501044_0121786 3300049823 Bacteria 2609
929 Ga0501044_0136669 3300049823 Bacteria 2442
930 Ga0501044_0359705 3300049823 Bacteria 1374
931 nmdc:mga0yw44_148821_c1 3300050492 Bacteria 1526
932 nmdc:mga0yw44_21678_c1 3300050492 Bacteria 3589
933 nmdc:mga07m45_119687_c1 3300050496 Bacteria 1520
934 nmdc:mga07m45_329248_c1 3300050496 Bacteria 888
935 nmdc:mga05p37_17300_c1 3300050507 Bacteria 8697
936 nmdc:mga05p37_29857_c1 3300050507 Bacteria 6652
937 nmdc:mga05p37_30554_c1 3300050507 Bacteria 6574
938 nmdc:mga05p37_316503_c1 3300050507 Bacteria 1848
939 nmdc:mga05p37_858261_c1 3300050507 Bacteria 985
940 nmdc:mga05p37_91672_c1 3300050507 Bacteria 3745
941 nmdc:mga09592_19325_c1 3300050508 Bacteria 5595
942 nmdc:mga09592_579603_c1 3300050508 Bacteria 962
943 nmdc:mga0qj67_16366_c1 3300050509 Bacteria 5623
944 nmdc:mga0qj67_692511_c1 3300050509 Bacteria 811
945 nmdc:mga06r32_13918_c1 3300050510 Bacteria 7299
946 nmdc:mga06r32_184501_c1 3300050510 Bacteria 2073
947 nmdc:mga06r32_194626_c1 3300050510 Bacteria 2015
948 nmdc:mga06r32_624430_c1 3300050510 Bacteria 1047
949 nmdc:mga08y16_11614_c1 3300050511 Bacteria 9252
950 nmdc:mga08y16_1223706_c1 3300050511 Unclassified 721
951 nmdc:mga08y16_127989_c1 3300050511 Bacteria 2642
952 nmdc:mga08y16_182816_c1 3300050511 Bacteria 2176
953 nmdc:mga08y16_389596_c1 3300050511 Bacteria 1427
954 nmdc:mga08y16_46677_c1 3300050511 Bacteria 4535
955 nmdc:mga08y16_62806_c1 3300050511 Bacteria 3879
956 nmdc:mga0n895_201283_c1 3300050512 Bacteria 2022
957 nmdc:mga0n895_2883_c1 3300050512 Bacteria 13647
958 nmdc:mga0n895_322816_c1 3300050512 Bacteria 1565
959 nmdc:mga0n895_482738_c1 3300050512 Bacteria 1250
960 nmdc:mga0n895_57546_c1 3300050512 Bacteria 3832
961 nmdc:mga0n895_618531_c1 3300050512 Bacteria 1084
962 nmdc:mga0n895_733471_c1 3300050512 Bacteria 982
963 nmdc:mga0rr50_209869_c1 3300050513 Bacteria 1604
964 nmdc:mga0rr50_264782_c1 3300050513 Bacteria 1431
965 nmdc:mga0rr50_354259_c1 3300050513 Bacteria 1235
966 nmdc:mga0rr50_409141_c1 3300050513 Unclassified 1147
967 nmdc:mga0rr50_43298_c1 3300050513 Bacteria 3293
968 nmdc:mga08x19_234836_c1 3300050514 Unclassified 1263
969 nmdc:mga08x19_441594_c1 3300050514 Unclassified 915
970 nmdc:mga0a205_1021051_c1 3300050515 Bacteria 674
971 nmdc:mga0a205_11980_c1 3300050515 Bacteria 8009
972 nmdc:mga0a205_20190_c1 3300050515 Bacteria 6285
973 nmdc:mga0a205_494565_c1 3300050515 Bacteria 671
974 Ga0495601_0000137 3300053077 Bacteria 41334
975 Ga0495601_0121075 3300053077 Bacteria 1699
976 Ga0495601_0129966 3300053077 Bacteria 1640
977 Ga0495612_0000679 3300053078 Bacteria 13704
978 Ga0495612_0003588 3300053078 Bacteria 6429
979 Ga0495612_0020227 3300053078 Bacteria 2668
980 Ga0495612_0028364 3300053078 Bacteria 2254
981 Ga0495655_0036334 3300053083 Bacteria 1231
982 Ga0495595_0001976 3300053084 Bacteria 7966
983 Ga0495595_0002770 3300053084 Bacteria 6885
984 Ga0495595_0004744 3300053084 Bacteria 5469
985 Ga0495595_0258522 3300053084 Unclassified 872
986 Ga0495619_0002352 3300053085 Bacteria 12446
987 Ga0495619_0006115 3300053085 Bacteria 7625
988 Ga0495619_0006472 3300053085 Bacteria 7417
989 Ga0500643_017451 3300053087 Bacteria 2403
990 Ga0500644_0003222 3300053088 Bacteria 4040
991 Ga0500651_0000773 3300053093 Bacteria 15642
992 Ga0500566_0032448 3300053094 Bacteria 3046
993 Ga0500641_0014625 3300053096 Bacteria 2899
994 Ga0500595_000001 3300053119 Bacteria 1088438
995 Ga0500595_005500 3300053119 Bacteria 5528
996 Ga0500642_0280754 3300053130 Bacteria 757
997 Ga0500652_017811 3300053131 Bacteria 2610
998 Ga0500561_0182031 3300053137 Bacteria 662
999 Ga0500573_0296753 3300053140 Bacteria 810
1000 Ga0500616_0000001 3300053153 Bacteria 1986011
1001 Ga0500645_000370 3300053730 Bacteria 31624
1002 Ga0501084_0027155 3300054114 Bacteria 4784
1003 Ga0501084_0070030 3300054114 Bacteria 2937
1004 Ga0501084_0237111 3300054114 Bacteria 1540
1005 Ga0501084_0603897 3300054114 Bacteria 927
1006 Ga0501082_0314421 3300060353 Bacteria 1364
1007 Ga0501082_0589657 3300060353 Bacteria 972
1008 Ga0501082_0798286 3300060353 Bacteria 826
1009 Ga0530510_0055065 3300061734 Bacteria 2874
1010 Ga0530510_0072607 3300061734 Bacteria 2498
1011 Ga0530510_0752532 3300061734 Bacteria 743
1012 Ga0070714_100227100
1013 2214773003
1014 ARcpr5oldR_c000063
1015 ARSoilYngRDRAFT_c00158
1016 ARcpr5yngRDRAFT_c000065
1017 ARSoilOldRDRAFT_c000068
1018 ARCol0oldRDRAFT_c02928
1019 ARCol0yngRDRAFT_1000177
1020 JGI24032J14994_101865
1021 JGI24741J21665_1006926
1022 JGI24752J21851_1008192
1023 JGI24746J21847_1012275
1024 JGI24739J22299_10023557
1025 JGI24743J22301_10044263
1026 JGI24750J21931_1001335
1027 JGI24745J21846_1008340
1028 JGI24738J21930_10008401
1029 JGI24749J21850_1001566
1030 JGI24744J21845_10024551
1031 JGI24035J26624_1000242
1032 JGI24033J26618_1009855
1033 rootH2_10150727
1034 JGI25405J52794_10080227
1035 Ga0058861_11407041
1036 Ga0065716_1002145
1037 Ga0065704_10040669
1038 Ga0065712_10008684
1039 Ga0065712_10072748
1040 Ga0065715_10539460
1041 Ga0065707_10188752
1042 Ga0070658_10052638
1043 Ga0070676_10025727
1044 Ga0070676_10120093
1045 Ga0070683_100065036
1046 Ga0070683_100120682
1047 Ga0070683_100144139
1048 Ga0070690_100005956
1049 Ga0070690_100026003
1050 Ga0070690_100027267
1051 Ga0070690_100135954
1052 Ga0070670_100351697
1053 Ga0070670_101162845
1054 Ga0070677_10001154
1055 Ga0068869_100056191
1056 Ga0068869_100733959
1057 Ga0070666_10055647
1058 Ga0070666_11172271
1059 Ga0070680_100045501
1060 Ga0070680_100068956
1061 Ga0070680_100207057
1062 Ga0070680_100440621
1063 Ga0068868_100079304
1064 Ga0068868_100091549
1065 Ga0070660_100054597
1066 Ga0070660_100067452
1067 Ga0070660_100089589
1068 Ga0070660_100090122
1069 Ga0070660_100430079
1070 Ga0070689_100029104
1071 Ga0070689_100067424
1072 Ga0070691_10013699
1073 Ga0070691_10555226
1074 Ga0070687_100000184
1075 Ga0070687_100104368
1076 Ga0070661_100033600
1077 Ga0070661_100272644
1078 Ga0070661_100454387
1079 Ga0070692_10005813
1080 Ga0070692_10108281
1081 Ga0070692_10295085
1082 Ga0070668_100085761
1083 Ga0070668_100150854
1084 Ga0070668_100424228
1085 Ga0070668_100489906
1086 Ga0070669_100029760
1087 Ga0070669_100667695
1088 Ga0070675_100032769
1089 Ga0070675_100109180
1090 Ga0070675_100317222
1091 Ga0070675_101705011
1092 Ga0070671_100000348
1093 Ga0070671_100279666
1094 Ga0070671_100718040
1095 Ga0070674_100031708
1096 Ga0070674_100037559
1097 Ga0070673_100021426
1098 Ga0070673_100204139
1099 Ga0070673_100533368
1100 Ga0070688_100027408
1101 Ga0070688_100120349
1102 Ga0070688_100144847
1103 Ga0070688_100235709
1104 Ga0070659_100011784
1105 Ga0070659_100050448
1106 Ga0070667_100163192
1107 Ga0070667_100193949
1108 Ga0070667_100445413
1109 Ga0070709_10136123
1110 Ga0070709_10674694
1111 Ga0070709_11091676
1112 Ga0070714_100126476
1113 Ga0070713_100046433
1114 Ga0070713_100546314
1115 Ga0070710_10224431
1116 Ga0070701_10011484
1117 Ga0070705_100015256
1118 Ga0070705_100086715
1119 Ga0070705_100152486
1120 Ga0070700_100019204
1121 Ga0070700_100112893
1122 Ga0070700_100226267
1123 Ga0070694_100052473
1124 Ga0070694_100963752
1125 Ga0070708_100037273
1126 Ga0070708_100145950
1127 Ga0070663_100039185
1128 Ga0070663_100210991
1129 Ga0070663_100331053
1130 Ga0070663_100499892
1131 Ga0070678_100018719
1132 Ga0070678_100067960
1133 Ga0070678_100327215
1134 Ga0070678_100481924
1135 Ga0070662_100076990
1136 Ga0070662_100506440
1137 Ga0070662_101317916
1138 Ga0070681_10088074
1139 Ga0070681_10093013
1140 Ga0068867_100062994
1141 Ga0068867_100119169
1142 Ga0068867_100656679
1143 Ga0070685_10181102
1144 Ga0070685_10541427
1145 Ga0070698_101946166
1146 Ga0074259_11362925
1147 Ga0070699_100005897
1148 Ga0070699_100194686
1149 Ga0070679_100038088
1150 Ga0070679_100061631
1151 Ga0070679_100154158
1152 Ga0070679_100233854
1153 Ga0070679_100583448
1154 Ga0070679_100690147
1155 Ga0070679_100992027
1156 Ga0070684_100012243
1157 Ga0070684_100328229
1158 Ga0070684_100523459
1159 Ga0070697_100384820
1160 Ga0068853_100164993
1161 Ga0068853_100456273
1162 Ga0070672_100054936
1163 Ga0070686_100043359
1164 Ga0070686_100095576
1165 Ga0070686_100126201
1166 Ga0070686_100174243
1167 Ga0070686_100903650
1168 Ga0070696_100043061
1169 Ga0070696_100121552
1170 Ga0070696_100270960
1171 Ga0070696_100373695
1172 Ga0070693_100017020
1173 Ga0070693_100143428
1174 Ga0070693_100249994
1175 Ga0070693_101033196
1176 Ga0070665_100113262
1177 Ga0070665_100659912
1178 Ga0070704_100066695
1179 Ga0070704_100161732
1180 Ga0068855_100037153
1181 Ga0068855_100176114
1182 Ga0068855_100235539
1183 Ga0070664_100057358
1184 Ga0070664_100085873
1185 Ga0070664_100166446
1186 Ga0070664_100292869
1187 Ga0068857_100013840
1188 Ga0068857_100126512
1189 Ga0068857_101796424
1190 Ga0068854_100087832
1191 Ga0068854_100097564
1192 Ga0068854_100158345
1193 Ga0068854_100907716
1194 Ga0068856_100088266
1195 Ga0068856_100274858
1196 Ga0068856_100363144
1197 Ga0070702_100054242
1198 Ga0070702_100596093
1199 Ga0068852_100015188
1200 Ga0068852_100349374
1201 Ga0068852_100453742
1202 Ga0068852_100646690
1203 Ga0068859_100005469
1204 Ga0068859_100113228
1205 Ga0068859_100483555
1206 Ga0068859_100553165
1207 Ga0068864_100009632
1208 Ga0068864_100045253
1209 Ga0068864_100376630
1210 Ga0068866_10051280
1211 Ga0068861_100045116
1212 Ga0068861_100457870
1213 Ga0068851_11091743
1214 Ga0068870_10001851
1215 Ga0068870_10016871
1216 Ga0068863_100013874
1217 Ga0068858_100031941
1218 Ga0068858_100141055
1219 Ga0068858_100380510
1220 Ga0068858_100937989
1221 Ga0068860_100042871
1222 Ga0068860_100130436
1223 Ga0068860_100308868
1224 Ga0068862_100027421
1225 Ga0068862_100056632
1226 Ga0068862_100871572
1227 Ga0081455_10000404
1228 Ga0081455_10018650
1229 Ga0081455_10039290
1230 Ga0081455_10107538
1231 Ga0081455_10115838
1232 Ga0081455_10128263
1233 Ga0081538_10040213
1234 Ga0081538_10102975
1235 Ga0081540_1074288
1236 Ga0081540_1088610
1237 Ga0081540_1208341
1238 Ga0081539_10031957
1239 Ga0070717_10011726
1240 Ga0070717_11046349
1241 Ga0075365_10097082
1242 Ga0075365_10161758
1243 Ga0075365_10312417
1244 Ga0075365_10383521
1245 Ga0075432_10002316
1246 Ga0075432_10125745
1247 Ga0070715_10025105
1248 Ga0070715_10039045
1249 Ga0070716_100045408
1250 Ga0070716_100736086
1251 Ga0070712_100016939
1252 Ga0070712_100063746
1253 Ga0070712_100123074
1254 Ga0075362_10291952
1255 Ga0075362_10347715
1256 Ga0075367_10278376
1257 Ga0075367_10506592
1258 Ga0075367_10636358
1259 Ga0075369_10287970
1260 Ga0097621_100107279
1261 Ga0097621_100184118
1262 Ga0075370_10023759
1263 Ga0075428_100014827
1264 Ga0075428_100124917
1265 Ga0075428_100253736
1266 Ga0075430_100013770
1267 Ga0075430_100054076
1268 Ga0075431_100008339
1269 Ga0075431_100028947
1270 Ga0075431_100084770
1271 Ga0075431_100151984
1272 Ga0075431_101144190
1273 Ga0075431_101642466
1274 Ga0075433_10006454
1275 Ga0075433_10067581
1276 Ga0075434_100006422
1277 Ga0075434_100045654
1278 Ga0075434_100087664
1279 Ga0075434_100191392
1280 Ga0075434_100237005
1281 Ga0075434_100894648
1282 Ga0075434_102025052
1283 Ga0075429_100020613
1284 Ga0075429_100140361
1285 Ga0075429_100309528
1286 Ga0075429_100335747
1287 Ga0075429_100471954
1288 Ga0068865_100038002
1289 Ga0068865_100218954
1290 Ga0068865_100455315
1291 Ga0075436_100103436
1292 Ga0075436_100224943
1293 Ga0075436_100279100
1294 Ga0097620_100005469
1295 Ga0097620_100113222
1296 Ga0097620_100483568
1297 Ga0097620_100553163
1298 Ga0075435_100005128
1299 Ga0075435_100084633
1300 Ga0075435_100120750
1301 Ga0075435_100214658
1302 Ga0075435_101133901
1303 Ga0099794_10028981
1304 Ga0105251_10051680
1305 Ga0105251_10245641
1306 Ga0105240_10151222
1307 Ga0111539_10001349
1308 Ga0111539_10018218
1309 Ga0111539_10159265
1310 Ga0111539_10255867
1311 Ga0111539_10883233
1312 Ga0111539_11877561
1313 Ga0111539_12138184
1314 Ga0105245_10036366
1315 Ga0105245_10066484
1316 Ga0105247_10011736
1317 Ga0105247_10026758
1318 Ga0114129_10023892
1319 Ga0114129_10026898
1320 Ga0114129_10156190
1321 Ga0114129_10231119
1322 Ga0114129_10785724
1323 Ga0114129_11252749
1324 Ga0105243_10076814
1325 Ga0105243_10226906
1326 Ga0105243_10318838
1327 Ga0105241_10875270
1328 Ga0105242_10049159
1329 Ga0105248_10020176
1330 Ga0105248_10026619
1331 Ga0105248_10030985
1332 Ga0105248_13042612
1333 Ga0105237_10011839
1334 Ga0105237_10601647
1335 Ga0105238_10139710
1336 Ga0105238_10702427
1337 Ga0105249_10007332
1338 Ga0105249_10186540
1339 Ga0105249_10923002
1340 Ga0105239_10035238
1341 Ga0105239_10263644
1342 Ga0105239_11401061
1343 Ga0105246_10005348
1344 Ga0105246_10127169
1345 Ga0105246_10169954
1346 Ga0105246_10912417
1347 Ga0157320_1000205
1348 Ga0157325_1001937
1349 Ga0157339_1013360
1350 Ga0157338_1001673
1351 Ga0157371_10023549
1352 Ga0157371_10066573
1353 Ga0157371_10105040
1354 Ga0157371_11469291
1355 Ga0157370_10024394
1356 Ga0157370_10783655
1357 Ga0157369_10086450
1358 Ga0157369_11468335
1359 Ga0157374_10191223
1360 Ga0157374_10999710
1361 Ga0157378_10338162
1362 Ga0163162_10945357
1363 Ga0163162_11193537
1364 Ga0157372_10344753
1365 Ga0157372_12049658
1366 Ga0157375_10052064
1367 Ga0157375_10365309
1368 Ga0163163_10000318
1369 Ga0163163_10108737
1370 Ga0163163_10111084
1371 Ga0163163_10196161
1372 Ga0163163_10585805
1373 Ga0157380_10216890
1374 Ga0157380_10395488
1375 Ga0157380_10974207
1376 Ga0157380_11771925
1377 Ga0182008_10199091
1378 Ga0157377_10078754
1379 Ga0157377_10147848
1380 Ga0157377_10588104
1381 Ga0157379_10044911
1382 Ga0157379_10297320
1383 Ga0157379_10366131
1384 Ga0157379_10823343
1385 Ga0157379_10920823
1386 Ga0157376_10113291
1387 Ga0157376_10617936
1388 Ga0157376_11650168
1389 Ga0163161_10034359
1390 Ga0163161_10192247
1391 Ga0197907_10268439
1392 Ga0206356_11092613
1393 Ga0206353_10292301
1394 Ga0206353_10486689
1395 Ga0206353_11607177
1396 Ga0213876_10036889
1397 Ga0224712_10584784
1398 Ga0207673_1000103
1399 Ga0207697_10030709
1400 Ga0207653_10004967
1401 Ga0207653_10070795
1402 Ga0207682_10054890
1403 Ga0207692_10047479
1404 Ga0207692_10183562
1405 Ga0207642_10021833
1406 Ga0207642_10805281
1407 Ga0207710_10065426
1408 Ga0207710_10164362
1409 Ga0207688_10001502
1410 Ga0207680_10226533
1411 Ga0207680_10362134
1412 Ga0207647_10002513
1413 Ga0207647_10161487
1414 Ga0207685_10405426
1415 Ga0207643_10089901
1416 Ga0207705_10031451
1417 Ga0207705_10379119
1418 Ga0207654_10015859
1419 Ga0207707_10036443
1420 Ga0207707_10049562
1421 Ga0207707_10091347
1422 Ga0207707_10204578
1423 Ga0207707_10297255
1424 Ga0207695_10116458
1425 Ga0207671_10104015
1426 Ga0207671_10350846
1427 Ga0207693_10011489
1428 Ga0207693_10036204
1429 Ga0207693_10036211
1430 Ga0207693_10120732
1431 Ga0207660_10034851
1432 Ga0207660_10053310
1433 Ga0207660_10073540
1434 Ga0207660_10145273
1435 Ga0207660_10348405
1436 Ga0207660_10424775
1437 Ga0207662_10009038
1438 Ga0207657_10006553
1439 Ga0207657_10047597
1440 Ga0207657_10057406
1441 Ga0207657_10364350
1442 Ga0207649_10001009
1443 Ga0207652_10041370
1444 Ga0207652_10190922
1445 Ga0207652_10239087
1446 Ga0207652_10278245
1447 Ga0207652_10369717
1448 Ga0207652_10601686
1449 Ga0207646_10216621
1450 Ga0207681_10018419
1451 Ga0207681_10096010
1452 Ga0207681_10503672
1453 Ga0207681_10545815
1454 Ga0207694_10083753
1455 Ga0207694_10916501
1456 Ga0207650_10036047
1457 Ga0207650_10141495
1458 Ga0207659_10115184
1459 Ga0207659_10136727
1460 Ga0207687_10006543
1461 Ga0207700_10066229
1462 Ga0207664_10076178
1463 Ga0207664_10270524
1464 Ga0207644_10434868
1465 Ga0207644_11649637
1466 Ga0207690_10015532
1467 Ga0207690_10042069
1468 Ga0207690_10874433
1469 Ga0207709_10012890
1470 Ga0207670_10005976
1471 Ga0207670_10286623
1472 Ga0207669_10013484
1473 Ga0207669_10111644
1474 Ga0207669_10265018
1475 Ga0207704_10052785
1476 Ga0207665_10045359
1477 Ga0207665_10691971
1478 Ga0207691_10126738
1479 Ga0207711_10038522
1480 Ga0207711_10049627
1481 Ga0207661_10000500
1482 Ga0207661_10038404
1483 Ga0207679_10000073
1484 Ga0207679_10121415
1485 Ga0207679_10164034
1486 Ga0207679_11255513
1487 Ga0207667_10156921
1488 Ga0207667_10293159
1489 Ga0207651_10004037
1490 Ga0207712_10099138
1491 Ga0207712_10188502
1492 Ga0207668_10051474
1493 Ga0207668_10102250
1494 Ga0207668_10224167
1495 Ga0207668_10589823
1496 Ga0207668_11706853
1497 Ga0207640_10002641
1498 Ga0207640_10034940
1499 Ga0207658_10035001
1500 Ga0207658_10312512
1501 Ga0207677_10014893
1502 Ga0207703_10013981
1503 Ga0207703_10055498
1504 Ga0207703_10734487
1505 Ga0207639_10035494
1506 Ga0207639_10909355
1507 Ga0207678_10056143
1508 Ga0207708_10266496
1509 Ga0207702_10006076
1510 Ga0207702_10183852
1511 Ga0207702_10273031
1512 Ga0207641_10184795
1513 Ga0207641_10199366
1514 Ga0207648_10173078
1515 Ga0207676_10006437
1516 Ga0207676_10241413
1517 Ga0207674_10033677
1518 Ga0207674_10134742
1519 Ga0207675_100207746
1520 Ga0207675_100436048
1521 Ga0207683_10106902
1522 Ga0207698_10055877
1523 Ga0207698_10258164
1524 Ga0207698_11642420
1525 Ga0209996_1021857
1526 Ga0209984_1052135
1527 Ga0209970_1045951
1528 Ga0210002_1004812
1529 Ga0209971_1115263
1530 Ga0209966_1001929
1531 Ga0209998_10002879
1532 Ga0209998_10006315
1533 Ga0209974_10002818
1534 Ga0207428_10001432
1535 Ga0207428_10005007
1536 Ga0207428_10034138
1537 Ga0207428_10953096
1538 Ga0268266_10444699
1539 Ga0268265_10073775
1540 Ga0268265_10357073
1541 Ga0268264_10027537
1542 Ga0265338_10051458
1543 Ga0265332_10159996
1544 Ga0265325_10000004
1545 Ga0265339_10072487
1546 Ga0265313_10093881
1547 Ga0265313_10105339
1548 Ga0265313_10136649
1549 Ga0265313_10275746
1550 Ga0316575_10037644
1551 Ga0316575_10095740
1552 Ga0316579_10065763
1553 Ga0316583_10025555
1554 Ga0373930_0003251
1555 Ga0373948_0011244
1556 Ga0373958_0001455
1557 Ga0373959_0005113
1558 Ga0373959_0036516
1559 Ga0373938_0002185
1560 Ga0373938_0007073
1561 Ga0373926_0065812
1562 Ga0373928_0007812
1563 Ga0373929_0000248
1564 Ga0373940_0000098
1565 Ga0373940_0010425
1566 Ga0373944_0002451
1567 Ga0373944_0002775
1568 Ga0373944_0028419
1569 Ga0373949_0286354
1570 Ga0373951_0004830
1571 Ga0373923_0004618
1572 Ga0373923_0194504
1573 Ga0373932_0000586
1574 Ga0373936_0032686
1575 Ga0373939_0000650
1576 Ga0373939_0013752
1577 Ga0373941_0000197
1578 Ga0373945_0001528
1579 Ga0373945_0061049
1580 Ga0373953_0222150
1581 Ga0373954_0007450
1582 Ga0373954_0034662
1583 Ga0373954_0316513
1584 Ga0373956_0008167
1585 Ga0373956_0008980
1586 Ga0373956_0119895
1587 Ga0373957_0004466
1588 Ga0373957_0014018
1589 Ga0373960_0005113
1590 Ga0373960_0024905
1591 Ga0373943_0007905
1592 Ga0373943_0026367
1593 Ga0373946_0019720
1594 Ga0373946_0044630
1595 Ga0373946_0623215
1596 Ga0373955_0004448
1597 Ga0373955_0022485
1598 Ga0373955_0026739
1599 Ga0373942_0001180
1600 Ga0373961_0012280
1601 Ga0373961_0014929
1602 Ga0373961_0144846
1603 Ga0373962_0055096
1604 Ga0373924_0054336
1605 Ga0373924_0233936
1606 Ga0373924_0358272
1607 Ga0373931_0034901
1608 Ga0373931_0443486
1609 Ga0373935_0005520
1610 Ga0373935_0010567
1611 Ga0373935_0097129
1612 Ga0373935_0221126
1613 Ga0373935_0816457
1614 Ga0373927_0013207
1615 Ga0373927_0022447
1616 Ga0373927_0069057
1617 Ga0373933_0003227
1618 Ga0373933_0036360
1619 Ga0373933_0176811
1620 Ga0373933_0263155
1621 Ga0373947_0010385
1622 Ga0373947_0085165
1623 Ga0373947_0111766
1624 Ga0373937_0005224
1625 Ga0373937_0011749
1626 Ga0373937_0029334
1627 Ga0373937_0136429
1628 Ga0373937_0591569
1629 Ga0316582_0163815
1630 Ga0373925_0026613
1631 Ga0373925_0033142
1632 Ga0373925_1466591
1633 Ga0395899_0007490
1634 Ga0395899_0174593
1635 Ga0395899_0561818
1636 Ga0395900_0005278
1637 Ga0395900_0008706
1638 Ga0395898_0061586
1639 Ga0395898_0129749
1640 Ga0395901_0065832
1641 Ga0395901_0109688
1642 Ga0395901_0190092
1643 Ga0395901_0298607
1644 Ga0242420_025770
1645 Ga0436365_1542655
1646 Ga0436365_1905880
1647 Ga0436361_0854854
1648 Ga0436363_1259660
1649 Ga0436363_1294438
1650 Ga0436362_1300628
1651 Ga0439448_0033718
1652 Ga0439444_0049838
1653 Ga0439464_0036523
1654 Ga0439460_0055594
1655 Ga0466966_0388143
1656 Ga0466963_0084657
1657 Ga0466959_0305954
1658 Ga0466959_0322961
1659 Ga0451576_1161169
1660 Ga0495617_128741
1661 Ga0495592_0012029
1662 Ga0495592_0022220
1663 Ga0495592_0137094
1664 Ga0495592_0204865
1665 Ga0495603_0011832
1666 Ga0495603_0135806
1667 Ga0495629_0058047
1668 Ga0495629_0155402
1669 Ga0495629_0164864
1670 Ga0495638_0226854
1671 Ga0495641_0036496
1672 Ga0495651_0010613
1673 Ga0495651_0028420
1674 Ga0495651_0228233
1675 Ga0495651_0245222
1676 Ga0495653_0062913
1677 Ga0495653_0694436
1678 Ga0495580_0011461
1679 Ga0495582_0016975
1680 Ga0495605_0075518
1681 Ga0495639_0012458
1682 Ga0495664_0015661
1683 Ga0495584_0010562
1684 Ga0495584_0316540
1685 Ga0495584_0394950
1686 Ga0495585_0007439
1687 Ga0495585_0124792
1688 Ga0495594_0116665
1689 Ga0495594_0241084
1690 Ga0495607_0012941
1691 Ga0495607_0124268
1692 Ga0495608_0020087
1693 Ga0495608_0035555
1694 Ga0495608_0050275
1695 Ga0495608_0523120
1696 Ga0495616_0287700
1697 Ga0495618_0066077
1698 Ga0495618_0307704
1699 Ga0495628_0002929
1700 Ga0495628_0011523
1701 Ga0495630_0004487
1702 Ga0495631_0033974
1703 Ga0495637_0093757
1704 Ga0495644_0002214
1705 Ga0495644_0025698
1706 Ga0495666_0005918
1707 Ga0495666_0086892
1708 Ga0495652_0010152
1709 Ga0495652_0020838
1710 Ga0495665_0097155
1711 Ga0495640_0689052
1712 Ga0495586_0075579
1713 Ga0495587_0022988
1714 Ga0495587_0026523
1715 Ga0495587_0100129
1716 Ga0495598_0010145
1717 Ga0495621_0122268
1718 Ga0495645_0000359
1719 Ga0495645_0116148
1720 Ga0495622_0164000
1721 Ga0495633_0009681
1722 Ga0495633_0027510
1723 Ga0495667_0015835
1724 Ga0495667_0025456
1725 Ga0495667_0045221
1726 Ga0495667_0289541
1727 Ga0495656_0001258
1728 Ga0495656_0126059
1729 Ga0495634_0061443
1730 Ga0495634_0215277
1731 Ga0495611_0005786
1732 Ga0495635_0009700
1733 Ga0495635_0018411
1734 Ga0495635_0052344
1735 Ga0495659_0009054
1736 Ga0495659_0012038
1737 Ga0495659_0023126
1738 Ga0495661_0048221
1739 Ga0495588_0003980
1740 Ga0495588_0025993
1741 Ga0495657_0012702
1742 Ga0495657_0090623
1743 Ga0495599_0004676
1744 Ga0495623_0034824
1745 Ga0495623_0074392
1746 Ga0495646_0008212
1747 Ga0495646_0357386
1748 Ga0495647_0027087
1749 Ga0495647_0221236
1750 Ga0495658_0037142
1751 Ga0495658_0105952
1752 Ga0495669_0231753
1753 Ga0495613_0019139
1754 Ga0495613_0132268
1755 Ga0495613_0151706
1756 Ga0495624_0084584
1757 Ga0495624_0093357
1758 Ga0495624_0219007
1759 Ga0495670_0022571
1760 Ga0495670_0040967
1761 Ga0495600_0002996
1762 Ga0495600_0170206
1763 Ga0495660_0173662
1764 Ga0495581_0010023
1765 Ga0495581_0153505
1766 Ga0495604_0003521
1767 Ga0495604_0090669
1768 Ga0495604_0092089
1769 Ga0495674_0032385
1770 Ga0495674_0394326
1771 Ga0495674_0710247
1772 Ga0495672_0228242
1773 Ga0495676_0036868
1774 Ga0495676_0043929
1775 Ga0495676_0904047
1776 Ga0495680_0045470
1777 Ga0495680_0048021
1778 Ga0495680_0143795
1779 Ga0495680_0258848
1780 Ga0495675_0006898
1781 Ga0495675_0028460
1782 Ga0495679_013725
1783 Ga0495684_0018065
1784 Ga0495684_0045027
1785 Ga0495593_0143845
1786 Ga0495593_0160860
1787 Ga0495602_0007055
1788 Ga0495602_0010621
1789 Ga0495602_0243592
1790 Ga0495614_0014879
1791 Ga0496100_0004113
1792 Ga0496100_0038624
1793 Ga0496100_0094102
1794 Ga0496100_0377599
1795 Ga0496100_0404384
1796 Ga0496100_0953005
1797 Ga0496101_0003062
1798 Ga0496101_0012909
1799 Ga0496101_0193507
1800 Ga0496101_0268773
1801 Ga0496101_0844753
1802 Ga0496101_0875641
1803 Ga0496102_0027680
1804 Ga0496102_0066831
1805 Ga0496102_0081266
1806 Ga0496102_0184381
1807 Ga0496103_0013991
1808 Ga0496103_0056455
1809 Ga0496103_0070840
1810 Ga0496104_0000086
1811 Ga0496104_0005366
1812 Ga0496104_0005870
1813 Ga0496104_0038562
1814 Ga0496104_0040710
1815 Ga0496104_0066485
1816 Ga0496105_0000126
1817 Ga0496105_0010885
1818 Ga0496105_0015451
1819 Ga0496105_0025219
1820 Ga0496105_0070526
1821 Ga0496105_0115462
1822 Ga0496105_0431877
1823 Ga0496106_0011535
1824 Ga0496106_0049736
1825 Ga0496106_0123262
1826 Ga0496106_0228877
1827 Ga0496106_0921995
1828 Ga0496107_0011217
1829 Ga0496107_0023524
1830 Ga0496107_0037172
1831 Ga0496107_0059189
1832 Ga0496107_0091939
1833 Ga0496107_0117453
1834 Ga0496107_0434428
1835 Ga0496108_0002764
1836 Ga0496108_0003252
1837 Ga0496108_0004600
1838 Ga0496108_0008108
1839 Ga0496108_0318887
1840 Ga0496108_0624051
1841 Ga0496108_0857157
1842 Ga0496109_0000755
1843 Ga0496109_0003246
1844 Ga0496109_0018955
1845 Ga0496109_0117218
1846 Ga0496109_0268161
1847 Ga0496109_0343334
1848 Ga0496110_0023920
1849 Ga0496110_0067593
1850 Ga0496110_0074197
1851 Ga0496110_0097043
1852 Ga0496110_0112886
1853 Ga0496110_0294840
1854 Ga0496111_0007148
1855 Ga0496111_0018697
1856 Ga0496111_0033929
1857 Ga0496111_0283666
1858 Ga0496111_0423994
1859 Ga0496111_0618913
1860 Ga0496111_1120883
1861 Ga0496112_0000689
1862 Ga0496112_0010308
1863 Ga0496112_0010565
1864 Ga0496112_0019853
1865 Ga0496112_0386632
1866 Ga0496113_0005397
1867 Ga0496113_0020536
1868 Ga0496113_0032325
1869 Ga0496113_0076416
1870 Ga0496113_0606868
1871 Ga0496114_0054394
1872 Ga0496114_0479993
1873 Ga0496114_0593155
1874 Ga0496114_0617693
1875 Ga0496114_1008081
1876 Ga0496115_0025986
1877 Ga0496115_0256334
1878 Ga0496115_0698577
1879 Ga0501032_0058546
1880 Ga0501032_0316705
1881 Ga0501032_0549132
1882 Ga0501033_0021420
1883 Ga0501034_0065274
1884 Ga0501034_0174750
1885 Ga0501034_0302965
1886 Ga0501036_0390737
1887 Ga0501037_0378029
1888 Ga0501039_0133751
1889 Ga0501039_0274600
1890 Ga0501039_0324983
1891 Ga0501040_0139398
1892 Ga0501040_0192169
1893 Ga0501046_0359554
1894 Ga0501047_0054406
1895 Ga0501048_0670811
1896 Ga0501048_0747835
1897 Ga0501048_0865626
1898 Ga0501067_0013821
1899 Ga0501068_0024447
1900 Ga0501069_0046952
1901 Ga0501069_0584373
1902 Ga0501070_0036276
1903 Ga0501070_0046100
1904 Ga0501070_0071426
1905 Ga0501070_0896149
1906 Ga0501071_0216148
1907 Ga0501071_0256851
1908 Ga0501071_0411620
1909 Ga0501071_1153313
1910 Ga0501072_0043250
1911 Ga0501073_0028486
1912 Ga0501073_0108241
1913 Ga0501074_0043558
1914 Ga0501074_0494873
1915 Ga0501075_0323424
1916 Ga0501075_0862386
1917 Ga0501075_0904562
1918 Ga0501076_0734915
1919 Ga0501077_0056211
1920 Ga0501077_0068387
1921 Ga0501077_0108982
1922 Ga0501077_0487153
1923 Ga0501077_1091473
1924 Ga0501079_0439037
1925 Ga0501079_0832930
1926 Ga0501080_0169119
1927 Ga0501080_0207613
1928 Ga0501080_0484077
1929 Ga0501080_0591509
1930 Ga0501081_0118605
1931 Ga0501081_0775581
1932 Ga0501083_0026749
1933 Ga0501083_0834301
1934 Ga0501035_0002877
1935 Ga0501035_0563485
1936 Ga0501035_0596948
1937 Ga0501035_0728030
1938 Ga0501044_0032820
1939 Ga0501044_0121786
1940 Ga0501044_0136669
1941 Ga0501044_0359705
1942 nmdc:mga0yw44_148821_c1
1943 nmdc:mga0yw44_21678_c1
1944 nmdc:mga07m45_119687_c1
1945 nmdc:mga07m45_329248_c1
1946 nmdc:mga05p37_17300_c1
1947 nmdc:mga05p37_29857_c1
1948 nmdc:mga05p37_30554_c1
1949 nmdc:mga05p37_316503_c1
1950 nmdc:mga05p37_858261_c1
1951 nmdc:mga05p37_91672_c1
1952 nmdc:mga09592_19325_c1
1953 nmdc:mga09592_579603_c1
1954 nmdc:mga0qj67_16366_c1
1955 nmdc:mga0qj67_692511_c1
1956 nmdc:mga06r32_13918_c1
1957 nmdc:mga06r32_184501_c1
1958 nmdc:mga06r32_194626_c1
1959 nmdc:mga06r32_624430_c1
1960 nmdc:mga08y16_11614_c1
1961 nmdc:mga08y16_1223706_c1
1962 nmdc:mga08y16_127989_c1
1963 nmdc:mga08y16_182816_c1
1964 nmdc:mga08y16_389596_c1
1965 nmdc:mga08y16_46677_c1
1966 nmdc:mga08y16_62806_c1
1967 nmdc:mga0n895_201283_c1
1968 nmdc:mga0n895_2883_c1
1969 nmdc:mga0n895_322816_c1
1970 nmdc:mga0n895_482738_c1
1971 nmdc:mga0n895_57546_c1
1972 nmdc:mga0n895_618531_c1
1973 nmdc:mga0n895_733471_c1
1974 nmdc:mga0rr50_209869_c1
1975 nmdc:mga0rr50_264782_c1
1976 nmdc:mga0rr50_354259_c1
1977 nmdc:mga0rr50_409141_c1
1978 nmdc:mga0rr50_43298_c1
1979 nmdc:mga08x19_234836_c1
1980 nmdc:mga08x19_441594_c1
1981 nmdc:mga0a205_1021051_c1
1982 nmdc:mga0a205_11980_c1
1983 nmdc:mga0a205_20190_c1
1984 nmdc:mga0a205_494565_c1
1985 Ga0495601_0000137
1986 Ga0495601_0121075
1987 Ga0495601_0129966
1988 Ga0495612_0000679
1989 Ga0495612_0003588
1990 Ga0495612_0020227
1991 Ga0495612_0028364
1992 Ga0495655_0036334
1993 Ga0495595_0001976
1994 Ga0495595_0002770
1995 Ga0495595_0004744
1996 Ga0495595_0258522
1997 Ga0495619_0002352
1998 Ga0495619_0006115
1999 Ga0495619_0006472
2000 Ga0500643_017451
2001 Ga0500644_0003222
2002 Ga0500651_0000773
2003 Ga0500566_0032448
2004 Ga0500641_0014625
2005 Ga0500595_000001
2006 Ga0500595_005500
2007 Ga0500642_0280754
2008 Ga0500652_017811
2009 Ga0500561_0182031
2010 Ga0500573_0296753
2011 Ga0500616_0000001
2012 Ga0500645_000370
2013 Ga0501084_0027155
2014 Ga0501084_0070030
2015 Ga0501084_0237111
2016 Ga0501084_0603897
2017 Ga0501082_0314421
2018 Ga0501082_0589657
2019 Ga0501082_0798286
2020 Ga0530510_0055065
2021 Ga0530510_0072607
2022 Ga0530510_0752532

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11164

DUF2948

Protein of unknown function (DUF2948)

40

177

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dx9-assembly3.cif.gz_E icap1 in complex with integrin beta 1 cytoplasmic tail 0.785 95 126
5cxo-assembly1.cif.gz_A intriguing role of epoxide hydrolase/cyclase-like enzyme salbiii in pyran ring formation in polyether salinomycin 0.6986 37 74
3r7w-assembly2.cif.gz_D crystal structure of gtr1p-gtr2p complex 0.6955 98 125
7b70-assembly1.cif.gz_C trappcore plus c8 (355-596) and c11 (1-718) from minitrappiii 0.6946 100 123
6sb2-assembly1.cif.gz_D cryo-em structure of mtorc1 bound to active raga/c gtpases 0.6882 97 124
ID Description Score Start End Superfamily
af_Q8I346_1_137_3.30.450.50 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain 0.8277 97 124 3.30.450.50
af_Q4DNI0_193_354_3.30.450.190 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.8023 97 124 3.30.450.190
af_Q4DDN8_1_121_3.30.450.50 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain 0.7956 98 124 3.30.450.50
af_C6S3C4_1_106_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7831 98 126 3.30.450.30
af_A0A1D8PSL3_1_125_3.30.450.50 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain 0.7588 98 123 3.30.450.50
ID Description Score Start End GO Terms
AF-A0A560LKN0-F1-model_v4 DUF2948 family protein 0.9794 7 135
AF-A0A537QZ23-F1-model_v4 DUF2948 family protein 0.9734 10 115
AF-A0A2N3EKH6-F1-model_v4 DUF2948 domain-containing protein 0.972 7 146
AF-A0A2A4PC00-F1-model_v4 DUF2948 family protein 0.9719 7 146
AF-A0A165VJ59-F1-model_v4 DUF2948 domain-containing protein 0.9713 6 150

Map