F488135
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1011 | 441 | 2022 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100227100|Ga0070714_1002271001 |
| Length | 186 |
| Sequence | MLSPGRGYRSARLRRRRMLPNYPHNIEVLDATGACVMEPVKFVALDRDDLEVVSTHLQDALVKVCDVIWRPQDKRVVVALSRFDWLSAEGEKPELRRCRSALRFERVSCCKCRNVDPAGKAAVLNLLAVEFSETDAPGGVVNLIFSGGGMLRLEVECLEAELADLGPSWPAAARPVHADGTPDLRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 10 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 11 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 12 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 19 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 20 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 21 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 22 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 23 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 24 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 25 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 71 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 89 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 90 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 91 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 92 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 93 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 94 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 100 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 102 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 103 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 105 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 106 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 110 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 111 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 118 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 119 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 120 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 121 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 122 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 124 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 125 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 141 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 142 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 143 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 144 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 155 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 163 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 234 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 240 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 241 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 243 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 244 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 245 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 246 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 247 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 248 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 249 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 251 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 252 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 253 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 255 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 256 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 260 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 261 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 264 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 265 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 266 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 267 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 268 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 269 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 274 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 275 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 276 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 277 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 278 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 279 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 280 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 282 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 284 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 285 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 286 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 287 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 288 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 289 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 290 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 291 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 292 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 293 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 294 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 295 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 296 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 297 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 298 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 299 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 300 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 371 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 372 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 373 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 374 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 375 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 376 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 379 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 380 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 381 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 382 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 383 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 384 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 412 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 413 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 428 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 429 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 430 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 431 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 432 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 433 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 434 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 435 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 436 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 437 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 438 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 439 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.31 |
| Metatranscriptomes | 0.69 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.77 |
| Nodule | 0 |
| Rhizoplane | 8.7 |
| Rhizosphere | 87.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070714_100227100 | 3300005435 | Bacteria | 1718 |
| 2 | 2214773003 | 2209111006 | Bacteria | 2639 |
| 3 | ARcpr5oldR_c000063 | 3300000041 | Bacteria | 19343 |
| 4 | ARSoilYngRDRAFT_c00158 | 3300000042 | Bacteria | 11627 |
| 5 | ARcpr5yngRDRAFT_c000065 | 3300000043 | Bacteria | 17113 |
| 6 | ARSoilOldRDRAFT_c000068 | 3300000044 | Bacteria | 20059 |
| 7 | ARCol0oldRDRAFT_c02928 | 3300000045 | Unclassified | 692 |
| 8 | ARCol0yngRDRAFT_1000177 | 3300000652 | Bacteria | 10787 |
| 9 | JGI24032J14994_101865 | 3300001430 | Bacteria | 800 |
| 10 | JGI24741J21665_1006926 | 3300001915 | Bacteria | 2235 |
| 11 | JGI24752J21851_1008192 | 3300001976 | Bacteria | 1360 |
| 12 | JGI24746J21847_1012275 | 3300001977 | Unclassified | 1253 |
| 13 | JGI24739J22299_10023557 | 3300001989 | Bacteria | 2175 |
| 14 | JGI24743J22301_10044263 | 3300001991 | Bacteria | 898 |
| 15 | JGI24750J21931_1001335 | 3300002070 | Bacteria | 3096 |
| 16 | JGI24745J21846_1008340 | 3300002073 | Bacteria | 1167 |
| 17 | JGI24738J21930_10008401 | 3300002075 | Bacteria | 2350 |
| 18 | JGI24749J21850_1001566 | 3300002076 | Bacteria | 3237 |
| 19 | JGI24744J21845_10024551 | 3300002077 | Bacteria | 1178 |
| 20 | JGI24035J26624_1000242 | 3300002126 | Bacteria | 5026 |
| 21 | JGI24033J26618_1009855 | 3300002155 | Unclassified | 1118 |
| 22 | rootH2_10150727 | 3300003320 | Bacteria | 2507 |
| 23 | JGI25405J52794_10080227 | 3300003911 | Unclassified | 718 |
| 24 | Ga0058861_11407041 | 3300004800 | Unclassified | 616 |
| 25 | Ga0065716_1002145 | 3300005277 | Bacteria | 2182 |
| 26 | Ga0065704_10040669 | 3300005289 | Unclassified | 1021 |
| 27 | Ga0065712_10008684 | 3300005290 | Bacteria | 2646 |
| 28 | Ga0065712_10072748 | 3300005290 | Bacteria | 4630 |
| 29 | Ga0065715_10539460 | 3300005293 | Unclassified | 749 |
| 30 | Ga0065707_10188752 | 3300005295 | Unclassified | 1373 |
| 31 | Ga0070658_10052638 | 3300005327 | Bacteria | 3302 |
| 32 | Ga0070676_10025727 | 3300005328 | Bacteria | 3328 |
| 33 | Ga0070676_10120093 | 3300005328 | Bacteria | 1649 |
| 34 | Ga0070683_100065036 | 3300005329 | Bacteria | 3395 |
| 35 | Ga0070683_100120682 | 3300005329 | Bacteria | 2476 |
| 36 | Ga0070683_100144139 | 3300005329 | Bacteria | 2257 |
| 37 | Ga0070690_100005956 | 3300005330 | Bacteria | 6884 |
| 38 | Ga0070690_100026003 | 3300005330 | Bacteria | 3607 |
| 39 | Ga0070690_100027267 | 3300005330 | Bacteria | 3530 |
| 40 | Ga0070690_100135954 | 3300005330 | Bacteria | 1665 |
| 41 | Ga0070670_100351697 | 3300005331 | Bacteria | 1294 |
| 42 | Ga0070670_101162845 | 3300005331 | Unclassified | 704 |
| 43 | Ga0070677_10001154 | 3300005333 | Bacteria | 8507 |
| 44 | Ga0068869_100056191 | 3300005334 | Bacteria | 2870 |
| 45 | Ga0068869_100733959 | 3300005334 | Bacteria | 844 |
| 46 | Ga0070666_10055647 | 3300005335 | Bacteria | 2671 |
| 47 | Ga0070666_11172271 | 3300005335 | Bacteria | 572 |
| 48 | Ga0070680_100045501 | 3300005336 | Bacteria | 3568 |
| 49 | Ga0070680_100068956 | 3300005336 | Bacteria | 2903 |
| 50 | Ga0070680_100207057 | 3300005336 | Bacteria | 1654 |
| 51 | Ga0070680_100440621 | 3300005336 | Bacteria | 1112 |
| 52 | Ga0068868_100079304 | 3300005338 | Bacteria | 2630 |
| 53 | Ga0068868_100091549 | 3300005338 | Bacteria | 2450 |
| 54 | Ga0070660_100054597 | 3300005339 | Bacteria | 3085 |
| 55 | Ga0070660_100067452 | 3300005339 | Bacteria | 2787 |
| 56 | Ga0070660_100089589 | 3300005339 | Bacteria | 2424 |
| 57 | Ga0070660_100090122 | 3300005339 | Bacteria | 2417 |
| 58 | Ga0070660_100430079 | 3300005339 | Bacteria | 1094 |
| 59 | Ga0070689_100029104 | 3300005340 | Bacteria | 4178 |
| 60 | Ga0070689_100067424 | 3300005340 | Bacteria | 2789 |
| 61 | Ga0070691_10013699 | 3300005341 | Bacteria | 3718 |
| 62 | Ga0070691_10555226 | 3300005341 | Bacteria | 671 |
| 63 | Ga0070687_100000184 | 3300005343 | Bacteria | 21654 |
| 64 | Ga0070687_100104368 | 3300005343 | Bacteria | 1593 |
| 65 | Ga0070661_100033600 | 3300005344 | Bacteria | 3716 |
| 66 | Ga0070661_100272644 | 3300005344 | Bacteria | 1311 |
| 67 | Ga0070661_100454387 | 3300005344 | Bacteria | 1019 |
| 68 | Ga0070692_10005813 | 3300005345 | Bacteria | 5303 |
| 69 | Ga0070692_10108281 | 3300005345 | Unclassified | 1533 |
| 70 | Ga0070692_10295085 | 3300005345 | Bacteria | 988 |
| 71 | Ga0070668_100085761 | 3300005347 | Bacteria | 2475 |
| 72 | Ga0070668_100150854 | 3300005347 | Bacteria | 1879 |
| 73 | Ga0070668_100424228 | 3300005347 | Bacteria | 1139 |
| 74 | Ga0070668_100489906 | 3300005347 | Bacteria | 1063 |
| 75 | Ga0070669_100029760 | 3300005353 | Bacteria | 3939 |
| 76 | Ga0070669_100667695 | 3300005353 | Unclassified | 875 |
| 77 | Ga0070675_100032769 | 3300005354 | Bacteria | 4206 |
| 78 | Ga0070675_100109180 | 3300005354 | Bacteria | 2338 |
| 79 | Ga0070675_100317222 | 3300005354 | Bacteria | 1376 |
| 80 | Ga0070675_101705011 | 3300005354 | Unclassified | 581 |
| 81 | Ga0070671_100000348 | 3300005355 | Bacteria | 31750 |
| 82 | Ga0070671_100279666 | 3300005355 | Bacteria | 1419 |
| 83 | Ga0070671_100718040 | 3300005355 | Bacteria | 867 |
| 84 | Ga0070674_100031708 | 3300005356 | Bacteria | 3504 |
| 85 | Ga0070674_100037559 | 3300005356 | Bacteria | 3258 |
| 86 | Ga0070673_100021426 | 3300005364 | Bacteria | 4685 |
| 87 | Ga0070673_100204139 | 3300005364 | Bacteria | 1703 |
| 88 | Ga0070673_100533368 | 3300005364 | Bacteria | 1065 |
| 89 | Ga0070688_100027408 | 3300005365 | Bacteria | 3394 |
| 90 | Ga0070688_100120349 | 3300005365 | Bacteria | 1757 |
| 91 | Ga0070688_100144847 | 3300005365 | Bacteria | 1618 |
| 92 | Ga0070688_100235709 | 3300005365 | Bacteria | 1296 |
| 93 | Ga0070659_100011784 | 3300005366 | Bacteria | 6471 |
| 94 | Ga0070659_100050448 | 3300005366 | Bacteria | 3271 |
| 95 | Ga0070667_100163192 | 3300005367 | Bacteria | 1964 |
| 96 | Ga0070667_100193949 | 3300005367 | Bacteria | 1800 |
| 97 | Ga0070667_100445413 | 3300005367 | Bacteria | 1183 |
| 98 | Ga0070709_10136123 | 3300005434 | Bacteria | 1682 |
| 99 | Ga0070709_10674694 | 3300005434 | Bacteria | 802 |
| 100 | Ga0070709_11091676 | 3300005434 | Unclassified | 638 |
| 101 | Ga0070714_100126476 | 3300005435 | Bacteria | 2279 |
| 102 | Ga0070713_100046433 | 3300005436 | Bacteria | 3563 |
| 103 | Ga0070713_100546314 | 3300005436 | Bacteria | 1097 |
| 104 | Ga0070710_10224431 | 3300005437 | Unclassified | 1197 |
| 105 | Ga0070701_10011484 | 3300005438 | Bacteria | 3961 |
| 106 | Ga0070705_100015256 | 3300005440 | Bacteria | 3967 |
| 107 | Ga0070705_100086715 | 3300005440 | Bacteria | 1939 |
| 108 | Ga0070705_100152486 | 3300005440 | Bacteria | 1535 |
| 109 | Ga0070700_100019204 | 3300005441 | Bacteria | 3942 |
| 110 | Ga0070700_100112893 | 3300005441 | Bacteria | 1810 |
| 111 | Ga0070700_100226267 | 3300005441 | Unclassified | 1328 |
| 112 | Ga0070694_100052473 | 3300005444 | Bacteria | 2756 |
| 113 | Ga0070694_100963752 | 3300005444 | Bacteria | 707 |
| 114 | Ga0070708_100037273 | 3300005445 | Bacteria | 4241 |
| 115 | Ga0070708_100145950 | 3300005445 | Bacteria | 2198 |
| 116 | Ga0070663_100039185 | 3300005455 | Bacteria | 3310 |
| 117 | Ga0070663_100210991 | 3300005455 | Bacteria | 1520 |
| 118 | Ga0070663_100331053 | 3300005455 | Bacteria | 1227 |
| 119 | Ga0070663_100499892 | 3300005455 | Bacteria | 1009 |
| 120 | Ga0070678_100018719 | 3300005456 | Bacteria | 4495 |
| 121 | Ga0070678_100067960 | 3300005456 | Bacteria | 2655 |
| 122 | Ga0070678_100327215 | 3300005456 | Bacteria | 1310 |
| 123 | Ga0070678_100481924 | 3300005456 | Bacteria | 1091 |
| 124 | Ga0070662_100076990 | 3300005457 | Bacteria | 2474 |
| 125 | Ga0070662_100506440 | 3300005457 | Unclassified | 1007 |
| 126 | Ga0070662_101317916 | 3300005457 | Unclassified | 621 |
| 127 | Ga0070681_10088074 | 3300005458 | Bacteria | 3057 |
| 128 | Ga0070681_10093013 | 3300005458 | Bacteria | 2964 |
| 129 | Ga0068867_100062994 | 3300005459 | Bacteria | 2756 |
| 130 | Ga0068867_100119169 | 3300005459 | Bacteria | 2037 |
| 131 | Ga0068867_100656679 | 3300005459 | Unclassified | 921 |
| 132 | Ga0070685_10181102 | 3300005466 | Bacteria | 1356 |
| 133 | Ga0070685_10541427 | 3300005466 | Bacteria | 830 |
| 134 | Ga0070698_101946166 | 3300005471 | Bacteria | 541 |
| 135 | Ga0074259_11362925 | 3300005507 | Bacteria | 1555 |
| 136 | Ga0070699_100005897 | 3300005518 | Bacteria | 10705 |
| 137 | Ga0070699_100194686 | 3300005518 | Bacteria | 1801 |
| 138 | Ga0070679_100038088 | 3300005530 | Bacteria | 4780 |
| 139 | Ga0070679_100061631 | 3300005530 | Bacteria | 3739 |
| 140 | Ga0070679_100154158 | 3300005530 | Bacteria | 2273 |
| 141 | Ga0070679_100233854 | 3300005530 | Bacteria | 1797 |
| 142 | Ga0070679_100583448 | 3300005530 | Bacteria | 1061 |
| 143 | Ga0070679_100690147 | 3300005530 | Bacteria | 964 |
| 144 | Ga0070679_100992027 | 3300005530 | Bacteria | 784 |
| 145 | Ga0070684_100012243 | 3300005535 | Bacteria | 6867 |
| 146 | Ga0070684_100328229 | 3300005535 | Bacteria | 1406 |
| 147 | Ga0070684_100523459 | 3300005535 | Bacteria | 1099 |
| 148 | Ga0070697_100384820 | 3300005536 | Bacteria | 1215 |
| 149 | Ga0068853_100164993 | 3300005539 | Bacteria | 2001 |
| 150 | Ga0068853_100456273 | 3300005539 | Unclassified | 1202 |
| 151 | Ga0070672_100054936 | 3300005543 | Bacteria | 3119 |
| 152 | Ga0070686_100043359 | 3300005544 | Bacteria | 2822 |
| 153 | Ga0070686_100095576 | 3300005544 | Bacteria | 1996 |
| 154 | Ga0070686_100126201 | 3300005544 | Bacteria | 1763 |
| 155 | Ga0070686_100174243 | 3300005544 | Bacteria | 1524 |
| 156 | Ga0070686_100903650 | 3300005544 | Unclassified | 718 |
| 157 | Ga0070696_100043061 | 3300005546 | Bacteria | 3122 |
| 158 | Ga0070696_100121552 | 3300005546 | Bacteria | 1890 |
| 159 | Ga0070696_100270960 | 3300005546 | Bacteria | 1291 |
| 160 | Ga0070696_100373695 | 3300005546 | Bacteria | 1109 |
| 161 | Ga0070693_100017020 | 3300005547 | Bacteria | 3772 |
| 162 | Ga0070693_100143428 | 3300005547 | Bacteria | 1506 |
| 163 | Ga0070693_100249994 | 3300005547 | Bacteria | 1175 |
| 164 | Ga0070693_101033196 | 3300005547 | Bacteria | 623 |
| 165 | Ga0070665_100113262 | 3300005548 | Bacteria | 2715 |
| 166 | Ga0070665_100659912 | 3300005548 | Unclassified | 1059 |
| 167 | Ga0070704_100066695 | 3300005549 | Bacteria | 2596 |
| 168 | Ga0070704_100161732 | 3300005549 | Bacteria | 1771 |
| 169 | Ga0068855_100037153 | 3300005563 | Bacteria | 5794 |
| 170 | Ga0068855_100176114 | 3300005563 | Bacteria | 2420 |
| 171 | Ga0068855_100235539 | 3300005563 | Bacteria | 2047 |
| 172 | Ga0070664_100057358 | 3300005564 | Bacteria | 3310 |
| 173 | Ga0070664_100085873 | 3300005564 | Bacteria | 2718 |
| 174 | Ga0070664_100166446 | 3300005564 | Bacteria | 1953 |
| 175 | Ga0070664_100292869 | 3300005564 | Unclassified | 1470 |
| 176 | Ga0068857_100013840 | 3300005577 | Bacteria | 7025 |
| 177 | Ga0068857_100126512 | 3300005577 | Bacteria | 2303 |
| 178 | Ga0068857_101796424 | 3300005577 | Bacteria | 600 |
| 179 | Ga0068854_100087832 | 3300005578 | Bacteria | 2307 |
| 180 | Ga0068854_100097564 | 3300005578 | Bacteria | 2197 |
| 181 | Ga0068854_100158345 | 3300005578 | Bacteria | 1752 |
| 182 | Ga0068854_100907716 | 3300005578 | Unclassified | 775 |
| 183 | Ga0068856_100088266 | 3300005614 | Bacteria | 3083 |
| 184 | Ga0068856_100274858 | 3300005614 | Bacteria | 1701 |
| 185 | Ga0068856_100363144 | 3300005614 | Bacteria | 1466 |
| 186 | Ga0070702_100054242 | 3300005615 | Bacteria | 2305 |
| 187 | Ga0070702_100596093 | 3300005615 | Bacteria | 827 |
| 188 | Ga0068852_100015188 | 3300005616 | Bacteria | 5960 |
| 189 | Ga0068852_100349374 | 3300005616 | Bacteria | 1443 |
| 190 | Ga0068852_100453742 | 3300005616 | Archaea | 1269 |
| 191 | Ga0068852_100646690 | 3300005616 | Bacteria | 1064 |
| 192 | Ga0068859_100005469 | 3300005617 | Bacteria | 12924 |
| 193 | Ga0068859_100113228 | 3300005617 | Bacteria | 2777 |
| 194 | Ga0068859_100483555 | 3300005617 | Bacteria | 1334 |
| 195 | Ga0068859_100553165 | 3300005617 | Bacteria | 1245 |
| 196 | Ga0068864_100009632 | 3300005618 | Bacteria | 7970 |
| 197 | Ga0068864_100045253 | 3300005618 | Bacteria | 3775 |
| 198 | Ga0068864_100376630 | 3300005618 | Bacteria | 1344 |
| 199 | Ga0068866_10051280 | 3300005718 | Bacteria | 2100 |
| 200 | Ga0068861_100045116 | 3300005719 | Bacteria | 3317 |
| 201 | Ga0068861_100457870 | 3300005719 | Bacteria | 1144 |
| 202 | Ga0068851_11091743 | 3300005834 | Unclassified | 506 |
| 203 | Ga0068870_10001851 | 3300005840 | Bacteria | 8702 |
| 204 | Ga0068870_10016871 | 3300005840 | Bacteria | 3500 |
| 205 | Ga0068863_100013874 | 3300005841 | Bacteria | 7768 |
| 206 | Ga0068858_100031941 | 3300005842 | Bacteria | 4891 |
| 207 | Ga0068858_100141055 | 3300005842 | Bacteria | 2262 |
| 208 | Ga0068858_100380510 | 3300005842 | Unclassified | 1354 |
| 209 | Ga0068858_100937989 | 3300005842 | Unclassified | 847 |
| 210 | Ga0068860_100042871 | 3300005843 | Bacteria | 4318 |
| 211 | Ga0068860_100130436 | 3300005843 | Bacteria | 2412 |
| 212 | Ga0068860_100308868 | 3300005843 | Bacteria | 1550 |
| 213 | Ga0068862_100027421 | 3300005844 | Bacteria | 4794 |
| 214 | Ga0068862_100056632 | 3300005844 | Bacteria | 3359 |
| 215 | Ga0068862_100871572 | 3300005844 | Unclassified | 883 |
| 216 | Ga0081455_10000404 | 3300005937 | Bacteria | 56788 |
| 217 | Ga0081455_10018650 | 3300005937 | Bacteria | 6594 |
| 218 | Ga0081455_10039290 | 3300005937 | Bacteria | 4184 |
| 219 | Ga0081455_10107538 | 3300005937 | Bacteria | 2223 |
| 220 | Ga0081455_10115838 | 3300005937 | Bacteria | 2121 |
| 221 | Ga0081455_10128263 | 3300005937 | Bacteria | 1987 |
| 222 | Ga0081538_10040213 | 3300005981 | Bacteria | 2986 |
| 223 | Ga0081538_10102975 | 3300005981 | Bacteria | 1430 |
| 224 | Ga0081540_1074288 | 3300005983 | Bacteria | 1558 |
| 225 | Ga0081540_1088610 | 3300005983 | Bacteria | 1368 |
| 226 | Ga0081540_1208341 | 3300005983 | Unclassified | 705 |
| 227 | Ga0081539_10031957 | 3300005985 | Bacteria | 3232 |
| 228 | Ga0070717_10011726 | 3300006028 | Bacteria | 6669 |
| 229 | Ga0070717_11046349 | 3300006028 | Unclassified | 743 |
| 230 | Ga0075365_10097082 | 3300006038 | Bacteria | 2014 |
| 231 | Ga0075365_10161758 | 3300006038 | Bacteria | 1560 |
| 232 | Ga0075365_10312417 | 3300006038 | Bacteria | 1106 |
| 233 | Ga0075365_10383521 | 3300006038 | Bacteria | 991 |
| 234 | Ga0075432_10002316 | 3300006058 | Bacteria | 6338 |
| 235 | Ga0075432_10125745 | 3300006058 | Bacteria | 967 |
| 236 | Ga0070715_10025105 | 3300006163 | Bacteria | 2356 |
| 237 | Ga0070715_10039045 | 3300006163 | Bacteria | 1975 |
| 238 | Ga0070716_100045408 | 3300006173 | Bacteria | 2466 |
| 239 | Ga0070716_100736086 | 3300006173 | Unclassified | 757 |
| 240 | Ga0070712_100016939 | 3300006175 | Bacteria | 4712 |
| 241 | Ga0070712_100063746 | 3300006175 | Bacteria | 2611 |
| 242 | Ga0070712_100123074 | 3300006175 | Bacteria | 1955 |
| 243 | Ga0075362_10291952 | 3300006177 | Bacteria | 808 |
| 244 | Ga0075362_10347715 | 3300006177 | Bacteria | 742 |
| 245 | Ga0075367_10278376 | 3300006178 | Bacteria | 1051 |
| 246 | Ga0075367_10506592 | 3300006178 | Unclassified | 766 |
| 247 | Ga0075367_10636358 | 3300006178 | Unclassified | 678 |
| 248 | Ga0075369_10287970 | 3300006186 | Bacteria | 766 |
| 249 | Ga0097621_100107279 | 3300006237 | Bacteria | 2356 |
| 250 | Ga0097621_100184118 | 3300006237 | Bacteria | 1806 |
| 251 | Ga0075370_10023759 | 3300006353 | Bacteria | 3380 |
| 252 | Ga0075428_100014827 | 3300006844 | Bacteria | 8662 |
| 253 | Ga0075428_100124917 | 3300006844 | Bacteria | 2800 |
| 254 | Ga0075428_100253736 | 3300006844 | Bacteria | 1895 |
| 255 | Ga0075430_100013770 | 3300006846 | Bacteria | 6890 |
| 256 | Ga0075430_100054076 | 3300006846 | Bacteria | 3378 |
| 257 | Ga0075431_100008339 | 3300006847 | Bacteria | 10365 |
| 258 | Ga0075431_100028947 | 3300006847 | Bacteria | 5696 |
| 259 | Ga0075431_100084770 | 3300006847 | Bacteria | 3271 |
| 260 | Ga0075431_100151984 | 3300006847 | Bacteria | 2383 |
| 261 | Ga0075431_101144190 | 3300006847 | Bacteria | 742 |
| 262 | Ga0075431_101642466 | 3300006847 | Unclassified | 600 |
| 263 | Ga0075433_10006454 | 3300006852 | Bacteria | 9276 |
| 264 | Ga0075433_10067581 | 3300006852 | Bacteria | 3137 |
| 265 | Ga0075434_100006422 | 3300006871 | Bacteria | 10772 |
| 266 | Ga0075434_100045654 | 3300006871 | Bacteria | 4346 |
| 267 | Ga0075434_100087664 | 3300006871 | Bacteria | 3113 |
| 268 | Ga0075434_100191392 | 3300006871 | Bacteria | 2066 |
| 269 | Ga0075434_100237005 | 3300006871 | Bacteria | 1844 |
| 270 | Ga0075434_100894648 | 3300006871 | Bacteria | 903 |
| 271 | Ga0075434_102025052 | 3300006871 | Bacteria | 581 |
| 272 | Ga0075429_100020613 | 3300006880 | Bacteria | 5721 |
| 273 | Ga0075429_100140361 | 3300006880 | Bacteria | 2115 |
| 274 | Ga0075429_100309528 | 3300006880 | Bacteria | 1383 |
| 275 | Ga0075429_100335747 | 3300006880 | Bacteria | 1323 |
| 276 | Ga0075429_100471954 | 3300006880 | Unclassified | 1099 |
| 277 | Ga0068865_100038002 | 3300006881 | Bacteria | 3255 |
| 278 | Ga0068865_100218954 | 3300006881 | Bacteria | 1487 |
| 279 | Ga0068865_100455315 | 3300006881 | Bacteria | 1059 |
| 280 | Ga0075436_100103436 | 3300006914 | Bacteria | 1985 |
| 281 | Ga0075436_100224943 | 3300006914 | Bacteria | 1332 |
| 282 | Ga0075436_100279100 | 3300006914 | Unclassified | 1194 |
| 283 | Ga0097620_100005469 | 3300006931 | Bacteria | 12924 |
| 284 | Ga0097620_100113222 | 3300006931 | Bacteria | 2777 |
| 285 | Ga0097620_100483568 | 3300006931 | Bacteria | 1334 |
| 286 | Ga0097620_100553163 | 3300006931 | Bacteria | 1245 |
| 287 | Ga0075435_100005128 | 3300007076 | Bacteria | 9105 |
| 288 | Ga0075435_100084633 | 3300007076 | Bacteria | 2610 |
| 289 | Ga0075435_100120750 | 3300007076 | Bacteria | 2187 |
| 290 | Ga0075435_100214658 | 3300007076 | Bacteria | 1633 |
| 291 | Ga0075435_101133901 | 3300007076 | Bacteria | 684 |
| 292 | Ga0099794_10028981 | 3300007265 | Bacteria | 2577 |
| 293 | Ga0105251_10051680 | 3300009011 | Bacteria | 1959 |
| 294 | Ga0105251_10245641 | 3300009011 | Bacteria | 806 |
| 295 | Ga0105240_10151222 | 3300009093 | Bacteria | 2764 |
| 296 | Ga0111539_10001349 | 3300009094 | Bacteria | 32670 |
| 297 | Ga0111539_10018218 | 3300009094 | Bacteria | 8697 |
| 298 | Ga0111539_10159265 | 3300009094 | Bacteria | 2641 |
| 299 | Ga0111539_10255867 | 3300009094 | Bacteria | 2039 |
| 300 | Ga0111539_10883233 | 3300009094 | Bacteria | 1040 |
| 301 | Ga0111539_11877561 | 3300009094 | Unclassified | 695 |
| 302 | Ga0111539_12138184 | 3300009094 | Unclassified | 649 |
| 303 | Ga0105245_10036366 | 3300009098 | Bacteria | 4374 |
| 304 | Ga0105245_10066484 | 3300009098 | Bacteria | 3263 |
| 305 | Ga0105247_10011736 | 3300009101 | Bacteria | 5269 |
| 306 | Ga0105247_10026758 | 3300009101 | Bacteria | 3486 |
| 307 | Ga0114129_10023892 | 3300009147 | Bacteria | 8662 |
| 308 | Ga0114129_10026898 | 3300009147 | Bacteria | 8144 |
| 309 | Ga0114129_10156190 | 3300009147 | Bacteria | 3119 |
| 310 | Ga0114129_10231119 | 3300009147 | Bacteria | 2491 |
| 311 | Ga0114129_10785724 | 3300009147 | Unclassified | 1216 |
| 312 | Ga0114129_11252749 | 3300009147 | Unclassified | 921 |
| 313 | Ga0105243_10076814 | 3300009148 | Bacteria | 2715 |
| 314 | Ga0105243_10226906 | 3300009148 | Bacteria | 1654 |
| 315 | Ga0105243_10318838 | 3300009148 | Bacteria | 1415 |
| 316 | Ga0105241_10875270 | 3300009174 | Bacteria | 832 |
| 317 | Ga0105242_10049159 | 3300009176 | Bacteria | 3431 |
| 318 | Ga0105248_10020176 | 3300009177 | Bacteria | 7383 |
| 319 | Ga0105248_10026619 | 3300009177 | Bacteria | 6432 |
| 320 | Ga0105248_10030985 | 3300009177 | Bacteria | 5976 |
| 321 | Ga0105248_13042612 | 3300009177 | Unclassified | 534 |
| 322 | Ga0105237_10011839 | 3300009545 | Bacteria | 9226 |
| 323 | Ga0105237_10601647 | 3300009545 | Bacteria | 1107 |
| 324 | Ga0105238_10139710 | 3300009551 | Bacteria | 2399 |
| 325 | Ga0105238_10702427 | 3300009551 | Bacteria | 1023 |
| 326 | Ga0105249_10007332 | 3300009553 | Bacteria | 9614 |
| 327 | Ga0105249_10186540 | 3300009553 | Bacteria | 2021 |
| 328 | Ga0105249_10923002 | 3300009553 | Unclassified | 940 |
| 329 | Ga0105239_10035238 | 3300010375 | Bacteria | 5497 |
| 330 | Ga0105239_10263644 | 3300010375 | Bacteria | 1937 |
| 331 | Ga0105239_11401061 | 3300010375 | Bacteria | 807 |
| 332 | Ga0105246_10005348 | 3300011119 | Bacteria | 7815 |
| 333 | Ga0105246_10127169 | 3300011119 | Bacteria | 1898 |
| 334 | Ga0105246_10169954 | 3300011119 | Bacteria | 1669 |
| 335 | Ga0105246_10912417 | 3300011119 | Unclassified | 789 |
| 336 | Ga0157320_1000205 | 3300012481 | Bacteria | 2017 |
| 337 | Ga0157325_1001937 | 3300012485 | Bacteria | 1006 |
| 338 | Ga0157339_1013360 | 3300012505 | Unclassified | 784 |
| 339 | Ga0157338_1001673 | 3300012515 | Unclassified | 1628 |
| 340 | Ga0157371_10023549 | 3300013102 | Bacteria | 4503 |
| 341 | Ga0157371_10066573 | 3300013102 | Bacteria | 2551 |
| 342 | Ga0157371_10105040 | 3300013102 | Bacteria | 2004 |
| 343 | Ga0157371_11469291 | 3300013102 | Bacteria | 531 |
| 344 | Ga0157370_10024394 | 3300013104 | Bacteria | 5990 |
| 345 | Ga0157370_10783655 | 3300013104 | Bacteria | 868 |
| 346 | Ga0157369_10086450 | 3300013105 | Bacteria | 3349 |
| 347 | Ga0157369_11468335 | 3300013105 | Unclassified | 694 |
| 348 | Ga0157374_10191223 | 3300013296 | Bacteria | 2002 |
| 349 | Ga0157374_10999710 | 3300013296 | Bacteria | 855 |
| 350 | Ga0157378_10338162 | 3300013297 | Bacteria | 1467 |
| 351 | Ga0163162_10945357 | 3300013306 | Bacteria | 973 |
| 352 | Ga0163162_11193537 | 3300013306 | Bacteria | 863 |
| 353 | Ga0157372_10344753 | 3300013307 | Bacteria | 1735 |
| 354 | Ga0157372_12049658 | 3300013307 | Unclassified | 657 |
| 355 | Ga0157375_10052064 | 3300013308 | Bacteria | 4023 |
| 356 | Ga0157375_10365309 | 3300013308 | Bacteria | 1609 |
| 357 | Ga0163163_10000318 | 3300014325 | Bacteria | 46911 |
| 358 | Ga0163163_10108737 | 3300014325 | Bacteria | 2800 |
| 359 | Ga0163163_10111084 | 3300014325 | Bacteria | 2770 |
| 360 | Ga0163163_10196161 | 3300014325 | Bacteria | 2067 |
| 361 | Ga0163163_10585805 | 3300014325 | Bacteria | 1178 |
| 362 | Ga0157380_10216890 | 3300014326 | Bacteria | 1709 |
| 363 | Ga0157380_10395488 | 3300014326 | Bacteria | 1309 |
| 364 | Ga0157380_10974207 | 3300014326 | Bacteria | 880 |
| 365 | Ga0157380_11771925 | 3300014326 | Unclassified | 676 |
| 366 | Ga0182008_10199091 | 3300014497 | Bacteria | 1019 |
| 367 | Ga0157377_10078754 | 3300014745 | Bacteria | 1921 |
| 368 | Ga0157377_10147848 | 3300014745 | Bacteria | 1450 |
| 369 | Ga0157377_10588104 | 3300014745 | Bacteria | 792 |
| 370 | Ga0157379_10044911 | 3300014968 | Bacteria | 3944 |
| 371 | Ga0157379_10297320 | 3300014968 | Bacteria | 1471 |
| 372 | Ga0157379_10366131 | 3300014968 | Bacteria | 1321 |
| 373 | Ga0157379_10823343 | 3300014968 | Bacteria | 877 |
| 374 | Ga0157379_10920823 | 3300014968 | Unclassified | 830 |
| 375 | Ga0157376_10113291 | 3300014969 | Bacteria | 2391 |
| 376 | Ga0157376_10617936 | 3300014969 | Bacteria | 1080 |
| 377 | Ga0157376_11650168 | 3300014969 | Bacteria | 676 |
| 378 | Ga0163161_10034359 | 3300017792 | Bacteria | 3627 |
| 379 | Ga0163161_10192247 | 3300017792 | Bacteria | 1570 |
| 380 | Ga0197907_10268439 | 3300020069 | Bacteria | 538 |
| 381 | Ga0206356_11092613 | 3300020070 | Bacteria | 789 |
| 382 | Ga0206353_10292301 | 3300020082 | Unclassified | 844 |
| 383 | Ga0206353_10486689 | 3300020082 | Bacteria | 2288 |
| 384 | Ga0206353_11607177 | 3300020082 | Bacteria | 885 |
| 385 | Ga0213876_10036889 | 3300021384 | Bacteria | 2579 |
| 386 | Ga0224712_10584784 | 3300022467 | Unclassified | 544 |
| 387 | Ga0207673_1000103 | 3300025290 | Bacteria | 7639 |
| 388 | Ga0207697_10030709 | 3300025315 | Bacteria | 2198 |
| 389 | Ga0207653_10004967 | 3300025885 | Bacteria | 4154 |
| 390 | Ga0207653_10070795 | 3300025885 | Unclassified | 1192 |
| 391 | Ga0207682_10054890 | 3300025893 | Bacteria | 1656 |
| 392 | Ga0207692_10047479 | 3300025898 | Bacteria | 2156 |
| 393 | Ga0207692_10183562 | 3300025898 | Bacteria | 1220 |
| 394 | Ga0207642_10021833 | 3300025899 | Bacteria | 2527 |
| 395 | Ga0207642_10805281 | 3300025899 | Unclassified | 598 |
| 396 | Ga0207710_10065426 | 3300025900 | Bacteria | 1657 |
| 397 | Ga0207710_10164362 | 3300025900 | Bacteria | 1083 |
| 398 | Ga0207688_10001502 | 3300025901 | Bacteria | 12242 |
| 399 | Ga0207680_10226533 | 3300025903 | Bacteria | 1283 |
| 400 | Ga0207680_10362134 | 3300025903 | Bacteria | 1020 |
| 401 | Ga0207647_10002513 | 3300025904 | Bacteria | 13884 |
| 402 | Ga0207647_10161487 | 3300025904 | Bacteria | 1307 |
| 403 | Ga0207685_10405426 | 3300025905 | Unclassified | 700 |
| 404 | Ga0207643_10089901 | 3300025908 | Bacteria | 1789 |
| 405 | Ga0207705_10031451 | 3300025909 | Bacteria | 3789 |
| 406 | Ga0207705_10379119 | 3300025909 | Bacteria | 1092 |
| 407 | Ga0207654_10015859 | 3300025911 | Bacteria | 3917 |
| 408 | Ga0207707_10036443 | 3300025912 | Bacteria | 4300 |
| 409 | Ga0207707_10049562 | 3300025912 | Bacteria | 3659 |
| 410 | Ga0207707_10091347 | 3300025912 | Bacteria | 2661 |
| 411 | Ga0207707_10204578 | 3300025912 | Bacteria | 1721 |
| 412 | Ga0207707_10297255 | 3300025912 | Unclassified | 1397 |
| 413 | Ga0207695_10116458 | 3300025913 | Bacteria | 2646 |
| 414 | Ga0207671_10104015 | 3300025914 | Bacteria | 2154 |
| 415 | Ga0207671_10350846 | 3300025914 | Bacteria | 1170 |
| 416 | Ga0207693_10011489 | 3300025915 | Bacteria | 7162 |
| 417 | Ga0207693_10036204 | 3300025915 | Bacteria | 3890 |
| 418 | Ga0207693_10036211 | 3300025915 | Bacteria | 3889 |
| 419 | Ga0207693_10120732 | 3300025915 | Bacteria | 2058 |
| 420 | Ga0207660_10034851 | 3300025917 | Bacteria | 3491 |
| 421 | Ga0207660_10053310 | 3300025917 | Bacteria | 2882 |
| 422 | Ga0207660_10073540 | 3300025917 | Bacteria | 2492 |
| 423 | Ga0207660_10145273 | 3300025917 | Bacteria | 1817 |
| 424 | Ga0207660_10348405 | 3300025917 | Bacteria | 1187 |
| 425 | Ga0207660_10424775 | 3300025917 | Unclassified | 1072 |
| 426 | Ga0207662_10009038 | 3300025918 | Bacteria | 5473 |
| 427 | Ga0207657_10006553 | 3300025919 | Bacteria | 12055 |
| 428 | Ga0207657_10047597 | 3300025919 | Bacteria | 3747 |
| 429 | Ga0207657_10057406 | 3300025919 | Bacteria | 3354 |
| 430 | Ga0207657_10364350 | 3300025919 | Bacteria | 1139 |
| 431 | Ga0207649_10001009 | 3300025920 | Bacteria | 17378 |
| 432 | Ga0207652_10041370 | 3300025921 | Bacteria | 3917 |
| 433 | Ga0207652_10190922 | 3300025921 | Bacteria | 1842 |
| 434 | Ga0207652_10239087 | 3300025921 | Bacteria | 1637 |
| 435 | Ga0207652_10278245 | 3300025921 | Bacteria | 1510 |
| 436 | Ga0207652_10369717 | 3300025921 | Bacteria | 1294 |
| 437 | Ga0207652_10601686 | 3300025921 | Bacteria | 986 |
| 438 | Ga0207646_10216621 | 3300025922 | Bacteria | 1729 |
| 439 | Ga0207681_10018419 | 3300025923 | Bacteria | 4399 |
| 440 | Ga0207681_10096010 | 3300025923 | Bacteria | 2127 |
| 441 | Ga0207681_10503672 | 3300025923 | Bacteria | 992 |
| 442 | Ga0207681_10545815 | 3300025923 | Unclassified | 953 |
| 443 | Ga0207694_10083753 | 3300025924 | Bacteria | 2508 |
| 444 | Ga0207694_10916501 | 3300025924 | Unclassified | 741 |
| 445 | Ga0207650_10036047 | 3300025925 | Bacteria | 3597 |
| 446 | Ga0207650_10141495 | 3300025925 | Bacteria | 1892 |
| 447 | Ga0207659_10115184 | 3300025926 | Bacteria | 2050 |
| 448 | Ga0207659_10136727 | 3300025926 | Bacteria | 1898 |
| 449 | Ga0207687_10006543 | 3300025927 | Bacteria | 7694 |
| 450 | Ga0207700_10066229 | 3300025928 | Bacteria | 2760 |
| 451 | Ga0207664_10076178 | 3300025929 | Bacteria | 2714 |
| 452 | Ga0207664_10270524 | 3300025929 | Bacteria | 1488 |
| 453 | Ga0207644_10434868 | 3300025931 | Unclassified | 1076 |
| 454 | Ga0207644_11649637 | 3300025931 | Bacteria | 537 |
| 455 | Ga0207690_10015532 | 3300025932 | Bacteria | 4615 |
| 456 | Ga0207690_10042069 | 3300025932 | Bacteria | 2998 |
| 457 | Ga0207690_10874433 | 3300025932 | Unclassified | 745 |
| 458 | Ga0207709_10012890 | 3300025935 | Bacteria | 4610 |
| 459 | Ga0207670_10005976 | 3300025936 | Bacteria | 6723 |
| 460 | Ga0207670_10286623 | 3300025936 | Bacteria | 1285 |
| 461 | Ga0207669_10013484 | 3300025937 | Bacteria | 4060 |
| 462 | Ga0207669_10111644 | 3300025937 | Bacteria | 1833 |
| 463 | Ga0207669_10265018 | 3300025937 | Bacteria | 1287 |
| 464 | Ga0207704_10052785 | 3300025938 | Bacteria | 2466 |
| 465 | Ga0207665_10045359 | 3300025939 | Bacteria | 2944 |
| 466 | Ga0207665_10691971 | 3300025939 | Bacteria | 801 |
| 467 | Ga0207691_10126738 | 3300025940 | Bacteria | 2258 |
| 468 | Ga0207711_10038522 | 3300025941 | Bacteria | 4066 |
| 469 | Ga0207711_10049627 | 3300025941 | Bacteria | 3593 |
| 470 | Ga0207661_10000500 | 3300025944 | Bacteria | 25254 |
| 471 | Ga0207661_10038404 | 3300025944 | Bacteria | 3753 |
| 472 | Ga0207679_10000073 | 3300025945 | Bacteria | 89687 |
| 473 | Ga0207679_10121415 | 3300025945 | Bacteria | 2081 |
| 474 | Ga0207679_10164034 | 3300025945 | Bacteria | 1822 |
| 475 | Ga0207679_11255513 | 3300025945 | Unclassified | 680 |
| 476 | Ga0207667_10156921 | 3300025949 | Bacteria | 2341 |
| 477 | Ga0207667_10293159 | 3300025949 | Bacteria | 1662 |
| 478 | Ga0207651_10004037 | 3300025960 | Bacteria | 7306 |
| 479 | Ga0207712_10099138 | 3300025961 | Bacteria | 2163 |
| 480 | Ga0207712_10188502 | 3300025961 | Bacteria | 1626 |
| 481 | Ga0207668_10051474 | 3300025972 | Bacteria | 2844 |
| 482 | Ga0207668_10102250 | 3300025972 | Bacteria | 2132 |
| 483 | Ga0207668_10224167 | 3300025972 | Bacteria | 1511 |
| 484 | Ga0207668_10589823 | 3300025972 | Bacteria | 967 |
| 485 | Ga0207668_11706853 | 3300025972 | Unclassified | 568 |
| 486 | Ga0207640_10002641 | 3300025981 | Bacteria | 9600 |
| 487 | Ga0207640_10034940 | 3300025981 | Bacteria | 3141 |
| 488 | Ga0207658_10035001 | 3300025986 | Bacteria | 3594 |
| 489 | Ga0207658_10312512 | 3300025986 | Unclassified | 1358 |
| 490 | Ga0207677_10014893 | 3300026023 | Bacteria | 4556 |
| 491 | Ga0207703_10013981 | 3300026035 | Bacteria | 6257 |
| 492 | Ga0207703_10055498 | 3300026035 | Bacteria | 3223 |
| 493 | Ga0207703_10734487 | 3300026035 | Bacteria | 940 |
| 494 | Ga0207639_10035494 | 3300026041 | Bacteria | 3690 |
| 495 | Ga0207639_10909355 | 3300026041 | Bacteria | 823 |
| 496 | Ga0207678_10056143 | 3300026067 | Bacteria | 3391 |
| 497 | Ga0207708_10266496 | 3300026075 | Unclassified | 1384 |
| 498 | Ga0207702_10006076 | 3300026078 | Bacteria | 10472 |
| 499 | Ga0207702_10183852 | 3300026078 | Bacteria | 1927 |
| 500 | Ga0207702_10273031 | 3300026078 | Bacteria | 1595 |
| 501 | Ga0207641_10184795 | 3300026088 | Bacteria | 1911 |
| 502 | Ga0207641_10199366 | 3300026088 | Bacteria | 1844 |
| 503 | Ga0207648_10173078 | 3300026089 | Bacteria | 1909 |
| 504 | Ga0207676_10006437 | 3300026095 | Bacteria | 8295 |
| 505 | Ga0207676_10241413 | 3300026095 | Bacteria | 1621 |
| 506 | Ga0207674_10033677 | 3300026116 | Bacteria | 5362 |
| 507 | Ga0207674_10134742 | 3300026116 | Bacteria | 2432 |
| 508 | Ga0207675_100207746 | 3300026118 | Bacteria | 1882 |
| 509 | Ga0207675_100436048 | 3300026118 | Unclassified | 1296 |
| 510 | Ga0207683_10106902 | 3300026121 | Bacteria | 2503 |
| 511 | Ga0207698_10055877 | 3300026142 | Bacteria | 3045 |
| 512 | Ga0207698_10258164 | 3300026142 | Bacteria | 1599 |
| 513 | Ga0207698_11642420 | 3300026142 | Unclassified | 658 |
| 514 | Ga0209996_1021857 | 3300027395 | Bacteria | 903 |
| 515 | Ga0209984_1052135 | 3300027424 | Unclassified | 599 |
| 516 | Ga0209970_1045951 | 3300027614 | Unclassified | 783 |
| 517 | Ga0210002_1004812 | 3300027617 | Bacteria | 2015 |
| 518 | Ga0209971_1115263 | 3300027682 | Bacteria | 660 |
| 519 | Ga0209966_1001929 | 3300027695 | Bacteria | 3483 |
| 520 | Ga0209998_10002879 | 3300027717 | Bacteria | 3860 |
| 521 | Ga0209998_10006315 | 3300027717 | Bacteria | 2463 |
| 522 | Ga0209974_10002818 | 3300027876 | Bacteria | 6310 |
| 523 | Ga0207428_10001432 | 3300027907 | Bacteria | 25078 |
| 524 | Ga0207428_10005007 | 3300027907 | Bacteria | 12458 |
| 525 | Ga0207428_10034138 | 3300027907 | Bacteria | 4172 |
| 526 | Ga0207428_10953096 | 3300027907 | Unclassified | 604 |
| 527 | Ga0268266_10444699 | 3300028379 | Bacteria | 1231 |
| 528 | Ga0268265_10073775 | 3300028380 | Bacteria | 2666 |
| 529 | Ga0268265_10357073 | 3300028380 | Bacteria | 1336 |
| 530 | Ga0268264_10027537 | 3300028381 | Bacteria | 4645 |
| 531 | Ga0265338_10051458 | 3300028800 | Bacteria | 3708 |
| 532 | Ga0265332_10159996 | 3300031238 | Bacteria | 941 |
| 533 | Ga0265325_10000004 | 3300031241 | Bacteria | 347347 |
| 534 | Ga0265339_10072487 | 3300031249 | Bacteria | 1833 |
| 535 | Ga0265313_10093881 | 3300031595 | Bacteria | 1342 |
| 536 | Ga0265313_10105339 | 3300031595 | Unclassified | 1246 |
| 537 | Ga0265313_10136649 | 3300031595 | Bacteria | 1057 |
| 538 | Ga0265313_10275746 | 3300031595 | Bacteria | 680 |
| 539 | Ga0316575_10037644 | 3300031665 | Unclassified | 1906 |
| 540 | Ga0316575_10095740 | 3300031665 | Bacteria | 1205 |
| 541 | Ga0316579_10065763 | 3300031691 | Bacteria | 1711 |
| 542 | Ga0316583_10025555 | 3300032133 | Bacteria | 2109 |
| 543 | Ga0373930_0003251 | 3300034816 | Bacteria | 2569 |
| 544 | Ga0373948_0011244 | 3300034817 | Bacteria | 1578 |
| 545 | Ga0373958_0001455 | 3300034819 | Bacteria | 3188 |
| 546 | Ga0373959_0005113 | 3300034820 | Bacteria | 2145 |
| 547 | Ga0373959_0036516 | 3300034820 | Unclassified | 1014 |
| 548 | Ga0373938_0002185 | 3300034957 | Bacteria | 3140 |
| 549 | Ga0373938_0007073 | 3300034957 | Bacteria | 1963 |
| 550 | Ga0373926_0065812 | 3300035083 | Bacteria | 1326 |
| 551 | Ga0373928_0007812 | 3300035084 | Bacteria | 2069 |
| 552 | Ga0373929_0000248 | 3300035085 | Bacteria | 9932 |
| 553 | Ga0373940_0000098 | 3300035088 | Bacteria | 10456 |
| 554 | Ga0373940_0010425 | 3300035088 | Bacteria | 2184 |
| 555 | Ga0373944_0002451 | 3300035089 | Bacteria | 4716 |
| 556 | Ga0373944_0002775 | 3300035089 | Bacteria | 4480 |
| 557 | Ga0373944_0028419 | 3300035089 | Bacteria | 1664 |
| 558 | Ga0373949_0286354 | 3300035090 | Unclassified | 519 |
| 559 | Ga0373951_0004830 | 3300035091 | Bacteria | 3172 |
| 560 | Ga0373923_0004618 | 3300035111 | Bacteria | 4586 |
| 561 | Ga0373923_0194504 | 3300035111 | Bacteria | 936 |
| 562 | Ga0373932_0000586 | 3300035112 | Bacteria | 11105 |
| 563 | Ga0373936_0032686 | 3300035113 | Bacteria | 2059 |
| 564 | Ga0373939_0000650 | 3300035114 | Bacteria | 8639 |
| 565 | Ga0373939_0013752 | 3300035114 | Bacteria | 2088 |
| 566 | Ga0373941_0000197 | 3300035115 | Bacteria | 11482 |
| 567 | Ga0373945_0001528 | 3300035116 | Bacteria | 7075 |
| 568 | Ga0373945_0061049 | 3300035116 | Unclassified | 1407 |
| 569 | Ga0373953_0222150 | 3300035117 | Bacteria | 818 |
| 570 | Ga0373954_0007450 | 3300035118 | Bacteria | 4789 |
| 571 | Ga0373954_0034662 | 3300035118 | Bacteria | 2339 |
| 572 | Ga0373954_0316513 | 3300035118 | Bacteria | 770 |
| 573 | Ga0373956_0008167 | 3300035119 | Bacteria | 4235 |
| 574 | Ga0373956_0008980 | 3300035119 | Bacteria | 4054 |
| 575 | Ga0373956_0119895 | 3300035119 | Bacteria | 1228 |
| 576 | Ga0373957_0004466 | 3300035120 | Bacteria | 4257 |
| 577 | Ga0373957_0014018 | 3300035120 | Bacteria | 2733 |
| 578 | Ga0373960_0005113 | 3300035121 | Bacteria | 3024 |
| 579 | Ga0373960_0024905 | 3300035121 | Bacteria | 1622 |
| 580 | Ga0373943_0007905 | 3300035170 | Bacteria | 4773 |
| 581 | Ga0373943_0026367 | 3300035170 | Bacteria | 2722 |
| 582 | Ga0373946_0019720 | 3300035171 | Bacteria | 2600 |
| 583 | Ga0373946_0044630 | 3300035171 | Bacteria | 1830 |
| 584 | Ga0373946_0623215 | 3300035171 | Unclassified | 560 |
| 585 | Ga0373955_0004448 | 3300035172 | Bacteria | 6210 |
| 586 | Ga0373955_0022485 | 3300035172 | Bacteria | 3199 |
| 587 | Ga0373955_0026739 | 3300035172 | Bacteria | 2976 |
| 588 | Ga0373942_0001180 | 3300035207 | Bacteria | 6905 |
| 589 | Ga0373961_0012280 | 3300035241 | Bacteria | 2141 |
| 590 | Ga0373961_0014929 | 3300035241 | Bacteria | 1978 |
| 591 | Ga0373961_0144846 | 3300035241 | Bacteria | 805 |
| 592 | Ga0373962_0055096 | 3300035242 | Unclassified | 1154 |
| 593 | Ga0373924_0054336 | 3300035410 | Bacteria | 1665 |
| 594 | Ga0373924_0233936 | 3300035410 | Unclassified | 812 |
| 595 | Ga0373924_0358272 | 3300035410 | Bacteria | 650 |
| 596 | Ga0373931_0034901 | 3300035691 | Bacteria | 2613 |
| 597 | Ga0373931_0443486 | 3300035691 | Bacteria | 829 |
| 598 | Ga0373935_0005520 | 3300035692 | Bacteria | 7449 |
| 599 | Ga0373935_0010567 | 3300035692 | Bacteria | 5539 |
| 600 | Ga0373935_0097129 | 3300035692 | Bacteria | 1937 |
| 601 | Ga0373935_0221126 | 3300035692 | Bacteria | 1315 |
| 602 | Ga0373935_0816457 | 3300035692 | Unclassified | 689 |
| 603 | Ga0373927_0013207 | 3300035695 | Bacteria | 5492 |
| 604 | Ga0373927_0022447 | 3300035695 | Bacteria | 4134 |
| 605 | Ga0373927_0069057 | 3300035695 | Bacteria | 2287 |
| 606 | Ga0373933_0003227 | 3300035724 | Bacteria | 9105 |
| 607 | Ga0373933_0036360 | 3300035724 | Bacteria | 2882 |
| 608 | Ga0373933_0176811 | 3300035724 | Bacteria | 1360 |
| 609 | Ga0373933_0263155 | 3300035724 | Bacteria | 1112 |
| 610 | Ga0373947_0010385 | 3300035725 | Bacteria | 5342 |
| 611 | Ga0373947_0085165 | 3300035725 | Bacteria | 1963 |
| 612 | Ga0373947_0111766 | 3300035725 | Bacteria | 1727 |
| 613 | Ga0373937_0005224 | 3300036401 | Bacteria | 11093 |
| 614 | Ga0373937_0011749 | 3300036401 | Bacteria | 7681 |
| 615 | Ga0373937_0029334 | 3300036401 | Bacteria | 4982 |
| 616 | Ga0373937_0136429 | 3300036401 | Bacteria | 2294 |
| 617 | Ga0373937_0591569 | 3300036401 | Unclassified | 1053 |
| 618 | Ga0316582_0163815 | 3300036647 | Bacteria | 1507 |
| 619 | Ga0373925_0026613 | 3300037068 | Bacteria | 4232 |
| 620 | Ga0373925_0033142 | 3300037068 | Bacteria | 3807 |
| 621 | Ga0373925_1466591 | 3300037068 | Unclassified | 558 |
| 622 | Ga0395899_0007490 | 3300037312 | Bacteria | 8431 |
| 623 | Ga0395899_0174593 | 3300037312 | Bacteria | 1512 |
| 624 | Ga0395899_0561818 | 3300037312 | Unclassified | 732 |
| 625 | Ga0395900_0005278 | 3300037418 | Bacteria | 13545 |
| 626 | Ga0395900_0008706 | 3300037418 | Bacteria | 10423 |
| 627 | Ga0395898_0061586 | 3300037466 | Bacteria | 3645 |
| 628 | Ga0395898_0129749 | 3300037466 | Bacteria | 2415 |
| 629 | Ga0395901_0065832 | 3300038443 | Bacteria | 3774 |
| 630 | Ga0395901_0109688 | 3300038443 | Bacteria | 2897 |
| 631 | Ga0395901_0190092 | 3300038443 | Bacteria | 2153 |
| 632 | Ga0395901_0298607 | 3300038443 | Bacteria | 1670 |
| 633 | Ga0242420_025770 | 3300038996 | Unclassified | 1070 |
| 634 | Ga0436365_1542655 | 3300039437 | Bacteria | 11188 |
| 635 | Ga0436365_1905880 | 3300039437 | Bacteria | 1282 |
| 636 | Ga0436361_0854854 | 3300039447 | Bacteria | 5402 |
| 637 | Ga0436363_1259660 | 3300039450 | Bacteria | 6844 |
| 638 | Ga0436363_1294438 | 3300039450 | Bacteria | 1507 |
| 639 | Ga0436362_1300628 | 3300039453 | Bacteria | 2829 |
| 640 | Ga0439448_0033718 | 3300042005 | Bacteria | 1634 |
| 641 | Ga0439444_0049838 | 3300042437 | Bacteria | 848 |
| 642 | Ga0439464_0036523 | 3300042439 | Bacteria | 1390 |
| 643 | Ga0439460_0055594 | 3300042461 | Bacteria | 1197 |
| 644 | Ga0466966_0388143 | 3300044684 | Unclassified | 839 |
| 645 | Ga0466963_0084657 | 3300044694 | Bacteria | 2152 |
| 646 | Ga0466959_0305954 | 3300045049 | Bacteria | 1088 |
| 647 | Ga0466959_0322961 | 3300045049 | Bacteria | 1055 |
| 648 | Ga0451576_1161169 | 3300045051 | Unclassified | 807 |
| 649 | Ga0495617_128741 | 3300046452 | Unclassified | 813 |
| 650 | Ga0495592_0012029 | 3300046454 | Bacteria | 6559 |
| 651 | Ga0495592_0022220 | 3300046454 | Bacteria | 4825 |
| 652 | Ga0495592_0137094 | 3300046454 | Bacteria | 1706 |
| 653 | Ga0495592_0204865 | 3300046454 | Bacteria | 1329 |
| 654 | Ga0495603_0011832 | 3300046455 | Bacteria | 5280 |
| 655 | Ga0495603_0135806 | 3300046455 | Unclassified | 1431 |
| 656 | Ga0495629_0058047 | 3300046459 | Bacteria | 2705 |
| 657 | Ga0495629_0155402 | 3300046459 | Bacteria | 1589 |
| 658 | Ga0495629_0164864 | 3300046459 | Bacteria | 1539 |
| 659 | Ga0495638_0226854 | 3300046460 | Bacteria | 1041 |
| 660 | Ga0495641_0036496 | 3300046461 | Bacteria | 2309 |
| 661 | Ga0495651_0010613 | 3300046462 | Bacteria | 7086 |
| 662 | Ga0495651_0028420 | 3300046462 | Bacteria | 4358 |
| 663 | Ga0495651_0228233 | 3300046462 | Bacteria | 1284 |
| 664 | Ga0495651_0245222 | 3300046462 | Bacteria | 1226 |
| 665 | Ga0495653_0062913 | 3300046463 | Bacteria | 2802 |
| 666 | Ga0495653_0694436 | 3300046463 | Bacteria | 618 |
| 667 | Ga0495580_0011461 | 3300046472 | Bacteria | 6860 |
| 668 | Ga0495582_0016975 | 3300046473 | Bacteria | 3986 |
| 669 | Ga0495605_0075518 | 3300046474 | Bacteria | 1585 |
| 670 | Ga0495639_0012458 | 3300046475 | Bacteria | 3667 |
| 671 | Ga0495664_0015661 | 3300046477 | Bacteria | 4313 |
| 672 | Ga0495584_0010562 | 3300046491 | Bacteria | 4742 |
| 673 | Ga0495584_0316540 | 3300046491 | Unclassified | 792 |
| 674 | Ga0495584_0394950 | 3300046491 | Bacteria | 703 |
| 675 | Ga0495585_0007439 | 3300046492 | Bacteria | 6704 |
| 676 | Ga0495585_0124792 | 3300046492 | Bacteria | 1359 |
| 677 | Ga0495594_0116665 | 3300046499 | Bacteria | 1508 |
| 678 | Ga0495594_0241084 | 3300046499 | Bacteria | 1030 |
| 679 | Ga0495607_0012941 | 3300046501 | Bacteria | 5487 |
| 680 | Ga0495607_0124268 | 3300046501 | Bacteria | 1351 |
| 681 | Ga0495608_0020087 | 3300046511 | Bacteria | 4593 |
| 682 | Ga0495608_0035555 | 3300046511 | Bacteria | 3359 |
| 683 | Ga0495608_0050275 | 3300046511 | Bacteria | 2766 |
| 684 | Ga0495608_0523120 | 3300046511 | Unclassified | 717 |
| 685 | Ga0495616_0287700 | 3300046513 | Unclassified | 697 |
| 686 | Ga0495618_0066077 | 3300046514 | Bacteria | 2299 |
| 687 | Ga0495618_0307704 | 3300046514 | Unclassified | 983 |
| 688 | Ga0495628_0002929 | 3300046516 | Bacteria | 15303 |
| 689 | Ga0495628_0011523 | 3300046516 | Bacteria | 7475 |
| 690 | Ga0495630_0004487 | 3300046517 | Bacteria | 9784 |
| 691 | Ga0495631_0033974 | 3300046518 | Bacteria | 2288 |
| 692 | Ga0495637_0093757 | 3300046520 | Unclassified | 1181 |
| 693 | Ga0495644_0002214 | 3300046523 | Bacteria | 7782 |
| 694 | Ga0495644_0025698 | 3300046523 | Bacteria | 2235 |
| 695 | Ga0495666_0005918 | 3300046526 | Bacteria | 6162 |
| 696 | Ga0495666_0086892 | 3300046526 | Bacteria | 1477 |
| 697 | Ga0495652_0010152 | 3300046529 | Bacteria | 8537 |
| 698 | Ga0495652_0020838 | 3300046529 | Bacteria | 5825 |
| 699 | Ga0495665_0097155 | 3300046531 | Bacteria | 1546 |
| 700 | Ga0495640_0689052 | 3300046533 | Unclassified | 613 |
| 701 | Ga0495586_0075579 | 3300046535 | Bacteria | 1844 |
| 702 | Ga0495587_0022988 | 3300046536 | Bacteria | 3834 |
| 703 | Ga0495587_0026523 | 3300046536 | Bacteria | 3533 |
| 704 | Ga0495587_0100129 | 3300046536 | Bacteria | 1670 |
| 705 | Ga0495598_0010145 | 3300046537 | Bacteria | 2249 |
| 706 | Ga0495621_0122268 | 3300046539 | Bacteria | 1007 |
| 707 | Ga0495645_0000359 | 3300046543 | Bacteria | 31690 |
| 708 | Ga0495645_0116148 | 3300046543 | Bacteria | 1889 |
| 709 | Ga0495622_0164000 | 3300046557 | Unclassified | 1001 |
| 710 | Ga0495633_0009681 | 3300046558 | Bacteria | 5300 |
| 711 | Ga0495633_0027510 | 3300046558 | Bacteria | 2780 |
| 712 | Ga0495667_0015835 | 3300046559 | Bacteria | 5098 |
| 713 | Ga0495667_0025456 | 3300046559 | Bacteria | 3987 |
| 714 | Ga0495667_0045221 | 3300046559 | Bacteria | 2916 |
| 715 | Ga0495667_0289541 | 3300046559 | Bacteria | 1039 |
| 716 | Ga0495656_0001258 | 3300046615 | Bacteria | 8239 |
| 717 | Ga0495656_0126059 | 3300046615 | Bacteria | 1214 |
| 718 | Ga0495634_0061443 | 3300046642 | Bacteria | 2497 |
| 719 | Ga0495634_0215277 | 3300046642 | Bacteria | 1188 |
| 720 | Ga0495611_0005786 | 3300046648 | Bacteria | 5275 |
| 721 | Ga0495635_0009700 | 3300046663 | Bacteria | 6732 |
| 722 | Ga0495635_0018411 | 3300046663 | Bacteria | 4874 |
| 723 | Ga0495635_0052344 | 3300046663 | Bacteria | 2813 |
| 724 | Ga0495659_0009054 | 3300046664 | Bacteria | 3174 |
| 725 | Ga0495659_0012038 | 3300046664 | Bacteria | 2795 |
| 726 | Ga0495659_0023126 | 3300046664 | Bacteria | 2109 |
| 727 | Ga0495661_0048221 | 3300046665 | Bacteria | 2589 |
| 728 | Ga0495588_0003980 | 3300046674 | Bacteria | 6489 |
| 729 | Ga0495588_0025993 | 3300046674 | Bacteria | 2920 |
| 730 | Ga0495657_0012702 | 3300046675 | Bacteria | 6244 |
| 731 | Ga0495657_0090623 | 3300046675 | Bacteria | 1962 |
| 732 | Ga0495599_0004676 | 3300046678 | Bacteria | 8119 |
| 733 | Ga0495623_0034824 | 3300046679 | Bacteria | 3229 |
| 734 | Ga0495623_0074392 | 3300046679 | Bacteria | 2111 |
| 735 | Ga0495646_0008212 | 3300046680 | Bacteria | 6636 |
| 736 | Ga0495646_0357386 | 3300046680 | Bacteria | 764 |
| 737 | Ga0495647_0027087 | 3300046681 | Bacteria | 2104 |
| 738 | Ga0495647_0221236 | 3300046681 | Unclassified | 836 |
| 739 | Ga0495658_0037142 | 3300046683 | Bacteria | 2691 |
| 740 | Ga0495658_0105952 | 3300046683 | Bacteria | 1684 |
| 741 | Ga0495669_0231753 | 3300046684 | Unclassified | 886 |
| 742 | Ga0495613_0019139 | 3300046689 | Bacteria | 5103 |
| 743 | Ga0495613_0132268 | 3300046689 | Bacteria | 1786 |
| 744 | Ga0495613_0151706 | 3300046689 | Bacteria | 1652 |
| 745 | Ga0495624_0084584 | 3300046690 | Bacteria | 1960 |
| 746 | Ga0495624_0093357 | 3300046690 | Bacteria | 1855 |
| 747 | Ga0495624_0219007 | 3300046690 | Bacteria | 1154 |
| 748 | Ga0495670_0022571 | 3300046691 | Bacteria | 3108 |
| 749 | Ga0495670_0040967 | 3300046691 | Bacteria | 2310 |
| 750 | Ga0495600_0002996 | 3300046809 | Bacteria | 9863 |
| 751 | Ga0495600_0170206 | 3300046809 | Bacteria | 1406 |
| 752 | Ga0495660_0173662 | 3300046810 | Unclassified | 1048 |
| 753 | Ga0495581_0010023 | 3300047315 | Bacteria | 5480 |
| 754 | Ga0495581_0153505 | 3300047315 | Bacteria | 1345 |
| 755 | Ga0495604_0003521 | 3300047317 | Bacteria | 12475 |
| 756 | Ga0495604_0090669 | 3300047317 | Bacteria | 2269 |
| 757 | Ga0495604_0092089 | 3300047317 | Bacteria | 2246 |
| 758 | Ga0495674_0032385 | 3300047319 | Bacteria | 4741 |
| 759 | Ga0495674_0394326 | 3300047319 | Unclassified | 1118 |
| 760 | Ga0495674_0710247 | 3300047319 | Unclassified | 788 |
| 761 | Ga0495672_0228242 | 3300047320 | Unclassified | 915 |
| 762 | Ga0495676_0036868 | 3300047321 | Bacteria | 4077 |
| 763 | Ga0495676_0043929 | 3300047321 | Bacteria | 3652 |
| 764 | Ga0495676_0904047 | 3300047321 | Unclassified | 565 |
| 765 | Ga0495680_0045470 | 3300047322 | Bacteria | 3466 |
| 766 | Ga0495680_0048021 | 3300047322 | Bacteria | 3354 |
| 767 | Ga0495680_0143795 | 3300047322 | Bacteria | 1743 |
| 768 | Ga0495680_0258848 | 3300047322 | Bacteria | 1231 |
| 769 | Ga0495675_0006898 | 3300047444 | Bacteria | 6975 |
| 770 | Ga0495675_0028460 | 3300047444 | Bacteria | 3561 |
| 771 | Ga0495679_013725 | 3300047446 | Bacteria | 3027 |
| 772 | Ga0495684_0018065 | 3300047471 | Bacteria | 5434 |
| 773 | Ga0495684_0045027 | 3300047471 | Bacteria | 3377 |
| 774 | Ga0495593_0143845 | 3300047673 | Bacteria | 1207 |
| 775 | Ga0495593_0160860 | 3300047673 | Bacteria | 1133 |
| 776 | Ga0495602_0007055 | 3300048088 | Bacteria | 11792 |
| 777 | Ga0495602_0010621 | 3300048088 | Bacteria | 9553 |
| 778 | Ga0495602_0243592 | 3300048088 | Bacteria | 1344 |
| 779 | Ga0495614_0014879 | 3300048089 | Bacteria | 3399 |
| 780 | Ga0496100_0004113 | 3300048903 | Bacteria | 7669 |
| 781 | Ga0496100_0038624 | 3300048903 | Bacteria | 3026 |
| 782 | Ga0496100_0094102 | 3300048903 | Bacteria | 2051 |
| 783 | Ga0496100_0377599 | 3300048903 | Bacteria | 1076 |
| 784 | Ga0496100_0404384 | 3300048903 | Unclassified | 1040 |
| 785 | Ga0496100_0953005 | 3300048903 | Bacteria | 675 |
| 786 | Ga0496101_0003062 | 3300048904 | Bacteria | 10323 |
| 787 | Ga0496101_0012909 | 3300048904 | Bacteria | 5587 |
| 788 | Ga0496101_0193507 | 3300048904 | Bacteria | 1570 |
| 789 | Ga0496101_0268773 | 3300048904 | Bacteria | 1331 |
| 790 | Ga0496101_0844753 | 3300048904 | Bacteria | 721 |
| 791 | Ga0496101_0875641 | 3300048904 | Bacteria | 707 |
| 792 | Ga0496102_0027680 | 3300048905 | Bacteria | 5062 |
| 793 | Ga0496102_0066831 | 3300048905 | Bacteria | 3296 |
| 794 | Ga0496102_0081266 | 3300048905 | Bacteria | 2987 |
| 795 | Ga0496102_0184381 | 3300048905 | Bacteria | 1967 |
| 796 | Ga0496103_0013991 | 3300048906 | Bacteria | 4763 |
| 797 | Ga0496103_0056455 | 3300048906 | Bacteria | 2437 |
| 798 | Ga0496103_0070840 | 3300048906 | Bacteria | 2181 |
| 799 | Ga0496104_0000086 | 3300048907 | Bacteria | 89916 |
| 800 | Ga0496104_0005366 | 3300048907 | Bacteria | 11220 |
| 801 | Ga0496104_0005870 | 3300048907 | Bacteria | 10759 |
| 802 | Ga0496104_0038562 | 3300048907 | Bacteria | 4471 |
| 803 | Ga0496104_0040710 | 3300048907 | Bacteria | 4356 |
| 804 | Ga0496104_0066485 | 3300048907 | Bacteria | 3423 |
| 805 | Ga0496105_0000126 | 3300048908 | Bacteria | 51169 |
| 806 | Ga0496105_0010885 | 3300048908 | Bacteria | 7163 |
| 807 | Ga0496105_0015451 | 3300048908 | Bacteria | 6084 |
| 808 | Ga0496105_0025219 | 3300048908 | Bacteria | 4837 |
| 809 | Ga0496105_0070526 | 3300048908 | Bacteria | 2889 |
| 810 | Ga0496105_0115462 | 3300048908 | Bacteria | 2214 |
| 811 | Ga0496105_0431877 | 3300048908 | Unclassified | 1042 |
| 812 | Ga0496106_0011535 | 3300048909 | Bacteria | 6534 |
| 813 | Ga0496106_0049736 | 3300048909 | Bacteria | 3158 |
| 814 | Ga0496106_0123262 | 3300048909 | Bacteria | 2027 |
| 815 | Ga0496106_0228877 | 3300048909 | Bacteria | 1484 |
| 816 | Ga0496106_0921995 | 3300048909 | Unclassified | 689 |
| 817 | Ga0496107_0011217 | 3300048910 | Bacteria | 6237 |
| 818 | Ga0496107_0023524 | 3300048910 | Bacteria | 4356 |
| 819 | Ga0496107_0037172 | 3300048910 | Bacteria | 3493 |
| 820 | Ga0496107_0059189 | 3300048910 | Bacteria | 2772 |
| 821 | Ga0496107_0091939 | 3300048910 | Bacteria | 2218 |
| 822 | Ga0496107_0117453 | 3300048910 | Bacteria | 1958 |
| 823 | Ga0496107_0434428 | 3300048910 | Bacteria | 976 |
| 824 | Ga0496108_0002764 | 3300048911 | Bacteria | 14047 |
| 825 | Ga0496108_0003252 | 3300048911 | Bacteria | 13057 |
| 826 | Ga0496108_0004600 | 3300048911 | Bacteria | 11109 |
| 827 | Ga0496108_0008108 | 3300048911 | Bacteria | 8516 |
| 828 | Ga0496108_0318887 | 3300048911 | Bacteria | 1355 |
| 829 | Ga0496108_0624051 | 3300048911 | Unclassified | 938 |
| 830 | Ga0496108_0857157 | 3300048911 | Bacteria | 781 |
| 831 | Ga0496109_0000755 | 3300048912 | Bacteria | 26947 |
| 832 | Ga0496109_0003246 | 3300048912 | Bacteria | 13551 |
| 833 | Ga0496109_0018955 | 3300048912 | Bacteria | 6058 |
| 834 | Ga0496109_0117218 | 3300048912 | Bacteria | 2478 |
| 835 | Ga0496109_0268161 | 3300048912 | Bacteria | 1608 |
| 836 | Ga0496109_0343334 | 3300048912 | Bacteria | 1410 |
| 837 | Ga0496110_0023920 | 3300048913 | Bacteria | 5201 |
| 838 | Ga0496110_0067593 | 3300048913 | Bacteria | 3162 |
| 839 | Ga0496110_0074197 | 3300048913 | Bacteria | 3020 |
| 840 | Ga0496110_0097043 | 3300048913 | Bacteria | 2641 |
| 841 | Ga0496110_0112886 | 3300048913 | Bacteria | 2443 |
| 842 | Ga0496110_0294840 | 3300048913 | Bacteria | 1477 |
| 843 | Ga0496111_0007148 | 3300048914 | Bacteria | 7294 |
| 844 | Ga0496111_0018697 | 3300048914 | Bacteria | 4803 |
| 845 | Ga0496111_0033929 | 3300048914 | Bacteria | 3641 |
| 846 | Ga0496111_0283666 | 3300048914 | Bacteria | 1228 |
| 847 | Ga0496111_0423994 | 3300048914 | Bacteria | 983 |
| 848 | Ga0496111_0618913 | 3300048914 | Unclassified | 792 |
| 849 | Ga0496111_1120883 | 3300048914 | Unclassified | 560 |
| 850 | Ga0496112_0000689 | 3300048915 | Bacteria | 23554 |
| 851 | Ga0496112_0010308 | 3300048915 | Bacteria | 8475 |
| 852 | Ga0496112_0010565 | 3300048915 | Bacteria | 8384 |
| 853 | Ga0496112_0019853 | 3300048915 | Bacteria | 6358 |
| 854 | Ga0496112_0386632 | 3300048915 | Bacteria | 1340 |
| 855 | Ga0496113_0005397 | 3300048916 | Bacteria | 7966 |
| 856 | Ga0496113_0020536 | 3300048916 | Bacteria | 4645 |
| 857 | Ga0496113_0032325 | 3300048916 | Bacteria | 3803 |
| 858 | Ga0496113_0076416 | 3300048916 | Bacteria | 2558 |
| 859 | Ga0496113_0606868 | 3300048916 | Bacteria | 876 |
| 860 | Ga0496114_0054394 | 3300048917 | Bacteria | 3337 |
| 861 | Ga0496114_0479993 | 3300048917 | Bacteria | 1100 |
| 862 | Ga0496114_0593155 | 3300048917 | Bacteria | 977 |
| 863 | Ga0496114_0617693 | 3300048917 | Unclassified | 955 |
| 864 | Ga0496114_1008081 | 3300048917 | Unclassified | 716 |
| 865 | Ga0496115_0025986 | 3300048918 | Bacteria | 4565 |
| 866 | Ga0496115_0256334 | 3300048918 | Bacteria | 1439 |
| 867 | Ga0496115_0698577 | 3300048918 | Bacteria | 798 |
| 868 | Ga0501032_0058546 | 3300049569 | Bacteria | 2587 |
| 869 | Ga0501032_0316705 | 3300049569 | Bacteria | 1007 |
| 870 | Ga0501032_0549132 | 3300049569 | Bacteria | 737 |
| 871 | Ga0501033_0021420 | 3300049570 | Bacteria | 4877 |
| 872 | Ga0501034_0065274 | 3300049571 | Bacteria | 3652 |
| 873 | Ga0501034_0174750 | 3300049571 | Bacteria | 2114 |
| 874 | Ga0501034_0302965 | 3300049571 | Unclassified | 1534 |
| 875 | Ga0501036_0390737 | 3300049572 | Bacteria | 1161 |
| 876 | Ga0501037_0378029 | 3300049573 | Bacteria | 974 |
| 877 | Ga0501039_0133751 | 3300049575 | Bacteria | 1947 |
| 878 | Ga0501039_0274600 | 3300049575 | Bacteria | 1325 |
| 879 | Ga0501039_0324983 | 3300049575 | Bacteria | 1209 |
| 880 | Ga0501040_0139398 | 3300049576 | Bacteria | 1708 |
| 881 | Ga0501040_0192169 | 3300049576 | Bacteria | 1449 |
| 882 | Ga0501046_0359554 | 3300049580 | Bacteria | 1056 |
| 883 | Ga0501047_0054406 | 3300049581 | Bacteria | 3871 |
| 884 | Ga0501048_0670811 | 3300049582 | Bacteria | 744 |
| 885 | Ga0501048_0747835 | 3300049582 | Bacteria | 702 |
| 886 | Ga0501048_0865626 | 3300049582 | Bacteria | 650 |
| 887 | Ga0501067_0013821 | 3300049583 | Bacteria | 4471 |
| 888 | Ga0501068_0024447 | 3300049584 | Bacteria | 3548 |
| 889 | Ga0501069_0046952 | 3300049585 | Bacteria | 2396 |
| 890 | Ga0501069_0584373 | 3300049585 | Unclassified | 670 |
| 891 | Ga0501070_0036276 | 3300049586 | Bacteria | 4117 |
| 892 | Ga0501070_0046100 | 3300049586 | Bacteria | 3625 |
| 893 | Ga0501070_0071426 | 3300049586 | Bacteria | 2874 |
| 894 | Ga0501070_0896149 | 3300049586 | Bacteria | 692 |
| 895 | Ga0501071_0216148 | 3300049587 | Bacteria | 1442 |
| 896 | Ga0501071_0256851 | 3300049587 | Unclassified | 1319 |
| 897 | Ga0501071_0411620 | 3300049587 | Unclassified | 1033 |
| 898 | Ga0501071_1153313 | 3300049587 | Unclassified | 599 |
| 899 | Ga0501072_0043250 | 3300049588 | Bacteria | 3540 |
| 900 | Ga0501073_0028486 | 3300049589 | Bacteria | 3991 |
| 901 | Ga0501073_0108241 | 3300049589 | Bacteria | 1929 |
| 902 | Ga0501074_0043558 | 3300049590 | Bacteria | 3248 |
| 903 | Ga0501074_0494873 | 3300049590 | Bacteria | 866 |
| 904 | Ga0501075_0323424 | 3300049591 | Bacteria | 1175 |
| 905 | Ga0501075_0862386 | 3300049591 | Unclassified | 689 |
| 906 | Ga0501075_0904562 | 3300049591 | Bacteria | 671 |
| 907 | Ga0501076_0734915 | 3300049592 | Bacteria | 815 |
| 908 | Ga0501077_0056211 | 3300049593 | Bacteria | 2498 |
| 909 | Ga0501077_0068387 | 3300049593 | Bacteria | 2251 |
| 910 | Ga0501077_0108982 | 3300049593 | Bacteria | 1755 |
| 911 | Ga0501077_0487153 | 3300049593 | Unclassified | 790 |
| 912 | Ga0501077_1091473 | 3300049593 | Bacteria | 514 |
| 913 | Ga0501079_0439037 | 3300049741 | Bacteria | 1025 |
| 914 | Ga0501079_0832930 | 3300049741 | Unclassified | 726 |
| 915 | Ga0501080_0169119 | 3300049742 | Bacteria | 2016 |
| 916 | Ga0501080_0207613 | 3300049742 | Bacteria | 1796 |
| 917 | Ga0501080_0484077 | 3300049742 | Bacteria | 1107 |
| 918 | Ga0501080_0591509 | 3300049742 | Bacteria | 986 |
| 919 | Ga0501081_0118605 | 3300049743 | Bacteria | 1883 |
| 920 | Ga0501081_0775581 | 3300049743 | Bacteria | 721 |
| 921 | Ga0501083_0026749 | 3300049744 | Bacteria | 3986 |
| 922 | Ga0501083_0834301 | 3300049744 | Unclassified | 600 |
| 923 | Ga0501035_0002877 | 3300049822 | Bacteria | 16600 |
| 924 | Ga0501035_0563485 | 3300049822 | Bacteria | 932 |
| 925 | Ga0501035_0596948 | 3300049822 | Bacteria | 900 |
| 926 | Ga0501035_0728030 | 3300049822 | Bacteria | 798 |
| 927 | Ga0501044_0032820 | 3300049823 | Bacteria | 5458 |
| 928 | Ga0501044_0121786 | 3300049823 | Bacteria | 2609 |
| 929 | Ga0501044_0136669 | 3300049823 | Bacteria | 2442 |
| 930 | Ga0501044_0359705 | 3300049823 | Bacteria | 1374 |
| 931 | nmdc:mga0yw44_148821_c1 | 3300050492 | Bacteria | 1526 |
| 932 | nmdc:mga0yw44_21678_c1 | 3300050492 | Bacteria | 3589 |
| 933 | nmdc:mga07m45_119687_c1 | 3300050496 | Bacteria | 1520 |
| 934 | nmdc:mga07m45_329248_c1 | 3300050496 | Bacteria | 888 |
| 935 | nmdc:mga05p37_17300_c1 | 3300050507 | Bacteria | 8697 |
| 936 | nmdc:mga05p37_29857_c1 | 3300050507 | Bacteria | 6652 |
| 937 | nmdc:mga05p37_30554_c1 | 3300050507 | Bacteria | 6574 |
| 938 | nmdc:mga05p37_316503_c1 | 3300050507 | Bacteria | 1848 |
| 939 | nmdc:mga05p37_858261_c1 | 3300050507 | Bacteria | 985 |
| 940 | nmdc:mga05p37_91672_c1 | 3300050507 | Bacteria | 3745 |
| 941 | nmdc:mga09592_19325_c1 | 3300050508 | Bacteria | 5595 |
| 942 | nmdc:mga09592_579603_c1 | 3300050508 | Bacteria | 962 |
| 943 | nmdc:mga0qj67_16366_c1 | 3300050509 | Bacteria | 5623 |
| 944 | nmdc:mga0qj67_692511_c1 | 3300050509 | Bacteria | 811 |
| 945 | nmdc:mga06r32_13918_c1 | 3300050510 | Bacteria | 7299 |
| 946 | nmdc:mga06r32_184501_c1 | 3300050510 | Bacteria | 2073 |
| 947 | nmdc:mga06r32_194626_c1 | 3300050510 | Bacteria | 2015 |
| 948 | nmdc:mga06r32_624430_c1 | 3300050510 | Bacteria | 1047 |
| 949 | nmdc:mga08y16_11614_c1 | 3300050511 | Bacteria | 9252 |
| 950 | nmdc:mga08y16_1223706_c1 | 3300050511 | Unclassified | 721 |
| 951 | nmdc:mga08y16_127989_c1 | 3300050511 | Bacteria | 2642 |
| 952 | nmdc:mga08y16_182816_c1 | 3300050511 | Bacteria | 2176 |
| 953 | nmdc:mga08y16_389596_c1 | 3300050511 | Bacteria | 1427 |
| 954 | nmdc:mga08y16_46677_c1 | 3300050511 | Bacteria | 4535 |
| 955 | nmdc:mga08y16_62806_c1 | 3300050511 | Bacteria | 3879 |
| 956 | nmdc:mga0n895_201283_c1 | 3300050512 | Bacteria | 2022 |
| 957 | nmdc:mga0n895_2883_c1 | 3300050512 | Bacteria | 13647 |
| 958 | nmdc:mga0n895_322816_c1 | 3300050512 | Bacteria | 1565 |
| 959 | nmdc:mga0n895_482738_c1 | 3300050512 | Bacteria | 1250 |
| 960 | nmdc:mga0n895_57546_c1 | 3300050512 | Bacteria | 3832 |
| 961 | nmdc:mga0n895_618531_c1 | 3300050512 | Bacteria | 1084 |
| 962 | nmdc:mga0n895_733471_c1 | 3300050512 | Bacteria | 982 |
| 963 | nmdc:mga0rr50_209869_c1 | 3300050513 | Bacteria | 1604 |
| 964 | nmdc:mga0rr50_264782_c1 | 3300050513 | Bacteria | 1431 |
| 965 | nmdc:mga0rr50_354259_c1 | 3300050513 | Bacteria | 1235 |
| 966 | nmdc:mga0rr50_409141_c1 | 3300050513 | Unclassified | 1147 |
| 967 | nmdc:mga0rr50_43298_c1 | 3300050513 | Bacteria | 3293 |
| 968 | nmdc:mga08x19_234836_c1 | 3300050514 | Unclassified | 1263 |
| 969 | nmdc:mga08x19_441594_c1 | 3300050514 | Unclassified | 915 |
| 970 | nmdc:mga0a205_1021051_c1 | 3300050515 | Bacteria | 674 |
| 971 | nmdc:mga0a205_11980_c1 | 3300050515 | Bacteria | 8009 |
| 972 | nmdc:mga0a205_20190_c1 | 3300050515 | Bacteria | 6285 |
| 973 | nmdc:mga0a205_494565_c1 | 3300050515 | Bacteria | 671 |
| 974 | Ga0495601_0000137 | 3300053077 | Bacteria | 41334 |
| 975 | Ga0495601_0121075 | 3300053077 | Bacteria | 1699 |
| 976 | Ga0495601_0129966 | 3300053077 | Bacteria | 1640 |
| 977 | Ga0495612_0000679 | 3300053078 | Bacteria | 13704 |
| 978 | Ga0495612_0003588 | 3300053078 | Bacteria | 6429 |
| 979 | Ga0495612_0020227 | 3300053078 | Bacteria | 2668 |
| 980 | Ga0495612_0028364 | 3300053078 | Bacteria | 2254 |
| 981 | Ga0495655_0036334 | 3300053083 | Bacteria | 1231 |
| 982 | Ga0495595_0001976 | 3300053084 | Bacteria | 7966 |
| 983 | Ga0495595_0002770 | 3300053084 | Bacteria | 6885 |
| 984 | Ga0495595_0004744 | 3300053084 | Bacteria | 5469 |
| 985 | Ga0495595_0258522 | 3300053084 | Unclassified | 872 |
| 986 | Ga0495619_0002352 | 3300053085 | Bacteria | 12446 |
| 987 | Ga0495619_0006115 | 3300053085 | Bacteria | 7625 |
| 988 | Ga0495619_0006472 | 3300053085 | Bacteria | 7417 |
| 989 | Ga0500643_017451 | 3300053087 | Bacteria | 2403 |
| 990 | Ga0500644_0003222 | 3300053088 | Bacteria | 4040 |
| 991 | Ga0500651_0000773 | 3300053093 | Bacteria | 15642 |
| 992 | Ga0500566_0032448 | 3300053094 | Bacteria | 3046 |
| 993 | Ga0500641_0014625 | 3300053096 | Bacteria | 2899 |
| 994 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 995 | Ga0500595_005500 | 3300053119 | Bacteria | 5528 |
| 996 | Ga0500642_0280754 | 3300053130 | Bacteria | 757 |
| 997 | Ga0500652_017811 | 3300053131 | Bacteria | 2610 |
| 998 | Ga0500561_0182031 | 3300053137 | Bacteria | 662 |
| 999 | Ga0500573_0296753 | 3300053140 | Bacteria | 810 |
| 1000 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1001 | Ga0500645_000370 | 3300053730 | Bacteria | 31624 |
| 1002 | Ga0501084_0027155 | 3300054114 | Bacteria | 4784 |
| 1003 | Ga0501084_0070030 | 3300054114 | Bacteria | 2937 |
| 1004 | Ga0501084_0237111 | 3300054114 | Bacteria | 1540 |
| 1005 | Ga0501084_0603897 | 3300054114 | Bacteria | 927 |
| 1006 | Ga0501082_0314421 | 3300060353 | Bacteria | 1364 |
| 1007 | Ga0501082_0589657 | 3300060353 | Bacteria | 972 |
| 1008 | Ga0501082_0798286 | 3300060353 | Bacteria | 826 |
| 1009 | Ga0530510_0055065 | 3300061734 | Bacteria | 2874 |
| 1010 | Ga0530510_0072607 | 3300061734 | Bacteria | 2498 |
| 1011 | Ga0530510_0752532 | 3300061734 | Bacteria | 743 |
| 1012 | Ga0070714_100227100 | |||
| 1013 | 2214773003 | |||
| 1014 | ARcpr5oldR_c000063 | |||
| 1015 | ARSoilYngRDRAFT_c00158 | |||
| 1016 | ARcpr5yngRDRAFT_c000065 | |||
| 1017 | ARSoilOldRDRAFT_c000068 | |||
| 1018 | ARCol0oldRDRAFT_c02928 | |||
| 1019 | ARCol0yngRDRAFT_1000177 | |||
| 1020 | JGI24032J14994_101865 | |||
| 1021 | JGI24741J21665_1006926 | |||
| 1022 | JGI24752J21851_1008192 | |||
| 1023 | JGI24746J21847_1012275 | |||
| 1024 | JGI24739J22299_10023557 | |||
| 1025 | JGI24743J22301_10044263 | |||
| 1026 | JGI24750J21931_1001335 | |||
| 1027 | JGI24745J21846_1008340 | |||
| 1028 | JGI24738J21930_10008401 | |||
| 1029 | JGI24749J21850_1001566 | |||
| 1030 | JGI24744J21845_10024551 | |||
| 1031 | JGI24035J26624_1000242 | |||
| 1032 | JGI24033J26618_1009855 | |||
| 1033 | rootH2_10150727 | |||
| 1034 | JGI25405J52794_10080227 | |||
| 1035 | Ga0058861_11407041 | |||
| 1036 | Ga0065716_1002145 | |||
| 1037 | Ga0065704_10040669 | |||
| 1038 | Ga0065712_10008684 | |||
| 1039 | Ga0065712_10072748 | |||
| 1040 | Ga0065715_10539460 | |||
| 1041 | Ga0065707_10188752 | |||
| 1042 | Ga0070658_10052638 | |||
| 1043 | Ga0070676_10025727 | |||
| 1044 | Ga0070676_10120093 | |||
| 1045 | Ga0070683_100065036 | |||
| 1046 | Ga0070683_100120682 | |||
| 1047 | Ga0070683_100144139 | |||
| 1048 | Ga0070690_100005956 | |||
| 1049 | Ga0070690_100026003 | |||
| 1050 | Ga0070690_100027267 | |||
| 1051 | Ga0070690_100135954 | |||
| 1052 | Ga0070670_100351697 | |||
| 1053 | Ga0070670_101162845 | |||
| 1054 | Ga0070677_10001154 | |||
| 1055 | Ga0068869_100056191 | |||
| 1056 | Ga0068869_100733959 | |||
| 1057 | Ga0070666_10055647 | |||
| 1058 | Ga0070666_11172271 | |||
| 1059 | Ga0070680_100045501 | |||
| 1060 | Ga0070680_100068956 | |||
| 1061 | Ga0070680_100207057 | |||
| 1062 | Ga0070680_100440621 | |||
| 1063 | Ga0068868_100079304 | |||
| 1064 | Ga0068868_100091549 | |||
| 1065 | Ga0070660_100054597 | |||
| 1066 | Ga0070660_100067452 | |||
| 1067 | Ga0070660_100089589 | |||
| 1068 | Ga0070660_100090122 | |||
| 1069 | Ga0070660_100430079 | |||
| 1070 | Ga0070689_100029104 | |||
| 1071 | Ga0070689_100067424 | |||
| 1072 | Ga0070691_10013699 | |||
| 1073 | Ga0070691_10555226 | |||
| 1074 | Ga0070687_100000184 | |||
| 1075 | Ga0070687_100104368 | |||
| 1076 | Ga0070661_100033600 | |||
| 1077 | Ga0070661_100272644 | |||
| 1078 | Ga0070661_100454387 | |||
| 1079 | Ga0070692_10005813 | |||
| 1080 | Ga0070692_10108281 | |||
| 1081 | Ga0070692_10295085 | |||
| 1082 | Ga0070668_100085761 | |||
| 1083 | Ga0070668_100150854 | |||
| 1084 | Ga0070668_100424228 | |||
| 1085 | Ga0070668_100489906 | |||
| 1086 | Ga0070669_100029760 | |||
| 1087 | Ga0070669_100667695 | |||
| 1088 | Ga0070675_100032769 | |||
| 1089 | Ga0070675_100109180 | |||
| 1090 | Ga0070675_100317222 | |||
| 1091 | Ga0070675_101705011 | |||
| 1092 | Ga0070671_100000348 | |||
| 1093 | Ga0070671_100279666 | |||
| 1094 | Ga0070671_100718040 | |||
| 1095 | Ga0070674_100031708 | |||
| 1096 | Ga0070674_100037559 | |||
| 1097 | Ga0070673_100021426 | |||
| 1098 | Ga0070673_100204139 | |||
| 1099 | Ga0070673_100533368 | |||
| 1100 | Ga0070688_100027408 | |||
| 1101 | Ga0070688_100120349 | |||
| 1102 | Ga0070688_100144847 | |||
| 1103 | Ga0070688_100235709 | |||
| 1104 | Ga0070659_100011784 | |||
| 1105 | Ga0070659_100050448 | |||
| 1106 | Ga0070667_100163192 | |||
| 1107 | Ga0070667_100193949 | |||
| 1108 | Ga0070667_100445413 | |||
| 1109 | Ga0070709_10136123 | |||
| 1110 | Ga0070709_10674694 | |||
| 1111 | Ga0070709_11091676 | |||
| 1112 | Ga0070714_100126476 | |||
| 1113 | Ga0070713_100046433 | |||
| 1114 | Ga0070713_100546314 | |||
| 1115 | Ga0070710_10224431 | |||
| 1116 | Ga0070701_10011484 | |||
| 1117 | Ga0070705_100015256 | |||
| 1118 | Ga0070705_100086715 | |||
| 1119 | Ga0070705_100152486 | |||
| 1120 | Ga0070700_100019204 | |||
| 1121 | Ga0070700_100112893 | |||
| 1122 | Ga0070700_100226267 | |||
| 1123 | Ga0070694_100052473 | |||
| 1124 | Ga0070694_100963752 | |||
| 1125 | Ga0070708_100037273 | |||
| 1126 | Ga0070708_100145950 | |||
| 1127 | Ga0070663_100039185 | |||
| 1128 | Ga0070663_100210991 | |||
| 1129 | Ga0070663_100331053 | |||
| 1130 | Ga0070663_100499892 | |||
| 1131 | Ga0070678_100018719 | |||
| 1132 | Ga0070678_100067960 | |||
| 1133 | Ga0070678_100327215 | |||
| 1134 | Ga0070678_100481924 | |||
| 1135 | Ga0070662_100076990 | |||
| 1136 | Ga0070662_100506440 | |||
| 1137 | Ga0070662_101317916 | |||
| 1138 | Ga0070681_10088074 | |||
| 1139 | Ga0070681_10093013 | |||
| 1140 | Ga0068867_100062994 | |||
| 1141 | Ga0068867_100119169 | |||
| 1142 | Ga0068867_100656679 | |||
| 1143 | Ga0070685_10181102 | |||
| 1144 | Ga0070685_10541427 | |||
| 1145 | Ga0070698_101946166 | |||
| 1146 | Ga0074259_11362925 | |||
| 1147 | Ga0070699_100005897 | |||
| 1148 | Ga0070699_100194686 | |||
| 1149 | Ga0070679_100038088 | |||
| 1150 | Ga0070679_100061631 | |||
| 1151 | Ga0070679_100154158 | |||
| 1152 | Ga0070679_100233854 | |||
| 1153 | Ga0070679_100583448 | |||
| 1154 | Ga0070679_100690147 | |||
| 1155 | Ga0070679_100992027 | |||
| 1156 | Ga0070684_100012243 | |||
| 1157 | Ga0070684_100328229 | |||
| 1158 | Ga0070684_100523459 | |||
| 1159 | Ga0070697_100384820 | |||
| 1160 | Ga0068853_100164993 | |||
| 1161 | Ga0068853_100456273 | |||
| 1162 | Ga0070672_100054936 | |||
| 1163 | Ga0070686_100043359 | |||
| 1164 | Ga0070686_100095576 | |||
| 1165 | Ga0070686_100126201 | |||
| 1166 | Ga0070686_100174243 | |||
| 1167 | Ga0070686_100903650 | |||
| 1168 | Ga0070696_100043061 | |||
| 1169 | Ga0070696_100121552 | |||
| 1170 | Ga0070696_100270960 | |||
| 1171 | Ga0070696_100373695 | |||
| 1172 | Ga0070693_100017020 | |||
| 1173 | Ga0070693_100143428 | |||
| 1174 | Ga0070693_100249994 | |||
| 1175 | Ga0070693_101033196 | |||
| 1176 | Ga0070665_100113262 | |||
| 1177 | Ga0070665_100659912 | |||
| 1178 | Ga0070704_100066695 | |||
| 1179 | Ga0070704_100161732 | |||
| 1180 | Ga0068855_100037153 | |||
| 1181 | Ga0068855_100176114 | |||
| 1182 | Ga0068855_100235539 | |||
| 1183 | Ga0070664_100057358 | |||
| 1184 | Ga0070664_100085873 | |||
| 1185 | Ga0070664_100166446 | |||
| 1186 | Ga0070664_100292869 | |||
| 1187 | Ga0068857_100013840 | |||
| 1188 | Ga0068857_100126512 | |||
| 1189 | Ga0068857_101796424 | |||
| 1190 | Ga0068854_100087832 | |||
| 1191 | Ga0068854_100097564 | |||
| 1192 | Ga0068854_100158345 | |||
| 1193 | Ga0068854_100907716 | |||
| 1194 | Ga0068856_100088266 | |||
| 1195 | Ga0068856_100274858 | |||
| 1196 | Ga0068856_100363144 | |||
| 1197 | Ga0070702_100054242 | |||
| 1198 | Ga0070702_100596093 | |||
| 1199 | Ga0068852_100015188 | |||
| 1200 | Ga0068852_100349374 | |||
| 1201 | Ga0068852_100453742 | |||
| 1202 | Ga0068852_100646690 | |||
| 1203 | Ga0068859_100005469 | |||
| 1204 | Ga0068859_100113228 | |||
| 1205 | Ga0068859_100483555 | |||
| 1206 | Ga0068859_100553165 | |||
| 1207 | Ga0068864_100009632 | |||
| 1208 | Ga0068864_100045253 | |||
| 1209 | Ga0068864_100376630 | |||
| 1210 | Ga0068866_10051280 | |||
| 1211 | Ga0068861_100045116 | |||
| 1212 | Ga0068861_100457870 | |||
| 1213 | Ga0068851_11091743 | |||
| 1214 | Ga0068870_10001851 | |||
| 1215 | Ga0068870_10016871 | |||
| 1216 | Ga0068863_100013874 | |||
| 1217 | Ga0068858_100031941 | |||
| 1218 | Ga0068858_100141055 | |||
| 1219 | Ga0068858_100380510 | |||
| 1220 | Ga0068858_100937989 | |||
| 1221 | Ga0068860_100042871 | |||
| 1222 | Ga0068860_100130436 | |||
| 1223 | Ga0068860_100308868 | |||
| 1224 | Ga0068862_100027421 | |||
| 1225 | Ga0068862_100056632 | |||
| 1226 | Ga0068862_100871572 | |||
| 1227 | Ga0081455_10000404 | |||
| 1228 | Ga0081455_10018650 | |||
| 1229 | Ga0081455_10039290 | |||
| 1230 | Ga0081455_10107538 | |||
| 1231 | Ga0081455_10115838 | |||
| 1232 | Ga0081455_10128263 | |||
| 1233 | Ga0081538_10040213 | |||
| 1234 | Ga0081538_10102975 | |||
| 1235 | Ga0081540_1074288 | |||
| 1236 | Ga0081540_1088610 | |||
| 1237 | Ga0081540_1208341 | |||
| 1238 | Ga0081539_10031957 | |||
| 1239 | Ga0070717_10011726 | |||
| 1240 | Ga0070717_11046349 | |||
| 1241 | Ga0075365_10097082 | |||
| 1242 | Ga0075365_10161758 | |||
| 1243 | Ga0075365_10312417 | |||
| 1244 | Ga0075365_10383521 | |||
| 1245 | Ga0075432_10002316 | |||
| 1246 | Ga0075432_10125745 | |||
| 1247 | Ga0070715_10025105 | |||
| 1248 | Ga0070715_10039045 | |||
| 1249 | Ga0070716_100045408 | |||
| 1250 | Ga0070716_100736086 | |||
| 1251 | Ga0070712_100016939 | |||
| 1252 | Ga0070712_100063746 | |||
| 1253 | Ga0070712_100123074 | |||
| 1254 | Ga0075362_10291952 | |||
| 1255 | Ga0075362_10347715 | |||
| 1256 | Ga0075367_10278376 | |||
| 1257 | Ga0075367_10506592 | |||
| 1258 | Ga0075367_10636358 | |||
| 1259 | Ga0075369_10287970 | |||
| 1260 | Ga0097621_100107279 | |||
| 1261 | Ga0097621_100184118 | |||
| 1262 | Ga0075370_10023759 | |||
| 1263 | Ga0075428_100014827 | |||
| 1264 | Ga0075428_100124917 | |||
| 1265 | Ga0075428_100253736 | |||
| 1266 | Ga0075430_100013770 | |||
| 1267 | Ga0075430_100054076 | |||
| 1268 | Ga0075431_100008339 | |||
| 1269 | Ga0075431_100028947 | |||
| 1270 | Ga0075431_100084770 | |||
| 1271 | Ga0075431_100151984 | |||
| 1272 | Ga0075431_101144190 | |||
| 1273 | Ga0075431_101642466 | |||
| 1274 | Ga0075433_10006454 | |||
| 1275 | Ga0075433_10067581 | |||
| 1276 | Ga0075434_100006422 | |||
| 1277 | Ga0075434_100045654 | |||
| 1278 | Ga0075434_100087664 | |||
| 1279 | Ga0075434_100191392 | |||
| 1280 | Ga0075434_100237005 | |||
| 1281 | Ga0075434_100894648 | |||
| 1282 | Ga0075434_102025052 | |||
| 1283 | Ga0075429_100020613 | |||
| 1284 | Ga0075429_100140361 | |||
| 1285 | Ga0075429_100309528 | |||
| 1286 | Ga0075429_100335747 | |||
| 1287 | Ga0075429_100471954 | |||
| 1288 | Ga0068865_100038002 | |||
| 1289 | Ga0068865_100218954 | |||
| 1290 | Ga0068865_100455315 | |||
| 1291 | Ga0075436_100103436 | |||
| 1292 | Ga0075436_100224943 | |||
| 1293 | Ga0075436_100279100 | |||
| 1294 | Ga0097620_100005469 | |||
| 1295 | Ga0097620_100113222 | |||
| 1296 | Ga0097620_100483568 | |||
| 1297 | Ga0097620_100553163 | |||
| 1298 | Ga0075435_100005128 | |||
| 1299 | Ga0075435_100084633 | |||
| 1300 | Ga0075435_100120750 | |||
| 1301 | Ga0075435_100214658 | |||
| 1302 | Ga0075435_101133901 | |||
| 1303 | Ga0099794_10028981 | |||
| 1304 | Ga0105251_10051680 | |||
| 1305 | Ga0105251_10245641 | |||
| 1306 | Ga0105240_10151222 | |||
| 1307 | Ga0111539_10001349 | |||
| 1308 | Ga0111539_10018218 | |||
| 1309 | Ga0111539_10159265 | |||
| 1310 | Ga0111539_10255867 | |||
| 1311 | Ga0111539_10883233 | |||
| 1312 | Ga0111539_11877561 | |||
| 1313 | Ga0111539_12138184 | |||
| 1314 | Ga0105245_10036366 | |||
| 1315 | Ga0105245_10066484 | |||
| 1316 | Ga0105247_10011736 | |||
| 1317 | Ga0105247_10026758 | |||
| 1318 | Ga0114129_10023892 | |||
| 1319 | Ga0114129_10026898 | |||
| 1320 | Ga0114129_10156190 | |||
| 1321 | Ga0114129_10231119 | |||
| 1322 | Ga0114129_10785724 | |||
| 1323 | Ga0114129_11252749 | |||
| 1324 | Ga0105243_10076814 | |||
| 1325 | Ga0105243_10226906 | |||
| 1326 | Ga0105243_10318838 | |||
| 1327 | Ga0105241_10875270 | |||
| 1328 | Ga0105242_10049159 | |||
| 1329 | Ga0105248_10020176 | |||
| 1330 | Ga0105248_10026619 | |||
| 1331 | Ga0105248_10030985 | |||
| 1332 | Ga0105248_13042612 | |||
| 1333 | Ga0105237_10011839 | |||
| 1334 | Ga0105237_10601647 | |||
| 1335 | Ga0105238_10139710 | |||
| 1336 | Ga0105238_10702427 | |||
| 1337 | Ga0105249_10007332 | |||
| 1338 | Ga0105249_10186540 | |||
| 1339 | Ga0105249_10923002 | |||
| 1340 | Ga0105239_10035238 | |||
| 1341 | Ga0105239_10263644 | |||
| 1342 | Ga0105239_11401061 | |||
| 1343 | Ga0105246_10005348 | |||
| 1344 | Ga0105246_10127169 | |||
| 1345 | Ga0105246_10169954 | |||
| 1346 | Ga0105246_10912417 | |||
| 1347 | Ga0157320_1000205 | |||
| 1348 | Ga0157325_1001937 | |||
| 1349 | Ga0157339_1013360 | |||
| 1350 | Ga0157338_1001673 | |||
| 1351 | Ga0157371_10023549 | |||
| 1352 | Ga0157371_10066573 | |||
| 1353 | Ga0157371_10105040 | |||
| 1354 | Ga0157371_11469291 | |||
| 1355 | Ga0157370_10024394 | |||
| 1356 | Ga0157370_10783655 | |||
| 1357 | Ga0157369_10086450 | |||
| 1358 | Ga0157369_11468335 | |||
| 1359 | Ga0157374_10191223 | |||
| 1360 | Ga0157374_10999710 | |||
| 1361 | Ga0157378_10338162 | |||
| 1362 | Ga0163162_10945357 | |||
| 1363 | Ga0163162_11193537 | |||
| 1364 | Ga0157372_10344753 | |||
| 1365 | Ga0157372_12049658 | |||
| 1366 | Ga0157375_10052064 | |||
| 1367 | Ga0157375_10365309 | |||
| 1368 | Ga0163163_10000318 | |||
| 1369 | Ga0163163_10108737 | |||
| 1370 | Ga0163163_10111084 | |||
| 1371 | Ga0163163_10196161 | |||
| 1372 | Ga0163163_10585805 | |||
| 1373 | Ga0157380_10216890 | |||
| 1374 | Ga0157380_10395488 | |||
| 1375 | Ga0157380_10974207 | |||
| 1376 | Ga0157380_11771925 | |||
| 1377 | Ga0182008_10199091 | |||
| 1378 | Ga0157377_10078754 | |||
| 1379 | Ga0157377_10147848 | |||
| 1380 | Ga0157377_10588104 | |||
| 1381 | Ga0157379_10044911 | |||
| 1382 | Ga0157379_10297320 | |||
| 1383 | Ga0157379_10366131 | |||
| 1384 | Ga0157379_10823343 | |||
| 1385 | Ga0157379_10920823 | |||
| 1386 | Ga0157376_10113291 | |||
| 1387 | Ga0157376_10617936 | |||
| 1388 | Ga0157376_11650168 | |||
| 1389 | Ga0163161_10034359 | |||
| 1390 | Ga0163161_10192247 | |||
| 1391 | Ga0197907_10268439 | |||
| 1392 | Ga0206356_11092613 | |||
| 1393 | Ga0206353_10292301 | |||
| 1394 | Ga0206353_10486689 | |||
| 1395 | Ga0206353_11607177 | |||
| 1396 | Ga0213876_10036889 | |||
| 1397 | Ga0224712_10584784 | |||
| 1398 | Ga0207673_1000103 | |||
| 1399 | Ga0207697_10030709 | |||
| 1400 | Ga0207653_10004967 | |||
| 1401 | Ga0207653_10070795 | |||
| 1402 | Ga0207682_10054890 | |||
| 1403 | Ga0207692_10047479 | |||
| 1404 | Ga0207692_10183562 | |||
| 1405 | Ga0207642_10021833 | |||
| 1406 | Ga0207642_10805281 | |||
| 1407 | Ga0207710_10065426 | |||
| 1408 | Ga0207710_10164362 | |||
| 1409 | Ga0207688_10001502 | |||
| 1410 | Ga0207680_10226533 | |||
| 1411 | Ga0207680_10362134 | |||
| 1412 | Ga0207647_10002513 | |||
| 1413 | Ga0207647_10161487 | |||
| 1414 | Ga0207685_10405426 | |||
| 1415 | Ga0207643_10089901 | |||
| 1416 | Ga0207705_10031451 | |||
| 1417 | Ga0207705_10379119 | |||
| 1418 | Ga0207654_10015859 | |||
| 1419 | Ga0207707_10036443 | |||
| 1420 | Ga0207707_10049562 | |||
| 1421 | Ga0207707_10091347 | |||
| 1422 | Ga0207707_10204578 | |||
| 1423 | Ga0207707_10297255 | |||
| 1424 | Ga0207695_10116458 | |||
| 1425 | Ga0207671_10104015 | |||
| 1426 | Ga0207671_10350846 | |||
| 1427 | Ga0207693_10011489 | |||
| 1428 | Ga0207693_10036204 | |||
| 1429 | Ga0207693_10036211 | |||
| 1430 | Ga0207693_10120732 | |||
| 1431 | Ga0207660_10034851 | |||
| 1432 | Ga0207660_10053310 | |||
| 1433 | Ga0207660_10073540 | |||
| 1434 | Ga0207660_10145273 | |||
| 1435 | Ga0207660_10348405 | |||
| 1436 | Ga0207660_10424775 | |||
| 1437 | Ga0207662_10009038 | |||
| 1438 | Ga0207657_10006553 | |||
| 1439 | Ga0207657_10047597 | |||
| 1440 | Ga0207657_10057406 | |||
| 1441 | Ga0207657_10364350 | |||
| 1442 | Ga0207649_10001009 | |||
| 1443 | Ga0207652_10041370 | |||
| 1444 | Ga0207652_10190922 | |||
| 1445 | Ga0207652_10239087 | |||
| 1446 | Ga0207652_10278245 | |||
| 1447 | Ga0207652_10369717 | |||
| 1448 | Ga0207652_10601686 | |||
| 1449 | Ga0207646_10216621 | |||
| 1450 | Ga0207681_10018419 | |||
| 1451 | Ga0207681_10096010 | |||
| 1452 | Ga0207681_10503672 | |||
| 1453 | Ga0207681_10545815 | |||
| 1454 | Ga0207694_10083753 | |||
| 1455 | Ga0207694_10916501 | |||
| 1456 | Ga0207650_10036047 | |||
| 1457 | Ga0207650_10141495 | |||
| 1458 | Ga0207659_10115184 | |||
| 1459 | Ga0207659_10136727 | |||
| 1460 | Ga0207687_10006543 | |||
| 1461 | Ga0207700_10066229 | |||
| 1462 | Ga0207664_10076178 | |||
| 1463 | Ga0207664_10270524 | |||
| 1464 | Ga0207644_10434868 | |||
| 1465 | Ga0207644_11649637 | |||
| 1466 | Ga0207690_10015532 | |||
| 1467 | Ga0207690_10042069 | |||
| 1468 | Ga0207690_10874433 | |||
| 1469 | Ga0207709_10012890 | |||
| 1470 | Ga0207670_10005976 | |||
| 1471 | Ga0207670_10286623 | |||
| 1472 | Ga0207669_10013484 | |||
| 1473 | Ga0207669_10111644 | |||
| 1474 | Ga0207669_10265018 | |||
| 1475 | Ga0207704_10052785 | |||
| 1476 | Ga0207665_10045359 | |||
| 1477 | Ga0207665_10691971 | |||
| 1478 | Ga0207691_10126738 | |||
| 1479 | Ga0207711_10038522 | |||
| 1480 | Ga0207711_10049627 | |||
| 1481 | Ga0207661_10000500 | |||
| 1482 | Ga0207661_10038404 | |||
| 1483 | Ga0207679_10000073 | |||
| 1484 | Ga0207679_10121415 | |||
| 1485 | Ga0207679_10164034 | |||
| 1486 | Ga0207679_11255513 | |||
| 1487 | Ga0207667_10156921 | |||
| 1488 | Ga0207667_10293159 | |||
| 1489 | Ga0207651_10004037 | |||
| 1490 | Ga0207712_10099138 | |||
| 1491 | Ga0207712_10188502 | |||
| 1492 | Ga0207668_10051474 | |||
| 1493 | Ga0207668_10102250 | |||
| 1494 | Ga0207668_10224167 | |||
| 1495 | Ga0207668_10589823 | |||
| 1496 | Ga0207668_11706853 | |||
| 1497 | Ga0207640_10002641 | |||
| 1498 | Ga0207640_10034940 | |||
| 1499 | Ga0207658_10035001 | |||
| 1500 | Ga0207658_10312512 | |||
| 1501 | Ga0207677_10014893 | |||
| 1502 | Ga0207703_10013981 | |||
| 1503 | Ga0207703_10055498 | |||
| 1504 | Ga0207703_10734487 | |||
| 1505 | Ga0207639_10035494 | |||
| 1506 | Ga0207639_10909355 | |||
| 1507 | Ga0207678_10056143 | |||
| 1508 | Ga0207708_10266496 | |||
| 1509 | Ga0207702_10006076 | |||
| 1510 | Ga0207702_10183852 | |||
| 1511 | Ga0207702_10273031 | |||
| 1512 | Ga0207641_10184795 | |||
| 1513 | Ga0207641_10199366 | |||
| 1514 | Ga0207648_10173078 | |||
| 1515 | Ga0207676_10006437 | |||
| 1516 | Ga0207676_10241413 | |||
| 1517 | Ga0207674_10033677 | |||
| 1518 | Ga0207674_10134742 | |||
| 1519 | Ga0207675_100207746 | |||
| 1520 | Ga0207675_100436048 | |||
| 1521 | Ga0207683_10106902 | |||
| 1522 | Ga0207698_10055877 | |||
| 1523 | Ga0207698_10258164 | |||
| 1524 | Ga0207698_11642420 | |||
| 1525 | Ga0209996_1021857 | |||
| 1526 | Ga0209984_1052135 | |||
| 1527 | Ga0209970_1045951 | |||
| 1528 | Ga0210002_1004812 | |||
| 1529 | Ga0209971_1115263 | |||
| 1530 | Ga0209966_1001929 | |||
| 1531 | Ga0209998_10002879 | |||
| 1532 | Ga0209998_10006315 | |||
| 1533 | Ga0209974_10002818 | |||
| 1534 | Ga0207428_10001432 | |||
| 1535 | Ga0207428_10005007 | |||
| 1536 | Ga0207428_10034138 | |||
| 1537 | Ga0207428_10953096 | |||
| 1538 | Ga0268266_10444699 | |||
| 1539 | Ga0268265_10073775 | |||
| 1540 | Ga0268265_10357073 | |||
| 1541 | Ga0268264_10027537 | |||
| 1542 | Ga0265338_10051458 | |||
| 1543 | Ga0265332_10159996 | |||
| 1544 | Ga0265325_10000004 | |||
| 1545 | Ga0265339_10072487 | |||
| 1546 | Ga0265313_10093881 | |||
| 1547 | Ga0265313_10105339 | |||
| 1548 | Ga0265313_10136649 | |||
| 1549 | Ga0265313_10275746 | |||
| 1550 | Ga0316575_10037644 | |||
| 1551 | Ga0316575_10095740 | |||
| 1552 | Ga0316579_10065763 | |||
| 1553 | Ga0316583_10025555 | |||
| 1554 | Ga0373930_0003251 | |||
| 1555 | Ga0373948_0011244 | |||
| 1556 | Ga0373958_0001455 | |||
| 1557 | Ga0373959_0005113 | |||
| 1558 | Ga0373959_0036516 | |||
| 1559 | Ga0373938_0002185 | |||
| 1560 | Ga0373938_0007073 | |||
| 1561 | Ga0373926_0065812 | |||
| 1562 | Ga0373928_0007812 | |||
| 1563 | Ga0373929_0000248 | |||
| 1564 | Ga0373940_0000098 | |||
| 1565 | Ga0373940_0010425 | |||
| 1566 | Ga0373944_0002451 | |||
| 1567 | Ga0373944_0002775 | |||
| 1568 | Ga0373944_0028419 | |||
| 1569 | Ga0373949_0286354 | |||
| 1570 | Ga0373951_0004830 | |||
| 1571 | Ga0373923_0004618 | |||
| 1572 | Ga0373923_0194504 | |||
| 1573 | Ga0373932_0000586 | |||
| 1574 | Ga0373936_0032686 | |||
| 1575 | Ga0373939_0000650 | |||
| 1576 | Ga0373939_0013752 | |||
| 1577 | Ga0373941_0000197 | |||
| 1578 | Ga0373945_0001528 | |||
| 1579 | Ga0373945_0061049 | |||
| 1580 | Ga0373953_0222150 | |||
| 1581 | Ga0373954_0007450 | |||
| 1582 | Ga0373954_0034662 | |||
| 1583 | Ga0373954_0316513 | |||
| 1584 | Ga0373956_0008167 | |||
| 1585 | Ga0373956_0008980 | |||
| 1586 | Ga0373956_0119895 | |||
| 1587 | Ga0373957_0004466 | |||
| 1588 | Ga0373957_0014018 | |||
| 1589 | Ga0373960_0005113 | |||
| 1590 | Ga0373960_0024905 | |||
| 1591 | Ga0373943_0007905 | |||
| 1592 | Ga0373943_0026367 | |||
| 1593 | Ga0373946_0019720 | |||
| 1594 | Ga0373946_0044630 | |||
| 1595 | Ga0373946_0623215 | |||
| 1596 | Ga0373955_0004448 | |||
| 1597 | Ga0373955_0022485 | |||
| 1598 | Ga0373955_0026739 | |||
| 1599 | Ga0373942_0001180 | |||
| 1600 | Ga0373961_0012280 | |||
| 1601 | Ga0373961_0014929 | |||
| 1602 | Ga0373961_0144846 | |||
| 1603 | Ga0373962_0055096 | |||
| 1604 | Ga0373924_0054336 | |||
| 1605 | Ga0373924_0233936 | |||
| 1606 | Ga0373924_0358272 | |||
| 1607 | Ga0373931_0034901 | |||
| 1608 | Ga0373931_0443486 | |||
| 1609 | Ga0373935_0005520 | |||
| 1610 | Ga0373935_0010567 | |||
| 1611 | Ga0373935_0097129 | |||
| 1612 | Ga0373935_0221126 | |||
| 1613 | Ga0373935_0816457 | |||
| 1614 | Ga0373927_0013207 | |||
| 1615 | Ga0373927_0022447 | |||
| 1616 | Ga0373927_0069057 | |||
| 1617 | Ga0373933_0003227 | |||
| 1618 | Ga0373933_0036360 | |||
| 1619 | Ga0373933_0176811 | |||
| 1620 | Ga0373933_0263155 | |||
| 1621 | Ga0373947_0010385 | |||
| 1622 | Ga0373947_0085165 | |||
| 1623 | Ga0373947_0111766 | |||
| 1624 | Ga0373937_0005224 | |||
| 1625 | Ga0373937_0011749 | |||
| 1626 | Ga0373937_0029334 | |||
| 1627 | Ga0373937_0136429 | |||
| 1628 | Ga0373937_0591569 | |||
| 1629 | Ga0316582_0163815 | |||
| 1630 | Ga0373925_0026613 | |||
| 1631 | Ga0373925_0033142 | |||
| 1632 | Ga0373925_1466591 | |||
| 1633 | Ga0395899_0007490 | |||
| 1634 | Ga0395899_0174593 | |||
| 1635 | Ga0395899_0561818 | |||
| 1636 | Ga0395900_0005278 | |||
| 1637 | Ga0395900_0008706 | |||
| 1638 | Ga0395898_0061586 | |||
| 1639 | Ga0395898_0129749 | |||
| 1640 | Ga0395901_0065832 | |||
| 1641 | Ga0395901_0109688 | |||
| 1642 | Ga0395901_0190092 | |||
| 1643 | Ga0395901_0298607 | |||
| 1644 | Ga0242420_025770 | |||
| 1645 | Ga0436365_1542655 | |||
| 1646 | Ga0436365_1905880 | |||
| 1647 | Ga0436361_0854854 | |||
| 1648 | Ga0436363_1259660 | |||
| 1649 | Ga0436363_1294438 | |||
| 1650 | Ga0436362_1300628 | |||
| 1651 | Ga0439448_0033718 | |||
| 1652 | Ga0439444_0049838 | |||
| 1653 | Ga0439464_0036523 | |||
| 1654 | Ga0439460_0055594 | |||
| 1655 | Ga0466966_0388143 | |||
| 1656 | Ga0466963_0084657 | |||
| 1657 | Ga0466959_0305954 | |||
| 1658 | Ga0466959_0322961 | |||
| 1659 | Ga0451576_1161169 | |||
| 1660 | Ga0495617_128741 | |||
| 1661 | Ga0495592_0012029 | |||
| 1662 | Ga0495592_0022220 | |||
| 1663 | Ga0495592_0137094 | |||
| 1664 | Ga0495592_0204865 | |||
| 1665 | Ga0495603_0011832 | |||
| 1666 | Ga0495603_0135806 | |||
| 1667 | Ga0495629_0058047 | |||
| 1668 | Ga0495629_0155402 | |||
| 1669 | Ga0495629_0164864 | |||
| 1670 | Ga0495638_0226854 | |||
| 1671 | Ga0495641_0036496 | |||
| 1672 | Ga0495651_0010613 | |||
| 1673 | Ga0495651_0028420 | |||
| 1674 | Ga0495651_0228233 | |||
| 1675 | Ga0495651_0245222 | |||
| 1676 | Ga0495653_0062913 | |||
| 1677 | Ga0495653_0694436 | |||
| 1678 | Ga0495580_0011461 | |||
| 1679 | Ga0495582_0016975 | |||
| 1680 | Ga0495605_0075518 | |||
| 1681 | Ga0495639_0012458 | |||
| 1682 | Ga0495664_0015661 | |||
| 1683 | Ga0495584_0010562 | |||
| 1684 | Ga0495584_0316540 | |||
| 1685 | Ga0495584_0394950 | |||
| 1686 | Ga0495585_0007439 | |||
| 1687 | Ga0495585_0124792 | |||
| 1688 | Ga0495594_0116665 | |||
| 1689 | Ga0495594_0241084 | |||
| 1690 | Ga0495607_0012941 | |||
| 1691 | Ga0495607_0124268 | |||
| 1692 | Ga0495608_0020087 | |||
| 1693 | Ga0495608_0035555 | |||
| 1694 | Ga0495608_0050275 | |||
| 1695 | Ga0495608_0523120 | |||
| 1696 | Ga0495616_0287700 | |||
| 1697 | Ga0495618_0066077 | |||
| 1698 | Ga0495618_0307704 | |||
| 1699 | Ga0495628_0002929 | |||
| 1700 | Ga0495628_0011523 | |||
| 1701 | Ga0495630_0004487 | |||
| 1702 | Ga0495631_0033974 | |||
| 1703 | Ga0495637_0093757 | |||
| 1704 | Ga0495644_0002214 | |||
| 1705 | Ga0495644_0025698 | |||
| 1706 | Ga0495666_0005918 | |||
| 1707 | Ga0495666_0086892 | |||
| 1708 | Ga0495652_0010152 | |||
| 1709 | Ga0495652_0020838 | |||
| 1710 | Ga0495665_0097155 | |||
| 1711 | Ga0495640_0689052 | |||
| 1712 | Ga0495586_0075579 | |||
| 1713 | Ga0495587_0022988 | |||
| 1714 | Ga0495587_0026523 | |||
| 1715 | Ga0495587_0100129 | |||
| 1716 | Ga0495598_0010145 | |||
| 1717 | Ga0495621_0122268 | |||
| 1718 | Ga0495645_0000359 | |||
| 1719 | Ga0495645_0116148 | |||
| 1720 | Ga0495622_0164000 | |||
| 1721 | Ga0495633_0009681 | |||
| 1722 | Ga0495633_0027510 | |||
| 1723 | Ga0495667_0015835 | |||
| 1724 | Ga0495667_0025456 | |||
| 1725 | Ga0495667_0045221 | |||
| 1726 | Ga0495667_0289541 | |||
| 1727 | Ga0495656_0001258 | |||
| 1728 | Ga0495656_0126059 | |||
| 1729 | Ga0495634_0061443 | |||
| 1730 | Ga0495634_0215277 | |||
| 1731 | Ga0495611_0005786 | |||
| 1732 | Ga0495635_0009700 | |||
| 1733 | Ga0495635_0018411 | |||
| 1734 | Ga0495635_0052344 | |||
| 1735 | Ga0495659_0009054 | |||
| 1736 | Ga0495659_0012038 | |||
| 1737 | Ga0495659_0023126 | |||
| 1738 | Ga0495661_0048221 | |||
| 1739 | Ga0495588_0003980 | |||
| 1740 | Ga0495588_0025993 | |||
| 1741 | Ga0495657_0012702 | |||
| 1742 | Ga0495657_0090623 | |||
| 1743 | Ga0495599_0004676 | |||
| 1744 | Ga0495623_0034824 | |||
| 1745 | Ga0495623_0074392 | |||
| 1746 | Ga0495646_0008212 | |||
| 1747 | Ga0495646_0357386 | |||
| 1748 | Ga0495647_0027087 | |||
| 1749 | Ga0495647_0221236 | |||
| 1750 | Ga0495658_0037142 | |||
| 1751 | Ga0495658_0105952 | |||
| 1752 | Ga0495669_0231753 | |||
| 1753 | Ga0495613_0019139 | |||
| 1754 | Ga0495613_0132268 | |||
| 1755 | Ga0495613_0151706 | |||
| 1756 | Ga0495624_0084584 | |||
| 1757 | Ga0495624_0093357 | |||
| 1758 | Ga0495624_0219007 | |||
| 1759 | Ga0495670_0022571 | |||
| 1760 | Ga0495670_0040967 | |||
| 1761 | Ga0495600_0002996 | |||
| 1762 | Ga0495600_0170206 | |||
| 1763 | Ga0495660_0173662 | |||
| 1764 | Ga0495581_0010023 | |||
| 1765 | Ga0495581_0153505 | |||
| 1766 | Ga0495604_0003521 | |||
| 1767 | Ga0495604_0090669 | |||
| 1768 | Ga0495604_0092089 | |||
| 1769 | Ga0495674_0032385 | |||
| 1770 | Ga0495674_0394326 | |||
| 1771 | Ga0495674_0710247 | |||
| 1772 | Ga0495672_0228242 | |||
| 1773 | Ga0495676_0036868 | |||
| 1774 | Ga0495676_0043929 | |||
| 1775 | Ga0495676_0904047 | |||
| 1776 | Ga0495680_0045470 | |||
| 1777 | Ga0495680_0048021 | |||
| 1778 | Ga0495680_0143795 | |||
| 1779 | Ga0495680_0258848 | |||
| 1780 | Ga0495675_0006898 | |||
| 1781 | Ga0495675_0028460 | |||
| 1782 | Ga0495679_013725 | |||
| 1783 | Ga0495684_0018065 | |||
| 1784 | Ga0495684_0045027 | |||
| 1785 | Ga0495593_0143845 | |||
| 1786 | Ga0495593_0160860 | |||
| 1787 | Ga0495602_0007055 | |||
| 1788 | Ga0495602_0010621 | |||
| 1789 | Ga0495602_0243592 | |||
| 1790 | Ga0495614_0014879 | |||
| 1791 | Ga0496100_0004113 | |||
| 1792 | Ga0496100_0038624 | |||
| 1793 | Ga0496100_0094102 | |||
| 1794 | Ga0496100_0377599 | |||
| 1795 | Ga0496100_0404384 | |||
| 1796 | Ga0496100_0953005 | |||
| 1797 | Ga0496101_0003062 | |||
| 1798 | Ga0496101_0012909 | |||
| 1799 | Ga0496101_0193507 | |||
| 1800 | Ga0496101_0268773 | |||
| 1801 | Ga0496101_0844753 | |||
| 1802 | Ga0496101_0875641 | |||
| 1803 | Ga0496102_0027680 | |||
| 1804 | Ga0496102_0066831 | |||
| 1805 | Ga0496102_0081266 | |||
| 1806 | Ga0496102_0184381 | |||
| 1807 | Ga0496103_0013991 | |||
| 1808 | Ga0496103_0056455 | |||
| 1809 | Ga0496103_0070840 | |||
| 1810 | Ga0496104_0000086 | |||
| 1811 | Ga0496104_0005366 | |||
| 1812 | Ga0496104_0005870 | |||
| 1813 | Ga0496104_0038562 | |||
| 1814 | Ga0496104_0040710 | |||
| 1815 | Ga0496104_0066485 | |||
| 1816 | Ga0496105_0000126 | |||
| 1817 | Ga0496105_0010885 | |||
| 1818 | Ga0496105_0015451 | |||
| 1819 | Ga0496105_0025219 | |||
| 1820 | Ga0496105_0070526 | |||
| 1821 | Ga0496105_0115462 | |||
| 1822 | Ga0496105_0431877 | |||
| 1823 | Ga0496106_0011535 | |||
| 1824 | Ga0496106_0049736 | |||
| 1825 | Ga0496106_0123262 | |||
| 1826 | Ga0496106_0228877 | |||
| 1827 | Ga0496106_0921995 | |||
| 1828 | Ga0496107_0011217 | |||
| 1829 | Ga0496107_0023524 | |||
| 1830 | Ga0496107_0037172 | |||
| 1831 | Ga0496107_0059189 | |||
| 1832 | Ga0496107_0091939 | |||
| 1833 | Ga0496107_0117453 | |||
| 1834 | Ga0496107_0434428 | |||
| 1835 | Ga0496108_0002764 | |||
| 1836 | Ga0496108_0003252 | |||
| 1837 | Ga0496108_0004600 | |||
| 1838 | Ga0496108_0008108 | |||
| 1839 | Ga0496108_0318887 | |||
| 1840 | Ga0496108_0624051 | |||
| 1841 | Ga0496108_0857157 | |||
| 1842 | Ga0496109_0000755 | |||
| 1843 | Ga0496109_0003246 | |||
| 1844 | Ga0496109_0018955 | |||
| 1845 | Ga0496109_0117218 | |||
| 1846 | Ga0496109_0268161 | |||
| 1847 | Ga0496109_0343334 | |||
| 1848 | Ga0496110_0023920 | |||
| 1849 | Ga0496110_0067593 | |||
| 1850 | Ga0496110_0074197 | |||
| 1851 | Ga0496110_0097043 | |||
| 1852 | Ga0496110_0112886 | |||
| 1853 | Ga0496110_0294840 | |||
| 1854 | Ga0496111_0007148 | |||
| 1855 | Ga0496111_0018697 | |||
| 1856 | Ga0496111_0033929 | |||
| 1857 | Ga0496111_0283666 | |||
| 1858 | Ga0496111_0423994 | |||
| 1859 | Ga0496111_0618913 | |||
| 1860 | Ga0496111_1120883 | |||
| 1861 | Ga0496112_0000689 | |||
| 1862 | Ga0496112_0010308 | |||
| 1863 | Ga0496112_0010565 | |||
| 1864 | Ga0496112_0019853 | |||
| 1865 | Ga0496112_0386632 | |||
| 1866 | Ga0496113_0005397 | |||
| 1867 | Ga0496113_0020536 | |||
| 1868 | Ga0496113_0032325 | |||
| 1869 | Ga0496113_0076416 | |||
| 1870 | Ga0496113_0606868 | |||
| 1871 | Ga0496114_0054394 | |||
| 1872 | Ga0496114_0479993 | |||
| 1873 | Ga0496114_0593155 | |||
| 1874 | Ga0496114_0617693 | |||
| 1875 | Ga0496114_1008081 | |||
| 1876 | Ga0496115_0025986 | |||
| 1877 | Ga0496115_0256334 | |||
| 1878 | Ga0496115_0698577 | |||
| 1879 | Ga0501032_0058546 | |||
| 1880 | Ga0501032_0316705 | |||
| 1881 | Ga0501032_0549132 | |||
| 1882 | Ga0501033_0021420 | |||
| 1883 | Ga0501034_0065274 | |||
| 1884 | Ga0501034_0174750 | |||
| 1885 | Ga0501034_0302965 | |||
| 1886 | Ga0501036_0390737 | |||
| 1887 | Ga0501037_0378029 | |||
| 1888 | Ga0501039_0133751 | |||
| 1889 | Ga0501039_0274600 | |||
| 1890 | Ga0501039_0324983 | |||
| 1891 | Ga0501040_0139398 | |||
| 1892 | Ga0501040_0192169 | |||
| 1893 | Ga0501046_0359554 | |||
| 1894 | Ga0501047_0054406 | |||
| 1895 | Ga0501048_0670811 | |||
| 1896 | Ga0501048_0747835 | |||
| 1897 | Ga0501048_0865626 | |||
| 1898 | Ga0501067_0013821 | |||
| 1899 | Ga0501068_0024447 | |||
| 1900 | Ga0501069_0046952 | |||
| 1901 | Ga0501069_0584373 | |||
| 1902 | Ga0501070_0036276 | |||
| 1903 | Ga0501070_0046100 | |||
| 1904 | Ga0501070_0071426 | |||
| 1905 | Ga0501070_0896149 | |||
| 1906 | Ga0501071_0216148 | |||
| 1907 | Ga0501071_0256851 | |||
| 1908 | Ga0501071_0411620 | |||
| 1909 | Ga0501071_1153313 | |||
| 1910 | Ga0501072_0043250 | |||
| 1911 | Ga0501073_0028486 | |||
| 1912 | Ga0501073_0108241 | |||
| 1913 | Ga0501074_0043558 | |||
| 1914 | Ga0501074_0494873 | |||
| 1915 | Ga0501075_0323424 | |||
| 1916 | Ga0501075_0862386 | |||
| 1917 | Ga0501075_0904562 | |||
| 1918 | Ga0501076_0734915 | |||
| 1919 | Ga0501077_0056211 | |||
| 1920 | Ga0501077_0068387 | |||
| 1921 | Ga0501077_0108982 | |||
| 1922 | Ga0501077_0487153 | |||
| 1923 | Ga0501077_1091473 | |||
| 1924 | Ga0501079_0439037 | |||
| 1925 | Ga0501079_0832930 | |||
| 1926 | Ga0501080_0169119 | |||
| 1927 | Ga0501080_0207613 | |||
| 1928 | Ga0501080_0484077 | |||
| 1929 | Ga0501080_0591509 | |||
| 1930 | Ga0501081_0118605 | |||
| 1931 | Ga0501081_0775581 | |||
| 1932 | Ga0501083_0026749 | |||
| 1933 | Ga0501083_0834301 | |||
| 1934 | Ga0501035_0002877 | |||
| 1935 | Ga0501035_0563485 | |||
| 1936 | Ga0501035_0596948 | |||
| 1937 | Ga0501035_0728030 | |||
| 1938 | Ga0501044_0032820 | |||
| 1939 | Ga0501044_0121786 | |||
| 1940 | Ga0501044_0136669 | |||
| 1941 | Ga0501044_0359705 | |||
| 1942 | nmdc:mga0yw44_148821_c1 | |||
| 1943 | nmdc:mga0yw44_21678_c1 | |||
| 1944 | nmdc:mga07m45_119687_c1 | |||
| 1945 | nmdc:mga07m45_329248_c1 | |||
| 1946 | nmdc:mga05p37_17300_c1 | |||
| 1947 | nmdc:mga05p37_29857_c1 | |||
| 1948 | nmdc:mga05p37_30554_c1 | |||
| 1949 | nmdc:mga05p37_316503_c1 | |||
| 1950 | nmdc:mga05p37_858261_c1 | |||
| 1951 | nmdc:mga05p37_91672_c1 | |||
| 1952 | nmdc:mga09592_19325_c1 | |||
| 1953 | nmdc:mga09592_579603_c1 | |||
| 1954 | nmdc:mga0qj67_16366_c1 | |||
| 1955 | nmdc:mga0qj67_692511_c1 | |||
| 1956 | nmdc:mga06r32_13918_c1 | |||
| 1957 | nmdc:mga06r32_184501_c1 | |||
| 1958 | nmdc:mga06r32_194626_c1 | |||
| 1959 | nmdc:mga06r32_624430_c1 | |||
| 1960 | nmdc:mga08y16_11614_c1 | |||
| 1961 | nmdc:mga08y16_1223706_c1 | |||
| 1962 | nmdc:mga08y16_127989_c1 | |||
| 1963 | nmdc:mga08y16_182816_c1 | |||
| 1964 | nmdc:mga08y16_389596_c1 | |||
| 1965 | nmdc:mga08y16_46677_c1 | |||
| 1966 | nmdc:mga08y16_62806_c1 | |||
| 1967 | nmdc:mga0n895_201283_c1 | |||
| 1968 | nmdc:mga0n895_2883_c1 | |||
| 1969 | nmdc:mga0n895_322816_c1 | |||
| 1970 | nmdc:mga0n895_482738_c1 | |||
| 1971 | nmdc:mga0n895_57546_c1 | |||
| 1972 | nmdc:mga0n895_618531_c1 | |||
| 1973 | nmdc:mga0n895_733471_c1 | |||
| 1974 | nmdc:mga0rr50_209869_c1 | |||
| 1975 | nmdc:mga0rr50_264782_c1 | |||
| 1976 | nmdc:mga0rr50_354259_c1 | |||
| 1977 | nmdc:mga0rr50_409141_c1 | |||
| 1978 | nmdc:mga0rr50_43298_c1 | |||
| 1979 | nmdc:mga08x19_234836_c1 | |||
| 1980 | nmdc:mga08x19_441594_c1 | |||
| 1981 | nmdc:mga0a205_1021051_c1 | |||
| 1982 | nmdc:mga0a205_11980_c1 | |||
| 1983 | nmdc:mga0a205_20190_c1 | |||
| 1984 | nmdc:mga0a205_494565_c1 | |||
| 1985 | Ga0495601_0000137 | |||
| 1986 | Ga0495601_0121075 | |||
| 1987 | Ga0495601_0129966 | |||
| 1988 | Ga0495612_0000679 | |||
| 1989 | Ga0495612_0003588 | |||
| 1990 | Ga0495612_0020227 | |||
| 1991 | Ga0495612_0028364 | |||
| 1992 | Ga0495655_0036334 | |||
| 1993 | Ga0495595_0001976 | |||
| 1994 | Ga0495595_0002770 | |||
| 1995 | Ga0495595_0004744 | |||
| 1996 | Ga0495595_0258522 | |||
| 1997 | Ga0495619_0002352 | |||
| 1998 | Ga0495619_0006115 | |||
| 1999 | Ga0495619_0006472 | |||
| 2000 | Ga0500643_017451 | |||
| 2001 | Ga0500644_0003222 | |||
| 2002 | Ga0500651_0000773 | |||
| 2003 | Ga0500566_0032448 | |||
| 2004 | Ga0500641_0014625 | |||
| 2005 | Ga0500595_000001 | |||
| 2006 | Ga0500595_005500 | |||
| 2007 | Ga0500642_0280754 | |||
| 2008 | Ga0500652_017811 | |||
| 2009 | Ga0500561_0182031 | |||
| 2010 | Ga0500573_0296753 | |||
| 2011 | Ga0500616_0000001 | |||
| 2012 | Ga0500645_000370 | |||
| 2013 | Ga0501084_0027155 | |||
| 2014 | Ga0501084_0070030 | |||
| 2015 | Ga0501084_0237111 | |||
| 2016 | Ga0501084_0603897 | |||
| 2017 | Ga0501082_0314421 | |||
| 2018 | Ga0501082_0589657 | |||
| 2019 | Ga0501082_0798286 | |||
| 2020 | Ga0530510_0055065 | |||
| 2021 | Ga0530510_0072607 | |||
| 2022 | Ga0530510_0752532 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dx9-assembly3.cif.gz_E | icap1 in complex with integrin beta 1 cytoplasmic tail | 0.785 | 95 | 126 |
| 5cxo-assembly1.cif.gz_A | intriguing role of epoxide hydrolase/cyclase-like enzyme salbiii in pyran ring formation in polyether salinomycin | 0.6986 | 37 | 74 |
| 3r7w-assembly2.cif.gz_D | crystal structure of gtr1p-gtr2p complex | 0.6955 | 98 | 125 |
| 7b70-assembly1.cif.gz_C | trappcore plus c8 (355-596) and c11 (1-718) from minitrappiii | 0.6946 | 100 | 123 |
| 6sb2-assembly1.cif.gz_D | cryo-em structure of mtorc1 bound to active raga/c gtpases | 0.6882 | 97 | 124 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8I346_1_137_3.30.450.50 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain | 0.8277 | 97 | 124 | 3.30.450.50 |
| af_Q4DNI0_193_354_3.30.450.190 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase; | 0.8023 | 97 | 124 | 3.30.450.190 |
| af_Q4DDN8_1_121_3.30.450.50 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain | 0.7956 | 98 | 124 | 3.30.450.50 |
| af_C6S3C4_1_106_3.30.450.30 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic | 0.7831 | 98 | 126 | 3.30.450.30 |
| af_A0A1D8PSL3_1_125_3.30.450.50 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain | 0.7588 | 98 | 123 | 3.30.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A560LKN0-F1-model_v4 | DUF2948 family protein | 0.9794 | 7 | 135 |
|
| AF-A0A537QZ23-F1-model_v4 | DUF2948 family protein | 0.9734 | 10 | 115 |
|
| AF-A0A2N3EKH6-F1-model_v4 | DUF2948 domain-containing protein | 0.972 | 7 | 146 |
|
| AF-A0A2A4PC00-F1-model_v4 | DUF2948 family protein | 0.9719 | 7 | 146 |
|
| AF-A0A165VJ59-F1-model_v4 | DUF2948 domain-containing protein | 0.9713 | 6 | 150 |
|